3KJIA

Zn and adp bound state of cooc1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
total genus 90
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjiA00
2QL6A 4KLZA 221PA 1G17A 2BEJA 3T61A 3CF6R 5JRJA 1YQTA 4DUGD 3EZ2A 3U3KA 1DARA 4AKIA 4OK6A 1G4AE 3BFXA 2ZM5A 2N46A 4LYAA 3ZH9B 3VQTA 5DI3A 2GJ9A 1ZYUA 3K8YA 5EUMA 3A8TA 3AKEA 4B6FA 3SI7A 1KMQA 3F3YA 1BYUA 4LBYA 1EFTA 1MH1A 4KITB 1ZUNB 1XPOA 5KSOA 1U8AA 2GJKA 4Q7LA 5B2ZA 2J41A 1U0JA 2QAGC 1Q22A 2FPLA 4QBFA 3QI2A 1W48A 1GTVA 1W0JD 1Z0JA 2WSSD 1TMKA 2JJ1A 3C7KA 4JLAA 3ONWA 3Q72A 1UDXA 3IBYA 4OQLA 4QBIA 3SC3A 3UKDA 3ZIAD 3AVUA 3LX8A 3FFAA 4IOJA 1OV4A 4ACBA 2VP0A 1G9XA 1ONBA 1R0ZA 4GZMA 1DELA 1T91A 3SS8A 2IT1A 2OESA 2BMFA 1N6IA 2X2FA 2ZVQX 1UJ2A 3IBGA 4PHGA 2BM1A 4PO9A 2ZE6A 5G3YA 3PXGA 1WA5A 5KHOC 2ZVPX 1XEXB 3IUYA 4M4SA 4G1UC 4TLBA 1M7HA 3WNBA 1F6BA 3SU8A 121PA 3CNOA 1G6OA 2GVZC 1A7JA 2P6UA 3RS0A 4ERNA 1UBFA 2PJRA 4MGYR 3T15A 4RD6A 1J8MF 3PIRA 4MKGA 5FTMA 4BFUA 4HDQB 2W2XA 3QPVA 4RZUA 4BLOA 3NH9A 3FKSD 3H2YA 1T0JB 2H7VA 1F48A 2GKSA 3TNFA 4US1R 2YKGA 2P6RA 3QXSA 1CR0A 2OSBA 4CIDA 3LXXA 3CR8A 4XD7D 4OHXA 2NZ8A 4Q4LA 5LD2C 3PFIA 2BIFA 3PQCA 4B71A 3SQXA 2VA8A 2BVNA 2V9PA 3PUWA 3RSOA 2V8OA 4OYHA 5IT5A 3Q9LA 3LVQE 1W36C 1GRQA 1N0VC 3UWOA 3A4NA 2FEOA 4RKFA 1JXMA 4QG7A 4NU0A 4URWR 2GBLC 1WMSA 3T35A 3VR3A 1GDDA 3U7EB 4DEXA 4AKHA 3K0CA 1ESNA 4AURA 2JASA 3JVUA 5L3SB 2CHVA 1DAFA 1R5BA 3ADDA 4TQUS 4QHYA 5EXTA 5JI2E 2W6JA 2WPDD 4JYBA 3K70B 4ZIRA 1Z63A 2C95A 1KO7A 4MYHA 5J4KA 1AS3A 1W5SA 1FMLA 4C2TA 3EPHA 1MOZA 4W7SA 3U2QA 1CU1A 4PFSA 3LAWA 2B7CA 3IIMA 5DN6D 1S1MA 1G7TA 5FBLB 4MUAA 1Q21A 2KE5A 2GAOA 2D06A 3ZD7A 2ATVA 1T3SA 2XZOA 4DB2A 3B13B 2WBLC 2BCGY 4NCNA 3N5CA 1HUQA 1XNJA 5D3MA 1ZUHA 5EE5B 5JS7A 4BFYA 1OB5A 3LBIA 3O8BA 4DDUA 1F2TB 1TUEA 4BECA 2GCPA 3GD7A 3KJHA 3VU9B 1X3SA 2IYUA 2QTFA 4GOKA 3QEJA 4IOKA 4WA7A 4ARZA 5KUTA 3OEHD 1B23P 1SULA 3T5GA 1S2MA 2IUSA 3S1AA 1SXJD 1YHNA 4E03A 2C8VA 3W5JA 3OE7A 3WMGA 5E3HA 1D9XA 2ZRHA 3GLIB 4IDOA 2H16A 5CDFE 1KMHA 1M2OB 4OI1A 1U81A 4TL8A 1DO2A 1VCNA 4JKYA 4LPSA 3A6PC 2VIIA 3WNDA 1KK0A 2RGDA 3ZZTA 1R4AA 3F5FA 3FMIA 4M1TA 1S9HA 3AVQA 5E7MA 3L8YA 2NG1A 5SZJA 3J81k 4B3CA 1FPMA 3QG5A 4TYWA 1G7SA 2JLWA 2ORWA 4EFMA 1VG1A 2V6IA 2QY9A 1G64A 5L3SA 4ASUD 2XB4A 1KSHA 3D31A 2PEYA 5D3QA 2PEZA 2QRZA 3GJ3A 2IWRA 3W6NA 1KI7A 2J59A 3CWQA 1QHNA 2ATXA 5BWMA 1MRNA 2ZE7A 4RFVA 3MMPA 1YZUA 2BKUA 1XEWY 4ZI3A 2I3BA 4WBSA 3WHLA 2NO0A 4GL2A 1Z3IX 1FTNA 1IXSB 5L3QB 3HU1A 2DBYA 8OHMA 3EX7C 2WIBA 4ZCMA 4TTPA 3W90A 2ERYA 2QTHA 1KO8A 1EFRD 2AXNA 5E95A 5JEEA 1HH4A 4QOSA 3AVYA 1FMJA 1J70A 1LV7A 1KO5A 2J7KA 4M53A 4M1SA 2O0KA 2OHFA 4A2WA 3GCGA 3U5ZB 1Z28A 3LVRE 1XRJA 4DCVA 1HE8B 1NSTA 1RZ3A 2J3EA 2IXEA 3VHXA 2PCJA 4GMXA 4QJ5A 3GJ5A 3HDTA 1CLUA 3DZ8A 1LW7A 5FPTA 1FX0B 3RS3A 1P4SA 2AD5A 2J45A 3SJBA 1Z0KA 1JJ7A 1L8QA 4XTRA 3ZJYA 4B73A 5FOTA 1VYTA 2Q6TA 1G18A 2LCFA 4A36A 1M7GA 4BLSA 2MMGA 3NHBA 2OAP1 4PR0A 4Q00A 4A0GA 4HAYA 1XPUA 1E2FA 2HEIA 4G5RA 4HUQB 4QGGA 2X8AA 3IO5A 1AIPA 1HT1E 4B44A 5JBQA 2CL7X 2FSFA 1UDWA 1KZGB 4LI0A 2Z4RA 3JZAA 1SKYB 1CRPA 2B8WA 4A6XA 2ZRMA 1WXQA 2ZI5A 1SZPA 3CPJB 4PQFA 5LBIA 3B6EA 3NBZC 4NCHA 2V54A 1TPZA 2CL0X 2QE7A 4HZUB 1DTSA 3K53A 4HLUA 1WBBA 2ZU0C 3THXB 3C4JA 2IL1A 3G82C 3IEVA 3QQ5A 1Z2AA 2XOKA 1NI3A 2AL7A 4NYJQ 1KSFX 4YMSA 4B2PA 2JIZA 2J0UB 3GJ8A 5FR1A 4TZ0A 2WJHA 1A2KC 4L9SA 1R8QA 3CRW1 1H8HA 2F3TA 2ZS9A 4RD2A 1NMXA 2C9YA 3DHWC 4TWZA 1D2NA 5HCIA 1GM5A 3SR0A 3C5CA 1NN0A 4C0LA 4PO1A 1L2TA 3M0EA 3SHWA 1EFCA 3I5XA 3AKCA 3I3SR 5JWOA 1XXHB 4JT2A 2A5JA 2G6BA 3H0KA 3A58B 4DBLC 5CJ2A 4A0FA 2J5XA 3RS2A 2OE2A 1UEIA 5CIWA 1VDZA 3R9XA 5LD2B 3MWJA 1MO5A 1P9NA 2GNOA 2YYZA 2GCOA 4BZQA 4FWTA 3KL4A 3CR7A 3QKUA 4KV9A 3K9NA 1TL7C 3AVPA 1AS0A 4MKFA 4GNKA 4HYYA 1BO6A 3ASZA 3C16C 4E22A 4A15A 3K70D 4X8LA 4BWYA 4B43A 3QPWA 3PEUA 4AYXA 5EP3A 1FTSA 3MD0A 1E4VA 3WMFA 3ICQB 4P31A 1GNRA 3TJZA 3X1DA 2ZI6A 1ODFA 4FXPA 2JLVA 1JR6A 3A4MA 1EFRA 4AK9A 3CRRA 1RPZA 2G3YA 2NPIA 3AUYA 1CS4C 4FMCF 1D2EA 4TYQA 2VQSA 4D6PA 4B74A 3QUSA 4EDHA 4ZKEA 1E9DA 2DCUA 1RYHA 5E4FA 2ZRBA 4IOMA 3I1FA 4Q03A 4F93B 3KQLA 1E1QD 2F43A 3OFND 3K0AB 3NTUA 3Q5EA 5DYGA 5KNDA 2GF9A 4K8OA 3KQNA 1QF9A 4M0LA 4F92B 4EPTA 2QSZA 5KDDA 4PHHA 2J0SA 3X1WA 1G3QA 4AIIA 4E07A 1EWRA 2OAQ1 3O8DA 4C4PA 2FG5A 1Q0UA 5BQ5A 4URZR 3B1ZA 3SFZA 3T1VA 3SE0A 3VR5A 1KYIA 2QMEA 3DOEA 1TEXA 2DWPA 4TTRA 3BGWA 1XXHA 1RKBA 4IHQA 1DAGA 1E0JA 1AK2A 4PPGA 1YR6A 1YZLA 3MJHA 1FQJA 3IIKA 4Q01A 2R8RA 1Z22A 1K6MA 3V4RA 2E1RA 3GLIA 4C0SA 2GESA 2XSZA 5CM9C 2XGJA 1E2EA 5FPHA 4JVMA 1E9AA 3Q7PA 2A5DA 1C9KA 1JQJC 4PHFA 1E2DA 5J5CA 2WWXA 3GLHB 1IY2A 3RS4A 1G8YA 1EGAA 1OE0A 5BW8A 5JJIA 4M8NE 1R5NA 3Q3JB 1G7RA 4LPKA 3W3ZB 4LRWA 4QBHA 2IYVA 3X1YA 1NN5A 1IN8A 3LV8A 1ZNWA 1G5RA 3U61B 2OILA 2XJ9A 3C8UA 4KHZA 3HU3A 1N6NA 1ESMA 2QM7A 4Q4JA 2XTMA 2EWWA 1GRNA 2VP4A 4ZO4A 3CUEF 1E9RA 5KNBA 3VU9A 2FSGA 3EASA 2EU8A 4KAXA 3GLFA 1K8RA 1HQYE 2E87A 2QGZA 2JDIA 1COWA 1M1YE 1J8YF 4B47A 4ZDJA 4KSBA 3RWOA 2PT5A 2Q3MA 2OXRA 4NYIR 4DWJA 