3KJJA

Crystal structure of nmb1025, a member of yjgf protein family, from neisseria meningitidis (hexagonal crystal form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
HMDIRYFGTTPRYSEAVGANGLIFLSGMVPENGETAAEQTADVLAQIDRWLAECGSDKAHVLDAVIYLRDMGDYAEMNGVWDAWVAAGRTPARACVEARLARPEWRVEIKITAVKRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Unknown function
molecule keywords NMB1025 protein
total genus 31
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3kjjA00
4NWOB 2B33A 1QD9A 3ZOPA 3LMEA 1XHOA 1JD1A 1FNJA 3MQWA 2OTMA 2CHTA 2UYNA 3VCZA 1UFYA 2DYYA 2CHSA 3I3FA 3K12A 1PF5A 3LYBA 3KJKA 2CVLA 3I7TA 3ZP7A 3ZP4A 2UYPA 3K0TA 2UYNB 5HP8A 1COMA 3QUWA 3ZO8A 5HP7A 1ONIA 3M4SA 1X25A 1FNKA 1NQ3A 2CSLA 3KJJA 3R0PA 1DBFA 4ZK7A 3D01A 1J7HA 2CWJA 3L7QA 1ODEA 3M1XA 1UI9A 2UYKA 3V4DA 1QAHA 2CW4A 2UYJA 3GTZA 2EWCA 2IG8A 1QU9A 1XRGA
chains in the Genus database with same CATH superfamily
1VK3A 3N2GA 2LBTA 3C9SA 1JFFB 4BT6A 3PLAC 4YJ2A 3FD5A 5FNVB 3KHNA 3IEQA 3TD5A 5IJ0B 2CHSA 3K12A 1VQNF 5J2TA 5EB1B 1JY8A 5IJ9B 5G4UC 2N48A 1GO1A 5CB4B 1YIJF 1FSZA 2VAWA 4BW0B 1JFFA 3CCQF 1W5FA 2Q1XA 4O2BA 3V4DA 4BVQA 1QAHA 5HXUA 1YJ9F 1VQ5F 2UYJA 3RYIB 3S0YA 2IG8A 4BT2A 1VQMF 3MDOA 1QD9A 3C9RA 3JARA 1IV4A 4B62A 2AIFA 2VAPA 4I50B 2CHTA 4TUYB 3D54A 5CB4A 5C8YA 5FLXM 3ZP4A 1VQLF 3JATB 4TV9A 4ZHQB 2VAMA 5EYPB 4C81A 3WJPA 2HS3A 3HJWC 3IR9A 3JAKB 4X1KB 2IAFA 4I50A 4YJ2B 5C8YB 4NWOB 1NJIH 4YJ3A 1FNJA 2Z1EA 3DC2A 3CC4F 4O4JA 4ZOLA 2OHWA 3CYPB 2JNBA 4ZHWA 1Q81H 5JCOA 2Z01A 2UYPA 1X7PA 1COMA 3CCJF 3LDTA 1KQSF 1RQ7A 1OAPA 3JVHA 5ITZB 1YHQF 3VYUC 3UT5B 1KNJA 3RA5A 4F6RA 3S0WA 4TZZA 1Q7YH 4TV8B 1W40A 2QI2A 1W581 3RE3A 4X1IA 2RB9A 1KNKA 1XV2A 3VI6A 5BMVB 5HXZA 3ERNA 3JATA 5G4VC 3Q8HA 2VGNA 2UYNB 2VXYA 4ZI7A 4O4HB 3CCUF 1VQ4F 4ZHYB 4U3JB 3M4SA 3GHZA 5EWRA 2PHNA 1ODEA 3NMUC 4YJ3B 2Q1YA 1W41A 5LOVB 2EWCA 1SZQA 2YXZA 2OTMA 1IV1A 4X1YA 4C4WC 1OFUA 5JH7B 3F0DA 1W5AA 3CB2A 1VQKF 4BVRA 2RHJA 2HP0B 3QUWA 3F0FA 5AVMA 4XCQA 3UT5A 5IJ0A 5LOVA 4C8GA 3QHDA 2FGYA 3N4ZA 3RYHB 2V9YA 3VTIC 4TV8A 4NQ3A 2L26A 4X3MA 2BTUA 1SA0B 5JH7A 4X1IB 1XBIA 2ZODA 4E6EA 5KMGB 3LMEA 1KC8H 3E22B 3EORA 