3KK3A

Hiv-1 reverse transcriptase-dna complex with gs-9148 terminated primer
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
555
structure length
555
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 147
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk3A05
4CF8A 3NKYA 1JXEA 1CSJA 4DL2A 3K57A 4J9QA 4LQ3A 3QIPB 3AVLA 3OY9A 4IKFA 4TY9A 5F8MA 3MXMA 5EDWA 3IG1B 4KV8A 1GX5A 1JXBA 4NLOA 1HNVB 1XHZA 5KG2A 3MTKA 1RA6A 1REVB 5FROA 2FLNA 3NCIA 5KTQA 4CJLA 5KFRA 3Q8RB 5HP1B 4DSIA 4J9LA 5EWGA 4DU4A 5KFSA 4WFYA 3LP3A 1RT1A 4TSXA 1RDRA 2YNIB 3O3HA 1NK0A 2AU0A 4QPXA 4WE1A 5KGWA 3L2WA 2OPRA 4MK9A 1KVBA 5I3UA 1DLOA 4JV1A 3HPHA 1HYZA 1JLBA 4CIGA 3OL7A 5L1IA 1JLCA 3O3GA 4CFCA 4OKEA 3V81A 4CJVA 3QGIA 5F9NA 3GYNA 3PHEA 4XPEA 2EX3A 4M3WA 1WN7A 3PJWA 3PX0A 1S5JA 4HYKA 3SPZA 5E41A 3NBPB 2ALZA 4DTRA 1C1CA 1RA7A 4JRQA 5KI6A 3QZ8A 2XHBA 3DYAA 4ID5A 2HWIA 4DU3A 3LANA 3LALA 1BQNB 3AA5X 4CEFA 3KJVA 1K1QA 2R8KA 3KNAA 1DTTA 3ZT3A 2WHOA 3G0ZA 2B5JB 4DTXA 1CZ9A 3K5MA 4E1MA 1XR6A 1RBUA 3OL8A 1SH2A 3LWLA 3HO1A 4FLUA 4KAZA 1L5UA 3JSMB 5KT7A 4ECTA 5JUMA 4IH6A 2OZSA 4MIBA 3MEEB 1K6YA 1RTJA 4PUOB 1Q9XA 2IOCA 4W5TA 2PYLA 2XC9A 3MECB 2JC0A 3DLEA 1L3SA 1NK9A 3BQ2A 5KFXA 3PO5A 3HVRA 5DQIA 1J5OA 4RW7A 3IAYA 2VA2A 3TR8A 1S1TA 4MKBA 1Z26A 2Y1JA 2ATQA 3OYLA 4KHUA 1RDAA 2QXFA 3DLRA 4GW6A 1SKWA 1FKPA 2RPIA 1GOAA 4NLGA 3SV4A 3SZ2A 1S9EA 2FLPA 4CJSA 2GC8A 4FJKA 4ED7A 1IKXA 4TY8A 4KHNA 1JXLA 2X78A 3V6DA 5KFIA 1RT2A 3DM2B 4FLWA 3UDLA 4MQ3A 1R0AA 4OPKA 2OPPB 4IDKA 1U45A 4O5BA 2DFEA 5HBMA 2AQ4A 5DMRA 4XIUA 1C0UA 5HLFB 1HQUB 4KB1A 4DQQA 2V4RA 2DFFA 2AWZA 2D0BA 4CF0A 1CXQA 1WSFA 3I0RB 2DPIA 4NYZA 1JX4A 1VRUA 1NKBA 3S3OA 3V4IB 4WZMA 4QWBA 1EETB 1NK7A 3DRSB 1S9GA 3BDPA 1TVRA 1RBVA 4KKOA 4O4GB 3V9XA 4O55A 1HJRA 4DSEA 3CO9A 1LW2B 3NDKA 5L1KA 1HMVB 4FBTA 4ED6A 3L3UA 4DF4A 3BQ0A 2G8UA 2RKIA 1N5YB 2BDPA 4NLXA 2NUBA 3V1RA 3TAFA 1TKZB 4TYAA 1TGOA 4YR3A 2BRKA 1VSDA 5KGXA 2X6SA 1X9WA 3LP0B 4J9RA 4DQIA 1RTIA 3TAQA 4I2PB 3TI0A 3OS2A 1TAQA 4DMNA 3QO9A 3GIJA 3CWJA 2AGQA 3VQ9A 3DLBA 1TL3A 5J2QA 3QGHA 3OYEA 4CF1A 4NZ0A 3M9OB 3OJSA 3H98A 2IJFA 4ZVHA 4DFKA 4DL3A 4O3SA 1N4LA 5F8NA 1SUQA 3V6JA 1N6QA 4EYHB 5JS2A 4NLTA 1T03A 1BQMA 2HHXA 3FQKA 3DMJB 1RILA 2YV0X 4PWDB 3F9KA 4TN2A 4FJXA 3NAIA 3T3FA 3MR5A 1RTHA 3O4NA 4IFVB 4R0EA 2IJNA 3LWMA 2WB4A 4FJIA 3KLIB 3K5OA 4DEZA 5KFJA 2ZE2A 3ULDA 1RBRA 3OHBA 5FDLB 2UUWA 3RAQA 1IKVB 3SNNA 5C25A 3NH1A 4J9PA 4C8LA 4ICLA 3NL0A 1JLEA 1VSIA 