3KJJA

Crystal structure of nmb1025, a member of yjgf protein family, from neisseria meningitidis (hexagonal crystal form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
HMDIRYFGTTPRYSEAVGANGLIFLSGMVPENGETAAEQTADVLAQIDRWLAECGSDKAHVLDAVIYLRDMGDYAEMNGVWDAWVAAGRTPARACVEARLARPEWRVEIKITAVKRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NMB1025 protein
publication title Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Unknown function
total genus 31
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3kjjA00
2CSLA 2CVLA 2EWCA 3K0TA 5HP8A 3V4DA 3VCZA 3QUWA 3L7QA 4ZK7A 3ZOPA 3KJJA 1NQ3A 3KJKA 2CHSA 3ZP4A 1UFYA 1FNJA 2UYNA 3ZP7A 2CHTA 3K12A 1DBFA 2UYPA 3R0PA 1QAHA 3LMEA 3MQWA 2CW4A 4NWOB 2UYKA 3I7TA 1COMA 1QD9A 1XHOA 3LYBA 2OTMA 5HP7A 1JD1A 1ODEA 2IG8A 2UYNB 3GTZA 3M1XA 1UI9A 1PF5A 1J7HA 1XRGA 1ONIA 2CWJA 2DYYA 2UYJA 3ZO8A 1FNKA 1X25A 3M4SA 3I3FA 3D01A 1QU9A 2B33A
chains in the Genus database with same CATH superfamily
4YJ3B 2GLZA 3JATB 1NJIH 1H47A 5IJ0B 4X3MA 4X3LA 1TUBB 4C82A 5LP6C 3CPQA 1CK2A 4DXDA 2MQEA 2HVYD 2V9YA 3HKBB 3GHZA 2ALEA 1YIJF 3NMUC 2QEXF 5EYPB 3I7TA 4XCQA 2FC3A 4ZHQB 4G4XA 1JN1A 2ZODA 2PHNA 3ESJA 2YXZA 1T0AA 4BT5A 4RQOA 4ERHA 4F6RB 4YJ2B 4U3JA 3WJPA 1KC8H 2VAMA 3C9TA 3SIUA 2OHWA 4C8EA 3VCZA 1SA0B 3RYHB 1IV4A 3I56F 3CCUF 4U39A 4IIJB 2UYNA 4EI7A 5ITZB 2YYEA 1VQ8F 2ZOVA 4NWOB 3WGJA 4ZI7A 3FPIA 3KIZA 1W581 3HAXD 3NK7A 5LXTA 4YJ3A 3WGMA 1W5AA 3JATA 5G4UC 3N2GA 1RQ7A 3M1XA 4FFBB 1TUBA 1UI9A 3CCRF 4I4TB 3M4SA 3MBMA 3HKBA 2CSLA 2EWCA 3VTIC 3E22B 4B62A 4O2BA 3L7QA 4ZHQA 4BT7A 2HQSC 3PLAC 3HKEA 3HKCA 4I55B 2N48A 3IEQA 5EB0A 1U43A 1E7KA 2KGWA 3E1YA 3WGNA 4YJ2A 4WBNA 3N2KA 1M1KH 1VQMF 1QD9A 1YJNF 1QVFF 3NVKE 4IHJB 3FBAA 1PF5A 1SA0A 1W5EA 4O4JB 1W59A 4O2AA 3RYHA 2CZWA 1W2BF 4X1YB 1FFXB 1VHAA 1IPAA 5ITZA 3ERNA 3V4DA 3N4YA 2H6LA 3V7QA 3MDOA 4EB6B 1GZ0A 1FNJA 4FFBA 3CCJF 4X1IB 1OFUA 1VH8A 3GYQA 3LDTA 5IYZB 2VGNA 3E22A 4G4YA 5B8FA 3J81M 4O4HA 5JCOC 5JVDA 1N8RH 5J2UB 4BT3A 3WJQA 4X1KB 5MN4A 1JJ2F 1QVGF 3S0HA 3D01A 3PAFA 3WXMB 1M90H 3JALA 3T80A 3LWVC 1VQ4F 3MCQA 4ZOLA 4IHJA 1XBIA 3C8LA 2RHOA 5JH7B 3FD5A 4O4JA 5EB1B 3RYIB 4X1YA 