1QVFF 3LWOC 3CCVF 4LNUB 2HRYA 3JCMM 4O4HA 4BT7A 3LWRC 3G6EF 1M1KH 1K73H 2ZF8A 5JQGA 3CCMF 3NK7A 1H47A 2YYEA 3VMFB 3HTNA 3NVKE 4BVSA 3RYFB 1JJ2F 4PWTA 3MCQA 4DRXB 3LWVC 3E22A 1N8RH 2H6LA 3HKCA 3K14A 1J7HA 3MCAB 1Q82H 3CC7F 2I6RA 5HY2A 5KX5A 5IYZB 5MN4A 1U3PA 2ZAUA 1S72F 3S06A 2RHLA 2DYYA 2HVYD 3I7TA 1VQ7F 1YJNF 3M84A 3RYHA 5HP8A 3E20B 4BY9D 1R1MA 3IMPA 4B46A 1X25A 4ZK7A 4RHAA 2KTVA 3C9UA 5HY4A 4B5CA 2QTPA 5MN6A 3D00A 5ITZA 3F0EA 1RLUA 4HNAA 3E1YA 3FPIA 3JALA 5J2TB 3C9TA 1XHOA 4F6RB 3N4YA 4X3LA 5JQGB 3RYFA 1T0KB 1GO0A 3LYBA 2IQQA 3IKFA 2CVLA 5JVDA 1RA4A 2LBXA 4DRXA 3CCSF 3ZO8A 2HS0A 3RYIA 4O4IA 2AIZP 1FNKA 2W8BC 3B6NA 3KJJA 3CCEF 4HNAB 3K2XA 1VQOF 5EIBD 5LYJA 3WJQA 4ERHA 2PMPA 1QVGF 3HKDA 3WPXA 1UI9A 3SIVA 4U3JA 4IHJA 4EI8A 4R40B 5CA0A 4G4ZA 3VIUA 4G4WA 4I55A 3ZOPA 1FFXA 3N2KB 5J2UB 1SDSA 1VQ9F 3T80A 3J80M 3WJRA 3OONA 4O2AA 5LXTB 1Q8RA 4M8IA 3C8LA 5LP6C 1W5EA 1ZWZA 3JAKA 2KG4A 3VO8A 3F6MA 5CA0B 1ONIA 3FD6A 5GIOC 4I55B 1U43A 3J81M 5J2UA 1YQNA 1YI2F 1W55A 4O2AB 5LXTA 1CN7A 4G4VA 1TUBB 2F9ZC 5DCVA 3P4EA 5JVDB 4I4TB 3JAWA 2LBWA 3V3TA 2GZLA 3LWQC 2WALA 3KJKA 1H7MA 2HS4A 5B8FA 5LA6B 5LYJB 1K9MH 1W42A 2G9IA 1YGYA 3FFMA 1VQPF 2CSLA 3MBMA 1U40A 5GONB 5GIPC 1RQ2A 2RHHA 3N2KA 4I4TA 5BMVA 5CA1A 5JCOC 2P6YA 3FBAA 4ZI7B 4O2BB 1W3EX 3P10A 3WGJA 4BT3A 3V7QA 4DXDA 3SIUA 4FFBA 3VCZA 1VQ6F 3I3FA 2LCAA 3WPWA 1VQVA 3HAXD 2ZVYA 3WGKA 1Q86H 3ELCA 3NVIB 4TUYA 4C8EA 2I6DA 4C8IA 5A2QM 1IV3A 5FJ4C 2OTJF 5CA1B 3VYTC 1DBFA 3PAFA 1U3LA 2K1SA 2ZVZA 4IIJA 3NK6A 5HWEA 1VH8A 1QU9A 5EAZA 1T0AA 3JAWB 3WGNA 4EI9A 5GAPK 3CXCF 4WBNB 3IKEA 3JALB 4G4XA 3U0OA 4C82A 1W2BF 1PF5A 3KE1A 2H8EA 3K0TA 1M90H 4B45A 4O4JB 4ZOLB 5GONA 3LWPC 4IIJB 5HP7A 1KD1H 4G88A 1NQ3A 1IPAA 2AMTA 2CWJA 3S03A 1JN1A 3DDNA 2UZHA 4BT5A 3S02A 3IEWA 3M1XA 4BVTA 3CG6A 4WBNA 3HKBA 4EB6A 1GZ0A 3I56F 3QTYA 4LNUA 5EB0A 1XRGA 4RQOA 3HKDB 3G4SF 2BTOA 3CPQA 3CMAF 2HP3A 2DT4A 1JD1A 2HRUA 3OBWA 3O85A 3KIZA 1TVKB 2KGWA 1W5BA 3J7AR 2HX0A 5IJ9A 3CCRF 3CCLF 3BYQA 2MQEA 2GVIA 1CK2A 2GLZA 2R6R1 3TD3A 1YITF 1X52A 2Z1UA 1H48A 2H8CA 5IYZA 2ZOVA 2R751 3WGLA 2CW4A 3ESJA 3JARB 5MN5A 3CMEF 3G71F 3OW2F 5LP6A 4O4LB 2HQSC 