2OH2A 4YMEA 2BQ3A 1JLQB 1QE1A 3RRGA 4HTUA 1BI4B 1ASUA 2RF2A 4IFYB 2FVPA 4WFXA 2R8GA 3D5MA 5KG0A 4NLRA 4H8KA 3HVTB 5KFCA 5HROA 4RNFA 4DSFA 3VA3A 1GOCA 4HUGA 4ZPCA 4U6PA 3T1AA 1FK9A 3RB4A 5FRMA 4NLDA 2OPQA 2RDIA 1IH7A 5KFNA 1S4FA 3Q8SB 3OYMA 3QLHA 4M3ZA 3DI6B 2JLEA 1U49A 1IM4A 3HYFA 3KKRA 3T5JA 1DTQA 2UVRA 2HVIA 5KT5A 3DOKB 5KFTA 3LDSA 2OZMA 3EZUA 5HRPA 2X74A 4KHQA 1RT6A 1XR5A 5J2NA 3ZSQA 4RZRA 3KLHB 5CYMB 1NHVA 3SPYA 4FJ5A 1X9MA 1HYVA 3MR3A 3H5YA 1FXXA 2W8LA 4JS4A 2HAIA 1ZYQA 4H4OB 3AVJA 2PZSA 4MFBB 3KHRA 1JL1A 4RW8A 1D5AA 4I2QA 1JLGB 3T19A 4DL4A 4CCHA 4IR9A 5DGBA 2UUTA 5KG1A 3CYMA 3PW0A 3P5JA 1C6VA 4J2BA 2AX0A 2W9BA 2GUIA 3SFGA 4N41A 3QEPA 5J2PA 2EHGA 4O4RA 4YNQA 3NAHA 4JUZA 3ITHA 1TK0A 5DGAA 4ZMMA 1NJZA 4IBNA 1NK4A 4NCGA 1SH0A 4GC6A 1ASWA 2VG7B 2G8WA 2IM1A 4KFBA 4DFMA 4CE9A 1F21A 1YT3A 3CG7A 1LWCA 2CKWA 4QW8A 4F8RA 3I5CA 3UIQA 4CIEA 2IA6A 5C24B 4ECZA 4YQWA 3TAMA 1EXQA 1S1XA 1CLQA 2WONB 4C8MA 3DDKA 1QAJA 4N5SA 4RW9B 3THVA 3PR4A 4CJKA 3AA2A 1RT5A 1T3NA 1LWFB 5KG3A 4RUCA 4Z4HA 4TLRA 2HNZA 4I7FA 3C94A 3EZ5A 3KK2B 4BDZA 2ILZA 2HMIB 4Q8EA 2FBYA 3HHKA 2HHUA 3OYGA 4DSJA 2EC0A 4EO6A 5KT2A 4RNOA 2R2SA 4KSEB 4DLEA 4CEBA 4K4TA 5KG5A 3DLGA 2V0NA 3EPIA 4RNNA 1S1WB 2GV9A 1ZTTA 4EP4A 4ZHRA 3BGRA 1TL1A 2FJXA 3V6HA 4O44A 1K1SA 3IN5A 4CEOA 3HK2A 4CEEA 2PY5A 3IGVA 2XRIA 3KLFB 4CJ3A 5K14B 3I5BA 3G6XA 3V1QA 4HCCA 2AGPA 3KK3B 4YP3A 3HL8A 1I6JA 1KCFA 3QIPA 3KTQA 3K59A 1CXUA 1C1BB 4F4KA 3N6LA 3L2VA 3VQEA 4XPCA 3IG1A 5C5JA 4YR2A 4FK2A 1HNVA 4Q0BB 3BQ1A 4IG0B 4F2RA 5SWMA 1KTQA 5KFZA 1REVA 4ID1A 1JLFA 2XCAA 5KRTA 5HP1A 3RB3A 4HHTA 4B9NA 4KHWA 3PZPA 2BR0A 1O1WA 2O5DA 2YNIA 4J2AA 4CJQA 3QETA 1C0TB 4WYLA 3H4BA 4K8XA 4DS4A 4CIFA 3MFIA 3H5SA 1A5XA 1HRHA 3T5KA 3QGGA 3ZSXA 4E1NA 1KLMB 1QSLA 3OYCA 4F4ZA 3NBPA 3NH2A 4B9SA 4CJ5A 2YNGB 1HNIB 1S49A 1T8EA 3HVAA 4G3IA 4NLVA 2VG5B 2E9RX 4KI4A 3VQDA 4FK4A 1BQNA 4GMJB 1LV5A 2B5JA 1KLNA 3PV8A 1RCHA 1YTAA 3WNGA 4CGFA 4ECXA 2F96A 2F8EX 3RB6A 2ITGA 1S48A 4J9NA 3GIKA 3JSMA 4DTJA 1IKWB 3MEEA 4PUOA 5KFDA 3ISND 3MECA 4IOBA 1WAFA 4CEAA 2DFHA 1TKTB 3DRPB 5DG9A 1Q8IA 5CYQA 4Y3CA 1NJYA 3QIDA 5KG6A 1ZBIA 1X9SA 5L1LA 4Z4GA 1BIZA 4DTMA 5KT3A 3VQBA 2VA3A 2P5OA 1QQCA 4FM0A 1MU2B 3OYIA 2D3ZA 3PR5B 1RT3B 1TKXB 5J1EB 4ELUA 2R8HA 1WAJA 1S6QB 4PQUB 1LW0B 3KLGB 5KT6A 1S1VB 4M45A 1U47A 2R2UA 3DM2A 3KD1E 2OPPA 1TK5A 3M8QB 1OS5A 4FLZA 3LP1B 2YHAA 1WNSA 3PW4A 3VN5A 1RT4B 5HLFA 3GILA 1HQUA 4KO0B 2E9TA 5KT4A 2W42A 3AO1A 3SJJA 3I0RA 