3KJRA

Crystal structure of dihydrofolate reductase/thymidylate synthase from babesia bovis determined using slipchip based microfluidics
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
507
structure length
498
Chain Sequence
YEGCGDLTIFVAVALNKVIGHKNQIPWPHITHDFRFLRNGTTYIPPEVLSKNPDIQNVVIFGRKTYESIPKASLPLKNRINVILSRTVKEVPGCLVYEDLSTAIRDLRANVPHNKIFILGGSFLYKEVLDNGLCDKIYLTRLNKEYPGDTYFPDIPDTFEITAISPTFSTDFVSYDFVIYERKPFDQLLMTGTDISVPKPKYVACPGVRIRNHEEFQYLDILADVLSHGVLKPNRTGTDAYSKFGYQMRFDLSRSFPLLTTKKVALRSIIEELLWFIKGSTNGNDLLAKNVRIWELNGRRDFLDKNGFTDREEHDLGPIYGFQWRHFGAEYLDMHADYTGKGIDQLAEIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVSDNKLSCMMHQRSCDLGLGVPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIARIPHPFPRLRLNPDIRNIEDFTIDDIVVEDYVSHPPIPMAMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiparameter screening on SlipChip used for nanoliter protein crystallization combining free interface diffusion and microbatch methods.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase/thymidylate synthase
molecule tags Transferase
total genus 159
structure length 498
sequence length 507
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3kjrA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3kjrA01
1TISA 3RO9A 2FZIA 3N5EA 1DHIA 3I3RA 1JU6A 1DRHA 1PDBA 3B5BA 3EAWX 4KD7A 1J3KC 3ED7A 3V8HA 4DQ1A 2W3WA 4G3MA 1BP6A 1NJEA 4QI9A 4KFJA 2BLAA 4ELFA 1TSLA 5H38A 1AIQA 3QLZA 4G6WX 3NXOA 1M79A 2W9GA 1HFPA 2ANOA 2G6VA 1YPVA 4Q0DA 3CL9A 1VZBA 4H96A 3EDWX 3I8AX 2C2TA 3KJSA 1TLSA 1M7AA 3DG8A 3KGBA 3F0SX 2ITHA 5CCCA 4PSGA 3FQFA 1D1GA 4ELEA 5CC9A 8DFRA 3IRNA 1TSYA 3FREX 5WRNA 1PD8A 3JWMA 4EB4A 4X5JA 3ZPGA 1JOLA 3FYWX 1QQQA 3GI2A 4DPHA 3NZAX 3TQ8A 1MVSA 3Q1HA 1DNAA 4EIGA 3FL8A 1LY3A 1RA1A 1KCEA 4JEFA 4QJZD 3GG5A 3DL5A 1TLCA 1TRGA 3C06A 3FQOA 1ZPRA 1B5DA 4KM2A 4UP1A 3IX9A 4TMSA 1DRBA 3NXTA 1B5EA 1RD7A 4DP3A 1DG8A 1J3JC 1S3WA 1I00A 4ELGA 4P3RA 3EIGA 1S3YA 2B3ZA 2W3AA 2KGKA 2FTNA 1F4DA 3F91A 1FWMA 4PTHA 3LG4A 1DAJA 1AO8A 4H1IA 3C0AA 1J3IA 1SEJA 1VZAA 1DR1A 1NJCA 3QGTA 1DYRA 1JUTA 1OHKA 1AN5A 5EAJA 3QG2A 1DR2A 4XSDA 1LCBA 3JTWA 2CIGA 4XE6X 3ZPCA 1DDRA 1S3VA 3GHVA 1RE7A 4GD7A 1U71A 4DFRA 3JW3A 4NX7A 1RX2A 4IXGX 4FQSA 1TSDA 1JTQA 1EVFA 1RA2A 1F4CA 2DHFA 3SRRX 4HOFA 3EEMA 1HVYA 4Q67A 3JW5A 1DREA 4IXFX 4FGHA 3IA4A 3FRFX 1DG7A 1RG7A 4PDJA 4QJCA 3SGYA 2FZJA 3SH2A 4ELBA 3N5GA 1JUJA 3DGAC 1MVTA 3SRSX 1TVWA 2BLBA 3GH0A 2W9SA 3SRWX 4OR7A 1BSPA 2D0KA 4G8ZX 3FL9A 3FY8X 2DRCA 3F0QX 1KZIA 3EGYX 2G86A 1BKOA 1RX3A 1SYNA 3QJ7A 4H97A 2TDMA 4Q6AA 4EINA 3IK1A 4LAEX 3JWFA 2BBQA 4CD2A 1RB2A 1JOMA 5HI6A 1DG5A 4XECX 4LAHX 1TSVA 1NJDA 1KZJA 3R33A 1TDBA 3QL3A 5HVBA 3NZDA 1IA4A 3DG8C 1THYA 3E0BA 2FZHA 1RF7A 1F4GA 4F2VA 2A9WA 4XSEA 1RX8A 2L28A 3CD2A 1BDUA 2FTQA 2KCEA 3S7AA 1JMHA 1YHOA 1RTSA 3NZ6X 1IA1A 3SR5X 1KLKA 4FGTA 7DFRA 4I13A 4LAGX 3FQZA 3BZ0A 2ANQA 3K45A 4FGGA 5HQZA 4ISWA 3VCOA 5HS3A 5FDAA 1VDRA 1TDAA 1RB3A 1NCEA 1BPJA 3NXVA 3NTZA 1EV8A 1HW3A 4XT4A 5E8QA 5JG0X 3GYFA 4KL9A 1DR7A 1VZEA 3FQ0A 3FYVX 2W9TA 4FOAA 3H9KA 2W9HA 2BLCA 3EJLA 3UM5A 1DDUA 1J3IC 2ONBA 1JUVA 4TU5X 4Q0EA 4HOGA 3KFYA 3UM6A 4XT5A 4XSCA 4IXED 2BL9A 4KNZA 3IRMA 5HQYA 1LUDA 1TDCA 4XT7A 2VF0A 1HFQA 2ZZAA 2LF1A 3QLXA 1RX7A 2HM9A 3TQBA 1RH3A 3KGYA 3K2HA 3NXRA 1DLRA 1DYIA 3IX6A 4KNEA 3NZBX 5HT4A 2VETA 1TSZA 4EILA 3N0HA 3NXXA 3SAIA 1LY4A 1U70A 4QLGA 3QLSA 1DR5A 5HSRA 2INQA 4H95A 2AZNA 1EVGA 5HPBA 2G8XA 4LEKX 1BP0A 2XW7A 1BZFA 3F0UX 2TSRA 3EEKA 3EELA 4H0UA 4KY4A 5J7WA 3FRDX 1TDUA 3JVXA 4M6KA 3SQYX 3EHIX 1RA9A 3JSUA 2D5NA 1DR4A 1KMVA 4KJKA 4XRBA 1JTUA 4HA7A 4KY8A 2G8AA 2G89A 1TSNA 5DXVA 4FOXA 3SRQX 2C2SA 3QLWA 1BQ1A 1RA3A 4P3QA 1HW4A 4IRRA 3CLBA 4GH8A 3EEJA 5U27A 1DYHA 4O1XA 2GD9A 1F4EA 4OSGA 1HZWA 3UM8A 3KJRA 1PD9A 1S3UA 3BYXA 4P68A 3HBBA 1HFRA 3M08A 4QHVA 4ELHA 1B02A 3CSEA 4M7UA 1NJAA 1TJSA 3EBUA 1NJBA 1DRFA 3JWCA 2RD8B 4PSYA 3L3RA 3S3VA 3DL6A 6DFRA 3F0VX 4IQQA 3BNZA 1DHFA 3HJ3A 1BKPA 1ZDRA 2CD2A 4GEVA 3F0XX 2HQPA 4PSSA 1CZ3A 