2PL3A 2NPFA 1AS2A 3ZQ6A 1NMZA 4BQSA 1VYUA 3KUCA 1TX4B 4NH0A 4ZDKA 4BLRA 1RRPA 3QPUA 1ETUA 4P4SA 3SJZA 4LHVA 4GDFA 2HCBA 4U02A 2I1QA 2GZAA 2O8BA 1OFTA 1OFHA 2MSDB 2R6FA 2XSZD 2Y8EA 3GJ7A 3QKSA 5HKKD 1VTKA 1JQLB 4NCKA 4H9GA 3CIOA 5C4MA 5JLJA 4JBYA 2Z83A 3NKVA 4BFSA 4XWOA 2YOGA 3FMFA 1NN1A 4LZZA 2TMKA 3MGCA 3I8SA 4BEBA 1QHHA 2QAJA 3BWDD 1JBKA 4M9QA 1Z0IA 4M21A 4OK3A 4UNNA 2WJVA 2GK6A 3TSOA 4XVUA 1S1CA 3GFPA 5H70A 3PUZA 1N6KA 4DT1A 5FL3A 2DWOA 4IVQA 1Z07A 1PLKA 1Z8FA 3MSXA 4E5UA 1TEVA 2RGCA 3IQWA 3AVXA 5DE3A 1W4BA 1FL9A 1UBCA 2PBRA 3KJIA 4A0HA 4LGMA 4NONA 4CEIB 2DR3A 3K1JA 2VP5A 3U3RA 1CR4A 1IJFA 1Z6TA 4M2LA 2PCLA 4MGIR 3EPLA 1JR3E 2G83A 2CE2X 4XSHA 4DIEA 1ZIPA 4LYJA 1T8UA 3EPKA 2O8FB 1OH6A 1U0LA 1T6NA 4FCVA 1UBEA 3T1QA 1VPLA 2EFGA 3P1JA 1UFQA 5LB2A 4TYYA 1EX7A 1P62B 1KK1A 1LF0A 3BORA 4MRSA 4JLPA 1JNYA 1NF3A 3LDAA 1Z6XA 3TVDA 4AY2A 1KTVA 3VNVA 1OFUX 1X6VA 3FMOB 4DIDA 1N2CE 1NRJB 1MR3F 1OHHA 2FWRA 5IK2A 1R10A 3GLGB 2GXAA 3KQKA 4P4UA 5G53C 1HEIA 5DHAA 4IXMA 2IYLD 5JZVA 3EXAA 2OLKA 3BS4A 4BASA 3KQHA 2VBCA 2OO7A 2QBYB 1E9CA 1E9FA 4JYCA 4M1KA 2VP6A 3SBDA 5FOSA 1IY1A 2QN6A 2QROA 4ACAA 2ZJ5A 1SXJA 4QRHA 4HAXA 2ZI7A 2AHOA 2ZEJA 3EARA 1UKVY 3NBFA 4HB4A 3KQUA 1KAOA 1R0WA 2PT7A 4PC3A 2O8CB 1O87A 2C78A 2QPOA 1Z0AA 2MMCA 4OI4A 2UVQA 1KKMA 4A2PA 3Q7QA 2ORIA 1NG9A 5LB4A 2BBOA 5CDFA 3GPLA 4OQXA 3CW2A 1GAJA 1HYQA 4JVLA 521PA 1HQCA 5FOXA 2O8DA 2W0MA 3CZPA 3DKVA 3UANA 2AFIE 2HCJB 3CF0A 4WAUA 1SVLA 4R9UC 4DDWA 3LA6A 3BE4A 3K9LA 4KBFA 3TKLA 2JJ2A 1P72A 1LTQA 2IA5A 4H1VA 1KY2A 2IHYA 4IVPA 2ZJZA 1GG2A 1CP2A 3AGPA 1T4GA 3WHKA 3PUYA 4R2IA 1IXRC 1YZKA 2BWJA 3Q85A 3KKNA 4HAVA 4F7WA 3TUZC 1GUAA 3RWMB 2MSEB 2QQ0A 1U8YA 1E98A 2JIZD 2WJYA 3DDCA 2ZJ2A 2QI9C 3SJAA 4ZKDA 3SOPA 3FOZA 2HT6A 1IY0A 4XOIA 2YHSA 2QORA 2Q9BA 4HEJA 2REBA 1XTRA 4WZBE 5HE8A 1KSJA 3PV0A 4PC2A 4XVQA 2ZRFA 1CBUA 1G8PA 2HLDD 2B6HA 4PHTA 4A4DA 3BB1A 5FH9A 4KO8A 2C96A 3ZYCA 3KB2A 3GFOA 3IHWA 4LHYA 4P3YA 5AJZA 4C9BA 3ADKA 4YDSA 2ERXA 3KXKA 3IPYA 3I62A 1HA3A 1XD2B 3WYGA 3NDBB 4UQOA 2BMEA 1R5OA 3DKPA 2BJWA 2VF8A 2LKCA 2WWHA 1T5IA 3NEJA 3OIYA 1FFHA 2CHGA 3EWAA 4RZXA 1SVIA 2ODNA 1GVNB 3TR5A 4IKEA 5KTYA 4Q1BA 3BAFA 2V6JA 4DHEA 1VCIA 1YR7A 2VYFA 1OXUA 1W2HA 2WJJA 1NVWQ 2WM9B 3B85A 3NEYA 4LJ6A 4LYFA 4QHTA 2PLRA 2N1BA 4GOJA 1US8A 2BM0A 3OIWA 5FPKA 2CCJA 3E2IA 4BLTA 1G7CA 1LS1A 1PZNA 2G1JA 3ADCA 3THYB 3I61A 1Z08A 1Q20A 2W6ID 1A2BA 4Q02A 5HZHA 4BEJA 3QKRB 4JLDA 4CEJA 1OH7A 4Q4JB 4B3BA 2A9KA 4M22A 1ZCBA 4E09A 5CYPA 2WTUA 1NBME 3AH8A 4GP6A 4BFVA 1B0UA 1IOZA 3B9QA 1VIYA 2WHXA 1G19A 3IKJA 1E2GA 3SQWA 2EWVA 4Z54A 2G0NA 3PCRB 3UMSA 3V4FA 1ZIOA 5P21A 4OL0A 4LBZA 2CBZA 4JLMA 4O2LA 1I4TD 1GP2A 4TLAA 5EZ6B 3CH5A 4Q7KA 2BEKA 5EQTA 1AQUA 1YZGA 4AYTA 1TTTA 1OLOA 4A6PA 5SZIA 3QXHA 3CRVA 1KGDA 1N25A 1G3UA 1U99A 3FE2A 4FCTA 4LBVA 4CEHA 1GKIA 4DDTA 1W44A 1BIFA 2ZUBA 5IF9A 2RB4A 1UADA 1RYFA 4B34A 3U4QA 3AF4A 3CB4A 3ZZ0A 4HDCA 4DLWA 1TQ4A 4C0JA 3RSLA 1RW4A 4WZ6A 3U7GA 1G5PA 1QHXA 4ZDWA 5HZKA 4ILEA 1Q3TA 3EZ6A 2X77A 4KU4A 2QUZA 3R8FA 1XJCA 1GL7A 1XMVA 3VX4A 4PX9A 2GHIA 4HATA 2J0UA 5J4LA 5KDOA 1HY3A 1K5DA 1ZM3A 3OEEA 2G0TA 3TQCA 2WKPA 2ZR7A 3FKSA 4EJSC 2DY1A 1AA9A 4OHZA 4GPTA 1W5TA 4IW3B 4NKRA 3RANA 1XCPA 2FJUA 2HUPA 2FOLA 2WIAA 4KVAA 4TL9A 2BBWA 1NBMA 1OJLA 1II9A 1N5IA 4B75A 4TMVA 4NYIQ 1M34E 1S4QA 2ZROA 3B2EA 2O8FA 3CRQA 3D8BA 4G01B 1DAIA 3CRMA 2QRNA 1U2RA 1X1SA 1IM2A 3RC3A 4G5GA 3P20A 4US0R 1Z6GA 4B76A 3ZDQA 4DT1B 1BH2A 2AK3A 1GWNA 2J7PA 3L0SA 4NBSA 4CT4B 5JRZA 2WICA 1JAHA 1E2MA 5HPYB 4OKSA 1ZM4A 3RNLA 5C46F 2YV5A 2V1UA 3BOSA 1FP7A 2W2VA 1OSNA 2JJ1D 3K0FA 4IXNA 2IYZA 2NO7A 2WPDA 3BB4A 1XD9A 2DB3A 1VIAA 1GKUB 2FFBA 4X8OA 2RGEA 1LFDB 1M8PA 1E96A 2P67A 3FTQA 4TMXA 1RIFA 4JJZA 2H8KA 2OT3B 2CL6X 2G88A 1S0UA 4DLTA 4TYNA 5H8WA 3BBPA 4JVNA 4M9XA 1NY6A 4I1OA 4A8JC 1KDTA 2FV8A 2V7QD 2FPKA 2ZTSA 3BXZA 2Z6VA 2ZRDA 3K09C 2ZITA 2CNWA 2EFHB 3L0PA 5C4GB 4L9WA 1E79A 1X86B 3NC1C 1N3BA 4ITRC 3T06B 4BZXA 1IONA 5KPJA 2VO1A 2CVFA 1RJ9B 3OEHA 3RRZA 3A36A 4CZ2A 4YMVA 1DAHA 1ZMXA 2CLCX 4XH9B 3RS5A 1KK3A 4K81B 2ZQ5A 4PXAA 4MKHA 3DVLA 1H65A 2I1VB 3QEOA 2WJGA 1OT3A 5IDVA 4XIGS 3U3JA 5SZHB 2JJ8A 5GJBA 4MKIA 1X8KA 4L8GA 2NMVA 4A0RA 1F3OA 3K70C 3PITA 4LCBA 5KSZA 4NMMA 2YNMA 1Q1ZA 4MYCA 4ON9A 2FFHA 1D5CA 1XZPA 1EWQA 5FUVA 1XXHE 4BRUA 4A92A 3FYHA 2QPAA 4O0MA 5AJXA 3OIVA 1YR8A 2IS1A 4L16A 2B8TA 4QBGB 2HYIC 5EJEA 3KFXA 2O8DB 2ZAMA 4TMWA 2QE7D 3DM5A 1II8A 3VR4A 5F3WB 4IFEA 1M74A 4DZZA 1TU4A 4G3XA 4Q21A 4ZV4A 4MDEA 2F55A 1V5WA 4JLNA 1H8ED 3KX2A 4KYIB 3BD9A 1P2SA 2YWGA 2HDNB 1VHLA 4JSTA 1P60A 2NO1A 3FDIA 1OF1A 1A82A 5CB8A 2FDCA 3I4LA 2YINC 2F7SA 2JLQA 1XMJA 5CYOA 3W6PA 2HXSA 1SVWA 3HJNA 2GVDC 3THXA 4NP6A 3TR0A 1DEKA 1IN4A 1FQKA 2QP4A 5C2JB 2ZANA 5JWRA 4P4SB 1D8TA 2UKDA 4URVR 1KNQA 1XTQA 2PX3A 4HZIA 4LX0A 2ONKA 4ABYA 2QZ4A 3FMPB 3VHLB 5CLQA 3QBTA 2W58A 4DVGA 4MGZR 3B1XA 2MSCB 4FW9A 2J0VA 1YRAA 3U44A 2RGNA 1KOFA 4HI0E 1S3GA 4HLUC 4X8HA 4LV6A 1NIPA 1Z6AA 2V3CC 1P2UA 1W1WA 2EFEB 1UEJA 4I1UA 3EC2A 4PAQA 5FTLA 1PUJA 3AKYA 