3CYQA 1X7OA 3WXMB 5EO3A 5EZYA 5EYPA 2FC3A 2BTQB 5EIBC 4X1KA 3HKBB 5LA6A 4EB6B 3HKEA 1VHAA 4X20A 3RYCB 2UYKA 4G4YA 2HP0A 1DT9A 2OZBA 3RA6A 1K8AH 4NUTA 2RHOA 2KTUA 1TVKA 2B33A 5EZYB 3JASB 5HY0A 3F0GA 1RLGA 3MQWA 1CLIA 3LFOA 2CZWA 1SA0A 3GYQA 1W59A 2QA4F 4O4IB 3ZP7A 5KMGA 2OTLF 3WGMA 1W57A 3HKEB 3RYCA 4FFBB 1Z5WA 4IHJB 5HY1A 3V7EA 2Z1TA 1GX1A 1FFXB 1PXWA 1Z5VA 3L7QA 3JASA 3VOAA 1IV2A 3TD4A 3AGKA 4EI7A 3JAMM 5GANK 1UFYA 5LP6B 4O4LA 3I55F 3VOBA 2BO1A 4KWEA 2VGMA 3ON1A 2UYNA 3P0ZA 3S0HA 1VQ8F 3HKCB 2Z1FA 5GINC 1NMUB 5IT9M 2NMUA 3N2GB 1YJWF 2QEXF 5KX5B 3CD6F 3VYSC 5FNVA 4X20B 1E7KA 2ALEA 4ZHVA 3CC2F 3R0PA 1TUBA 3HWUA 4TV9B 4U39A 4BT4A 3OBYA 4ZHQA 3GTZA 3D01A 4X1YB 4LCKA 3CPWF
chains in the Genus database with same CATH topology
4NWOB 2B33A 1QD9A 3ZOPA 3LMEA 1XHOA 1JD1A 1FNJA 3MQWA 2OTMA 2CHTA 2UYNA 3VCZA 1UFYA 2DYYA 2CHSA 3I3FA 3K12A 1PF5A 3LYBA 3KJKA 2CVLA 3I7TA 3ZP7A 3ZP4A 2UYPA 3K0TA 2UYNB 5HP8A 1COMA 3QUWA 3ZO8A 5HP7A 1ONIA 3M4SA 1X25A 1FNKA 1NQ3A 2CSLA 3KJJA 3R0PA 1DBFA 4ZK7A 3D01A 1J7HA 2CWJA 3L7QA 1ODEA 3M1XA 1UI9A 2UYKA 3V4DA 1QAHA 2CW4A 2UYJA 3GTZA 2EWCA 2IG8A 1QU9A 1XRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWO B;  2B33 A;  1QD9 A;  3ZOP A;  3LME A;  1XHO A;  1JD1 A;  1FNJ A;  3MQW A;  2OTM A;  2CHT A;  2UYN A;  3VCZ A;  1UFY A;  2DYY A;  2CHS A;  3I3F A;  3K12 A;  1PF5 A;  3LYB A;  3KJK A;  2CVL A;  3I7T A;  3ZP7 A;  3ZP4 A;  2UYP A;  3K0T A;  2UYN B;  5HP8 A;  1COM A;  3QUW A;  3ZO8 A;  5HP7 A;  1ONI A;  3M4S A;  1X25 A;  1FNK A;  1NQ3 A;  2CSL A;  3KJJ A;  3R0P A;  1DBF A;  4ZK7 A;  3D01 A;  1J7H A;  2CWJ A;  3L7Q A;  1ODE A;  3M1X A;  1UI9 A;  2UYK A;  3V4D A;  1QAH A;  2CW4 A;  2UYJ A;  3GTZ A;  2EWC A;  2IG8 A;  1QU9 A;  1XRG A; 
#chains in the Genus database with same CATH topology
 1VK3 A;  3N2G A;  2LBT A;  3C9S A;  1JFF B;  4BT6 A;  3PLA C;  4YJ2 A;  3FD5 A;  5FNV B;  3KHN A;  3IEQ A;  3TD5 A;  5IJ0 B;  2CHS A;  3K12 A;  1VQN F;  5J2T A;  5EB1 B;  1JY8 A;  5IJ9 B;  5G4U C;  2N48 A;  1GO1 A;  5CB4 B;  1YIJ F;  1FSZ A;  2VAW A;  4BW0 B;  1JFF A;  3CCQ F;  1W5F A;  2Q1X A;  4O2B A;  3V4D A;  4BVQ A;  1QAH