4AILC 3DLKB 4CEZA 4ECQA 4CESA 3BJYA 2KTQA 3HT3A 5DG8A 3P83D 3SQ0A 2C2RA 1KVCA 2HNYB 1JLAB 3V4IA 1EETA 4DLGA 3DRSA 2D41A 4ZP7A 1ITGA 3HM9A 3LP2B 3RTVA 4O4GA 2R8JA 1BCMA 4AHVA 4C8NA 2BE2B 1LW2A 2IC3B 1HMVA 1BIUA 5KFAA 4FLXA 4CK3A 2AJQA 3KLEB 4ZPBA 4R5PB 2E4LA 4B08A 4KB7A 1N5YA 1S0OA 3KMQA 2W7PA 4CHYA 1ASVA 1TKZA 4E89A 2PYJA 3LP0A 3NF7A 3OYAA 4J2EA 5KFOA 2WOMB 2XY7A 1UA1A 2R8IA 4I2PA 2D7SA 3BSAA 5KFFA 1TP7A 1EP4B 5J2MB 3PX4A 2OPSB 3MAQA 2J6UA 3CJ4A 1RYSA 4KREA 2E6MA 4CGHA 4M3TA 4B9MA 1TV6B 5I42B 4G1QB 5F8GA 4LH4A 3V9ZA 4ZTJA 4M3XA 1Z4UA 4FLVA 2C2EA 3RR8A 1S10A 4YFUA 2JEFA 1JIHA 2Z1JA 4O0IA 4M3YA 1RDBA 3PVXA 1A5WA 5EU7A 5FRNA 4BE2A 3AO5A 2JGUA 4AHCA 4DTUA 2FBXA 4PY5A 4E3SA 3AVIA 3M8RA 5CZ1A 3SUNA 5DQGA 3CFRA 4KE5A 2HHTA 3E51A 3DMJA 3TAPA 4N56A 4PWDA 4HCBA 3VQ6A 1HYSB 4CFAA 4IFVA 4FJMA 2I1RA 4CK2A 3KLIA 1W25A 1VSKA 4W5RA 2IS3A 3V9UA 4KHSA 3AVKA 5FDLA 3H2LA 3CDWA 4W5OA 1IKVA 3UQSA 1RYRA 3M8PB 4CHZA 4E0DA 2FVRA 5DQHA 1KRPA 2F8TA 3O4QA 4ELVA 3JYTB 1JLQA 3RMBA 4FM2A 3CM6A 3DOLB 1BI4A 4DFJA 5KFEA 5HRNA 1D1UA 4NRTA 2D0AA 3MEDB 2RDJA 3QESA 3SI8A 3H4DA 2YKNB 3HVTA 3QERA 4CECA 2KZZA 3LZIA 5C42B 4TQRA 2AGOA 3OLBA 4EBDA 2I5JB 3QNOA 4K4WA 3V9WA 2XY6A 1VRTB 1WSGA 3ZT2A 1S97A 3DI6A 4OKKA 4RW4B 4M3RA 4O3RA 3ISNC 3HVWA 2FVQA 3M9MB 3MR6A 4K4UA 1D0EA 3DOKA 4HUEA 2VG6B 3I0SB 4QWCA 3G10A 1LWEB 3KLHA 3HKWA 3NAEA 4ZP9A 4ZPAA 3AA3A 4CK1A 3NGIA 2HHQA 2FJVA 4J2DA 4H4OA 3KHLA 3SQ4A 4MFBA 3QYYA 4TQSA 3OS0A 2IAJB 3DRRB 1JLGA 2ASDA 3GV7B 1NK8A 4JV2A 4CJUA 4IRCA 3H59A 4F3OA 4M41A 5F8JA 3L2RA 5KFBA 4IQXA 3OL9A 1HQEB 2XGQA 4OLBA 4K4VA 3S9HA 4MKAA 3PUFA 3K5LA 4JRPA 3I5AA 2HW3A 3C95A 1SKRA 4BDYA 3KK1B 4ED1A 1ZTWA 2QK9A 1TAUA 4B9TA 2VG7A 2IM3A 4NLPA 2JEIA 2ILYA 4CGDA 4W5QA 5KG7A 4U7CA 4M42A 3QEXA 4EZ6A 5C24A 4QW9A 2XI3A 3CJ5A 2UVUA 3FDSA 2WONA 3BSOA 1RDCA 4RG8A 1NHUA 1JKHB 4RW9A 3OYKA 2HB5A 1S1UB 3SUPA 3CJ0A 3ZSOA 5KFLA 1NOYA 2IM0A 1LWFA 1UA0A 5DLGA 4BDPA 3KK2A 2HNDB 4K4XA 2HMIA 2FLLA 2G8IA 4OGEA 2D5RA 4BWJA 3ZT1A 3P1GA 4N47A 2R7YA 3TANA 4IRKA 3AO3A 3G6YA 4ED0A 5KFHA 3PX6A 4FXDA 1S1WA 5DG7A 3L3VA 4NLSA 5KFGA 4URSA 4HKQA 3KLFA 1YVFA 2O4IA 5CY4A 5K14A 3A2FA 3KK3A 4F2SA 4FW1A 3BREA 4WYWA 4QWEA 3OYJA 4F3TA 3C6UB 4MK8A 5F8HA 3WNEA 1C1BA 3VQ4A 1BCOA 2WTFA 3L2UA 4Z4FA 4Q0BA 4H4MB 3OLAA 4I9LA 4IG0A 1TK8A 2JEGA 4K4ZA 1GX6A 1FKOB 3CDEA 4IKAA 1RBSA 1RT7B 2YKMB 4BWMA 3SI6A 4KHMA 4H54A 1WSHA 4JV0A 1SV5B 4FS1A 3PJXA 1C0TA 3AVMA 4FK0A 2J6SA 4KRFA 2XCPA 4Q44A 3AVBA 