1FFXA 2DT4A 3LWQC 3B6NA 4BT4A 3JVHA 1W42A 4ZHYB 5J2TB 1W5BA 3CXCF 2HRYA 3Q8HA 2DYYA 1W40A 5EWRA 4EB6A 2IAFA 4TV9A 4X1IA 5CA0B 5A2QM 3M84A 3TD4A 1YQNA 2RHLA 4TV8B 3LFOA 1X7OA 3JCMM 3ZOPA 4BVQA 3VIUA 1S72F 4NQ3A 1K73H 5HY1A 4PWTA 1TVKB 2ZVZA 3RYCB 5GINC 4X1KA 4G4VA 5LYJB 1XV2A 1NMUB 1U3PA 4BVSA 3KHNA 3E20B 1W5FA 3ZO8A 1ZWZA 4C8IA 3RYFA 2R6R1 1OAPA 2OTLF 2CVLA 1X52A 1U3LA 2KG4A 4B5CA 3RYIA 5FNVA 2VXYA 2AIFA 2RB9A 1KNJA 3KJKA 5HY4A 5KMGB 3NVIB 4HNAA 5C8YB 3IMPA 3CCQF 4EI8A 3CYQA 3MQWA 3CC7F 1JFFA 3VYUC 5CA0A 5MN6A 1YGYA 2JNBA 5CB4B 2HRUA 4TV8A 2K1SA 3WPXA 5IJ0A 5IT9M 2LCAA 3TD3A 3VOBA 5GAPK 5KX5B 3CMAF 2HS0A 3RYCA 1TVKA 4KWEA 3IR9A 5LA6B 1K8AH 2HS4A 3DDNA 4I50B 3CCSF 1H48A 5EYPA 3HTNA 5LYJA 5GIPC 5EZYB 4EI9A 4O4LB 4BVRA 1VQLF 3CB2A 1KQSF 3JAMM 1KNKA 3UT5B 1Q81H 3LWRC 3VO8A 5EAZA 4F6RA 2G9IA 3KE1A 5HY0A 3CG6A 4C81A 3S0YA 3S02A 4TUYB 1ODEA 3VYTC 3LWPC 2R751 3FD6A 3QTYA 5KMGA 5C8YA 4BT6A 3LYBA 4DRXB 3JAKB 4IIJA 2Z1UA 1X7PA 3TD5A 5JQGB 3K0TA 3K14A 2HP0B 1IV3A 2WALA 4LNUB 3VYSC 3JASB 3N4ZA 4ZK7A 1VQVA 3G4SF 3G71F 3WJRA 5CB4A 1KD1H 2Z1TA 3V7EA 3LMEA 4I4TA 4M8IA 3WPWA 5LOVB 1XHOA 1GO1A 2BO1A 5LA6A 1CLIA 3V3TA 4I50A 2ZVYA 1FNKA 5HWEA 1Q7YH 2I6DA 5FLXM 4I55A 2B33A 3JARB 4G4ZA 3VOAA 3UT5A 5HP8A 3EORA 1PXWA 2FGYA 3RA5A 1VQ6F 1UFYA 2LBTA 2HX0A 1DT9A 2RHJA 4O4IB 3D00A 3LWOC 3OW2F 4LCKA 3HKDB 1Z5VA 1YJ9F 2OTMA 2H8CA 2L26A 3CC2F 1W41A 3F0EA 1GX1A 4LNUA 2UYJA 3OBWA 1X25A 5G4VC 3QHDA 1Q86H 1W3EX 1H7MA 5LOVA 1VQ7F 2QA4F 3RE3A 5IYZA 1NQ3A 4U3JB 5BMVB 5HXUA 3CMEF 1VK3A 2UYPA 3CCLF 5MN5A 3F6MA 5J2UA 1K9MH 1COMA 3G6EF 3C9UA 3JARA 2VAPA 5LP6B 2Z1FA 4RHAA 3VMFB 1YITF 1T0KB 5IJ9B 5DCVA 2KTUA 1VQOF 1VQ5F 1YHQF 4BVTA 2QI2A 5EIBD 4O4IA 2LBWA 2IQQA 5LXTB 4R40B 3SIVA 1U40A 4ZHVA 3N2GB 5JH7A 3OONA 2GZLA 3HKDA 2VGMA 2QTPA 3QUWA 1VQ9F 3KJJA 3NK6A 1IV1A 3CCVF 5J2TA 3P10A 2ZAUA 3CCMF 3IKEA 4O2BB 3BYQA 2ZF8A 3HKEB 3HKCB 5HP7A 3CCEF 3FFMA 2Z1EA 3P4EA 3CPWF 3CD6F 1VQNF 4WBNB 3N2KB 5BMVA 5FJ4C 3F0DA 3K2XA 4C4WC 1GO0A 3O85A 2Q1XA 2VAWA 3F0GA 4O2AB 5GANK 4BW0B 3WGKA 1RA4A 3DC2A 5LP6A 2LBXA 5IJ9A 2OZBA 5HXZA 2HP3A 3R0PA 2KTVA 1JY8A 5HY2A 1Q82H 1IV2A 1JD1A 2AMTA 1W57A 1YI2F 