2XXAA 4B35A 1P75A 1W4CA 2FFQA 2GZDA 1NVVQ 3JZMA 3LW8A 2P5TB 4RCYA 1MO4A 2JA1A 5KPDA 1TNDA 4QGHA 5AUQA 3LBHA 1RFLA 4B3DA 2WKQA 4PTLA 5FBRB 3PVSA 1KMHB 2OFWA 1PUIA 2VF7A 5CK5A 2XJ4A 3T5DA 3ZVLA 3ZGXA 4DJTA 4G5SA 3TMKA 1EXMA 4CEIA 3PG5A 2XNDD 4LJ4A 4BZPA 1E0KA 1NG1A 1YZTA 3THYA 2AR7A 3QY0A 2WSSA 5JCZA 1M7BA 2JLUA 3VKHA 1SXJE 2OZEA 2RGAA 3EA5A 3GEIA 6Q21A 4JJKA 1KAGA 4OI0A 5FL7D 3A1UA 4RD4A 3EIEA 4A1FA 2FGJA 1PVOA 4WIAA 3CX7A 5BN5A 1IXZA 1XPRA 2FF7A 1NKTA 1RE0A 2IBMA 3T12A 3IIJA 2OUKA 2XNSA 3PUXA 4QM7A 4C3ZA 3K9GA 5AR1A 1G3IA 1QRAA 4Q1EA 3TGPA 2ZJAA 3AP2A 1BOFA 2XTZA 1OXXK 1J99A 2Q3FA 3CBQA 5GJVC 4I1VA 1ZNYA 2ORVA 3PJRA 4A8JA 3U6BA 1AZSC 2B7BA 3FB4A 4UKDA 4WZAE 2HYDA 1HT2E 4NYMR 5DLQC 4V03A 4IDNA 1KDOA 2ZSAA 4RFSA 5CM8B 1GOTA 2ZIAA 2ZRJA 4TZ6A 3QENA 4PZYA 1VG9B 2I4IA 4US2R 2YZ2A 2J87A 2IS4A 4RD1A 2PMDA 1D6JA 3OAAA 1ZW6A 3WRYC 1CULC 3FKQA 3T1TA 1WB9A 4QFMA 3P4XA 1QVRA 1SXJB 2IWHA 3ZS9A 5KYKA 4Z8XA 4B2IA 1VMAA 1E2IA 4DLRA 3NHAA 1NL3A 2HLDA 5DN6A 1Z06A 4QXAA 1XCMA 2ZRCA 3FVQA 1CXZA 1VCOA 1HV8A 5EP1A 2F1IA 3A1SA 3CM0A 3QG1A 1XTJA 4DDVA 1Q1EA 1W46A 1J7KA 1JECA 4IEIA 3CPEA 1UM8A 5J47A 4MRPA 3SN6A 3H4MA 4RZ3A 1W0KA 5DH9A 1XEXA 4Q66C 4Q1AA 5FUWA 2CCGA 3A37A 4Q4HB 1U9IA 3SBEA 3CX8A 3I8XA 4POAA 3PEYA 1MV5A 1M6NA 2DPXA 1T5LA 2C99A 2ZI3A 4Z51A 3WRXC 4YXWD 3KKOA 3KXLA 4RVCA 3TQFA 3CPHA 4ESHA 3IHLA 4D82A 1U98A 2AK2A 4DLXA 3CONA 1W4AA 3GLFB 1A1VA 5BN3A 1Q44A 3HU2A 3TE6A 2ZXUA 4MRRA 2YOHA 1BYIA 1QHIA 1SGWA 4TYPA 1AQYA 3AV0B 4RD3A 5CITA 2NTYC 3EIQA 1DO0A 2OLJA 3RHFA 2HF9A 1XTSA 2ZRNA 1YU9A 2OBLA 3GMTA 3HPQA 4Q48A 4WVFA 1KI8A 2FEMA 1LB1B 5JEDA 2BDTA 2WWWA 1E2JA 1MRSA 4FCWA 3CNLA 4LJ9A 2VP9A 1MT0A 4D81A 4PZLA 2JGNA 3OE7D 1GNPA 1KI3A 4C0QC 3B1VA 2ODBA 3WBJA 3M1IA 4FD2A 2ZUDA 2FMXA 4OHVA 2CJWA 2A30A 2GWHA 2A2ZA 2QTVB 4DCTA 5EXPA 5G3ZA 3TAHA 2IS6A 1NMYA 3H86A 5G41A 5DI9A 5J4YA 3QF4B 4O25A 4GI7A 1DADA 1QDEA 2H1LA 4DLYA 3K0EA 3A1WA 2F9MA 1ZRHA 5C18A 5FOWA 2VRWA 1GL9B 3X1ZA 4Q7JB 2OCAA 3FHTA 3BERA 2GCOB 2C2HA 4JT4A 1KDPA 1WQ1R 4V02A 2AN9A 2W2TA 3U7FB 2FFAA 2WOOA 3X1XA 5B64A 4C0AC 1N5JA 2FZLA 4LUCA 3G0HA 2QEQA 5TXGA 3Q8XB 3BH0A 4DKXA 2FSHA 4PPFA 2Q21A 1II8B 3KKPA 4CEJB 3GFTA 4D80A 2HJGA 2E9SA 4TQAA 3EAQA 2IS2A 2ZETA 4HUTA 2GXSA 5FBWB 1N5LA 3UIEA 2RGBA 1CJVC 1CJKC 1F2TA 1EFUA 2WWYA 3LY5A 5F9HA 2H17A 1FNNA 4MRNA 1W47A 2ZSFA 4GSYA 1HURA 1BMFA 3OEED 4WXRA 4S2EA 4BUJA 4GMDA 1YKSA 5EZ5A 3V9PA 2CXXA 5E7IA 4LOAA 1XJQA 2ZJOA 4MUBA 2RAPA 4TLCA 2J9RA 4AKGA 2AKAB 1QG4A 2PZGA 4FINA 2CNWD 1G6HA 1P9RA 1TAGA 4ZCIA 1OKKA 5FFMA 4B3GA 4KFUA 1KK2A 5A0FA 3WYAA 2NIPA 4OBEA 3TUJC 1X1RA 2KB0A 1II0A 2W00A 1V43A 1WE2A 1P61B 4XD7A 3U44B 4Y0AA 3REGA 1RRCA 4C7OB 1Z0DA 2F6RA 2Q0HA 1ELOA 5FOUA 2BBSA 5TV2A 1VECA 2WMOB 2XITA 1KNXA 2D3WA 4B3XA 4LSGA 3B60A 4XWKA 2ZYWX 5TMPA 1NVUQ 1Z2CA 3DPUA 4R2HA 4FMCB 5EUQB 1WF3A 2QAGA 1P9WA 5LDDC 3NG1A 4Z1MA 3BFVA 1Q12A 2A7QA 2WMNB 1AM4D 4DLVA 1TF2A 3AQ4A 2EFCB 3F0TA 4KJZA 3TH5A 1A5TA 1IAQA 1NNEA 4DLZA 4EPVA 2DFKB 1E1RA 3SDZA 1KJYA 1ZD1A 4CGZA 1GSIA 2ZAOA 1FOEB 2CDNA 2CVHA 2GRJA 5FI0B 4UXIA 2VL7A 1DBSA 3MAAC 1G8FA 3B9PA 3DO6A 1RVDA 1UBGA 1OW3B 3OHMA 2AX4A 3GP8A 3BRWD 3MFYA 2VSFA 2ZR9A 3KTAA 2CK3D 3H84A 3NVAA 2VLIA 3LX5A 5TB5A 2FN4A 4FMDB 1W0JA 3QJYA 2C9CA 4D0GA 4CF7A 2JCSA 1P3JA 2VP2A 5AJWA 2KWIA 4LJ7A 2JLSA 1GZSA 1KJWA 1KI2A 2LKDA 2ZJBA 1QHGA 3AEZA 3EIHA 5JWHA 4ZI2A 4XSGA 5K8IA 5CIQA 4B3FX 3I5YA 3SYLA 2ONJA 4QJ4A 4EFLA 4FIDA 3W8NA 1E9BA 1U90A 1NKSA 1ANKA 1VG8A 4GZLA 1NY5A 3P26A 3QKSB 2DFTA 3NBYC 3AKDA 1K5GA 4KFTA 1C1YA 1E32A 4Q9LA 3M4YA 2ANBA 1SVMA 2GEDA 2JLZA 4HZUA 1ZM9A 2P3SA 3DMDA 3A1VA 1MABB 3T1OA 4LDJA 4I81A 1TADA 1CKEA 1JEDA 4DSTA 1NJGA 3LNCA 1KI4A 1CRQA 4FI3C 3L0OA 4W9MC 5HE9A 1NVVR 1O3YA 3UMRA 5EE9A 2R9VA 1KZ7B 3DOFA 2QSYA 3C14C 1UKEA 4RFSB 2CHQA 5AK0A 3REFA 2NZJA 4Q4HA 3QBVA 2D7DA 4LJAA 4M9ZA 2O8BB 4Q9KA 2KSQA 3VAAA 1AKYA 4WW0A 3NH6A 5FBVB 2DHRA 2QP9X 4JLJA 1CIPA 5ANRB 1R8SA 2IYSA 2XAUA 2QNRA 3L43A 1G8GA 3AP3A 3LFUA 2J7PD 1QG2A 4JVSB 3O47A 2WJIA 1FP6A 3KTAB 3MWYW 4XVRA 1L4UA 2YC4C 1FUKA 4OQMA 2NO9A 5J4HA 2O0HA 3OF5A 3W6OA 1E2LA 1Z6YA 1ZINA 1VCMA 5FPSA 2R44A 1IN6A 1JR3D 3E1SA 2IUTA 3EG5A 3QOFA 2IEYA 3U6KA 1R0XA 3AF1A 1DG3A 3GEEA 3D7MA 2VSOA 1J2JA 1F2UA 4QM6A 1CR1A 5E7JA 1IQPA 4U7DA 1N6LA 4IOLA 1FUUA 3B78A 3HWSA 3SYNA 4DC9A 1NN3A 2IYRA 4YQFA 4TTQA 3C5HA 4QC2A 3BK7A 1XFAA 4NCIA 2GILA 1VHTA 4JLKA 4V0LA 1Z47A 5DNYB 5FUYA 4F4CA 1SXJC 3T34A 1MKYA 4UNPA 5BXQC 2J46A 3PEVA 3LWNA 2FE4A 2RMKA 3ECCA 2OCYC 3QF4A 3KDSE 4LJ5A 1LNZA 2ZREA 3RYTC 2J1LA 2YVUA 3KZ1E 5BYJA 721PA 3E5HA 4UNSA 3DEFA 4C0KA 1SHZA 1E4YA 2PLFA 5TARA 1COWD 4L5BA 1CTQA 2P65A 4YMWA 1DS6A 1S96A 5KO2A 2ZRPA 2AFHE 3I92A 1E0AA 4AWXA 2OBMA 4LHWA 4Q9IA 5AJVB 1JJVA 5DHFA 5FI1B 2WKRA 1E0SA 5B30A 1S3SA 1G21E 1GKYA 5FUXA 4MYUA 2WV9A 4Q9JA 5KSYA 3DZDA 4JKIA 4V0ME 1N0UA 1E94E 3UATA 2GXUA 4BLPA 2XXAB 4QKQA 3EZ7A 2IEZA 4LJYA 3UPUA 1Q3HA 3K09A 3KB1A 1OYYA 5FTKA 1S8FA 3VKGA 2A5GA 1P2TA 1TUIA 2R2AA 3THWA 1OIVA 3TW8B 3ICEA 2SHKA 3IDQA 3UG7A 4Q4AB 4HSEA 2GTPA 4EPRA 