2G8HA 4FLTA 2QV6A 4FW2A 4OPJA 4MH8A 1KLMA 5KFQA 3AA4A 4DG1B 3VQ5A 1T05B 4NYNA 3KLVA 2E9ZA 2YNGA 3C6TB 4BE0A 4OKJA 1BL3A 1HNIA 1HPZB 1A5VA 1VSJA 1TQLA 5KRSA 5JS1A 3CDUA 2VG5A 4J9MA 4HVJA 3KMSA 1RTDB 3AO4A 1VK0A 3IS9B 4M94A 3IRXB 1UAXA 4Y2CA 1NJWA 1D8YA 3CQ8A 4DFPA 4FJLA 1KVAA 3FRZA 4DTNA 3PO4A 4DTSA 5D3GB 3KIOA 3D28A 4CHPA 1ZBUA 2BQUA 1SL2A 1IKWA 3HP6A 4JLHA 2XI2A 3SFUA 5KG4A 4O0JA 2GIRA 2FBTA 1TKTA 3ZSYA 4CJPA 4CJRA 3DRPA 3FFIB 4DL7A 4CGGA 4DU1A 3B6PA 1KFDA 4CJ4A 1N48A 2YNHB 4CF2A 3PW7A 3L8BA 3OSPA 1QSYA 3OYDA 2XGPA 3HXMA 2C28A 2BGGA 3EPGA 1SL1A 1MU2A 3S3NA 4NCBA 3KHGA 3SQ1A 1RT3A 2LSNA 1TKXA 5J1EA 3MXIA 1Y97A 3T5HA 3GV8B 3N6NA 1S6PB 1S6QA 4PQUA 5L9XA 4Q45A 4AHTA 5KFMA 1LW0A 4K8ZA 3MEGB 1W9HA 4CERA 4KI6A 1C1AA 4FCYA 4L8RB 3MFHA 3KLGA 4M95A 3ZSRA 1S1VA 3NH0A 3QEIA 1B92A 3VQQA 4FZZA 4FM1A 3MF5A 3H5UA 1LAVA 4NLYA 4FYDA 3M8QA 2B6AB 3ZSWA 3LP1A 3E01B 4KB0A 4B9VA 2XWYA 1RT4A 1QAIA 4K4YA 4KO0A 4FJ9A 2ZD1B 4FZYA 3DLGB 2XY8A 1IKYB 3VA0A 1TKDA 1C2PA 4DS5A 4QOZB 4AHRA 2V9WA 5KFWA 3DLKA 4KAIA 3UR0A 3NHGA 1I3AA 3RMCA 2HNYA 3O3FA 3LZJA 1J53A 1JLAA 2BANB 3GIIA 4E19A 4LSLB 4AHUA 2YNFB 4BACA 3LP2A 2OA8A 4CEDA 2BE2A 2IC3A 4Q5VA 4CJTA 5HRSA 3SQ2A 3KLEA 1JL2A 3Q8PB 1S0NA 4R5PA 2VWKA 1SKSA 4DTPA 4I9QA 3RR7A 5CZ2A 5EWEA 4K4SA 2AX1A 4FZXC 3OSNA 4E7KA 2DTUA 4RU9A 3CJ3A 4WFZA 3D0PA 5KFVA 1VSHA 1D9FA 1JLFB 2W9AA 1L3VA 4C8KA 2WOMA 4CGJA 1UWBB 1EP4A 5J2MA 2OPSA 1D9DA 4WXWA 4R8UB 3T5LA 2WRMA 3OJUA 1TV6A 5I42A 3AVAA 4G1QA 3RAXA 2GBZA 4LSNB 3ASMA 4IG3B 4J9OA 1NK5A 4Y34A 4ED8A 4Q8FA 3HP9A 2W9CB 3Q8QB 3OS1A 4KTQA 1KSPA 2Q3SA 4OLAA 3QIOA 4EP5A 4NLWA 1WSEA 3K2PA 3U6FA 4B3OB 1NK6A 1QTMA 1U04A 5HRRA 4K50A 1B9FA 1WNEA 4RW6B 1HYSA 3PY8A 3RBEA 3S3MA 4B8AB 4QWDA 4NCAA 4FJGA 1L3TA 3M9NB 4WZQA 4PA1A 1W0HA 1RBTA 3CVKA 3PW5A 3QINA 2BRLA 3NF8A 1C0MA 3VQ8A 3M8PA 2DY4A 3JYTA 1Z25A 4KV8B 3ICLA 3MR2A 3DOLA 4C8OA 4NRUA 3NF9A 3MEDA 3OYFA 2YKNA 5C42A 5F8LA 3OYHA 1KHVA 1I39A 5CYQB 2I5JA 2KZMA 4NLQA 3FQLA 1RT1B 2R2TA 3U3GA 1IG9A 4KPYA 1XI1A 1IO2A 4WE1B 2R2RA 1VRTA 1BGXT 2OPRB 2ASJA 2XY5A 5I3UB 3D45A 1DLOB 2JC1A 4ECSA 1LAWA 4RW4A 4LQ9A 2UVVA 1JLBB 4CFDA 1JLCB 1Q9YA 3V81B 4TXSA 1N56A 4EZ9A 1GOBA 4GVMA 3NE6A 2VG6A 3I0SA 1ZBLA 3IGNA 2D0CA 1LWEA 1C1CB 3VQ7A 4IH5A 4OJRA 3EYZA 4ZPDA 1ZBFA 1YTUA 3DYAB 2IM2A 2E6LA 4ID5B 3ZSZA 3VQPA 4CEQA 2HHWA 3OYNA 3GV5B 3CIZA 4EBCA 3KJVB 4ED3A 2D3UA 4EO8A 2QKKA 1DTTB 2IAJA 3ZT4A 3DRRA 2C22A 4QCLA 3RMDA 4URQU 4Y2AA 2Z1HA 1U48A 4QAGA 1HQEA 