1EV5A 3BFIA 1DF7A 1U72A 5HT5A 4E28A 1TSWA 2AAZA 5U26A 3S9UA 1LCAA 5HUIA 3IHIA 2OBCA 4G2OX 3UWLB 1TYSA 3FRBX 1TDRA 3TD8A 2O7PA 4KBNA 3ROAA 4H98A 1IA2A 3BHLA 4PTJA 3FY9X 3M09A 3K47A 1QZFA 3SA1A 1M78A 1VJ3A 4EIZA 1OHJA 4O1XD 2RDAA 3OCHA 3QLYA 4KLXA 2TSCA 3NXYA 4G95A 1DDSA 3B9HA 3GHWA 4EZ8A 4GYHA 1BSFA 1AI9A 4KJJA 3QYOA 2TDDA 1DR6A 3QLRA 4PSTA 5HF2X 3BGXA 2HXVA 4X5GA 1JMGA 1DIUA 3NZCX 1DR3A 1J3KA 1RX6A 4X5IA 4IQBA 4DPDA 3EX8A 4HA9A 3HB8A 1CI7A 1DISA 5DFRA 2FTOX 4M2XA 3TMSA 1RX4A 4I1NA 4KAKA 4KPWA 5BY6A 2P4GA 4RGCA 4LRRA 3OAFA 4M7VA 5HF0X 3N5EB 4X5HA 3D80A 1RA8A 3TQAA 1TSXA 3INVA 4FOGA 1BOZA 4XT8A 2RD8A 3OB7A 3EF9A 4XT6A 1DRAA 1JMFA 5FCTA 1DHJA 2QK8A 3RG9A 5H3AA 1JG0A 1AOEA 2W3MA 1IA3A 3FS6A 3D84X 4QLFA 3TQ9A 3GHCA 4O7UA 3BHRA 1CD2A 4M6LA 2W3BA 5H39A 1DLSA 3DAUA 1F4FA 1AXWA 4KM0A 3UWLA 1J3JA 1BJGA 4X5FA 3QL0A 3FQVA 4M6JA 3DATA 1BIDA 1JMIA 1KMSA 3SA2A 1RX9A 4KYAA 1FFLA 3IK0A 4O1UA 1RC4A 1BO8A 3IJZA 3IROA 3DFRA 3F8ZA 3IA5A 3QFXA 4KEBA 1AOBA 4QLEA 2JYBA 2OIPA 4DDRA 4ISKA 3NZ9X 1VZDA 5ECXA 1TSMA 4P66A 2W3VA 1BQ2A 1E26A 3FRAX 3JWKA 3KY8A 3GH2X 3FQCA 1F4BA 3DRCA 4FHBA 2H2QA 1RX5A 3NRRA 1B49A 1AJMA 5JA3A 4NX6A 4H0RA 4HOEA 5HSUA 4E5OA 1RX1A 3F8YA 1BO7A 3F0BX 3K74A 2G8DA 1TVUA 5ECCA 3SRUX 1TVVA 4ECKA 5HVEA 4KJLA 1LCEA 1VZCA 1F28A 3DGAA 1DYJA 3NU0A 3QYLA 4EJ1A
chains in the Genus database with same CATH superfamily
1TISA 3RO9A 2FZIA 3N5EA 1DHIA 3I3RA 1JU6A 1DRHA 1PDBA 3B5BA 3EAWX 4KD7A 1J3KC 3ED7A 3V8HA 4DQ1A 2W3WA 4G3MA 1BP6A 1NJEA 4QI9A 4KFJA 2BLAA 4ELFA 1TSLA 5H38A 1AIQA 3QLZA 4G6WX 3NXOA 1M79A 2W9GA 1HFPA 2ANOA 2G6VA 1YPVA 4Q0DA 3CL9A 1VZBA 4H96A 3EDWX 3I8AX 2C2TA 3KJSA 1TLSA 1M7AA 3DG8A 3KGBA 3F0SX 2ITHA 5CCCA 4PSGA 3FQFA 1D1GA 4ELEA 5CC9A 8DFRA 3IRNA 1TSYA 3FREX 5WRNA 1PD8A 3JWMA 4EB4A 4X5JA 3ZPGA 1JOLA 3FYWX 1QQQA 3GI2A 4DPHA 3NZAX 3TQ8A 1MVSA 3Q1HA 1DNAA 4EIGA 3FL8A 1LY3A 1RA1A 1KCEA 4JEFA 4QJZD 3GG5A 3DL5A 1TLCA 1TRGA 3C06A 3FQOA 1ZPRA 1B5DA 4KM2A 4UP1A 3IX9A 4TMSA 1DRBA 3NXTA 1B5EA 1RD7A 4DP3A 1DG8A 1J3JC 1S3WA 1I00A 4ELGA 4P3RA 3EIGA 1S3YA 2B3ZA 2W3AA 2KGKA 2FTNA 1F4DA 3F91A 1FWMA 4PTHA 3LG4A 1DAJA 1AO8A 4H1IA 3C0AA 1J3IA 1SEJA 1VZAA 1DR1A 1NJCA 3QGTA 1DYRA 1JUTA 1OHKA 1AN5A 5EAJA 3QG2A 1DR2A 4XSDA 1LCBA 3JTWA 2CIGA 4XE6X 3ZPCA 1DDRA 1S3VA 3GHVA 1RE7A 4GD7A 1U71A 4DFRA 3JW3A 4NX7A 1RX2A 4IXGX 4FQSA 1TSDA 1JTQA 1EVFA 1RA2A 1F4CA 2DHFA 3SRRX 4HOFA 3EEMA 1HVYA 4Q67A 3JW5A 1DREA 4IXFX 4FGHA 3IA4A 3FRFX 1DG7A 1RG7A 4PDJA 4QJCA 3SGYA 2FZJA 3SH2A 4ELBA 3N5GA 1JUJA 3DGAC 1MVTA 3SRSX 1TVWA 2BLBA 3GH0A 2W9SA 3SRWX 4OR7A 1BSPA 2D0KA 4G8ZX 3FL9A 3FY8X 2DRCA 3F0QX 1KZIA 3EGYX 2G86A 1BKOA 1RX3A 1SYNA 3QJ7A 4H97A 2TDMA 4Q6AA 4EINA 3IK1A 4LAEX 3JWFA 2BBQA 4CD2A 1RB2A 1JOMA 5HI6A 1DG5A 4XECX 4LAHX 1TSVA 1NJDA 1KZJA 3R33A 1TDBA 3QL3A 5HVBA 3NZDA 1IA4A 3DG8C 1THYA 3E0BA 2FZHA 1RF7A 1F4GA 4F2VA 2A9WA 4XSEA 1RX8A 2L28A 3CD2A 1BDUA 2FTQA 2KCEA 3S7AA 1JMHA 1YHOA 1RTSA 3NZ6X 1IA1A 3SR5X 1KLKA 4FGTA 7DFRA 4I13A 4LAGX 3FQZA 3BZ0A 2ANQA 3K45A 4FGGA 5HQZA 4ISWA 3VCOA 5HS3A 5FDAA 1VDRA 1TDAA 1RB3A 1NCEA 1BPJA 3NXVA 3NTZA 1EV8A 1HW3A 4XT4A 5E8QA 5JG0X 3GYFA 4KL9A 1DR7A 1VZEA 3FQ0A 3FYVX 2W9TA 4FOAA 3H9KA 2W9HA 2BLCA 3EJLA 3UM5A 1DDUA 1J3IC 2ONBA 1JUVA 4TU5X 4Q0EA 4HOGA 3KFYA 3UM6A 4XT5A 4XSCA 4IXED 2BL9A 4KNZA 3IRMA 5HQYA 1LUDA 1TDCA 4XT7A 2VF0A 1HFQA 2ZZAA 2LF1A 3QLXA 1RX7A 2HM9A 3TQBA 1RH3A 3KGYA 3K2HA 3NXRA 1DLRA 1DYIA 3IX6A 4KNEA 3NZBX 5HT4A 2VETA 1TSZA 4EILA 3N0HA 3NXXA 3SAIA 1LY4A 1U70A 4QLGA 3QLSA 1DR5A 5HSRA 2INQA 4H95A 2AZNA 1EVGA 5HPBA 2G8XA 4LEKX 1BP0A 2XW7A 1BZFA 3F0UX 2TSRA 3EEKA 3EELA 4H0UA 4KY4A 5J7WA 3FRDX 1TDUA 3JVXA 4M6KA 3SQYX 3EHIX 1RA9A 3JSUA 2D5NA 1DR4A 1KMVA 4KJKA 4XRBA 1JTUA 4HA7A 4KY8A 2G8AA 2G89A 1TSNA 5DXVA 4FOXA 3SRQX 2C2SA 3QLWA 1BQ1A 1RA3A 4P3QA 1HW4A 4IRRA 3CLBA 4GH8A 3EEJA 5U27A 1DYHA 4O1XA 2GD9A 1F4EA 4OSGA 1HZWA 3UM8A 3KJRA 1PD9A 1S3UA 3BYXA 4P68A 3HBBA 1HFRA 3M08A 4QHVA 4ELHA 1B02A 3CSEA 4M7UA 1NJAA 1TJSA 3EBUA 1NJBA 1DRFA 3JWCA 2RD8B 