A;  5HXU A;  1YJ9 F;  1VQ5 F;  2UYJ A;  3RYI B;  3S0Y A;  2IG8 A;  4BT2 A;  1VQM F;  3MDO A;  1QD9 A;  3C9R A;  3JAR A;  1IV4 A;  4B62 A;  2AIF A;  2VAP A;  4I50 B;  2CHT A;  4TUY B;  3D54 A;  5CB4 A;  5C8Y A;  5FLX M;  3ZP4 A;  1VQL F;  3JAT B;  4TV9 A;  4ZHQ B;  2VAM A;  5EYP B;  4C81 A;  3WJP A;  2HS3 A;  3HJW C;  3IR9 A;  3JAK B;  4X1K B;  2IAF A;  4I50 A;  4YJ2 B;  5C8Y B;  4NWO B;  1NJI H;  4YJ3 A;  1FNJ A;  2Z1E A;  3DC2 A;  3CC4 F;  4O4J A;  4ZOL A;  2OHW A;  3CYP B;  2JNB A;  4ZHW A;  1Q81 H;  5JCO A;  2Z01 A;  2UYP A;  1X7P A;  1COM A;  3CCJ F;  3LDT A;  1KQS F;  1RQ7 A;  1OAP A;  3JVH A;  5ITZ B;  1YHQ F;  3VYU C;  3UT5 B;  1KNJ A;  3RA5 A;  4F6R A;  3S0W A;  4TZZ A;  1Q7Y H;  4TV8 B;  1W40 A;  2QI2 A;  1W58 1;  3RE3 A;  4X1I A;  2RB9 A;  1KNK A;  1XV2 A;  3VI6 A;  5BMV B;  5HXZ A;  3ERN A;  3JAT A;  5G4V C;  3Q8H A;  2VGN A;  2UYN B;  2VXY A;  4ZI7 A;  4O4H B;  3CCU F;  1VQ4 F;  4ZHY B;  4U3J B;  3M4S A;  3GHZ A;  5EWR A;  2PHN A;  1ODE A;  3NMU C;  4YJ3 B;  2Q1Y A;  1W41 A;  5LOV B;  2EWC A;  1SZQ A;  2YXZ A;  2OTM A;  1IV1 A;  4X1Y A;  4C4W C;  1OFU A;  5JH7 B;  3F0D A;  1W5A A;  3CB2 A;  1VQK F;  4BVR A;  2RHJ A;  2HP0 B;  3QUW A;  3F0F A;  5AVM A;  4XCQ A;  3UT5 A;  5IJ0 A;  5LOV A;  4C8G A;  3QHD A;  2FGY A;  3N4Z A;  3RYH B;  2V9Y A;  3VTI C;  4TV8 A;  4NQ3 A;  2L26 A;  4X3M A;  2BTU A;  1SA0 B;  5JH7 A;  4X1I B;  1XBI A;  2ZOD A;  4E6E A;  5KMG B;  3LME A;  1KC8 H;  3E22 B;  3EOR A;  1QVF F;  3LWO C;  3CCV F;  4LNU B;  2HRY A;  3JCM M;  4O4H A;  4BT7 A;  3LWR C;  3G6E F;  1M1K H;  1K73 H;  2ZF8 A;  5JQG A;  3CCM F;  3NK7 A;  1H47 A;  2YYE A;  3VMF B;  3HTN A;  3NVK E;  4BVS A;  3RYF B;  1JJ2 F;  4PWT A;  3MCQ A;  4DRX B;  3LWV C;  3E22 A;  1N8R H;  2H6L A;  3HKC A;  3K14 A;  1J7H A;  3MCA B;  1Q82 H;  3CC7 F;  2I6R A;  5HY2 A;  5KX5 A;  5IYZ B;  5MN4 A;  1U3P A;  2ZAU A;  1S72 F;  3S06 A;  2RHL A;  2DYY A;  2HVY D;  3I7T A;  1VQ7 F;  1YJN F;  3M84 A;  3RYH A;  5HP8 A;  3E20 B;  4BY9 D;  1R1M A;  3IMP A;  4B46 A;  1X25 A;  4ZK7 A;  4RHA A;  2KTV A;  3C9U A;  5HY4 A;  4B5C A;  2QTP A;  5MN6 A;  3D00 A;  