3AGKA 3JAWB 3D54A 4G4WA 1Q8RA 3VI6A 4O4HB 2UZHA 4X20B 3HWUA 5GONB 5JVDB 2AIZP 3OBYA 3U0OA 2GVIA 3WGLA 1SDSA 5CA1B 3ZP7A 4E6EA 3JALB 3RA6A 1QAHA 2BTOA 3IKFA 3S03A 4ZOLB 5KX5A 1W55A 1J7HA 1ONIA 4B45A 5EIBC 3J7AR 4C8GA 4BY9D 2P6YA 3F0FA 5EZYA 4O4LA 2OTJF 4B46A 1VQPF 1R1MA 4NUTA 2RHHA 1SZQA 3MCAB 3C9SA 2I6RA 2CHSA 3ZP4A 4TV9B 2NMUA 4TUYA 4TZZA 1DBFA 3JAWA 2CW4A 3CYPB 2W8BC 3J80M 2PMPA 3ON1A 4DRXA 3P0ZA 3JAKA 5EO3A 5JQGA 2IG8A 4X20A 5GONA 4BT2A 3ELCA 2HP0A 3IEWA 3JASA 4G88A 3I3FA 5CA1A 1FSZA 1RLGA 3I55F 1VQKF 2F9ZC 3CC4F 3RYFB 1RLUA 2Q1YA 2CHTA 3K12A 5AVMA 1CN7A 5FNVB 3HJWC 2UYKA 1Z5WA 1RQ2A 3S0WA 4HNAB 2HS3A 5GIOC 3GTZA 2UYNB 1YJWF 2Z01A 1XRGA 3C9RA 5JCOA 2BTUA 2CWJA 4ZHWA 3S06A 4ZI7B 1JFFB 1QU9A 2BTQB 2H8EA
chains in the Genus database with same CATH topology
2CSLA 2CVLA 2EWCA 3K0TA 5HP8A 3V4DA 3VCZA 3QUWA 3L7QA 4ZK7A 3ZOPA 3KJJA 1NQ3A 3KJKA 2CHSA 3ZP4A 1UFYA 1FNJA 2UYNA 3ZP7A 2CHTA 3K12A 1DBFA 2UYPA 3R0PA 1QAHA 3LMEA 3MQWA 2CW4A 4NWOB 2UYKA 3I7TA 1COMA 1QD9A 1XHOA 3LYBA 2OTMA 5HP7A 1JD1A 1ODEA 2IG8A 2UYNB 3GTZA 3M1XA 1UI9A 1PF5A 1J7HA 1XRGA 1ONIA 2CWJA 2DYYA 2UYJA 3ZO8A 1FNKA 1X25A 3M4SA 3I3FA 3D01A 1QU9A 2B33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSL A;  2CVL A;  2EWC A;  3K0T A;  5HP8 A;  3V4D A;  3VCZ A;  3QUW A;  3L7Q A;  4ZK7 A;  3ZOP A;  3KJJ A;  1NQ3 A;  3KJK A;  2CHS A;  3ZP4 A;  1UFY A;  1FNJ A;  2UYN A;  3ZP7 A;  2CHT A;  3K12 A;  1DBF A;  2UYP A;  3R0P A;  1QAH A;  3LME A;  3MQW A;  2CW4 A;  4NWO B;  2UYK A;  3I7T A;  1COM A;  1QD9 A;  1XHO A;  3LYB A;  2OTM A;  5HP7 A;  1JD1 A;  1ODE A;  2IG8 A;  2UYN B;  3GTZ A;  3M1X A;  1UI9 A;  1PF5 A;  1J7H A;  1XRG A;  1ONI A;  2CWJ A;  2DYY A;  2UYJ A;  3ZO8 A;  1FNK A;  1X25 A;  3M4S A;  3I3F A;  3D01 A;  1QU9 A;  2B33 A; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  2GLZ A;  3JAT B;  1NJI H;  1H47 A;  5IJ0 B;  4X3M A;  4X3L A;  1TUB B;  4C82 A;  5LP6 C;  3CPQ A;  1CK2 A;  4DXD A;  2MQE A;  2HVY D;  2V9Y A;  3HKB B;  3GHZ A;  2ALE A;  1YIJ F;  3NMU C;  2QEX F;  5EYP B;  3I7T A;  4XCQ A;  2FC3 A;  4ZHQ B;  4G4X A;  1JN1 A;  2ZOD A;  2PHN A;  3ESJ A;  2YXZ A;  