4PSYA 3L3RA 3S3VA 3DL6A 6DFRA 3F0VX 4IQQA 3BNZA 1DHFA 3HJ3A 1BKPA 1ZDRA 2CD2A 4GEVA 3F0XX 2HQPA 4PSSA 1CZ3A 1EV5A 3BFIA 1DF7A 1U72A 5HT5A 4E28A 1TSWA 2AAZA 5U26A 3S9UA 1LCAA 5HUIA 3IHIA 2OBCA 4G2OX 3UWLB 1TYSA 3FRBX 1TDRA 3TD8A 2O7PA 4KBNA 3ROAA 4H98A 1IA2A 3BHLA 4PTJA 3FY9X 3M09A 3K47A 1QZFA 3SA1A 1M78A 1VJ3A 4EIZA 1OHJA 4O1XD 2RDAA 3OCHA 3QLYA 4KLXA 2TSCA 3NXYA 4G95A 1DDSA 3B9HA 3GHWA 4EZ8A 4GYHA 1BSFA 1AI9A 4KJJA 3QYOA 2TDDA 1DR6A 3QLRA 4PSTA 5HF2X 3BGXA 2HXVA 4X5GA 1JMGA 1DIUA 3NZCX 1DR3A 1J3KA 1RX6A 4X5IA 4IQBA 4DPDA 3EX8A 4HA9A 3HB8A 1CI7A 1DISA 5DFRA 2FTOX 4M2XA 3TMSA 1RX4A 4I1NA 4KAKA 4KPWA 5BY6A 2P4GA 4RGCA 4LRRA 3OAFA 4M7VA 5HF0X 3N5EB 4X5HA 3D80A 1RA8A 3TQAA 1TSXA 3INVA 4FOGA 1BOZA 4XT8A 2RD8A 3OB7A 3EF9A 4XT6A 1DRAA 1JMFA 5FCTA 1DHJA 2QK8A 3RG9A 5H3AA 1JG0A 1AOEA 2W3MA 1IA3A 3FS6A 3D84X 4QLFA 3TQ9A 3GHCA 4O7UA 3BHRA 1CD2A 4M6LA 2W3BA 5H39A 1DLSA 3DAUA 1F4FA 1AXWA 4KM0A 3UWLA 1J3JA 1BJGA 4X5FA 3QL0A 3FQVA 4M6JA 3DATA 1BIDA 1JMIA 1KMSA 3SA2A 1RX9A 4KYAA 1FFLA 3IK0A 4O1UA 1RC4A 1BO8A 3IJZA 3IROA 3DFRA 3F8ZA 3IA5A 3QFXA 4KEBA 1AOBA 4QLEA 2JYBA 2OIPA 4DDRA 4ISKA 3NZ9X 1VZDA 5ECXA 1TSMA 4P66A 2W3VA 1BQ2A 1E26A 3FRAX 3JWKA 3KY8A 3GH2X 3FQCA 1F4BA 3DRCA 4FHBA 2H2QA 1RX5A 3NRRA 1B49A 1AJMA 5JA3A 4NX6A 4H0RA 4HOEA 5HSUA 4E5OA 1RX1A 3F8YA 1BO7A 3F0BX 3K74A 2G8DA 1TVUA 5ECCA 3SRUX 1TVVA 4ECKA 5HVEA 4KJLA 1LCEA 1VZCA 1F28A 3DGAA 1DYJA 3NU0A 3QYLA 4EJ1A
chains in the Genus database with same CATH topology
1TISA 3RO9A 2FZIA 3N5EA 1DHIA 3I3RA 1JU6A 1DRHA 1PDBA 3B5BA 3EAWX 4KD7A 1J3KC 3ED7A 3V8HA 4DQ1A 2W3WA 4G3MA 1BP6A 1NJEA 4QI9A 4KFJA 2BLAA 4ELFA 1TSLA 5H38A 1AIQA 3QLZA 4G6WX 3NXOA 1M79A 2W9GA 1HFPA 2ANOA 2G6VA 1YPVA 4Q0DA 3CL9A 1VZBA 4H96A 3EDWX 3I8AX 2C2TA 3KJSA 1TLSA 1M7AA 3DG8A 3KGBA 3F0SX 2ITHA 5CCCA 4PSGA 3FQFA 1D1GA 4ELEA 5CC9A 8DFRA 3IRNA 1TSYA 3FREX 5WRNA 1PD8A 3JWMA 4EB4A 4X5JA 3ZPGA 1JOLA 3FYWX 1QQQA 3GI2A 4DPHA 3NZAX 3TQ8A 1MVSA 3Q1HA 1DNAA 4EIGA 3FL8A 1LY3A 1RA1A 1KCEA 4JEFA 4QJZD 3GG5A 3DL5A 1TLCA 1TRGA 3C06A 3FQOA 1ZPRA 1B5DA 4KM2A 4UP1A 3IX9A 4TMSA 1DRBA 3NXTA 1B5EA 1RD7A 4DP3A 1DG8A 1J3JC 1S3WA 1I00A 4ELGA 4P3RA 3EIGA 1S3YA 2B3ZA 2W3AA 2KGKA 2FTNA 1F4DA 3F91A 1FWMA 4PTHA 3LG4A 1DAJA 1AO8A 4H1IA 3C0AA 1J3IA 1SEJA 1VZAA 1DR1A 1NJCA 3QGTA 1DYRA 1JUTA 1OHKA 1AN5A 5EAJA 3QG2A 1DR2A 4XSDA 1LCBA 3JTWA 2CIGA 4XE6X 3ZPCA 1DDRA 1S3VA 3GHVA 1RE7A 4GD7A 1U71A 4DFRA 3JW3A 4NX7A 1RX2A 4IXGX 4FQSA 1TSDA 1JTQA 1EVFA 1RA2A 1F4CA 2DHFA 3SRRX 4HOFA 3EEMA 1HVYA 4Q67A 3JW5A 1DREA 4IXFX 4FGHA 3IA4A 3FRFX 1DG7A 1RG7A 4PDJA 4QJCA 3SGYA 2FZJA 3SH2A 4ELBA 3N5GA 1JUJA 3DGAC 1MVTA 3SRSX 1TVWA 2BLBA 3GH0A 2W9SA 3SRWX 4OR7A 1BSPA 2D0KA 4G8ZX 3FL9A 3FY8X 2DRCA 3F0QX 1KZIA 3EGYX 2G86A 1BKOA 1RX3A 1SYNA 3QJ7A 4H97A 2TDMA 4Q6AA 4EINA 3IK1A 4LAEX 3JWFA 2BBQA 4CD2A 1RB2A 1JOMA 5HI6A 1DG5A 4XECX 4LAHX 1TSVA 1NJDA 1KZJA 3R33A 1TDBA 3QL3A 5HVBA 3NZDA 1IA4A 3DG8C 1THYA 3E0BA 2FZHA 1RF7A 1F4GA 4F2VA 2A9WA 4XSEA 1RX8A 2L28A 3CD2A 1BDUA 2FTQA 2KCEA 3S7AA 1JMHA 1YHOA 1RTSA 3NZ6X 1IA1A 3SR5X 1KLKA 4FGTA 7DFRA 4I13A 4LAGX 3FQZA 3BZ0A 2ANQA 3K45A 4FGGA 5HQZA 4ISWA 3VCOA 5HS3A 5FDAA 1VDRA 1TDAA 1RB3A 1NCEA 1BPJA 3NXVA 3NTZA 1EV8A 1HW3A 4XT4A 5E8QA 5JG0X 3GYFA 4KL9A 1DR7A 1VZEA 3FQ0A 3FYVX 2W9TA 4FOAA 3H9KA 2W9HA 2BLCA 3EJLA 3UM5A 1DDUA 1J3IC 2ONBA 1JUVA 4TU5X 4Q0EA 4HOGA 3KFYA 3UM6A 4XT5A 4XSCA 4IXED 2BL9A 4KNZA 3IRMA 5HQYA 1LUDA 1TDCA 4XT7A 2VF0A 1HFQA 2ZZAA 2LF1A 3QLXA 1RX7A 2HM9A 3TQBA 1RH3A 3KGYA 3K2HA 3NXRA 1DLRA 1DYIA 3IX6A 4KNEA 3NZBX 5HT4A 2VETA 1TSZA 4EILA 3N0HA 3NXXA 3SAIA 1LY4A 1U70A 4QLGA 3QLSA 1DR5A 5HSRA 2INQA 4H95A 2AZNA 1EVGA 5HPBA 2G8XA 4LEKX 1BP0A 2XW7A 1BZFA 3F0UX 2TSRA 3EEKA 3EELA 4H0UA 4KY4A 5J7WA 3FRDX 1TDUA 3JVXA 4M6KA 3SQYX 3EHIX 1RA9A 3JSUA 2D5NA 1DR4A 1KMVA 4KJKA 4XRBA 1JTUA 4HA7A 4KY8A 2G8AA 2G89A 1TSNA 5DXVA 4FOXA 3SRQX 2C2SA 3QLWA 1BQ1A 1RA3A 4P3QA 1HW4A 4IRRA 3CLBA 4GH8A 3EEJA 5U27A 1DYHA 4O1XA 2GD9A 1F4EA 4OSGA 1HZWA 3UM8A 3KJRA 1PD9A 1S3UA 