4I4LA 4BLQA 2ZRIA 1E2HA 3AVOA 3BFKA 1HTWA 2V7QA 3W3AA 4GRAA 1EFHA 3GLHE 4AC9A 5JFGA 5J40A 2K5UA 2X19A 1LF5A 1XWIA 3G5UA 2R6AA 2QPTA 2ZE5A 2IF0A 3B1YA 2R65A 3LD9A 2KBFA 1IN5A 1WCV1 2IX3A 1G20E 1YZQA 2OFOA 1E2QA 4MQBA 3QXJA 2IC5A 4B48A 3TK1A 3I32A 1JXOA 4YLGA 4MITA 2GJSA 4JLVA 4AG6A 5FR2A 4M1OA 3ZVNA 5GADl 1ZAKA 4TN1A 1NLYA 2JLYA 3W9YA 4D25A 1XB2A 4HDOB 4LWZA 1P2VA 4PPQA 3ASYA 3B1WA 4LHXA 3ZD6A 3HR7A 1OYWA 3R9WA 3VX3A 3R20A 2IYQA 2OFXA 4TLDA 1KIMA 3TW4A 5AWFC 3VR2A 4EIWA 2BV3A 2VHTA 4L15A 5DISB 4C7OA 2PZFA 4IRUB 5EE1A 4BGDA 3HR8A 3AB3A 3W5IA 1JB1A 2WWIA 2OBNA 4HAWA 3THOA 4TL6A 4R7ZA 1VG0B 1BS1A 5L8VA 3WYFA 3TSWA 4KBGA 4BFZA 1YJ5A 5KOYA 1N0WA 2RHDA 1U9IC 4JL8A 4NYMQ 1I2DA 4PAMA 1Z5ZA 4EJSB 3LLUA 2WWGA 4LJ8A 1JEEA 4R98A 2OXCA 3L8ZA 5K8LA 2GEVA 2QMUA 2EVWX 4F4IA 1JALA 4JZKA 1OH8A 3W34A 5JMTA 2IHBA 5TDHA 1GL6A 1XD8A 1IN7A 3EZFA 4PPNA 3ZVRA 2BJVA 2RKOA 1E79D 3R7WA 4GBMA 4RCZA 1GITA 1NP6A 4TL7A 2CE7A 3QE0A 4F38A 2QA5A 1P6XA 3EZ9A 4TMTA 4D4LA 3AF2A 2DFNA 4B2LA 4AG5A 1VKJA 1NIJA 3S1AB 3CKLA 4EFNA 4BRWA 2ZSDA 1NSFA 1TQ2A 1E1RD 1WRBA 4PSKA 4S35A 4MRVA 5IHPA 1CF4A 4RJLA 4OHWA 5JSZA 4N3NA 4MDFA 4G5QA 1QVAA 4LYHA 1E9EA 2F43B 2ASEA 3IPXA 1SKYE 2IW3A 2VHJA 4MGKR 3LLMA 4YC7A 2C03A 3L2OB 1U0HC 3D6TB 5EXXA 4M9SA 1KDRA 1OHHD 3UG6A 5IK2D 1DG1G 3EPJA 2IYTA 3EC1A 1KI6A 5H1YA 3ZS8A 3BJIC 4OK5A 3VKWA 3B8HA 5L3RA 3U7HB 3N2IA 3K0CC 3FFBA 2GAAA 4KCGA 2WAXA 1SQ5A 4DLUA 4UJ5A 2XZPA 2Q9CA 3CX6A 2GJ8A 3C15C 4AYWA 1FX0A 4OQNA 4U00A 2BBTA 2ZUCA 5KSPA 1X8LA 4KFSA 4M1WA 3MLEA 3EWSA 3R8CA 3TIFA 2WAYA 4KLNA 2W83A 3LH5A 2HT1A 4OJQA 3IILA 5KNCA 3RRYA 5HTKA 4UJ3A 1T3LA 2BCJQ 4TMZA 4P0TA 4GT1A 2DFLA 5FTNA 2B21A 421PA 2C98A 2IK8A 2OG2A 2RHMA 2DYKA 1G16A 1N5KA 2ZYUX 5EP4A 1D2MA 1G8HA 1DPFA 1AN0A 1NVXQ 4CVNA 4JL6A 3I73A 1Y63A 4EKDA 3RDPA 3TUIC 4P32A 2CCKA 2QT0A 1PV4A 4HB2A 3P4YA 5K8TA 1R7RA 2FSIA 1KHTA 4D2IA 4LV5B 3WBKA 1XDBA 3GLGE 2D7CA 3MWKA 3MWLA 1F2UB 1GIAA 4ZCLA 2G77B 2IXFA 2QGNA 1Q57A 2KI5A 3E70C 5HKKA 3OAAD 1RJ9A 1AGPA 1RRGA 2BKEA 3P27A 4HUQA 3VR6A 1KO1A 1C4OA 5JS8A 5JECA 4Q1FA 2JATA 2L0XA 3CLVA 4PC1A 5F98A 4NL4H 5CK4A 1YE8A 621PA 2ZRGA 1KI6B 1CEEA 1RC8A 1ZCAA 4LC0A 5JCPA 2FX3A 3GJXC 5JHHB 4PANA 3H1TA 4DSOA 1OFIA 2YWHA 4URUR 4NE2A 3HPRA 1P7CA 3P32A 5A4JA 1VYVA 3MCAA 1G5TA 1N6RA 4FMBB 1XEWX 3FHOA 1XU4A 4UXHA 1OXVA 2ZI9A 2G9NA 2A5YB 4QGAA 1P73A 3LQRA 1ZD9A 2RH5A 1US8B 4UNQA 2W6IA 4ZPXA 5M04A 1XBTA 2FA9A 5CJPA 1TQ6A 3D3QA 2EQBA 3K0SA 1E2NA 2Z5FA 3RS7A 4NTZA 2ANCA 5K8UA 2WVJA 2GBLA 5F9FA 2O0JA 4D4MA 1U8ZA 2PX0A 3QNUA 1IHUA 2BMDA 1Q1BA 5D3MB 5BYKA 4YMTA 2XOKD 4JMPA 2ODEA 3NXSA 4NDZA 2ZS8A 4Q47A 4J0QA 3GQBA 4CDGA 1G1MA 2KBEA 3A1TA 4JBXA 2HJVA 2WOJA 4FMDF 1H8HD 2W0SA 2PJZA 4V0NA 4DEYA 1N6PA 5H68A 2F9LA 2GEUA 2O8EA 2EYQA 3QF7A 1LS6A 5DYIA 2QMHA 4PC7A 1D9ZA 3KUDA 4Q5IA 1EX6A 2R6GA 4TSFD 3AGQA 4II7A 1FW6A 2D2FA 1LY1A 1ZVQA 4WXPA 1G3MA 1Q1QA 4KVGA 1GFIA 4I1SA 5GVSA 3PENA 2EW1A 4Q18A 5KU1A 5G40A 2WSMA 2QP3A 4DSNA 3K9HA 3L82B 4TSFA 4HLDA 2QM8A 3M6AA 2GZHA 3KJEA 1SVKA 4IDHA 3B82A 4DXAA 1E1QA 4QHSA 5DSZA 4DB4A 4V0KA 1TF5A 1CJMA 1T9HA 4BFTA 2QBYA 2ODWA 3QXCA 2ZRKA 4HLQB 5GJCA 3OIUA 2YWEA 3WNCA 1E2PA 2H92A 4IDQA 3BB3A 1KI9A 3GEHA 2D74A 2AKYA 2BHRA 2D4HA 1YR9A 1N6OA 1OB2A 4TLEA 1ZU5A 4DCSA 3HYRA 2GDJA 4YONB 1GRRA 1MO3A 4KFRA 3TAUA 1UKZA 3AVTA 5TVKA 3WY9A 4EJSA 3WXMA 2JAQA 4B6EA 3BIFA 5LPNA 4K46A 3TBKA 4F91B 2JLRA 3LQQA 3DMNA 3N70A 3SZRA 2Q3HA 3GLHA 4QL3A 2XB2A 2ZSEA 4D4KA 1BMFD 2VEDA 3R9IA 2NQ2C 3AM1A 3KFVA 4IFBA 4PC6A 5JJLA 5HCNA 1JI0A 1QHSA 2J0QA 2CMKA 5DO9A 4C0BA 2ZRLA 1I2MA 4B33A 3WMEA 3OESA 2HV8A 3N2EA 3LXRA 2A3RA 4MYTA 1G41A 4G5OA 3SFVA 4CYMA 4I99A 4BPBA 1OH5A 1T3HA 1KJZA 2CK3A 1I4LD 1L4YA 4HB3A 1OPXA 2IYWA 2KJQA 1ZP6A 4HAUA 4N0DA 3QVUA 3RRNA 3QIAA 4O3MA 4C2UA 2XTNA 4LC1A 4OHYA 1OXSC 4BE7B 1IJEA 3KKQA 1ZNXA 1KI1A 2JDID 2P2LA 3UXMA 3CNNA 4EPXA 3ZIAA 4PQYA 2H18A 5B58C 2IYXA 3NIBA 3OFNA 1UPTA 1GILA 3UK6A 1L7VC 2OM2A 5F2EA 4NCJA 3BH6A 3ETLA 2IUUA 4A9AA 3NDPA 2OCPA 4JLOA 4GP7A 2EYUA 3IGFA 5FTJA 1XX6A 4NZYA 3TSZA 4N0EA 4RKEA 2REXB 2YC2C 3RC8A 3TVTA 3FPAA 5JHGB 1Y3AA 4W5HA 3QSYA 1ZC3A 3QVVA 4W5WA 1EESA 1QBKC 3LW7A 4QJ3A 4Y0VA 1UKYA 5JSZB 3PR1A 1KO4A 1XP8A 2VHQA 2WZQA 3GLIE 4DSUA 3EW9A 4QNRA 2OCBA 1ZUIA 3KXIA 5BN4A 4JSYA 2Q9AA 4XTCS 3MG9A 2FZ4A 2ZS7A 3GJ4A 3OZXA 2QG6A 2QT1A 5J4VA 1SHKA 4JBWA 1DOAA 2ZI4A 4PSVA 2YJTD 3ADBA 2P0EA 1YZNA 3UWKA 2D2EA 3U3MA 3PEWA 4N1AA 2GK7A 4W5JA 2ZR0A 1XEFA 4HLCA 4CRWB 1JR3A 1QHHB 2O5VA 3BH7A 4NPHA 4OQFA 4AD8A 4ESVA 4FWIB 1AZTA 1DE0A 2DWQA 1TF7A 2UZ3A 3RLFA 3VMFA 4MH0R 3C41J 4KSCA 3THWB 3CZQA 3B7GA 3CO5A 4V0OA 3FWYA 3NWJA 4BFXA 2PZEA 5EP2A 4DRZA 2YOFA 4Q1CA 5FBQB 5GJWC 3RVBA 2GETA 4HB0A 4RSGA 4URXR 1XJ0A 2C5LA 2X1VA 2BMJA 4A82A 2AWOA 3IO3A 2A5FA 5DI3B 4ASUA 4Z1MD 1W4RA 1OIWA 2V4ZA 2H5EA 1WBDA 1E2KA 2ZE8A 1MO6A 2F1HA 1BKDR 2F3RA 2FGKA 2JEOA 1CR2A 2H57A 1XMIA 3CH4B 4IVRA 5JJKA 4NHOA 1XZQA 5KDLA 2OEPA 2JLXA 4H1UA 3HP1A 5UKDA 2AD1A 4CEHB 4EQ6B 4LK2A 4M1MA 4XJXA 2GJAA 5L3VA 1GNQA 1TQDA 1SVOA 2WWFA 3VR1A 4IEEA 1OIXA 