1T0A A;  4BT5 A;  4RQO A;  4ERH A;  4F6R B;  4YJ2 B;  4U3J A;  3WJP A;  1KC8 H;  2VAM A;  3C9T A;  3SIU A;  2OHW A;  4C8E A;  3VCZ A;  1SA0 B;  3RYH B;  1IV4 A;  3I56 F;  3CCU F;  4U39 A;  4IIJ B;  2UYN A;  4EI7 A;  5ITZ B;  2YYE A;  1VQ8 F;  2ZOV A;  4NWO B;  3WGJ A;  4ZI7 A;  3FPI A;  3KIZ A;  1W58 1;  3HAX D;  3NK7 A;  5LXT A;  4YJ3 A;  3WGM A;  1W5A A;  3JAT A;  5G4U C;  3N2G A;  1RQ7 A;  3M1X A;  4FFB B;  1TUB A;  1UI9 A;  3CCR F;  4I4T B;  3M4S A;  3MBM A;  3HKB A;  2CSL A;  2EWC A;  3VTI C;  3E22 B;  4B62 A;  4O2B A;  3L7Q A;  4ZHQ A;  4BT7 A;  2HQS C;  3PLA C;  3HKE A;  3HKC A;  4I55 B;  2N48 A;  3IEQ A;  5EB0 A;  1U43 A;  1E7K A;  2KGW A;  3E1Y A;  3WGN A;  4YJ2 A;  4WBN A;  3N2K A;  1M1K H;  1VQM F;  1QD9 A;  1YJN F;  1QVF F;  3NVK E;  4IHJ B;  3FBA A;  1PF5 A;  1SA0 A;  1W5E A;  4O4J B;  1W59 A;  4O2A A;  3RYH A;  2CZW A;  1W2B F;  4X1Y B;  1FFX B;  1VHA A;  1IPA A;  5ITZ A;  3ERN A;  3V4D A;  3N4Y A;  2H6L A;  3V7Q A;  3MDO A;  4EB6 B;  1GZ0 A;  1FNJ A;  4FFB A;  3CCJ F;  4X1I B;  1OFU A;  1VH8 A;  3GYQ A;  3LDT A;  5IYZ B;  2VGN A;  3E22 A;  4G4Y A;  5B8F A;  3J81 M;  4O4H A;  5JCO C;  5JVD A;  1N8R H;  5J2U B;  4BT3 A;  3WJQ A;  4X1K B;  5MN4 A;  1JJ2 F;  1QVG F;  3S0H A;  3D01 A;  3PAF A;  3WXM B;  1M90 H;  3JAL A;  3T80 A;  3LWV C;  1VQ4 F;  3MCQ A;  4ZOL A;  4IHJ A;  1XBI A;  3C8L A;  2RHO A;  5JH7 B;  3FD5 A;  4O4J A;  5EB1 B;  3RYI B;  4X1Y A;  1FFX A;  2DT4 A;  3LWQ C;  3B6N A;  4BT4 A;  3JVH A;  1W42 A;  4ZHY B;  5J2T B;  1W5B A;  3CXC F;  2HRY A;  3Q8H A;  2DYY A;  1W40 A;  5EWR A;  4EB6 A;  2IAF A;  4TV9 A;  4X1I A;  5CA0 B;  5A2Q M;  3M84 A;  3TD4 A;  1YQN A;  2RHL A;  4TV8 B;  3LFO A;  1X7O A;  3JCM M;  3ZOP A;  4BVQ A;  3VIU A;  1S72 F;  4NQ3 A;  1K73 H;  5HY1 A;  4PWT A;  1TVK B;  2ZVZ A;  3RYC B;  5GIN C;  4X1K A;  4G4V A;  5LYJ B;  1XV2 A;  1NMU B;  1U3P A;  4BVS A;  3KHN A;  3E20 B;  1W5F A;  3ZO8 A;  1ZWZ A;  4C8I A;  3RYF A;  2R6R 1;  1OAP A;  2OTL F;  2CVL A;  1X52 A;  1U3L A;  2KG4 A;  4B5C A;  3RYI A;  5FNV A;  2VXY A;  2AIF A;  2RB9 A;  1KNJ A;  3KJK A;  5HY4 A;  5KMG B;  3NVI B;  4HNA A;  5C8Y