3BYXA 4P68A 3HBBA 1HFRA 3M08A 4QHVA 4ELHA 1B02A 3CSEA 4M7UA 1NJAA 1TJSA 3EBUA 1NJBA 1DRFA 3JWCA 2RD8B 4PSYA 3L3RA 3S3VA 3DL6A 6DFRA 3F0VX 4IQQA 3BNZA 1DHFA 3HJ3A 1BKPA 1ZDRA 2CD2A 4GEVA 3F0XX 2HQPA 4PSSA 1CZ3A 1EV5A 3BFIA 1DF7A 1U72A 5HT5A 4E28A 1TSWA 2AAZA 5U26A 3S9UA 1LCAA 5HUIA 3IHIA 2OBCA 4G2OX 3UWLB 1TYSA 3FRBX 1TDRA 3TD8A 2O7PA 4KBNA 3ROAA 4H98A 1IA2A 3BHLA 4PTJA 3FY9X 3M09A 3K47A 1QZFA 3SA1A 1M78A 1VJ3A 4EIZA 1OHJA 4O1XD 2RDAA 3OCHA 3QLYA 4KLXA 2TSCA 3NXYA 4G95A 1DDSA 3B9HA 3GHWA 4EZ8A 4GYHA 1BSFA 1AI9A 4KJJA 3QYOA 2TDDA 1DR6A 3QLRA 4PSTA 5HF2X 3BGXA 2HXVA 4X5GA 1JMGA 1DIUA 3NZCX 1DR3A 1J3KA 1RX6A 4X5IA 4IQBA 4DPDA 3EX8A 4HA9A 3HB8A 1CI7A 1DISA 5DFRA 2FTOX 4M2XA 3TMSA 1RX4A 4I1NA 4KAKA 4KPWA 5BY6A 2P4GA 4RGCA 4LRRA 3OAFA 4M7VA 5HF0X 3N5EB 4X5HA 3D80A 1RA8A 3TQAA 1TSXA 3INVA 4FOGA 1BOZA 4XT8A 2RD8A 3OB7A 3EF9A 4XT6A 1DRAA 1JMFA 5FCTA 1DHJA 2QK8A 3RG9A 5H3AA 1JG0A 1AOEA 2W3MA 1IA3A 3FS6A 3D84X 4QLFA 3TQ9A 3GHCA 4O7UA 3BHRA 1CD2A 4M6LA 2W3BA 5H39A 1DLSA 3DAUA 1F4FA 1AXWA 4KM0A 3UWLA 1J3JA 1BJGA 4X5FA 3QL0A 3FQVA 4M6JA 3DATA 1BIDA 1JMIA 1KMSA 3SA2A 1RX9A 4KYAA 1FFLA 3IK0A 4O1UA 1RC4A 1BO8A 3IJZA 3IROA 3DFRA 3F8ZA 3IA5A 3QFXA 4KEBA 1AOBA 4QLEA 2JYBA 2OIPA 4DDRA 4ISKA 3NZ9X 1VZDA 5ECXA 1TSMA 4P66A 2W3VA 1BQ2A 1E26A 3FRAX 3JWKA 3KY8A 3GH2X 3FQCA 1F4BA 3DRCA 4FHBA 2H2QA 1RX5A 3NRRA 1B49A 1AJMA 5JA3A 4NX6A 4H0RA 4HOEA 5HSUA 4E5OA 1RX1A 3F8YA 1BO7A 3F0BX 3K74A 2G8DA 1TVUA 5ECCA 3SRUX 1TVVA 4ECKA 5HVEA 4KJLA 1LCEA 1VZCA 1F28A 3DGAA 1DYJA 3NU0A 3QYLA 4EJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIS A;  3RO9 A;  2FZI A;  3N5E A;  1DHI A;  3I3R A;  1JU6 A;  1DRH A;  1PDB A;  3B5B A;  3EAW X;  4KD7 A;  1J3K C;  3ED7 A;  3V8H A;  4DQ1 A;  2W3W A;  4G3M A;  1BP6 A;  1NJE A;  4QI9 A;  4KFJ A;  2BLA A;  4ELF A;  1TSL A;  5H38 A;  1AIQ A;  3QLZ A;  4G6W X;  3NXO A;  1M79 A;  2W9G A;  1HFP A;  2ANO A;  2G6V A;  1YPV A;  4Q0D A;  3CL9 A;  1VZB A;  4H96 A;  3EDW X;  3I8A X;  2C2T A;  3KJS A;  1TLS A;  1M7A A;  3DG8 A;  3KGB A;  3F0S X;  2ITH A;  5CCC A;  4PSG A;  3FQF A;  1D1G A;  4ELE A;  5CC9 A;  8DFR A;  3IRN A;  1TSY A;  3FRE X;  5WRN A;  1PD8 A;  3JWM A;  4EB4 A;  4X5J A;  3ZPG A;  1JOL A;  3FYW X;  1QQQ A;  3GI2 A;  4DPH A;  3NZA X;  3TQ8 A;  1MVS A;  3Q1H A;  1DNA A;  4EIG A;  3FL8 A;  1LY3 A;  1RA1 A;  1KCE A;  4JEF A;  4QJZ D;  3GG5 A;  3DL5 A;  1TLC A;  1TRG A;  3C06 A;  3FQO A;  1ZPR A;  1B5D A;  4KM2 A;  4UP1 A;  3IX9 A;  4TMS A;  1DRB A;  3NXT A;  1B5E A;  1RD7 A;  4DP3 A;  1DG8 A;  1J3J C;  1S3W A;  1I00 A;  4ELG A;  4P3R A;  3EIG A;  1S3Y A;  2B3Z A;  2W3A A;  2KGK A;  2FTN A;  1F4D A;  3F91 A;  1FWM A;  4PTH A;  3LG4 A;  1DAJ A;  1AO8 A;  4H1I A;  3C0A A;  1J3I A;  1SEJ A;  1VZA A;  1DR1 A;  1NJC A;  3QGT A;  1DYR A;  1JUT A;  1OHK A;  1AN5 A;  5EAJ A;  3QG2 A;  1DR2 A;  4XSD A;  1LCB A;  3JTW A;  2CIG A;  4XE6 X;  3ZPC A;  1DDR A;  1S3V A;  3GHV A;  1RE7 A;  4GD7 A;  1U71 A;  4DFR A;  3JW3 A;  4NX7 A;  1RX2 A;  4IXG X;  4FQS A;  1TSD A;  1JTQ A;  1EVF A;  1RA2 A;  1F4C A;  2DHF A;  3SRR X;  4HOF A;  3EEM A;  1HVY A;  4Q67 A;  3JW5 A;  1DRE A;  4IXF X;  4FGH A;  3IA4 A;  3FRF X;  1DG7 A;  1RG7 A;  4PDJ A;  4QJC A;  3SGY A;  2FZJ A;  3SH2 A;  4ELB A;  3N5G A;  1JUJ A;  3DGA C;  1MVT A;  3SRS X;  1TVW A;  2BLB A;  3GH0 A;  2W9S A;  3SRW X;  4OR7 A;  1BSP A;  2D0K A;  4G8Z X;  3FL9 A;  3FY8 X;  2DRC A;  3F0Q X;  1KZI A;  3EGY X;  2G86 A;  1BKO A;  1RX3 A;  1SYN A;  3QJ7 A;  4H97 A;  2TDM A;  4Q6A A;  4EIN A;  3IK1 A;  4LAE X;  3JWF A;  2BBQ A;  4CD2 A;  1RB2 A;  1JOM A;  5HI6 A;  1DG5 A;  4XEC X;  4LAH X;  1TSV A;  1NJD A;  1KZJ A;  3R33 A;  1TDB A;  3QL3 A;  5HVB A;  3NZD A;  1IA4 A;  3DG8 C;  1THY A;  3E0B A;  2FZH A;  1RF7 A;  1F4G A;  4F2V A;  2A9W A;  4XSE A;  1RX8 A;  2L28 A;  3CD2 A;  1BDU A;  2FTQ A;  2KCE A;  3S7A A;  1JMH A;  1YHO A;  1RTS A;  3NZ6 X;  1IA1 A;  3SR5 X;  1KLK A;  4FGT A;  7DFR A;  4I13 A;  4LAG X;  3FQZ A;  