2IBKA 3VQAA 2KFNA 3WNFA 2FBVA 4Z4EA 5KFPA 3ZCMA 4ZTFA 4UQGA 1RTJB 2B43A 4IFYA 1QHTA 4O3NA 3QNNA 3DLEB 3KK1A 2WCXA 1J5OB 4RW7B 3QEVA 1KFSA 1S1TB 1U09A 3AO2A 2F8SA 1S9FA 4J9SA 2ASLA 4LH5A 4CHQA 3LAKA 3AV9A 1FKPB 3OVNA 4FBUA 1T7PA 2QKBA 4ECVA 4FS2A 3KHHA 1JKHA 3GQCA 2RN2A 1S9EB 5KFUA 4NYFA 1S1UA 5SZTA 4X2BA 2Z1GA 5DK5A 2KQ2A 5KFYA 3V1OA 4ZVFA 1IKXB 4DL6A 4RNMA 4TY8B 5CYMA 4AH9A 3V6DB 3N6MA 1VSLA 4AHSA 4B9LA 2HNDA 1RT2B 4CFBA 1R0AB 1VSEA 2FC0A 4DWIA 1SH3A 1VSMA 4OVLA 4IDKB 4LY7A 1BHLA 4KTWA 3TAGA 1MMLA 2V4QA 5HBMB 1NOZA 4OGCA 4KTZA 1CZBA 3AVFA 2ETJA 1C0UB 1UOCA 2X6NA 4CJFA 2HVHA 1B9DA 5T7BA 3TQ1A 3TAEA 4MK7A 2G8KA 4LD0A 3H5XA 3I8DA 4W5NA 4M3UA 3HPGA 3BSNA 3DLHA 2Z1IA 1VRUB 2GIQA 3B6OA 3SYZA 4CHNA 2C2DA 1QSSA 4CJEA 4ZP6A 4EBEA 1S9GB 3ALYA 3FSIA 1TVRB 3C6UA 4KKOB 3SCXA 3NFAA 5T14A 2P1JA 4FJNA 4Z4IA 4HUFA 4FJ7A 4WXOA 5EWFA 4GC7A 1ZETA 1T94A 4Q43A 2RKIB 2A1SA 4DF8A 4ECWA 5KFKA 4H4MA 4O3QA 4RNHA 3AVHA 3KKSA 4ECRA 1FKOA 1RT7A 2YKMA 4B8CA 2KW4A 4F50A 1RTIB 2IDOA 2YHBA 1SV5A 3F73A 3LAMA 2UVWA 1U4BA 1YVUA 2A1RA 3WNHA 3QO9B 4B9UA 4Z0UA 3RBDA 4Y1DA 4E7LA 1S0MA 4KHYA 2IGIA 1TL3B 5J2QB 3RRHA 3AVCA 4E7JA 3ZSVA 4DG1A 4ZVGA 1T05A 4CF9A 3C6TA 1SUQB 4E7HA 2FVSA 3H40A 1N6QB 1HPZA 4MIAA 1J9AA 1BISA 4ED2A 5DLFA 1XC9A 1T03B 1BQMB 1RTDA 3IS9A 1SL0A 4CGIA 2G8VA 3U3YA 2J6TA 3AVNA 3IRXA 1RTHB 1X1PA 3RB0A 4KHRA 3LPUA 2KFZA 3SUOA 3UPFA 1NKCA 1WSJA 2ZE2B 2P51A 4ZVEA 4N76A 3LPTA 5D3GA 2HHVA 4NLUA 5C25B 4ICLB 1WSIA 1JLEB 3OYBA 4DQSA 4FJ8A 1QE1B 3TABA 4FLYA 1WLJA 2RF2B 4FVMA 1L3UA 3FFIA 5HROB 4DSLA 3G86A 4ZP8A 2W7OA 3HSTB 2YNHA 3VQCA 1NKEA 4URGA 2HHSA 3BR9A 3QZ7A 3M8SA 3NGDA 1FK9B 2QE5A 1RDDA 2OPQB 4O3PA 2W8KA 3QLHB 5JXSA 4J9KA 3SUQA 3NMAA 1DTQB 4EYIB 2BQRA 1S6PA 4F4YA 2G8FA 4BE1A 3MEGA 4YR0A 3CFPA 4IRDA 5F8IA 1RT6B 3NF6A 5J2NB 4TYBA 1RNHA 3AVGA 3H08A 3PW2A 3RWUA 4FJHA 4O3OA 5EUHA 2B6AA 3RMAA 4KBIA 3E01A 3V9SA 3KD5E 3BSCA 1VSFA 4CJWA 2IMWP 4RW8B 1XHXA 3V6KA 4I2QB 4Y1CA 2ZD1A 1IKYA 2ZQBA 1XWLA 3QEWA 3NGYA 1EX4A 1NNDA 4DTOA 4QWAA 2W9BB 3KOAA 1NJXA 3VQSA 2BANA 2O4GA 3CM5A 4F4WA 1EKEA 5J2PB 4LSLA 4F4XA 2YNFA 3ITHB 3L2QA 4ELTA 2DPJA 1XR7A 2JEJA 1J54A 2ZKUA 2ATLA 4NCGB 3OL6A 3GIMA 3K5NA 4KFBB 4ECYA 4JS5A 4E7IA 3TARA 1G15A 3HJFA 1LWCB 4DQRA 2OYQA 4ECUA 2Y1IA 4DL5A 3G6VA 3TAMB 1S1XB 2FVCA 2WK4A 2FJWA 3K58A 4DQPA 1UWBA 4FJJA 4XO0A 2HWHA 3CJ2A 3ZT0A 1RT5B 4R8UA 1QUVA 4DSKA 4OL8A 4LSNA 3TVKA 2HNZB 4I7FB 4IG3A 4IH7A 5L1JA 3HPOA 1KHWA 3OHAA 1RAJA 3EY1A 4CHOA 2W9CA 2CJQA 4Z4CA 1ZBHA 1QS4A 2XO7A 2P5GA 4B3OA 3SV3A 4RUAA 3MXJA 3TWHA 5F9LA 4RW6A 4EEYA 3CFOA 4IR1A 4ZHRB 3BGRB 1TL1B 4O44B 1HARA 2VWJA 3NGZA 2B4JA