5ITZ A;  3F0E A;  1RLU A;  4HNA A;  3E1Y A;  3FPI A;  3JAL A;  5J2T B;  3C9T A;  1XHO A;  4F6R B;  3N4Y A;  4X3L A;  5JQG B;  3RYF A;  1T0K B;  1GO0 A;  3LYB A;  2IQQ A;  3IKF A;  2CVL A;  5JVD A;  1RA4 A;  2LBX A;  4DRX A;  3CCS F;  3ZO8 A;  2HS0 A;  3RYI A;  4O4I A;  2AIZ P;  1FNK A;  2W8B C;  3B6N A;  3KJJ A;  3CCE F;  4HNA B;  3K2X A;  1VQO F;  5EIB D;  5LYJ A;  3WJQ A;  4ERH A;  2PMP A;  1QVG F;  3HKD A;  3WPX A;  1UI9 A;  3SIV A;  4U3J A;  4IHJ A;  4EI8 A;  4R40 B;  5CA0 A;  4G4Z A;  3VIU A;  4G4W A;  4I55 A;  3ZOP A;  1FFX A;  3N2K B;  5J2U B;  1SDS A;  1VQ9 F;  3T80 A;  3J80 M;  3WJR A;  3OON A;  4O2A A;  5LXT B;  1Q8R A;  4M8I A;  3C8L A;  5LP6 C;  1W5E A;  1ZWZ A;  3JAK A;  2KG4 A;  3VO8 A;  3F6M A;  5CA0 B;  1ONI A;  3FD6 A;  5GIO C;  4I55 B;  1U43 A;  3J81 M;  5J2U A;  1YQN A;  1YI2 F;  1W55 A;  4O2A B;  5LXT A;  1CN7 A;  4G4V A;  1TUB B;  2F9Z C;  5DCV A;  3P4E A;  5JVD B;  4I4T B;  3JAW A;  2LBW A;  3V3T A;  2GZL A;  3LWQ C;  2WAL A;  3KJK A;  1H7M A;  2HS4 A;  5B8F A;  5LA6 B;  5LYJ B;  1K9M H;  1W42 A;  2G9I A;  1YGY A;  3FFM A;  1VQP F;  2CSL A;  3MBM A;  1U40 A;  5GON B;  5GIP C;  1RQ2 A;  2RHH A;  3N2K A;  4I4T A;  5BMV A;  5CA1 A;  5JCO C;  2P6Y A;  3FBA A;  4ZI7 B;  4O2B B;  1W3E X;  3P10 A;  3WGJ A;  4BT3 A;  3V7Q A;  4DXD A;  3SIU A;  4FFB A;  3VCZ A;  1VQ6 F;  3I3F A;  2LCA A;  3WPW A;  1VQV A;  3HAX D;  2ZVY A;  3WGK A;  1Q86 H;  3ELC A;  3NVI B;  4TUY A;  4C8E A;  2I6D A;  4C8I A;  5A2Q M;  1IV3 A;  5FJ4 C;  2OTJ F;  5CA1 B;  3VYT C;  1DBF A;  3PAF A;  1U3L A;  2K1S A;  2ZVZ A;  4IIJ A;  3NK6 A;  5HWE A;  1VH8 A;  1QU9 A;  5EAZ A;  1T0A A;  3JAW B;  3WGN A;  4EI9 A;  5GAP K;  3CXC F;  4WBN B;  3IKE A;  3JAL B;  4G4X A;  3U0O A;  4C82 A;  1W2B F;  1PF5 A;  3KE1 A;  2H8E A;  3K0T A;  1M90 H;  4B45 A;  4O4J B;  4ZOL B;  5GON A;  3LWP C;  4IIJ B;  5HP7 A;  1KD1 H;  4G88 A;  1NQ3 A;  1IPA A;  2AMT A;  2CWJ A;  3S03 A;  1JN1 A;  3DDN A;  2UZH A;  4BT5 A;  3S02 A;  3IEW A;  3M1X A;  4BVT A;  3CG6 A;  4WBN A;  3HKB A;  4EB6 A;  1GZ0 A;  3I56 F;  3QTY A;  4LNU A;  5EB0 A;  1XRG A;  4RQO A;  3HKD B;  3G4S F;  