3BZ0 A;  2ANQ A;  3K45 A;  4FGG A;  5HQZ A;  4ISW A;  3VCO A;  5HS3 A;  5FDA A;  1VDR A;  1TDA A;  1RB3 A;  1NCE A;  1BPJ A;  3NXV A;  3NTZ A;  1EV8 A;  1HW3 A;  4XT4 A;  5E8Q A;  5JG0 X;  3GYF A;  4KL9 A;  1DR7 A;  1VZE A;  3FQ0 A;  3FYV X;  2W9T A;  4FOA A;  3H9K A;  2W9H A;  2BLC A;  3EJL A;  3UM5 A;  1DDU A;  1J3I C;  2ONB A;  1JUV A;  4TU5 X;  4Q0E A;  4HOG A;  3KFY A;  3UM6 A;  4XT5 A;  4XSC A;  4IXE D;  2BL9 A;  4KNZ A;  3IRM A;  5HQY A;  1LUD A;  1TDC A;  4XT7 A;  2VF0 A;  1HFQ A;  2ZZA A;  2LF1 A;  3QLX A;  1RX7 A;  2HM9 A;  3TQB A;  1RH3 A;  3KGY A;  3K2H A;  3NXR A;  1DLR A;  1DYI A;  3IX6 A;  4KNE A;  3NZB X;  5HT4 A;  2VET A;  1TSZ A;  4EIL A;  3N0H A;  3NXX A;  3SAI A;  1LY4 A;  1U70 A;  4QLG A;  3QLS A;  1DR5 A;  5HSR A;  2INQ A;  4H95 A;  2AZN A;  1EVG A;  5HPB A;  2G8X A;  4LEK X;  1BP0 A;  2XW7 A;  1BZF A;  3F0U X;  2TSR A;  3EEK A;  3EEL A;  4H0U A;  4KY4 A;  5J7W A;  3FRD X;  1TDU A;  3JVX A;  4M6K A;  3SQY X;  3EHI X;  1RA9 A;  3JSU A;  2D5N A;  1DR4 A;  1KMV A;  4KJK A;  4XRB A;  1JTU A;  4HA7 A;  4KY8 A;  2G8A A;  2G89 A;  1TSN A;  5DXV A;  4FOX A;  3SRQ X;  2C2S A;  3QLW A;  1BQ1 A;  1RA3 A;  4P3Q A;  1HW4 A;  4IRR A;  3CLB A;  4GH8 A;  3EEJ A;  5U27 A;  1DYH A;  4O1X A;  2GD9 A;  1F4E A;  4OSG A;  1HZW A;  3UM8 A;  3KJR A;  1PD9 A;  1S3U A;  3BYX A;  4P68 A;  3HBB A;  1HFR A;  3M08 A;  4QHV A;  4ELH A;  1B02 A;  3CSE A;  4M7U A;  1NJA A;  1TJS A;  3EBU A;  1NJB A;  1DRF A;  3JWC A;  2RD8 B;  4PSY A;  3L3R A;  3S3V A;  3DL6 A;  6DFR A;  3F0V X;  4IQQ A;  3BNZ A;  1DHF A;  3HJ3 A;  1BKP A;  1ZDR A;  2CD2 A;  4GEV A;  3F0X X;  2HQP A;  4PSS A;  1CZ3 A;  1EV5 A;  3BFI A;  1DF7 A;  1U72 A;  5HT5 A;  4E28 A;  1TSW A;  2AAZ A;  5U26 A;  3S9U A;  1LCA A;  5HUI A;  3IHI A;  2OBC A;  4G2O X;  3UWL B;  1TYS A;  3FRB X;  1TDR A;  3TD8 A;  2O7P A;  4KBN A;  3ROA A;  4H98 A;  1IA2 A;  3BHL A;  4PTJ A;  3FY9 X;  3M09 A;  3K47 A;  1QZF A;  3SA1 A;  1M78 A;  1VJ3 A;  4EIZ A;  1OHJ A;  4O1X D;  2RDA A;  3OCH A;  3QLY A;  4KLX A;  2TSC A;  3NXY A;  4G95 A;  1DDS A;  3B9H A;  3GHW A;  4EZ8 A;  4GYH A;  1BSF A;  1AI9 A;  4KJJ A;  3QYO A;  2TDD A;  1DR6 A;  3QLR A;  4PST A;  5HF2 X;  3BGX A;  2HXV A;  4X5G A;  1JMG A;  1DIU A;  3NZC X;  1DR3 A;  1J3K A;  1RX6 A;  4X5I A;  4IQB A;  4DPD A;  3EX8 A;  4HA9 A;  3HB8 A;  1CI7 A;  1DIS A;  5DFR A;  2FTO X;  4M2X A;  3TMS A;  1RX4 A;  4I1N A;  4KAK A;  4KPW A;  5BY6 A;  2P4G A;  4RGC A;  4LRR A;  3OAF A;  4M7V A;  5HF0 X;  3N5E B;  4X5H A;  3D80 A;  1RA8 A;  3TQA A;  1TSX A;  3INV A;  4FOG A;  1BOZ A;  4XT8 A;  2RD8 A;  3OB7 A;  3EF9 A;  4XT6 A;  1DRA A;  1JMF A;  5FCT A;  1DHJ A;  2QK8 A;  3RG9 A;  5H3A A;  1JG0 A;  1AOE A;  2W3M A;  1IA3 A;  3FS6 A;  3D84 X;  4QLF A;  3TQ9 A;  3GHC A;  4O7U A;  3BHR A;  1CD2 A;  4M6L A;  2W3B A;  5H39 A;  1DLS A;  3DAU A;  1F4F A;  1AXW A;  4KM0 A;  3UWL A;  1J3J A;  1BJG A;  4X5F A;  3QL0 A;  3FQV A;  4M6J A;  3DAT A;  1BID A;  1JMI A;  1KMS A;  3SA2 A;  1RX9 A;  4KYA A;  1FFL A;  3IK0 A;  4O1U A;  1RC4 A;  1BO8 A;  3IJZ A;  3IRO A;  3DFR A;  3F8Z A;  3IA5 A;  3QFX A;  4KEB A;  1AOB A;  4QLE A;  2JYB A;  2OIP A;  4DDR A;  4ISK A;  3NZ9 X;  1VZD A;  5ECX A;  1TSM A;  4P66 A;  2W3V A;  1BQ2 A;  1E26 A;  3FRA X;  3JWK A;  3KY8 A;  3GH2 X;  3FQC A;  1F4B A;  3DRC A;  4FHB A;  2H2Q A;  1RX5 A;  3NRR A;  1B49 A;  1AJM A;  5JA3 A;  4NX6 A;  4H0R A;  4HOE A;  5HSU A;  4E5O A;  1RX1 A;  3F8Y A;  1BO7 A;  3F0B X;  3K74 A;  2G8D A;  1TVU A;  5ECC A;  3SRU X;  1TVV A;  4ECK A;  5HVE A;  4KJL A;  1LCE A;  1VZC A;  1F28 A;  3DGA A;  1DYJ A;  3NU0 A;  3QYL A;  4EJ1 A; 
#chains in the Genus database with same CATH topology