2G1KA 3PUVA 1JAIA 2FNAA 5B57C 2ZJYA 2HF8A 4X8MA 5EE0A 5FL7A 3TRFA 3ND8A 3FGNA 1F5NA 4YMUA 3ZZUA 2NOAA 4DLSA 5SZKB 3SYKA 3X2SA 4LBWA 3UMFA 2ZJ8A 3HYTA 1ZD8A 4TT3A 3AP1A 4P33A 3QXXA 4G0NA 1G291 4MA4A 3FHCB 2PMKA 3MJRA 1FNMA 4M1YA 4KXFB 4RD0A 1N6HA 5C1BA 1JPNA 5HR5A 1SKQA 5DIFA 5AUPB 2QENA 3WP1B 2R62A 2RGXA 1DAMA 3VTKA 3O8RA 1G4UR 2ZU6A 2XEXA 2GA8A 1ZM7A 1W0KD 3VNUA 5EXSA 5ELXA 1ZJ6A 5FOVA 1ZM2A 1R6BX 3A4LA 5FPYA 1NLZA 4L4UA 5EE3A 4KYUA 3ZVMA 4KI0A 2GF0A 2Z4SA 3SEAA 2VTKA 2FPMA 2YWFA 3NC0C 3U3OA 1Z83A 3GJ6A 1KKLA 3LRPA 2W6JD 4UXJA 2PH1A 1YRBA 1KSGA 3AF0A 3GJ0A 4JLBA 1G3RA 4RY2A 3K0FB 3EA0A 2ZSBA 3LBNA 2N42A 3SNHA 4LV8B 3RAPR 1Z0FA 4JS0A 1OXTA 4Q19A 1ZC4A 4D0NA 2D62A 1FZQA 2NO6A 1QHYA 2ZPTX 4FN5A 1XMSA 4EQ6A 5GVRA 4EUNA 3KKMA 1OKKD 3O8CA 3MRSA 2P5SA 2O52A 2AXPA 2O8EB 2BC9A 4PAOA 4A2QA 1NJFA 1R0YA 3LO5A 1QZXA 4LHZA 4A8JB 2V1XA 4YXWA 4XWAA 4QNMA 1H8EA 1ZU4A 2Z43A 2AWNA 5AUOB 2OV2A 4HAZA 4WOPA 2VHCA 3U60B 3JVVA 1AJEA 2X2EA 1CJTC 3Q5DA 4JL5A 1P5ZB 4RZ2A 4Z8YA 3CF2A 4F4JA 4ZDIA 2REOA 4D4JA 4Q1DA 2LWIA 2Z0MA 4CT5A 2GXQA 2B92A 1JPJA 3I72A 4EPWA 3QKRA 3IEUA 1Z29A 1XD2A 2R6DA 2XX3A 2IYYA 3IQXA 1RRFA 1PJRA 2QQEA 4EAQA 4JIMA 4AKEA 2QMOA 2F1RA 2XNDA 3VFDA 1DVRA 4ZIRB 2HXYA 4P4TA 2QAGB 4AI6A 3RABA 4GFDA 1LVGA 2VHUA 1F60A 3MUFA 2ECKA 3SHFA 4CW7A 2BOVA 1WDTA 1XCGB 3DL0A 4TMKA 2JJ2D 2FU5C 2VSXA 4Q4AA 1XF9A 5TY0A 4URYR 2C9OA 3WP0A 1NBMD 1AGRA 5CLLA 1T0HB 1UAAA 5DGXA 4D26A 3RRMA 3W8RA 1CJUC 3F8TA 4OI2A 4D0LB 4KODA 3ND9A 1UF9A 1X8JA 2V55B 3AUXA 4OJKA 2VH5R 4V0MA 1EG7A 2IF2A 1R2QA 2QU8A 2XZLA 2P6NA 4EPYA 4O2RA 4ARZB 4PQRA 4TT3D 4TQ9A 3GLFE 1IBRA 3B5JA 5CB6A 1T8TA 1DAEA 4R71A 2ZRAA 1W2GA 2C77A 2CLSA 1W36B 3GLGA 4DUGA 1E9SA 1E99A 4PO8A 4C0HA 1J90A 2VPPA 2FH5B 2ZYVX 1AKEA 1A4RA 1S9DA 3AF3A 4DCUA 3K0AA 1TU3A 821PA 3AVWA 4PZZA 3AVVA 1EK0A 1PLLA 4IDPA 4BFWA 1WP9A 1SVSA 5JI3E 4PSAA 1I4DD 4Q9HA 4YDHB 2NGRA 3L0IB 1W36D 1DAKA 4QGFA 3U4QB 2RCNA 2CJWB 1HE1C 4IJMA 3TLXA 1KY3A 1XTKA 2R6CA 2ZYTX 4U5XA 4C30A 1MABA 1E3MA 2IXGA 2O8CA 2RGGA 2UZIR 3BC1A 4B32A 3NBXX 4Q7MB 1ZBDA 2A78A 4GOXA 3V00A 5AUNB 1NLFA 1W7AA 2CLDX 3SJCA 2GCNA 4UNRA 5L3QA 1U94A 3CWZA 2RGNC 2C04A 3DM9B 5IRCD 1E69A 3ZLJA 2EFDB 1E6CA 1ZNZA 5AJYA 1W49A 4NYJR 2F1JA 2CEAA 1YVDA 3QKTA 3ZQJA 3R7WB 4DCNA 1PLJA 5A5GA 4LY6A 1XTIA 3KJGA
chains in the Genus database with same CATH superfamily
4KLZA 2WFZA 2Z3ZA 4N9WA 5B1DA 2NSDA 1JLRA 221PA 1G17A 1ZN8A 2BEJA 3AFGA 3T61A 2BISA 3CF6R 1SIBE 2E1PA 4QG3A 1NU8A 3HHEA 1D7AA 3K5WA 4KE6A 2IIPA 5ED0A 3U3KA 2UAGA 4XUCA 1YDEA 1YV9A 1XKTA 2IOFA 1Q11A 4QOHA 1W94A 1AO0A 2NSHA 2R11A 5JQGB 1QRTA 4LYAA 3LKBA 3ZH9B 3VQTA 4KUGA 4CMHA 4KQGA 5K6TA 2CV0A 2V0CA 5DI3A 2G80A 2H4ZA 2ISSD 3I04A 3K8YA 6CHYA 6YASA 2P2ZA 4YRQA 1PSZA 3HCDA 3A8TA 1KMQA 3EUAA 3NGLA 4LBYA 2XXJA 4Y1GA 3CLTC 1T24A 4NATA 5B2ZA 2EBWA 1FB5A 4X44A 3IDFA 2PWYA 3QI2A 1E2BA 2PY6A 2R8XA 3BTUA 1W0JD 3UHOA 4B6SA 1TMKA 1NC1A 2WY2D 3HSKA 2IITA 1Z74A 4M1ZA 3C7KA 2YCLA 1OBOA 3ONWA 1DUVG 5K5EA 2XYQA 3IBYA 3QE4A 4OQLA 3SC3A 3UKDA 4B5LA 3ZIAD 2QTRA 3BMXA 4H18A 2WK1A 2O57A 4ACBA 1OV4A 1W19A 3HKDA 2VP0A 1IU9A 1L4BA 1VHQA 2W37A 3DAPA 4GZMA 1DELA 1LA2A 4HC4A 4X7MA 3SS8A 1LLCA 3IBCA 1QYRA 5JLAA 3PEFA 2FDRA 1P1HA 1DBRA 4IS2A 4J75A 1UJ2A 2FEKA 3R9KA 4PHGA 2BM1A 4LFAB 4B3RB 4DVJA 3AHCA 1WA5A 5KHOC 1I3NA 1XEXB 3IUYA 4P35A 3ZXIA 1SZCA 1USWA 1M7HA 4TLBA 1YRQA 3CNOA 4LNAA 3DL2A 5L51A 3OFJA 2YWDA 1L5WA 4BNNA 3AFIA 4H7JA 3INYA 4E2WA 4ERNA 2WWRA 2Q07A 4L3VA 4RD6A 4BVEA 1R8XA 3PIRA 1GN9A 2YXEA 2AF3C 1J8DA 2FZEA 3KPYA 4L1KA 4UC0A 4WT7A 5AP9A 5EHIA 4RZUA 1QJ4A 2H7VA 5I8PA 3HNOA 4RM2A 4CMKA 3RVQA 3A4VA 3QXSA 4KO2S 1CR0A 2GEKA 2OSBA 4XUEA 1QGYA 1Y4SA 4AXBA 1HYEA 1TGYA 3RRFA 4A6DA 5FFFA 3TF5A 4OHXA 2NZ8A 4TWIA 5G4LA 3QTLA 2R96A 2AQIA 3PFIA 4MW9A 1N2XA 2BIFA 4DIOA 5F7OA 3ZHVA 1KYWA 2WYVA 3OZSA 4OP1A 2VUUA 2BVNA 4EKIA 3HCRA 3PUWA 4E5SA 1DINA 2XVYA 4N54A 5IT5A 2JHFA 1J21A 2HMSA 2I8AA 3ETHA 3N0XA 1NSYA 4OXXA 5EJIA 4YX9A 3QLUC 3D7RA 1W36C 4O33A 2O5EA 3N2NA 4O4JF 1UC9A 4FZJA 1XLTC 3A4NA 5TSDA 1KDYA 4XDHA 4NU0A 4URWR 5B3JC 1L7XA 1KMCA 2WM3A 3U7EB 1I0LA 2X14A 5F3DA 1H0RA 1CS0B 2JASA 5L3SB 2WAOA 1P3DA 2ADOA 5E1DA 3QVSA 2G9RA 3ADDA 4U7TB 4QHYA 4ALKA 5JI2E 4ZO6A 1GDHA 3LOUA 3K70B 4QTXA 2ZQYA 4GX2A 3A26A 1CY1A 1UXJA 2C95A 2C1EA 1AS3A 1W5SA 3B3FA 3FF4A 2DX7A 2HJSA 3QVGB 4NFLA 4U7HA 3U9SA 5AI5A 3FB1A 5HUJA 2XKKA 5BSEA 4J0JA 5BN4B 1GU0A 2I3AA 1W93A 4WZZA 1Z35A 2DWUA 4K87A 1OWOA 1YIOA 4PNHA 2HA0A 2B7CA 3RG2A 4B6OA 5DN6D 1S1MA 1SUWA 4HPXB 3QEKA 2RJNA 4MAAA 1Q21A 2KE5A 4JXJA 2GAOA 2D06A 3EVEA 4F5DA 3ZD7A 3ZEIA 2ATVA 3L4BA 4TUYF 1X1TA 5DKFA 2WHQA 4H31A 2WBLC 2K2QB 5JXGA 4UQOA 2EJWA 4I6GA 4NCNA 1HUQA 3LY7A 1FFXA 4MP3A 5L7YA 1DWUA 1EJ0A 3RIMA 3C6MA 2D1TA 3DF9A 3U4GA 4ZZ3A 4GDMA 4L7VA 4IOKA 5KUTA 2VAVA 4J0EA 1B23P 3KVYA 3FZGA 2AG6A 3VNSA 4HP8A 1N0IA 2C8VA 3BMCA 4KNVA 3W5JA 4CQMB 3BULA 3L6DA 4UQPA 1RWXA 4OI1A 3RHTA 3AR6A 1Y8RA 1H2HA 1LNQA 4D4HA 4WH0A 4TL8A 3OCVA 3G0DA 3CLTD 2VIIA 1BGVA 3JWJA 4GSLA 5IYZF 3WNDA 3AL0C 1WO8A 1H1LA 2RGDA 