B;  3IMP A;  3CCQ F;  4EI8 A;  3CYQ A;  3MQW A;  3CC7 F;  1JFF A;  3VYU C;  5CA0 A;  5MN6 A;  1YGY A;  2JNB A;  5CB4 B;  2HRU A;  4TV8 A;  2K1S A;  3WPX A;  5IJ0 A;  5IT9 M;  2LCA A;  3TD3 A;  3VOB A;  5GAP K;  5KX5 B;  3CMA F;  2HS0 A;  3RYC A;  1TVK A;  4KWE A;  3IR9 A;  5LA6 B;  1K8A H;  2HS4 A;  3DDN A;  4I50 B;  3CCS F;  1H48 A;  5EYP A;  3HTN A;  5LYJ A;  5GIP C;  5EZY B;  4EI9 A;  4O4L B;  4BVR A;  1VQL F;  3CB2 A;  1KQS F;  3JAM M;  1KNK A;  3UT5 B;  1Q81 H;  3LWR C;  3VO8 A;  5EAZ A;  4F6R A;  2G9I A;  3KE1 A;  5HY0 A;  3CG6 A;  4C81 A;  3S0Y A;  3S02 A;  4TUY B;  1ODE A;  3VYT C;  3LWP C;  2R75 1;  3FD6 A;  3QTY A;  5KMG A;  5C8Y A;  4BT6 A;  3LYB A;  4DRX B;  3JAK B;  4IIJ A;  2Z1U A;  1X7P A;  3TD5 A;  5JQG B;  3K0T A;  3K14 A;  2HP0 B;  1IV3 A;  2WAL A;  4LNU B;  3VYS C;  3JAS B;  3N4Z A;  4ZK7 A;  1VQV A;  3G4S F;  3G71 F;  3WJR A;  5CB4 A;  1KD1 H;  2Z1T A;  3V7E A;  3LME A;  4I4T A;  4M8I A;  3WPW A;  5LOV B;  1XHO A;  1GO1 A;  2BO1 A;  5LA6 A;  1CLI A;  3V3T A;  4I50 A;  2ZVY A;  1FNK A;  5HWE A;  1Q7Y H;  2I6D A;  5FLX M;  4I55 A;  2B33 A;  3JAR B;  4G4Z A;  3VOA A;  3UT5 A;  5HP8 A;  3EOR A;  1PXW A;  2FGY A;  3RA5 A;  1VQ6 F;  1UFY A;  2LBT A;  2HX0 A;  1DT9 A;  2RHJ A;  4O4I B;  3D00 A;  3LWO C;  3OW2 F;  4LCK A;  3HKD B;  1Z5V A;  1YJ9 F;  2OTM A;  2H8C A;  2L26 A;  3CC2 F;  1W41 A;  3F0E A;  1GX1 A;  4LNU A;  2UYJ A;  3OBW A;  1X25 A;  5G4V C;  3QHD A;  1Q86 H;  1W3E X;  1H7M A;  5LOV A;  1VQ7 F;  2QA4 F;  3RE3 A;  5IYZ A;  1NQ3 A;  4U3J B;  5BMV B;  5HXU A;  3CME F;  1VK3 A;  2UYP A;  3CCL F;  5MN5 A;  3F6M A;  5J2U A;  1K9M H;  1COM A;  3G6E F;  3C9U A;  3JAR A;  2VAP A;  5LP6 B;  2Z1F A;  4RHA A;  3VMF B;  1YIT F;  1T0K B;  5IJ9 B;  5DCV A;  2KTU A;  1VQO F;  1VQ5 F;  1YHQ F;  4BVT A;  2QI2 A;  5EIB D;  4O4I A;  2LBW A;  2IQQ A;  5LXT B;  4R40 B;  3SIV A;  1U40 A;  4ZHV A;  3N2G B;  5JH7 A;  3OON A;  2GZL A;  3HKD A;  2VGM A;  2QTP A;  3QUW A;  1VQ9 F;  3KJJ A;  3NK6 A;  1IV1 A;  3CCV F;  5J2T A;  3P10 A;  2ZAU A;  3CCM F;  3IKE A;  4O2B B;  3BYQ A;  2ZF8 A;  3HKE B;  3HKC B;  5HP7 A;  3CCE F;  3FFM A;  