 1TIS A;  3RO9 A;  2FZI A;  3N5E A;  1DHI A;  3I3R A;  1JU6 A;  1DRH A;  1PDB A;  3B5B A;  3EAW X;  4KD7 A;  1J3K C;  3ED7 A;  3V8H A;  4DQ1 A;  2W3W A;  4G3M A;  1BP6 A;  1NJE A;  4QI9 A;  4KFJ A;  2BLA A;  4ELF A;  1TSL A;  5H38 A;  1AIQ A;  3QLZ A;  4G6W X;  3NXO A;  1M79 A;  2W9G A;  1HFP A;  2ANO A;  2G6V A;  1YPV A;  4Q0D A;  3CL9 A;  1VZB A;  4H96 A;  3EDW X;  3I8A X;  2C2T A;  3KJS A;  1TLS A;  1M7A A;  3DG8 A;  3KGB A;  3F0S X;  2ITH A;  5CCC A;  4PSG A;  3FQF A;  1D1G A;  4ELE A;  5CC9 A;  8DFR A;  3IRN A;  1TSY A;  3FRE X;  5WRN A;  1PD8 A;  3JWM A;  4EB4 A;  4X5J A;  3ZPG A;  1JOL A;  3FYW X;  1QQQ A;  3GI2 A;  4DPH A;  3NZA X;  3TQ8 A;  1MVS A;  3Q1H A;  1DNA A;  4EIG A;  3FL8 A;  1LY3 A;  1RA1 A;  1KCE A;  4JEF A;  4QJZ D;  3GG5 A;  3DL5 A;  1TLC A;  1TRG A;  3C06 A;  3FQO A;  1ZPR A;  1B5D A;  4KM2 A;  4UP1 A;  3IX9 A;  4TMS A;  1DRB A;  3NXT A;  1B5E A;  1RD7 A;  4DP3 A;  1DG8 A;  1J3J C;  1S3W A;  1I00 A;  4ELG A;  4P3R A;  3EIG A;  1S3Y A;  2B3Z A;  2W3A A;  2KGK A;  2FTN A;  1F4D A;  3F91 A;  1FWM A;  4PTH A;  3LG4 A;  1DAJ A;  1AO8 A;  4H1I A;  3C0A A;  1J3I A;  1SEJ A;  1VZA A;  1DR1 A;  1NJC A;  3QGT A;  1DYR A;  1JUT A;  1OHK A;  1AN5 A;  5EAJ A;  3QG2 A;  1DR2 A;  4XSD A;  1LCB A;  3JTW A;  2CIG A;  4XE6 X;  3ZPC A;  1DDR A;  1S3V A;  3GHV A;  1RE7 A;  4GD7 A;  1U71 A;  4DFR A;  3JW3 A;  4NX7 A;  1RX2 A;  4IXG X;  4FQS A;  1TSD A;  1JTQ A;  1EVF A;  1RA2 A;  1F4C A;  2DHF A;  3SRR X;  4HOF A;  3EEM A;  1HVY A;  4Q67 A;  3JW5 A;  1DRE A;  4IXF X;  4FGH A;  3IA4 A;  3FRF X;  1DG7 A;  1RG7 A;  4PDJ A;  4QJC A;  3SGY A;  2FZJ A;  3SH2 A;  4ELB A;  3N5G A;  1JUJ A;  3DGA C;  1MVT A;  3SRS X;  1TVW A;  2BLB A;  3GH0 A;  2W9S A;  3SRW X;  4OR7 A;  1BSP A;  2D0K A;  4G8Z X;  3FL9 A;  3FY8 X;  2DRC A;  3F0Q X;  1KZI A;  3EGY X;  2G86 A;  1BKO A;  1RX3 A;  1SYN A;  3QJ7 A;  4H97 A;  2TDM A;  4Q6A A;  4EIN A;  3IK1 A;  4LAE X;  3JWF A;  2BBQ A;  4CD2 A;  1RB2 A;  1JOM A;  5HI6 A;  1DG5 A;  4XEC X;  4LAH X;  1TSV A;  1NJD A;  1KZJ A;  3R33 A;  1TDB A;  3QL3 A;  5HVB A;  3NZD A;  1IA4 A;  3DG8 C;  1THY A;  3E0B A;  2FZH A;  1RF7 A;  1F4G A;  4F2V A;  2A9W A;  4XSE A;  1RX8 A;  2L28 A;  3CD2 A;  1BDU A;  2FTQ A;  2KCE A;  3S7A A;  1JMH A;  1YHO A;  1RTS A;  3NZ6 X;  1IA1 A;  3SR5 X;  1KLK A;  4FGT A;  7DFR A;  4I13 A;  4LAG X;  3FQZ A;  3BZ0 A;  2ANQ A;  3K45 A;  4FGG A;  5HQZ A;  4ISW A;  3VCO A;  5HS3 A;  5FDA A;  1VDR A;  1TDA A;  1RB3 A;  1NCE A;  1BPJ A;  3NXV A;  3NTZ A;  1EV8 A;  1HW3 A;  4XT4 A;  5E8Q A;  5JG0 X;  3GYF A;  4KL9 A;  1DR7 A;  1VZE A;  3FQ0 A;  3FYV X;  2W9T A;  4FOA A;  3H9K A;  2W9H A;  2BLC A;  3EJL A;  3UM5 A;  1DDU A;  1J3I C;  2ONB A;  1JUV A;  4TU5 X;  4Q0E A;  4HOG A;  3KFY A;  3UM6 A;  4XT5 A;  4XSC A;  4IXE D;  2BL9 A;  4KNZ A;  3IRM A;  5HQY A;  1LUD A;  1TDC A;  4XT7 A;  2VF0 A;  1HFQ A;  2ZZA A;  2LF1 A;  3QLX A;  1RX7 A;  2HM9 A;  3TQB A;  1RH3 A;  3KGY A;  3K2H A;  3NXR A;  1DLR A;  1DYI A;  3IX6 A;  4KNE A;  3NZB X;  5HT4 A;  2VET A;  1TSZ A;  4EIL A;  3N0H A;  3NXX A;  3SAI A;  1LY4 A;  1U70 A;  4QLG A;  3QLS A;  1DR5 A;  5HSR A;  2INQ A;  4H95 A;  2AZN A;  1EVG A;  5HPB A;  2G8X A;  4LEK X;  1BP0 A;  2XW7 A;  1BZF A;  3F0U X;  2TSR A;  3EEK A;  3EEL A;  4H0U A;  4KY4 A;  5J7W A;  3FRD X;  1TDU A;  3JVX A;  4M6K A;  3SQY X;  3EHI X;  1RA9 A;  3JSU A;  2D5N A;  1DR4 A;  1KMV A;  4KJK A;  4XRB A;  1JTU A;  4HA7 A;  4KY8 A;  2G8A A;  2G89 A;  1TSN A;  5DXV A;  4FOX A;  3SRQ X;  2C2S A;  3QLW A;  1BQ1 A;  1RA3 A;  4P3Q A;  1HW4 A;  4IRR A;  3CLB A;  4GH8 A;  3EEJ A;  5U27 A;  1DYH A;  4O1X A;  2GD9 A;  1F4E A;  4OSG A;  1HZW A;  3UM8 A;  3KJR A;  1PD9 A;  1S3U A;  3BYX A;  4P68 A;  3HBB A;  1HFR A;  3M08 A;  4QHV A;  4ELH A;  1B02 A;  3CSE A;  4M7U A;  1NJA A;  1TJS A;  3EBU A;  1NJB A;  1DRF A;  3JWC A;  2RD8 B;  4PSY A;  3L3R A;  3S3V A;  3DL6 A;  6DFR A;  3F0V X;  4IQQ A;  3BNZ A;  1DHF A;  3HJ3 A;  1BKP A;  1ZDR A;  2CD2 A;  4GEV A;  3F0X X;  2HQP A;  4PSS A;  1CZ3 A;  1EV5 A;  3BFI A;  1DF7 A;  1U72 A;  5HT5 A;  4E28 A;  1TSW A;  2AAZ A;  5U26 A;  3S9U A;  1LCA A;  5HUI A;  3IHI A;  2OBC A;  4G2O X;  3UWL B;  1TYS A;  3FRB X;  1TDR A;  