chains in the Genus database with same CATH superfamily
4BVPA 3NKYA 1JXEA 4DL2A 4PYAA 3AOBA 4J9QA 4LQ3A 4C1NI 4DR7F 2Q0RA 2OEMA 2VB6A 3QIPB 1KOOA 3M3ZA 3MXMA 5EDWA 3UVJB 2YH0A 1UEKA 3HD2A 2HPUA 2B51A 5FROA 3N4QA 4FWSA 2R4FA 3OTOF 3T41A 4EGLA 4EU0A 5EWGA 4DU4A 2J4RA 2HG4A 2HFNA 4WFYA 5GVQA 4DR1K 5FLXY 1VK8A 2U1AA 4OX9K 3UE2A 1WC5A 1ZM4A 3IP0A 2OPRA 3W8PA 4BROA 2GS8A 3HPHA 1U1QA 1ZA1B 4CIGA 3IR6B 5AXMA 4Q2LA 3O3GA 3V81A 3QGIA 1M5KC 3DXMB 3GYNA 3PHEA 4XPEA 4TVAB 3HZGA 4USJC 2MZJA 4MDAA 1C4AA 4CLZA 3SAHA 3MHYA 4ANDA 2BJ1A 3VEVA 2NRZA 3DYAA 4LF5F 2HWIA 3EXCX 5IQ6A 2UUAJ 3VZHA 2R8KA 1DTTA 3QGPA 4B3MK 2VL1A 1PJ6A 3HX9A 5CCMA 3OL8A 4DUZK 1SH2A 4CLFA 2AEJA 3QJPA 3DHWC 3UDVA 2G9OA 3FMBA 3CCVS 3JSMB 1L5UA 4IH6A 2OZSA 2LXFA 4MIBA 1K6YA 4PUOB 2WVDA 1QVGR 2NRHA 3AT1B 4DPUA 3DLEA 1RHQB 3BYRA 3ENHA 1S1TA 4MKBA 4KHPJ 3THXA 1HNZF 1J27A 2ATQA 2R7WA 5MAOA 4C11B 2QXFA 1Y5NB 3POTA 2F9TA 2PBDA 2L08A 2GHVC 4LF9K 3LDLA 3HSGA 3SZ2A 2FLPA 3C8YA 1HHTP 4ETZA 3E9LA 2KKHA 4ED7A 4OX7A 2G2YA 4JKHA 2EXUA 4FYVB 4P6QA 3FZKA 3DM2B 3UDLA 4OPHA 4IDKA 1Y5LB 5D4NA 2DFEA 2QC3A 2AQ4A 5DMRA 4H0TB 4BQLA 1EARA 2VUGA 1W7WA 3UCZP 5T7LA 1FEHA 2DJWA 3BZCA 2DFFA 1FDBA 2ZJQQ 5LM7E 1HR0F 4NYZA 5AQVA 3SDEA 3NEKA 4LFBK 5D8HB 4UY85 4WZMA 3M2RB 3P45B 2JFKA 3V9XA 1LW2B 5L1KA 3BP8A 4ED6A 1IXKA 2G8UA 2RKIA 3J7YP 4NE9C 2G2ZA 2V2QA 2NUBA 3TAFA 4TYAA 4NXMK 4YR3A 5EOYA 1VSDA 2X6SA 2QEXS 4J9RA 2I9SA 4NX9A 1U24A 1E6VA 3C3LA 2P9KB 3TOQA 1TAQA 3HDSA 3QO9A 5D4OA 3CHWA 3C7NB 1Q95G 3CWJA 4ZVUB 2ASYA 3QB0A 3VQ9A 3DLBA 3MN9A 5J2QA 4LBIA 2R7OA 2WAQD 1JCFA 1NLVA 3FZBA 5AQIA 1Y3KA 2BBEA 5DRKA 3A8YA 5F8NA 3V6JA 4FWPA 1S6UA 1T03A 3B78A 3PRVA 4ZOSA 2HHXA 3ZZYA 1Y0HA 1YSJA 3ZO7A 3ZTQA 2MKYA 4PWDB 3NAIA 3MR5A 3LWMA 2IJNA 1WHVA 1JCEA 3CIMA 3ULDA 3VGTA 5FDLB 3RAQA 4Y0FA 1PC5A 1S77D 1IKVB 3G87A 2CIMA 3NL0A 1JLEA 5IWAF 2OH2A 3UWTA 4X66K 1IJJA 1ASUA 4B3TJ 4MO4A 4JKFA 5KFCA 5HROA 2P8IA 1TFWA 2IPOB 1OQ3A 7FD1A 3T1AA 2DNQA 2UZAA 4ZLLA 2IVOA 2OPQA 3JSYA 2RDIA 5KFNA 4I6YA 3Q8SB 3AODA 3QLHA 4M3ZA 1K9MO 2JLEA 1IM4A 3KKRA 3W2VA 3T5JA 1DTQA 1JJHA 3ZXWA 2NRXA 2NRWA 5KT5A 1R59O 1Z2LA 1IBKJ 2X74A 4KHQA 2PI5A 4MKVA 1NPRA 1WTBA 3R1LA 1BO5O 1QVGM 4FJ5A 3MR3A 2W41A 3KUHA 4JS4A 2HAIA 3EDQB 1ZYQA 1B70B 5AFUA 3CCLN 3BO2A 3TUJC 1RAIB 2GWJA 2E5HA 2C3OA 3KHRA 4RW8A 1JLGB 