3M6FA 4GPD1 3Q1LA 4OQYA 2VF2A 2O50A 4YTEA 1NNI1 3JATB 4XIFA 3FMIA 4AW9A 3E58A 4F0JA 3DP9A 1POWA 2NG1A 4XD2A 5A4KA 1P4HA 2RC5A 1R0CA 1FPMA 2YZNA 3GF4A 3H7AA 3PB3A 2QZJA 1Z16A 5TT0A 4YAGA 2H5JA 3LM8A 2ORWA 1SCNE 1M5RA 1GHTA 2GASA 3MTDA 3ONNA 4K9MA 2FMKA 3SIXA 1P1KA 2PZMA 2HW8A 3FYUB 2B6NA 4A27A 3LDGA 3CPSA 4PSDA 1XCOA 2PEZA 2OZKA 4IZIA 3W6NA 4JHLA 2G8NA 3UPDA 2ICAA 3F2IA 3HJRA 4OJNA 5EZYF 1EVLA 4OAPA 2ZE7A 3Q7RA 1JTVA 2I6FA 2JFBA 4M60A 5CFOA 1YZUA 2LGJA 1XEWY 2A0UA 1ZMRA 2DTXA 3TTXA 4ZI3A 4A5OA 2NO0A 5HYVA 4TV8B 1MG0A 3EX7C 1PZXA 2GM9A 3W4KA 2WIBA 3TM5A 3ZWYA 3HJHA 3W90A 1S8OA 4ES6A 1JQ3A 4F2GA 1KO8A 5KQSA 2P30A 4ENSA 4XDGA 1L6IA 7REQA 2FG6C 2J7KA 1KO5A 3U4AA 4M53A 3CYFA 1QC5B 2Q4OA 4M1SA 2D3TA 2W8BA 4W7HA 2ZB8A 3H2KA 4MI9A 2Z2IA 1B3RA 1XRJA 4X9XA 3LCVB 1QIDA 1JEOA 1NSTA 3P9QA 2FR8A 2IXDA 2PCJA 2VDWA 4FXOA 4DJAA 5FXMA 3F7TA 5HS6A 3TD2A 4KBYA 5EEGA 3TEMA 4MUYA 1C4KA 3S8MA 3VU3A 4Y9RA 2AD5A 2WV7A 5AXDA 1KYZA 5EQJB 3TDNA 5LNK1 4UDOA 3K5PA 3IDOA 1L8QA 1K66A 1VE6A 5FOTA 1T1IA 1ENOA 4A36A 1VBMA 4RJJA 4BLSA 5JR3A 3UBTA 1OBVA 2I2WA 2BFAA 2GH1A 2JLAA 3NHJA 3O03A 2XCRB 1LRLA 1E2FA 2FWJA 3PQ3A 1DV1A 4JJ4A 5LU8A 1AXEA 1GGEA 2X8AA 1LK7A 3DUWA 2AB0A 3L8EA 2JW5A 4WZBA 2FSFA 1J56A 4TTIA 4R8MA 2VJDA 2B8WA 3FNHA 2EP8A 2ZRMA 2ZI5A 3IMGA 4K9DA 2FUKA 4R6WA 5AI4A 5EJ9A 1ZL0A 5DTMA 4PQFA 1MW9X 4GVPA 2VTVA 4E15A 5MFZA 3SHOA 4ZVUA 4D8WA 2V54A 1ZIXA 2BN4A 1PT8A 2R25B 5EINA 4HS4A 3E7DA 2BRUC 5ALGA 1JBQA 5B2FA 1UR5A 5HNKA 2B1IA 3C4JA 1G8JA 3Q11A 4BNDA 1HE2A 4XYEA 2Q3JA 3A3PA 3VPFA 4AN0A 2ODPA 3PNKA 1ZVKA 1PL6A 1EJ6A 5DCYA 2X5NA 3TZLA 1MUUA 1URPA 4ITVA 1P1IA 4ZOAA 1VSBA 3IUNA 2BGGA 4UTPA 3L7DA 3PC3A 1ODLA 2DHQA 2IPNA 3ORHA 3BMQB 4J43A 2F3TA 3KOWA 3ONVA 4MCHA 5IJ9B 3DHWC 3ILSA 5HCIA 3D6VA 3T7IA 3SR0A 3ZHZA 2XW6A 1NN0A 4C22A 4N6GA 3SHWA 1SHUX 7GPBA 1XELA 1BAPA 3SSMA 3F5SA 5EKXA 1RE1A 3I3SR 3WBFA 5JWOA 1XXHB 3N6RA 4F46A 4C6HA 2ZWAA 5JQWA 1USKA 4IY1A 1IK4A 2CF5A 3SM3A 2QRLA 4DBLC 3DDSA 4A0FA 3GGDA 3FTNA 1SHJA 1UEIA 1Y89A 4IIFA 4LZNA 1KEZA 1R50A 3I76A 2QJOA 3R9XA 2ST1A 1Y34E 3LUPA 1JMKC 1P9NA 2CXTA 1FFDA 2GNOA 1ZEJA 3IUMA 3LIIA 3MWJA 1LUAA 3CR7A 4HNSA 1JTFA 4YRGA 3OZTA 1JIXA 2BKVA 3TB6A 1TL7C 4TUYB 3AZQA 4U4AA 4NBTA 1T13A 1ADGA 1BHSA 4R16A 4HYYA 1GZVA 2WFLB 3IODA 1X39A 3QH4A 1TLTA 4E22A 1UPUA 1ENZA 2GHQA 2R87A 4AO8A 1NVTA 4G9GA 5FBHA 3N7AA 4ND7A 1M0SA 4D41A 5DHQA 3P8ZA 5EP3A 1FBNA 4P53A 2DH6A 1NNLA 3GAAA 5BVGB 3S99A 1SBNE 3WMFA 3ICQB 2NUTB 1GQRA 4L4ZA 1I0ZA 4FXPA 4J4BA 2JLVA 1JR6A 5JAUA 3HCFA 1Y5IA 3CRRA 1RPZA 1VPWA 5JSKA 2BFFA 2G3YA 5BSWA 4ZARA 3O3CA 5IKPA 4AQ7A 1WPXA 1FJ2A 1V5GA 1U0BB 1D2EA 3MBIA 4Y1FA 1NBHA 1O8CA 1ZBQA 2VQSA 3TEFA 3HJFA 5DM0A 3FWZA 1JHYA 4IOMA 4Q03A 3VVMA 2OZPA 2GTHA 4CXMA 3GXBA 4K8OA 3KQNA 1DKUA 3A05A 3JQCA 3U40A 3N8KA 1FP2A 1FYDA 4V0QA 4O8CA 1WUTA 2QSZA 5HJ5A 5CUQA 2ZIZA 3X1WA 3KB6A 1RTTA 1EJ2A 1LQ2A 3BSSA 5GAJA 5HUQA 2FG5A 1A5ZA 2NT3A 1Q0UA 4GOMD 3SFZA 1V95A 3T1VA 3SAJA 3AG6A 2DQKA 3VU8A 2GLXA 3EQ7A 3WWZA 1B0ZA 4R1MA 4I8XA 2BMVA 4G2NA 4HZGA 5A4AA 3M9WA 5AICA 4DIBA 4G5HA 1RKBA 3L7JA 4QDTA 5T6MA 4YQYA 2VEOA 3PNOA 2DBRA 1SD5A 3NJ8A 3HNRA 4PLPA 1UK9A 1RM3A 1R9GA 4QYTA 3VZPA 1LWOA 1FQJA 1PKEA 1FXUA 1WOYA 5K4HA 1Z22A 2HSZA 3ENQA 4ZPJA 3QVGA 4IQ0A 3VPHA 4BNLA 4NBRA 4EI7A 5C5DA 3I6QA 3EZYA 2GESA 3NJRA 2HWUA 3AOGA 4RSMA 1OWPA 2O2GA 5LMCA 1IG3A 1VE1A 1O9BA 4JVMA 2A5DA 4JCCA 3KB8A 1C9KA 5DP2A 4LDRA 1E2DA 2C31A 4KN8A 5J5CA 5I7FA 1IY2A 3KT8A 5AKJA 1TEZA 5BW8A 3G0CA 1OE0A 3SKYA 5IKEA 4M8NE 3A4TA 3X1YA 5JJIA 1IRIA 2UZ1B 4LRWA 2IYVA 1IN8A 4YR9A 2OILA 2XJ9A 2ZSKA 3C8UA 5A9TA 1RYBA 2PGNA 5H4GA 2EWWA 1A7UA 1OLSB 4HQ6A 1E9RA 1BDMA 2QB5A 4YGXB 5L4SA 5HK8A 3UB2A 1LC0A 3R5KA 5GONF 4AF8A 2B5OA 3UJ8A 1Y0BA 1B42A 2JDIA 4GUDA 1R4NB 2H4HA 2Q3MA 3LUHA 1R5JA 4LDNA 4MCIA 2YZMA 3PA6A 3RWOA 2PL3A 4CMEA 1AS2A 3E82A 3ANSA 4XOUA 4UBLA 4ZDKA 2FCRA 3NKFA 3OZBA 3BD7A 2OCDA 3KWJA 3TLKA 2QVLA 4ZYZA 4UDNA 1QH1B 3LS2A 1AKTA 1QFSA 4FDUA 4HDMB 1WABA 5BSHA 1PQUA 1OLUB 2GB4A 3BRQA 2QV0A 5JH7A 3QELA 3LCUA 1CSEE 3N7TA 3PL1A 5F5XA 5A4MS 1RHRA 3EG9A 3GT4A 3PTLA 4MB6A 1B8VA 2GZAA 4HDKA 1OFTA 3SX0A 3K8QA 2R6FA 2XSZD 3QKSA 3SK0A 5HKKD 2C82A 2ACWA 3CIOA 5C4MA 4UMFA 2CYBA 4FR0A 4BFSA 3OWHA 3SQOA 3ACCA 3A1FA 4LZZA 3I8SA 4BEBA 1TK9A 2JKVA 2VH2A 3FYUA 3TLBA 3S28A 3ZGNA 4F6LA 1JBKA 3LF1A 4M9QA 3V4LA 3DS8A 4M0MA 1CQIA 2WJVA 5D2CA 2V03A 4CKEA 3C3PA 4D57A 1Y8CA 3U3XA 3GFPA 1JSCA 4HAIA 5H70A 4JP5A 3ZV5A 1D04A 3KM0A 4X71A 5A6SB 3RKUA 4FGKA 3VAZA 1Z07A 1Z8FA 3MSXA 4HJRA 2YRXA 2XUDA 4G97A 4EB6B 3DE0X 1GLNA 1L7OA 5DE3A 3VO9A 1FL9A 1T5TA 1XHLA 2P9QA 4HSGA 1NC3A 3BL6A 3MMNA 4NXMB 4CEIB 3ZHSA 4KR2A 2DR3A 3NIGB 2D1YA 1E20A 2VP5A 4GGOA 5EJGA 3NXKA 1Z0UA 3NORA 1JJFA 1HBJA 4ZQEA 3V1LA 1KS9A 4DJJA 4PO3X 1WTCA 4KDRA 1VLQA 4L6AA 4TTSA 5CGZA 4YCBA 1JR3E 3KG2A 5DHRA 3T9BA 3VI4B 2G83A 3B2QA 2VLBA 3VPSA 4KOAA 1DJPA 1T5DX 3RUHA 1FYVA 3MXOA 4PYRA 2OBBA 1RJDA 1T8UA 1YULA 4AXXA 1T6NA 1NXSA 3ZI7A 1P62B 2ZJ6A 3TLGA 4KTTE 5A2GA 2DHCA 4BB5A 3BORA 3Q6NA 4MRSA 2JH8A 5B3AA 3E7XA 4EM6A 