3TD8 A;  2O7P A;  4KBN A;  3ROA A;  4H98 A;  1IA2 A;  3BHL A;  4PTJ A;  3FY9 X;  3M09 A;  3K47 A;  1QZF A;  3SA1 A;  1M78 A;  1VJ3 A;  4EIZ A;  1OHJ A;  4O1X D;  2RDA A;  3OCH A;  3QLY A;  4KLX A;  2TSC A;  3NXY A;  4G95 A;  1DDS A;  3B9H A;  3GHW A;  4EZ8 A;  4GYH A;  1BSF A;  1AI9 A;  4KJJ A;  3QYO A;  2TDD A;  1DR6 A;  3QLR A;  4PST A;  5HF2 X;  3BGX A;  2HXV A;  4X5G A;  1JMG A;  1DIU A;  3NZC X;  1DR3 A;  1J3K A;  1RX6 A;  4X5I A;  4IQB A;  4DPD A;  3EX8 A;  4HA9 A;  3HB8 A;  1CI7 A;  1DIS A;  5DFR A;  2FTO X;  4M2X A;  3TMS A;  1RX4 A;  4I1N A;  4KAK A;  4KPW A;  5BY6 A;  2P4G A;  4RGC A;  4LRR A;  3OAF A;  4M7V A;  5HF0 X;  3N5E B;  4X5H A;  3D80 A;  1RA8 A;  3TQA A;  1TSX A;  3INV A;  4FOG A;  1BOZ A;  4XT8 A;  2RD8 A;  3OB7 A;  3EF9 A;  4XT6 A;  1DRA A;  1JMF A;  5FCT A;  1DHJ A;  2QK8 A;  3RG9 A;  5H3A A;  1JG0 A;  1AOE A;  2W3M A;  1IA3 A;  3FS6 A;  3D84 X;  4QLF A;  3TQ9 A;  3GHC A;  4O7U A;  3BHR A;  1CD2 A;  4M6L A;  2W3B A;  5H39 A;  1DLS A;  3DAU A;  1F4F A;  1AXW A;  4KM0 A;  3UWL A;  1J3J A;  1BJG A;  4X5F A;  3QL0 A;  3FQV A;  4M6J A;  3DAT A;  1BID A;  1JMI A;  1KMS A;  3SA2 A;  1RX9 A;  4KYA A;  1FFL A;  3IK0 A;  4O1U A;  1RC4 A;  1BO8 A;  3IJZ A;  3IRO A;  3DFR A;  3F8Z A;  3IA5 A;  3QFX A;  4KEB A;  1AOB A;  4QLE A;  2JYB A;  2OIP A;  4DDR A;  4ISK A;  3NZ9 X;  1VZD A;  5ECX A;  1TSM A;  4P66 A;  2W3V A;  1BQ2 A;  1E26 A;  3FRA X;  3JWK A;  3KY8 A;  3GH2 X;  3FQC A;  1F4B A;  3DRC A;  4FHB A;  2H2Q A;  1RX5 A;  3NRR A;  1B49 A;  1AJM A;  5JA3 A;  4NX6 A;  4H0R A;  4HOE A;  5HSU A;  4E5O A;  1RX1 A;  3F8Y A;  1BO7 A;  3F0B X;  3K74 A;  2G8D A;  1TVU A;  5ECC A;  3SRU X;  1TVV A;  4ECK A;  5HVE A;  4KJL A;  1LCE A;  1VZC A;  1F28 A;  3DGA A;  1DYJ A;  3NU0 A;  3QYL A;  4EJ1 A; 
#chains in the Genus database with same CATH homology
 1TIS A;  3RO9 A;  2FZI A;  3N5E A;  1DHI A;  3I3R A;  1JU6 A;  1DRH A;  1PDB A;  3B5B A;  3EAW X;  4KD7 A;  1J3K C;  3ED7 A;  3V8H A;  4DQ1 A;  2W3W A;  4G3M A;  1BP6 A;  1NJE A;  4QI9 A;  4KFJ A;  2BLA A;  4ELF A;  1TSL A;  5H38 A;  1AIQ A;  3QLZ A;  4G6W X;  3NXO A;  1M79 A;  2W9G A;  1HFP A;  2ANO A;  2G6V A;  1YPV A;  4Q0D A;  3CL9 A;  1VZB A;  4H96 A;  3EDW X;  3I8A X;  2C2T A;  3KJS A;  1TLS A;  1M7A A;  3DG8 A;  3KGB A;  3F0S X;  2ITH A;  5CCC A;  4PSG A;  3FQF A;  1D1G A;  4ELE A;  5CC9 A;  8DFR A;  3IRN A;  1TSY A;  3FRE X;  5WRN A;  1PD8 A;  3JWM A;  4EB4 A;  4X5J A;  3ZPG A;  1JOL A;  3FYW X;  1QQQ A;  3GI2 A;  4DPH A;  3NZA X;  3TQ8 A;  1MVS A;  3Q1H A;  1DNA A;  4EIG A;  3FL8 A;  1LY3 A;  1RA1 A;  1KCE A;  4JEF A;  4QJZ D;  3GG5 A;  3DL5 A;  1TLC A;  1TRG A;  3C06 A;  3FQO A;  1ZPR A;  1B5D A;  4KM2 A;  4UP1 A;  3IX9 A;  4TMS A;  1DRB A;  3NXT A;  1B5E A;  1RD7 A;  4DP3 A;  1DG8 A;  1J3J C;  1S3W A;  1I00 A;  4ELG A;  4P3R A;  3EIG A;  1S3Y A;  2B3Z A;  2W3A A;  2KGK A;  2FTN A;  1F4D A;  3F91 A;  1FWM A;  4PTH A;  3LG4 A;  1DAJ A;  1AO8 A;  4H1I A;  3C0A A;  1J3I A;  1SEJ A;  1VZA A;  1DR1 A;  1NJC A;  3QGT A;  1DYR A;  1JUT A;  1OHK A;  1AN5 A;  5EAJ A;  3QG2 A;  1DR2 A;  4XSD A;  1LCB A;  3JTW A;  2CIG A;  4XE6 X;  3ZPC A;  1DDR A;  1S3V A;  3GHV A;  1RE7 A;  4GD7 A;  1U71 A;  4DFR A;  3JW3 A;  4NX7 A;  1RX2 A;  4IXG X;  4FQS A;  1TSD A;  1JTQ A;  1EVF A;  1RA2 A;  1F4C A;  2DHF A;  3SRR X;  4HOF A;  3EEM A;  1HVY A;  4Q67 A;  3JW5 A;  1DRE A;  4IXF X;  4FGH A;  3IA4 A;  3FRF X;  1DG7 A;  1RG7 A;  4PDJ A;  4QJC A;  3SGY A;  2FZJ A;  3SH2 A;  4ELB A;  3N5G A;  1JUJ A;  3DGA C;  1MVT A;  3SRS X;  1TVW A;  2BLB A;  3GH0 A;  2W9S A;  3SRW X;  4OR7 A;  1BSP A;  2D0K A;  4G8Z X;  3FL9 A;  3FY8 X;  2DRC A;  3F0Q X;  1KZI A;  3EGY X;  2G86 A;  1BKO A;  1RX3 A;  1SYN A;  3QJ7 A;  4H97 A;  2TDM A;  4Q6A A;  4EIN A;  3IK1 A;  4LAE X;  3JWF A;  2BBQ A;  4CD2 A;  1RB2 A;  1JOM A;  5HI6 A;  1DG5 A;  4XEC X;  4LAH X;  1TSV A;  1NJD A;  1KZJ A;  3R33 A;  1TDB A;  3QL3 A;  5HVB A;  3NZD A;  1IA4 