5B8HA 3H46O 3MWPA 1FE4A 1U2RA 4DL4A 5KQDA 2W6KA 4CH0S 3PIPQ 4IOCL 5KG1A 3PW0A 4P2XA 2MSTA 5B0BA 2W9BA 3R2DJ 2ZJPL 3FJ2A 2IYIA 3VGKA 3NAHA 4JUZA 4EHUA 1N88A 4ZMMA 1UJ5A 3LO3A 4KC5A 4FF1A 4OLOA 5B0DA 1NU0A 2JFDA 4GC6A 1BDGA 4LF7J 3ISZA 4DPTA 2P9CA 2VQEK 4LF8J 1LWCA 2CKWA 2M7SA 2H51B 4JV5K 2HQCA 4CIEA 3TAMA 1EXQA 4L73A 4OJ3A 3JQKA 3THVA 4LBHA 4ED5A 1PILA 7AT1B 3AA2A 3AQPA 4RUCA 3IBCB 1ZC6A 4TLRA 4I7FA 3PXGa 3DRXA 3NS5A 3MAHA 4BDZA 2N82B 2XMTA 3AOAA 3H25A 4DSJA 4DV1J 4O8UA 4EO6A 4DPOA 5LOQA 2BTFA 2G0JA 3EPIA 1R3NA 2EK1A 4BR2A 3UKRB 3BB5A 4JBCA 2W4CA 2Z56B 1EQ0A 3BGRA 2FJXA 4CEOA 2Y9HA 1MMDA 1QQOA 2MGZB 2XRIA 3AD7C 3L7UA 4CJ3A 5IOLA 1GFWB 3O9RA 3V1QA 3G6XA 4HCCA 3HL8A 1NO8A 2G13A 2ZH8A 2ZBPA 2E1MC 3K59A 3N6LA 3L2VA 3VQEA 5C5JA 1IUJA 1NDKA 4FK2A 1HNVA 4Q0BB 1W97L 4IG0B 1KTQA 5KFZA 4ZKAA 3GSIA 3IWNC 2HFSA 3CD6S 1YIJS 1JLFA 2YQ0A 1ZPVA 3TA0A 3RB3A 4B9NA 4DV7F 3H45C 1BQXA 2O5DA 3HF5A 2V8DA 3HRGA 1OY9A 5E3QA 4WFBL 1A5XA 3T1YK 1DKGD 2CPJA 4NI2A 1N32J 1HRHA 2ZM6K 4CZEA 3ENQA 3CCZA 3Q89A 4LF2A 3H6EA 1R27B 1WG5A 4C7QA 2GNKA 4ZJLA 2QIFA 2B7CB 1OWXA 2VG5B 2E9RX 4FKYA 5BRFA 5HOOA 4H0XB 2MYFA 4BRDA 3KWMA 3HLUA 3S1TA 1PGZA 3C15A 4BR5A 4ECXA 2F96A 2RU9A 3FNNA 4LF6J 4ID8A 1Q8KA 3CGIA 3QICA 1FXDA 3TSUA 3R5AA 4ALZA 4F26A 1TKTB 2GV1A 4NXNK 2BX6A 1DQ9A 1WHWA 5BRDA 1UW9A 4DR2J 1Q8IA 3H3OB 5DETA 2KM8C 3QIDA 4JI0K 1ZBIA 4Z4GA 1KNZA 2BV3A 3IKMA 2D3ZA 2M0GB 1TKXB 3QT6A 1X8DA 5E3AA 1SIWB 1LW0B 1FXRA 5KT6A 3VR1A 2AMCB 3PKYA 4FPAA 3R3TA 1OYDA 1NSAA 4FLZA 3LP1B 2YPYA 2HF3A 4DI6A 1RT4B 3GILA 2PFDA 4DUYF 4LRCA 2W42A 3AO1A 2ZFHA 3SJJA 1V5IB 1SC3B 4CESA 1J5EJ 2HSTA 2HNYB 2GVDA 2FLOA 2VBXA 1VQ8S 3DXKA 3DRSA 1K47A 6FD1A 5AQNA 2O3DA 4F0HA 1BCMA 4AHVA 5JMVA 2BE2B 4HHUA 1GLJO 1HMVA 3CD0A 4ILLA 4CK3A 3KLEB 4TLQA 4ZPBA 5F3ZA 4X64F 3WUHA 1ASVA 1TKZA 1HNXJ 4E89A 4BRGA 3CE8A 2CGKA 5CA5A 3NF7A 1H73A 4YOVA 8RUCA 4KGVB 3AY9A 4IXCA 4UZBA 4XK8C 2D7SA 1TP7A 1V6HA 1EP4B 4LFAJ 2J6UA 1J6ZA 5E2QA 1RYSA 1F6TA 4M3TA 1RBLA 1M5PC 4M3XA 1Z4UA 2VDHA 3TZWA 2P9LB 2L9DA 3O4WA 1JIHA 2DISA 3PVXA 2VPYB 2H3EB 2XZTB 3NS6A 2JGUA 3LPEA 4DTUA 1HBUB 4PY5A 2V7ZA 1H98A 3RU0A 3E51A 3DMJA 3MM8B 4CI6A 1TL7A 2IIHA 2IMOA 1KQGB 4IFVA 2IRXA 4JYAF 1Q7YO 4S0MA 2IS3A 1HI0P 2HS3A 1KAZA 1M5OC 3TJAA 3UQSA 4AF1A 3L0QA 1FNMA 5IT4A 3O4QA 1JLQA 4JKCA 4NA2A 4FM2A 1PJ5A 4WF9Q 1O0PA 3DOLB 2FZKB 2D0AA 3MEDB 2RDJA 3QESA 1YQHA 3HVTA 4CZCA 4TQRA 4BR9A 2ABYA 3QNOA 2X3GA 2Z30B 2NPFA 1U1PA 1VRTB 1JJ4A 1S97A 3DI6A 