2BTO A;  3CPQ A;  3CMA F;  2HP3 A;  2DT4 A;  1JD1 A;  2HRU A;  3OBW A;  3O85 A;  3KIZ A;  1TVK B;  2KGW A;  1W5B A;  3J7A R;  2HX0 A;  5IJ9 A;  3CCR F;  3CCL F;  3BYQ A;  2MQE A;  2GVI A;  1CK2 A;  2GLZ A;  2R6R 1;  3TD3 A;  1YIT F;  1X52 A;  2Z1U A;  1H48 A;  2H8C A;  5IYZ A;  2ZOV A;  2R75 1;  3WGL A;  2CW4 A;  3ESJ A;  3JAR B;  5MN5 A;  3CME F;  3G71 F;  3OW2 F;  5LP6 A;  4O4L B;  2HQS C;  3CYQ A;  1X7O A;  3WXM B;  5EO3 A;  5EZY A;  5EYP A;  2FC3 A;  2BTQ B;  5EIB C;  4X1K A;  3HKB B;  5LA6 A;  4EB6 B;  3HKE A;  1VHA A;  4X20 A;  3RYC B;  2UYK A;  4G4Y A;  2HP0 A;  1DT9 A;  2OZB A;  3RA6 A;  1K8A H;  4NUT A;  2RHO A;  2KTU A;  1TVK A;  2B33 A;  5EZY B;  3JAS B;  5HY0 A;  3F0G A;  1RLG A;  3MQW A;  1CLI A;  3LFO A;  2CZW A;  1SA0 A;  3GYQ A;  1W59 A;  2QA4 F;  4O4I B;  3ZP7 A;  5KMG A;  2OTL F;  3WGM A;  1W57 A;  3HKE B;  3RYC A;  4FFB B;  1Z5W A;  4IHJ B;  5HY1 A;  3V7E A;  2Z1T A;  1GX1 A;  1FFX B;  1PXW A;  1Z5V A;  3L7Q A;  3JAS A;  3VOA A;  1IV2 A;  3TD4 A;  3AGK A;  4EI7 A;  3JAM M;  5GAN K;  1UFY A;  5LP6 B;  4O4L A;  3I55 F;  3VOB A;  2BO1 A;  4KWE A;  2VGM A;  3ON1 A;  2UYN A;  3P0Z A;  3S0H A;  1VQ8 F;  3HKC B;  2Z1F A;  5GIN C;  1NMU B;  5IT9 M;  2NMU A;  3N2G B;  1YJW F;  2QEX F;  5KX5 B;  3CD6 F;  3VYS C;  5FNV A;  4X20 B;  1E7K A;  2ALE A;  4ZHV A;  3CC2 F;  3R0P A;  1TUB A;  3HWU A;  4TV9 B;  4U39 A;  4BT4 A;  3OBY A;  4ZHQ A;  3GTZ A;  3D01 A;  4X1Y B;  4LCK A;  3CPW F; 
#chains in the Genus database with same CATH homology
 4NWO B;  2B33 A;  1QD9 A;  3ZOP A;  3LME A;  1XHO A;  1JD1 A;  1FNJ A;  3MQW A;  2OTM A;  2CHT A;  2UYN A;  3VCZ A;  1UFY A;  2DYY A;  2CHS A;  3I3F A;  3K12 A;  1PF5 A;  3LYB A;  3KJK A;  2CVL A;  3I7T A;  3ZP7 A;  3ZP4 A;  2UYP A;  3K0T A;  2UYN B;  5HP8 A;  1COM A;  3QUW A;  3ZO8 A;  5HP7 A;  1ONI A;  3M4S A;  1X25 A;  1FNK A;  1NQ3 A;  2CSL A;  3KJJ A;  3R0P A;  1DBF A;  4ZK7 A;  3D01 A;  1J7H A;  2CWJ A;  3L7Q A;  1ODE A;  3M1X A;  1UI9 A;  2UYK A;  3V4D A;  1QAH A;  2CW4 A;  2UYJ A;  3GTZ A;  2EWC A;  2IG8 A;  1QU9 A;  1XRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...