A;  3DG8 C;  1THY A;  3E0B A;  2FZH A;  1RF7 A;  1F4G A;  4F2V A;  2A9W A;  4XSE A;  1RX8 A;  2L28 A;  3CD2 A;  1BDU A;  2FTQ A;  2KCE A;  3S7A A;  1JMH A;  1YHO A;  1RTS A;  3NZ6 X;  1IA1 A;  3SR5 X;  1KLK A;  4FGT A;  7DFR A;  4I13 A;  4LAG X;  3FQZ A;  3BZ0 A;  2ANQ A;  3K45 A;  4FGG A;  5HQZ A;  4ISW A;  3VCO A;  5HS3 A;  5FDA A;  1VDR A;  1TDA A;  1RB3 A;  1NCE A;  1BPJ A;  3NXV A;  3NTZ A;  1EV8 A;  1HW3 A;  4XT4 A;  5E8Q A;  5JG0 X;  3GYF A;  4KL9 A;  1DR7 A;  1VZE A;  3FQ0 A;  3FYV X;  2W9T A;  4FOA A;  3H9K A;  2W9H A;  2BLC A;  3EJL A;  3UM5 A;  1DDU A;  1J3I C;  2ONB A;  1JUV A;  4TU5 X;  4Q0E A;  4HOG A;  3KFY A;  3UM6 A;  4XT5 A;  4XSC A;  4IXE D;  2BL9 A;  4KNZ A;  3IRM A;  5HQY A;  1LUD A;  1TDC A;  4XT7 A;  2VF0 A;  1HFQ A;  2ZZA A;  2LF1 A;  3QLX A;  1RX7 A;  2HM9 A;  3TQB A;  1RH3 A;  3KGY A;  3K2H A;  3NXR A;  1DLR A;  1DYI A;  3IX6 A;  4KNE A;  3NZB X;  5HT4 A;  2VET A;  1TSZ A;  4EIL A;  3N0H A;  3NXX A;  3SAI A;  1LY4 A;  1U70 A;  4QLG A;  3QLS A;  1DR5 A;  5HSR A;  2INQ A;  4H95 A;  2AZN A;  1EVG A;  5HPB A;  2G8X A;  4LEK X;  1BP0 A;  2XW7 A;  1BZF A;  3F0U X;  2TSR A;  3EEK A;  3EEL A;  4H0U A;  4KY4 A;  5J7W A;  3FRD X;  1TDU A;  3JVX A;  4M6K A;  3SQY X;  3EHI X;  1RA9 A;  3JSU A;  2D5N A;  1DR4 A;  1KMV A;  4KJK A;  4XRB A;  1JTU A;  4HA7 A;  4KY8 A;  2G8A A;  2G89 A;  1TSN A;  5DXV A;  4FOX A;  3SRQ X;  2C2S A;  3QLW A;  1BQ1 A;  1RA3 A;  4P3Q A;  1HW4 A;  4IRR A;  3CLB A;  4GH8 A;  3EEJ A;  5U27 A;  1DYH A;  4O1X A;  2GD9 A;  1F4E A;  4OSG A;  1HZW A;  3UM8 A;  3KJR A;  1PD9 A;  1S3U A;  3BYX A;  4P68 A;  3HBB A;  1HFR A;  3M08 A;  4QHV A;  4ELH A;  1B02 A;  3CSE A;  4M7U A;  1NJA A;  1TJS A;  3EBU A;  1NJB A;  1DRF A;  3JWC A;  2RD8 B;  4PSY A;  3L3R A;  3S3V A;  3DL6 A;  6DFR A;  3F0V X;  4IQQ A;  3BNZ A;  1DHF A;  3HJ3 A;  1BKP A;  1ZDR A;  2CD2 A;  4GEV A;  3F0X X;  2HQP A;  4PSS A;  1CZ3 A;  1EV5 A;  3BFI A;  1DF7 A;  1U72 A;  5HT5 A;  4E28 A;  1TSW A;  2AAZ A;  5U26 A;  3S9U A;  1LCA A;  5HUI A;  3IHI A;  2OBC A;  4G2O X;  3UWL B;  1TYS A;  3FRB X;  1TDR A;  3TD8 A;  2O7P A;  4KBN A;  3ROA A;  4H98 A;  1IA2 A;  3BHL A;  4PTJ A;  3FY9 X;  3M09 A;  3K47 A;  1QZF A;  3SA1 A;  1M78 A;  1VJ3 A;  4EIZ A;  1OHJ A;  4O1X D;  2RDA A;  3OCH A;  3QLY A;  4KLX A;  2TSC A;  3NXY A;  4G95 A;  1DDS A;  3B9H A;  3GHW A;  4EZ8 A;  4GYH A;  1BSF A;  1AI9 A;  4KJJ A;  3QYO A;  2TDD A;  1DR6 A;  3QLR A;  4PST A;  5HF2 X;  3BGX A;  2HXV A;  4X5G A;  1JMG A;  1DIU A;  3NZC X;  1DR3 A;  1J3K A;  1RX6 A;  4X5I A;  4IQB A;  4DPD A;  3EX8 A;  4HA9 A;  3HB8 A;  1CI7 A;  1DIS A;  5DFR A;  2FTO X;  4M2X A;  3TMS A;  1RX4 A;  4I1N A;  4KAK A;  4KPW A;  5BY6 A;  2P4G A;  4RGC A;  4LRR A;  3OAF A;  4M7V A;  5HF0 X;  3N5E B;  4X5H A;  3D80 A;  1RA8 A;  3TQA A;  1TSX A;  3INV A;  4FOG A;  1BOZ A;  4XT8 A;  2RD8 A;  3OB7 A;  3EF9 A;  4XT6 A;  1DRA A;  1JMF A;  5FCT A;  1DHJ A;  2QK8 A;  3RG9 A;  5H3A A;  1JG0 A;  1AOE A;  2W3M A;  1IA3 A;  3FS6 A;  3D84 X;  4QLF A;  3TQ9 A;  3GHC A;  4O7U A;  3BHR A;  1CD2 A;  4M6L A;  2W3B A;  5H39 A;  1DLS A;  3DAU A;  1F4F A;  1AXW A;  4KM0 A;  3UWL A;  1J3J A;  1BJG A;  4X5F A;  3QL0 A;  3FQV A;  4M6J A;  3DAT A;  1BID A;  1JMI A;  1KMS A;  3SA2 A;  1RX9 A;  4KYA A;  1FFL A;  3IK0 A;  4O1U A;  1RC4 A;  1BO8 A;  3IJZ A;  3IRO A;  3DFR A;  3F8Z A;  3IA5 A;  3QFX A;  4KEB A;  1AOB A;  4QLE A;  2JYB A;  2OIP A;  4DDR A;  4ISK A;  3NZ9 X;  1VZD A;  5ECX A;  1TSM A;  4P66 A;  2W3V A;  1BQ2 A;  1E26 A;  3FRA X;  3JWK A;  3KY8 A;  3GH2 X;  3FQC A;  1F4B A;  3DRC A;  4FHB A;  2H2Q A;  1RX5 A;  3NRR A;  1B49 A;  1AJM A;  5JA3 A;  4NX6 A;  4H0R A;  4HOE A;  5HSU A;  4E5O A;  1RX1 A;  3F8Y A;  1BO7 A;  3F0B X;  3K74 A;  2G8D A;  1TVU A;  5ECC A;  3SRU X;  1TVV A;  4ECK A;  5HVE A;  4KJL A;  1LCE A;  1VZC A;  1F28 A;  3DGA A;  1DYJ A;  3NU0 A;  3QYL A;  4EJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...