3GEDA 4TT8A 3CUSA 4KGZA 2PZBA 3TVDA 4C05A 2L2QA 3ONFA 1B76A 3VNVA 3IQDB 1KYXA 1ZOOA 3DYBA 3LVBA 4A26A 2WHRA 3QLUA 1NRJB 1MR3F 1OHHA 2FWRA 3F7MA 5FUBA 4QSHA 3RYFB 5BNTA 3KQKA 2R6ZA 4XDYA 5KOIA 1IHDA 4HWKA 1SOWA 1V96A 5DOVA 4GZ6A 3MOGA 3UTCA 3DMPA 5LWHA 4WZBB 4MK4A 4UBMA 2DBVO 4L8YA 3ZKWA 4EVSA 1DKLA 1E3DA 3OZWA 1ULZA 4BASA 2VBCA 3L8DA 2A7XA 1CE8B 3GA0A 1RWNA 1Y6QA 1Y98A 4Q3CA 3SBDA 4DPKA 5HUHA 2F8TA 4LNUB 4E08A 4C4SA 2ZI7A 5FV4A 2ADFA 1SUDA 4DQVA 3EARA 1UKVY 4LKRA 4HNGA 3KQUA 1KAOA 1R0WA 4PS0A 1SKMA 5EFOA 2QPOA 3BXHA 4XM1A 3W7VA 3AWIA 4YUZA 1KKMA 2D13A 4IR7A 1NG9A 4OXQA 5IZCA 3ZU4A 1SC3A 1R27A 4FNOA 4PYIA 3IQZA 4OQXA 2B94A 2P2DA 3KOOA 1QV7A 1JKIA 2B0CA 1HQCA 3G2MA 521PA 4BNGA 4I1PA 2EERA 1I1HA 3FBTA 4QJIA 3UANA 1CDDA 4E0BA 1O5OA 2YZ7A 1ABFA 1CUDA 4V2IA 4WAUA 1YAJA 1EGVB 3MRVA 5KKNB 3VU0A 2XZDA 5C31A 4R9UC 4HN9A 3W77A 5TLSA 1AKMA 1YBMA 3EVGA 1CEQA 5BSFA 3P97A 4DN6A 4JI2B 3IURA 2JJ2A 3BD8A 1JL3A 4PG8A 5I7WA 4CDMA 4PAGA 4IVPA 4Z4QA 2OD7A 2V7UA 4ZQCB 2WIDA 1OREA 1N7HA 4B7AA 4RKRA 1Y6JA 1T4GA 4G1BA 5EIFA 3PUYA 4TMFA 1TVKB 5LP6C 4HAVA 4F7WA 1T4BA 3KE8A 4LDQA 2AMLA 4FEYA 4NAUA 5DBIA 2DU8A 5D3ZA 5CXQA 4B45A 3TUZC 4E5MA 4UTOA 3IVGA 1UJCA 3DDCA 1JKFA 3V9AA 2QI9C 5AK6A 2HT6A 3FOZA 3U4CA 2Q9BA 3LT2A 4WZBE 3T9DA 5I7RA 4XVQA 4N7JA 4DR7B 1TZJA 3C6BA 3O1LA 1Q0PA 1D7OA 3BMOA 3BRSA 2HLDD 4JI7B 1CUWA 3HUDA 2ACKA 3BB1A 3BIXA 3KHTA 3L8CA 5TGZA 3UBMA 2C96A 2BFDA 3VPGA 1MIOA 4PGHA 4P3YA 2EF1A 4PTZA 4ZT4A 4JI1B 3RAEC 3BM5A 5IVPA 3CZ4A 4RMNA 1TLLA 5D51S 4O1IA 3KXKA 3M6LA 3BXOA 4ZWNA 3B51X 3F2VA 1HA3A 4KRXA 3WYGA 4MQ5A 4IZHA 3IT2A 1PR5A 2BMEA 3EK2A 2HRCA 5HF8A 5B12A 2BJWA 3WYBA 1XZFA 3D6FA 1IWOA 1U3UA 1TCBA 1VE3A 3BXEA 2LKCA 2WWHA 3I09A 3LY9A 3NEJA 3VPCA 2HIHA 1MLDA 2XUJA 3MCZA 1DLIA 1PGOA 3DW3X 1JJBA 3QWIA 2V6JA 1YJCA 3Q3CA 1VCIA 4DHEA 1YRHA 1QCCA 2WZCA 1BVYF 1QONA 2OFFA 3H9JA 1MX3A 4ZGGA 5KC9A 3TZHA 1UDAA 1R0LA 1T9KA 1MFZA 2XYRA 1Q7RA 3OIWA 2GZRA 4GOJA 4KB5A 2RD2A 3QI7A 1Q92A 2AOUB 2C5GA 1G7CA 2HPVA 1LS1A 3I9LA 3IQHX 3P0HA 5A3RA 5IZCC 3I61A 1A2BA 2EARA 2R7MA 2WA1A 3BJMA 3I37X 5EGNA 3H18A 3QKRB 5JS2A 4CEJA 1AOXA 2BFEB 2X1LA 2H06A 5CLGA 3RLIA 3RBAA 3OQ1A 4Q4JB 1YB4A 1JLLB 4M22A 1CEYA 2CMDA 1UWVA 3EQ9A 2HDHA 3PXBA 1A04A 1JEQA 2BUCA 2FPPB 5BN5B 4E09A 1NBME 3AH8A 5CB4F 1NUPA 1QV9A 3GGPA 4OJYA 3TXYA 1CB7A 1VIYA 4LTNA 3BK1A 5DW0A 3SPXA 5AVZA 1NP3A 3SQMA 4BMCA 2IYAA 4ZZ2A 2EWVA 3WWCA 4OBXA 3RPEA 5FD8A 2G0NA 2ZBQA 4B6GA 5KQMA 3CO0S 3H9CA 2A9OA 3PYMA 4TXHA 3UMSA 2NV6A 3V4FA 3C3EA 3L18A 2LXNA 2OZLB 2P9YA 3NLLA 2YVQA 5CD1A 1GEGA 2Y6VA 1EINA 1LC3A 4LBZA 1EM8B 5LMNB 1N7GA 4O2LA 1A98A 3OTIA 5CNIA 5DF1A 3KSRA 1R64A 5EQTA 5THQA 3SZMA 2FKAA 3W5VA 5BW4A 1P6QA 1AX9A 1SMKA 4PR3A 1SCAA 4BE4A 4L08A 4BCCA 3HB5X 1T5OA 2UYQA 3IXMA 5AHWA 5JSHA 3COWA 3SFTA 4DDMA 5IF9A 1EAYA 1DP4A 1RYFA 1UADA 2Y9MB 4HNQA 4G41A 4MQUA 4HDCA 5T3YA 4AKTA 5BVHB 4DIMA 3K16A 1TQ4A 2QLJA 3U7GA 4WZ6A 4X1IB 4NBWA 3RC7A 3QWAA 3A06A 3CLUD 3FVVA 5HZKA 1Q0HA 5LP6F 1LBIA 4KU4A 4GBJA 4WBXC 2CJFA 4NBVA 3GUVA 3B70A 1XMVA 2QN3A 3T41A 1QH1A 4M7RA 1SA0B 2FRDC 2RDMA 3ZIDA 2JK1A 4AL4A 4E12A 4I7EA 5JH7B 4Y9UA 4JR0A 4J49A 2O19A 1PE0A 2LDXA 3ID6C 4OHZA 3ZVKA 4IW3B 4NKRA 2IV7A 2IZ6A 2WIAA 3DCIA 4KVAA 2HA7A 1RLUA 2XPCA 4TLLB 5HRUA 2YQ5A 4AX8A 4EECA 3JQAB 4W8GA 5F7ZA 1FSZA 2QPLA 4OHKA 4B75A 4NYIQ 1M34E 1OD6A 3UAGA 2QIOA 3OPYI 2GCIA 3DFFA 2RARA 2ZROA 2PRJA 5LJLA 2O8FA 1WCXA 3CRQA 4M46A 4MROA 3MTIA 1L5HB 3BSFA 3CRMA 1O77A 3EYWA 2QRNA 3FLMA 3GFSA 3IT1A 2E21A 1U2RA 4RY9A 2XVAA 4CFZA 1WUIS 4ZU6X 1UC5B 2JGAA 4B76A 3V1YA 2AK3A 4GKVA 4O4IF 1X87A 1KWGA 1T36B 4HY3A 1ODSA 5FFNA 2GM4A 3RG8A 5KWJA 1AKQA 3HJBA 3W9UA 2NXNA 3NQ41 4OKSA 3U7JA 1DRJA 1JQKA 3FWPA 4A0QA 3RS8A 5ADWA 2BEWB 2W2VA 1OSNA 3HJGA 3P2KA 4MYDA 3PDCA 4O2BF 4QLAA 3VVCA 3VO8A 4AJLA 4N9QA 4HXYA 2D5IA 2VYQA 3MT0A 1MT3A 4ZEOA 2CB9A 2DB3A 1VIAA 4NE9A 3UH1A 3ZCQA 3QX8A 5HIIA 2RGEA 3IV7A 1M8PA 4JOSA 4TXMA 3VO2A 5K4AA 1RP7A 2I4LA 4FR5A 4TMXA 4U9HS 4YFVA 5AI9A 4BNMA 1EDZA 2MR5A 2YHIA 1KYQA 2H8KA 4HFJA 5CXSA 2CL6X 2G88A 1N2BA 3PDUA 1E4EB 3OPXA 5J63A 2PGXA 1NY6A 3AR5A 4F84A 3ROTA 3WL8A 2HA2A 2FV8A 4A8JC 4J0DA 2QTVA 3W3AD 1E3JA 3G9TA 2ZTSA 4URFA 2CXSA 2Z6VA 5ICMA 3CG4A 2AJCA 2Q8NA 1BRMA 2ZITA 3K09C 3PU6A 3Q8WA 3A1NA 4R9SA 3UK0A 3L0PA 4R0MA 1QQBA 1HL7A 2BM8A 4LHSA 2BT4A 4YQEA 1K63A 1X86B 2C5FA 3NC1C 4DMHA 4ESOA 3HE3A 1Y5MA 3OZCA 4M9UA 2X0EA 3ENWA 4BZXA 4C7MA 2PR2A 1RJ9B 2AC4A 3RRZA 2O9JA 1G0OA 2B4KA 5EI5A 3R3JA 1DAHA 3QMMA 4RM3A 5KWVA 1DWQA 1UBUS 3N6XA 2CLCX 2B2CA 3EZLA 4HVAA 3STTA 1KK3A 4DOMA 1EFAA 1EX1A 3PP8A 2I1VB 1ZESA 3Q7IA 1W29A 2C58A 1K2VN 2XB6A 3AJ8A 1OA0A 1X8KA 1C3VA 3RIEA 1AVTA 2UYYA 5TGDA 4YXFA 5C53B 2NMVA 1CUJA 4RF4A 4D79A 3K70C 1KXJA 1SCUB 3FJ1A 1R4ZA 5KSZA 2YNMA 3H1GA 3JQ8A 2R60A 5GOTA 1K6EA 3NALA 4MYCA 2FFHA 3RVNA 1Z4LA 2D59A 3DEAA 5FUVA 1XXHE 1MEOA 1H4SA 2YYYA 1LDYA 1C30A 3VR5D 4O0MA 3H5LA 5AJXA 2CNNA 4IJKA 5HQTA 3RVRA 3VKUA 2D5BA 2W71A 1VKHA 1GGMA 3HRKA 2OBFA 4JUBA 1YBHA 4B1FA 4L16A 3F90A 3VA7A 3HKEB 1QE3A 1UWLA 2ZAMA 3A31A 