2Z1E A;  3P4E A;  3CPW F;  3CD6 F;  1VQN F;  4WBN B;  3N2K B;  5BMV A;  5FJ4 C;  3F0D A;  3K2X A;  4C4W C;  1GO0 A;  3O85 A;  2Q1X A;  2VAW A;  3F0G A;  4O2A B;  5GAN K;  4BW0 B;  3WGK A;  1RA4 A;  3DC2 A;  5LP6 A;  2LBX A;  5IJ9 A;  2OZB A;  5HXZ A;  2HP3 A;  3R0P A;  2KTV A;  1JY8 A;  5HY2 A;  1Q82 H;  1IV2 A;  1JD1 A;  2AMT A;  1W57 A;  1YI2 F;  3AGK A;  3JAW B;  3D54 A;  4G4W A;  1Q8R A;  3VI6 A;  4O4H B;  2UZH A;  4X20 B;  3HWU A;  5GON B;  5JVD B;  2AIZ P;  3OBY A;  3U0O A;  2GVI A;  3WGL A;  1SDS A;  5CA1 B;  3ZP7 A;  4E6E A;  3JAL B;  3RA6 A;  1QAH A;  2BTO A;  3IKF A;  3S03 A;  4ZOL B;  5KX5 A;  1W55 A;  1J7H A;  1ONI A;  4B45 A;  5EIB C;  3J7A R;  4C8G A;  4BY9 D;  2P6Y A;  3F0F A;  5EZY A;  4O4L A;  2OTJ F;  4B46 A;  1VQP F;  1R1M A;  4NUT A;  2RHH A;  1SZQ A;  3MCA B;  3C9S A;  2I6R A;  2CHS A;  3ZP4 A;  4TV9 B;  2NMU A;  4TUY A;  4TZZ A;  1DBF A;  3JAW A;  2CW4 A;  3CYP B;  2W8B C;  3J80 M;  2PMP A;  3ON1 A;  4DRX A;  3P0Z A;  3JAK A;  5EO3 A;  5JQG A;  2IG8 A;  4X20 A;  5GON A;  4BT2 A;  3ELC A;  2HP0 A;  3IEW A;  3JAS A;  4G88 A;  3I3F A;  5CA1 A;  1FSZ A;  1RLG A;  3I55 F;  1VQK F;  2F9Z C;  3CC4 F;  3RYF B;  1RLU A;  2Q1Y A;  2CHT A;  3K12 A;  5AVM A;  1CN7 A;  5FNV B;  3HJW C;  2UYK A;  1Z5W A;  1RQ2 A;  3S0W A;  4HNA B;  2HS3 A;  5GIO C;  3GTZ A;  2UYN B;  1YJW F;  2Z01 A;  1XRG A;  3C9R A;  5JCO A;  2BTU A;  2CWJ A;  4ZHW A;  3S06 A;  4ZI7 B;  1JFF B;  1QU9 A;  2BTQ B;  2H8E A; 
#chains in the Genus database with same CATH homology
 2CSL A;  2CVL A;  2EWC A;  3K0T A;  5HP8 A;  3V4D A;  3VCZ A;  3QUW A;  3L7Q A;  4ZK7 A;  3ZOP A;  3KJJ A;  1NQ3 A;  3KJK A;  2CHS A;  3ZP4 A;  1UFY A;  1FNJ A;  2UYN A;  3ZP7 A;  2CHT A;  3K12 A;  1DBF A;  2UYP A;  3R0P A;  1QAH A;  3LME A;  3MQW A;  2CW4 A;  4NWO B;  2UYK A;  3I7T A;  1COM A;  1QD9 A;  1XHO A;  3LYB A;  2OTM A;  5HP7 A;  1JD1 A;  1ODE A;  2IG8 A;  2UYN B;  3GTZ A;  3M1X A;  1UI9 A;  1PF5 A;  1J7H A;  1XRG A;  1ONI A;  2CWJ A;  2DYY A;  2UYJ A;  3ZO8 A;  1FNK A;  1X25 A;  3M4S A;  3I3F A;  3D01 A;  1QU9 A;  2B33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...