2QE7D 2VNIA 3I0MA 4ZN6A 2A86A 2P2GA 2IOFK 5F3WB 3JRNA 1M74A 4DZZA 1AG9A 4EITA 1CNFA 4IXWA 4JFAA 4L4XA 3SSOA 2VDKB 3GJRA 5TEWA 2VDNB 3KX2A 4KYIB 5L4LA 3BD9A 4XQ9A 3UUWA 2QK4A 5EMJA 2YWGA 2VAPA 4G63A 4WLNA 5EMMA 3ZGLA 5HFJA 2NO1A 1G5HA 3W79A 5CB8A 1VDMA 2AE2A 3LI2A 1Y7HA 3O8QB 3KO8A 2JLQA 5GY7A 1B3BA 4CNQA 1XMJA 2KM1A 5CYOA 3PXUA 3BHMA 4PX5A 1PYGA 2ZIFA 4WOJA 4XM2A 1ORIA 3AZOA 4BTEA 2XECA 4C43A 4RA9B 3HJNA 3WFZA 2GVDC 4DY6A 1J0EA 2ETVA 5CNJA 3N0VA 2DFPA 3FTPA 3GFQA 1IN4A 1BS9A 4PINA 4Y2YA 2HSDA 5AI0A 1XA3A 4QXOA 2IV2X 5JWRA 1OXKB 1D8TA 3GT7A 5EKUA 4URVR 4E2XA 4LX0A 1YFKA 1PZFA 2ONKA 2DOKA 3QK7A 4KGDA 3C5VA 4RVFA 1P29A 1QK5A 3Q2KA 1ZMBA 3EDRA 4DVGA 4EMTA 3DDNA 3UJ9A 1TYAE 1YCGA 4DILA 3U44A 5DXFA 1ECBA 1VYHA 1HXHA 2NVUA 4MI1A 5ALLA 4F3YA 1S3GA 4O4IB 3JQGB 3GWGA 3A6LA 2GPWA 4DLPA 2YFHA 4YVFA 3ER9A 4GIBA 4B09A 1PUJA 4BNTA 5IVKA 2XXAA 3UMCA 1P75A 2GN6A 4OKIA 3IJ5A 2HJRA 3LW8A 4OSOA 2P5TB 3WG9A 1FFWA 1LJLA 3LBHA 4YLEA 2XBUA 4B3DA 2P77A 1WQ3A 1QZZA 2Q4RA 1KMHB 5BQXA 4I5IA 4I14A 2VF7A 5CK5A 3ZVLA 4DR6B 4UBJA 1RI1A 4G5SA 1S02A 4JQYA 4LJ4A 4BZPA 4IG4A 1YZTA 3E9YA 3N3AC 3OQHA 1P4GA 5KYXB 3QQPA 1M7BA 4AKSA 2YBEA 1SXJE 3V2UA 4DUZB 2OZEA 3GEIA 1QWOA 1ZI6A 2HAEA 2BSQA 1NRIA 4X3OA 2RHRA 1E1NA 1I2CA 4O2AF 1O94A 1O96B 4WUTA 3WKDA 1YXMA 1C5KA 1D6NA 2FPPA 4HYQA 5BN5A 5C8DA 1UP7A 1XPRA 2FF7A 4OQDA 2XB9A 3ZY6A 4OAOA 2JCYA 1EGHA 3T12A 3QRWA 4KEAA 2OUKA 2YWJA 1GZ4A 1M33A 1ULSA 1U7TA 3PUXA 1NW9B 1Z62A 1MJNA 3CINA 3K0HA 3R6GA 1X7HA 3DBLA 3WZ2A 4QM7A 1QRAA 4WMLA 1YF3A 2XI4A 1OX6A 1BOFA 3ETNA 1MOSA 1NAHA 1J99A 1OXXK 3DFKA 4PLZA 5GJVC 5IHXA 1DXHA 2JI9A 1XVLA 1ZNYA 2ORVA 3G8YA 3O95A 4YRRA 5K99A 1AZSC 2B7BA 4P92A 2XA1A 1F7UA 5IARA 4NYMR 2VF4X 4NOMA 3TMAA 4EHLA 1JFVA 3UW1A 5L3QB 3L4EA 4V03A 1EVKA 2F59A 1I9CA 3LSYA 4MX8A 4W1QA 1QMPA 4RFSA 5K0TA 2ZIAA 1C0IA 4FYXA 1A9XA 2J85A 3QENA 2WU3A 3P5SA 2W93A 3HCNA 1XYVA 2J6CA 2I6XA 3IAEA 2EZTA 1ECPA 2HF7A 3FFTA 3R5XA 1QNLA 2PMDA 3OAAA 1ZW6A 4MMZB 1CULC 4RD1A 4D4IA 4MIEA 4WGGA 1C41A 2Q8PA 3P4XA 2D1FA 5IKXA 1LJUA 1SXJB 3LT1A 3ZS9A 2JIMA 1YS9A 2I2CA 3NT4A 1E2IA 2A0WA 5IS2A 1J00A 2KW5A 4FOLA 4YRFA 3V8MA 3OURA 3ZGOA 1IPFA 5CCDA 3TI9A 2HD4A 2CV2A 4M36A 1DRUA 4PBRA 3QU7A 1XTJA 1PT7A 1E5TA 1H2EA 1V4BA 3TNLA 1PAUA 1UUFA 1NRWA 1UM8A 1XZBA 2ID8A 3CVJA 3GCZA 4M49A 4ZVSA 1YVRA 3H4MA 3OA2A 3OM0A 4DYHA 2R1VA 3G1WA 1MRZA 2XE6A 5K0FA 4TYMA 3I8XA 4IRMA 3CVUA 2XRMA 3HACA 4IKPA 1MV5A 2EG5A 4NEHB 2QUAA 5ECGC 2PR7A 3TYXA 3DZFA 1S8AA 2C99A 1MPXA 3GARA 1QQTA 1NOIA 5E4TA 1JYEA 4UTXA 3WLPA 4CCWA 4GKKB 3HMKA 3HNPA 4W4TA 5AFSA 4Y98A 3KEQA 2QLTA 4R54A 1C1DA 1M6VA 5HX7A 2DPYA 3CONA 5DSTA 3ZCTA 1A1VA 4R8VA 5BN3A 4RFLA 3ESZA 2XB8A 1ZW1A 3TIXB 3G0IA 3IP5A 4LF7B 4HKTA 3HB4X 5I7VA 1VJ0A 1JFFA 3DCNA 5EJMA 3DEYX 2NTYC 1EFLA 4IIJA 2V7BA 1FJGB 2UXDB 2MSKA 1CLEA 1VPDA 4QPDA 2ET6A 3O31A 1R12A 4PAWA 3TBFA 5AW2A 1K6IA 2Y0BA 2OBLA 5EZSA 2YXDA 3HPQA 4MWTA 3UVEA 1WW3A 2RG7A 2GN2A 3R74A 3L4JA 3OICA 1IMOA 3I4CA 1IZYA 2NAFA 3LRTA 1DJNA 1E2JA 4ZO8A 4CM5A 5A1TA 1HDCA 3CZMA 2P1ZA 4M7OA 2X9NA 3EY4A 3DYIA 1MT0A 2P9EA 3JARB 4PZLA 3OE7D 1KI3A 3X2EA 5GPBA 2O1WA 1RIIA 3CVOA 1R0RE 4D8TA 2ODBA 4AMGA 2UXCB 2JVIA 3H0EA 1YC2A 2H1VA 2ZUDA 3C3XA 2G28A 2OFPA 1KBQA 2AS0A 5I45A 5EPUA 2QTVB 3T38A 4PX2A 3TAHA 3HCOA 1NMYA 1LBTA 1QP8A 4MZXA 3QHPA 1IAVA 4HBGA 4LG1A 3BZUA 1QDEA 5K03A 2K4MA 5LQUA 2JD1A 5FLXA 1Y4DE 3A1WA 4JBLA 1NW6A 4LE2A 1P5JA 5C18A 1GL9B 1O1YA 2I2BA 3X1ZA 2Z30A 1JVNA 1TRHA 2WUWE 3LHFA 1PBNA 1QAOA 3OETA 4ZOCA 1PQWA 1G55A 5EIHA 1N5JA 2FZLA 3CXUA 4LUCA 3G0HA 1Z8HA 2QEQA 4AF7A 1C7RA 1PL7A 2HRBA 5IVIA 1WXIA 2FSHA 4JQZA 5BMVA 2Z08A 3GFTA 3V32A 1JI3A 3ANYB 2GXSA 3KK0A 3MMXA 2H4YA 1Y82A 3G8CA 3GJSA 3PKIA 5GV7A 3BHJA 5CX4A 3RBXA 1F2VA 2WJ3A 3JZFA 3ZGYA 3LY5A 1ISMA 4CUZA 2ZTLA 1KP2A 3D6MA 3L1KA 3WOHA 4GMGA 1H4QA 4GSYA 1HURA 1ZH4A 5C8YA 1XA0A 3PFKA 2BUAA 2EIXA 3P9NA 3E22A 4S2EA 3AQIA 1UMDA 1YKSA 4IV0A 5KTSA 5E7IA 2FUCA 3GZJA 1YJAA 1Z82A 2VDPB 3OUZA 4U8HA 5CX1B 4BNZA 3LGSA 5K3BA 4MUBA 1R88A 1NZJA 2ZT8A 3PNPA 2J9RA 4TLCA 2AKAB 3K1YA 4WN9A 5C7YA 4AKGA 3U4DA 1J5XA 1W88A 3NUGA 4K05A 1V26A 1G6HA 1TAGA 1PD1A 4DNXA 1DC4A 1JMYA 2BTEA 4B3GA 2QWXA 4DMFA 3F3MA 4ZVRA 1THMA 5A4IS 1KK2A 5A7HA 5AW0A 3BCHA 3UN1A 2SNIE 3N86A 1BA2A 5LXTF 3AHFA 2OAGA 4QYIA 4EY3A 2IOYA 3OFVA 3T3PB 4PF1A 4K2AA 1II0A 1WE2A 2CUZA 2Y05A 1FDSA 1P61B 5IBQA 5HEKA 4D1YA 5HQ3B 1RRCA 2ECFA 5H3CA 2F6RA 1NR7A 2ZB2A 5FOUA 2OO3A 1DQNA 1FP1D 2FG7C 3L1JA 4ME6A 4KGVA 3VDXA 3V8VA 4HR7A 1U7HA 2D3WA 3V7NA 4LSGA 3AEYA 3L7OA 4M0UA 2Q4DA 5FI5A 4R2HA 1WV1A 4BNIA 3ZDYB 2ZAGA 3BFVA 1JIVA 3KOYA 4F96A 4MUHA 5KSWB 3TQTA 2PAAA 1QTQA 1AM4D 1ILEA 1FVFA 2EFCB 3F0TA 1OVMA 1TQ8A 1A5TA 3ETEA 1KQNA 3EXHA 4J0HA 1IAQA 1K3UB 1PZHA 4KG7A 4PE5B 3RS9A 2SBTA 4YAJA 3MCTA 1KJYA 4DLZA 1W4LA 3IA7A 1GSIA 2QTMA 4IDAA 2TMYA 3I9KA 2XDQA 3O6VA 1TKRA 2P0YA 4G2TA 4UXIA 1L7DA 1U1EA 3SKXA 4C4YA 1VIDA 1Y9AA 4QULA 3B9PA 1UODA 3OJOA 4F6RA 4ENVA 3FPHA 3OKAA 4XB2A 1UBGA 5JMPA 3OHMA 2AX4A 4HDRA 5H3LA 5BPHA 2M1XA 1WUJS 4OXIA 2VSFA 4II2A 4EL0A </