4K2XA 4RW4B 2MQQA 2F1FA 3M9MB 3RBXA 2P2CB 4YOUA 5HK4A 4OZ0A 4QWCA 2G0CA 1LWEB 3DXBA 1GLDG 2J0WA 2B56A 4ENOA 3D2FB 4BRKA 4CK1A 1NBWA 2UUAF 1CQNA 4J2DA 2Y8WA 2XB2D 2QA4G 2BJEA 5GMKa 2CPHA 4WKYA 3OS0A 1RWWB 3JQMA 3ONQA 2W24A 3OTBA 3HOSA 2NUHA 5D0HA 4OHWA 4GNIA 4DR6K 4CJUA 2DH9A 1VRQC 2MDAA 2D1KA 4JI3J 3LM9A 3O44A 4IQXA 2D3O1 1I1GA 2XGQA 5GAEI 1VBKA 3GR0A 1X0FA 4QOTA 4FVUA 1CVJA 3K5LA 3I5AA 3GMGA 2YI1A 5EGYA 3ZX3A 2F4VK 4DV5K 1ZAWA 1ZTWA 3E3XA 3UKUB 1GLFO 1TAUA 2J8AA 5JLFA 4KHPF 2DKOB 1OY6A 2B0GA 2VYPA 4QW9A 2XI3A 5HL7Q 4FVCA 3I4HX 2WONA 3VEZA 2KM8B 3SK3A 1NHUA 1JKHB 4RW9A 3GJSB 4JKEA 2CVIA 1M1HA 2HB5A 3IR7B 3ZSOA 2J9EA 1QHAA 1U1MA 2IM0A 4LR8A 1LXJA 1UA0A 2FSNA 4O0NA 5IM0B 4XAKA 5DS7A 3FGVA 1JJ2R 4DX5A 3G4SS 3KK2A 2HMIA 3G6EN 3NGTA 2FLLA 1NJIT 4JKGA 1TUUA 3MGJA 2D5RA 4NMXA 3QBWA 3JXUA 3W3DA 3LH2S 2B9EA 1N36J 1VHIA 5CE3A 2MJNA 4MKYA 1NPKA 3QFUA 2CWXA 1WB9A 3IXQA 1VBZA 2EWHA 5M2PA 3J80O 3KK3A 4F2SA 1KAYA 4QWEA 3M4XA 4F3TA 3OXFA 3KUGA 3C6UB 5ETKA 3WNEA 4I68A 4JNEA 3W5XA 4H4MB 3OLAA 2RQ4A 2VF3A 4K4ZA 3IM8A 3H20A 1A6LA 4JD2B 1WSHA 2VQFK 4L74A 4DR3K 1C0TA 3AVMA 1YF5L 4FK0A 2QA4S 4BG8A 2XCPA 4KRFA 2BKNA 1O13A 3AVBA 2Q66A 4LJMA 4FLTA 2QV6A 3D2EA 1VQ6N 4ZVRB 2GFFA 4YDUC 2ZH9A 1YJ9S 5LMNK 3C6TB 4DHYA 2JWNA 4QBUA 3VTHA 5E3CA 1TQLA 3DWLA 1FJCA 2QSFA 3J7YI 1OPZA 1VQ9N 5KRSA 2GQ2A 3KMSA 6AT1B 1VK0A 3IS9B 2LQ5A 3R7SB 1OSDA 1RU1A 5AQYA 3THWB 2XHWA 1NJWA 2XWXA 3WDOA 2F7VA 4HACB 4DFPA 2E8AA 3ZETA 4FXWA 1W7AA 3D68A 4DTSA 2QA2A 3D28A 1Q0NA 4GV3A 3JAMU 1IKWA 2XSJA 2L9WA 5E33A 5DDRC 4L3QA 5BR8K 3ZSYA 1NZ8A 1SPBP 4B3TF 3DRPA 4U67Q 3T1HJ 4ILJA 1TYQA 4CGGA 4DU1A 4WJBA 2EKNA 4CF2A 4LUBA 1WC3A 3CPEA 4F02A 1K9MT 1YITN 3HXMA 2C28A 2HEKA 2BGGA 2WSFC 3S8SA 3OXGA 1MU2A 2ROPA 4NCBA 3SQ1A 2RIJA 2LSNA 5J1EA 2GELA 1Y97A 3SAFA 3GV8B 5GAGI 2RS8A 1S6QA 4PQUA 2C2NA 1X3NA 5HVGA 5B08A 3I55N 3MEGB 3MX2A 1C1AA 3KLGA 3OBIA 5DM6L 3THYA 3I9ZA 1EX8A 2LU2A 1WF0A 2XM3A 2ZGZA 4FYDA 3TZYA 2AJ1A 4P75A 3E01B 3GCWP 4QU6A 2VFTA 3AD8C 3MM9A 2R7QA 3DRYA 4KO0A 1U6FA 4FZYA 3M2VA 3A8EA 2XY8A 1NH7A 3VF6A 1TKDA 2BVZA 2UU9K 4JK9A 3DLKA 4LVNP 3VAHA 1F1BB 4CZKA 1P27B 3OV7A 3MUTP 5AXKA 3LZJA 3GIIA 1P9YA 1YXQA 4H0OA 2O8DB 1JJ2M 1HKBA 2FZGB 5HRSA 1BHNA 2A1BA 2VWKA 4A5BA 4DX7A 4R79A 2UXDJ 3K2YA 2LQBA 4LF7F 3LW5C 3Q86A 4FPBA 4AL5A 4I6MA 3U8XA 3FR0A 4JI4K 4E7KA 1R8PA 4LF8F 3D0PA 1VSHA 1D9FA 2RE2A 1G1XA 1JLFB 3Q8UA 4WWSA 2WOMA 2UUBK 1FRXA 1ZM9A 4DR4J 5C2CA 3ELHA 4WXWA 3T5LA 1REGX 2HGNA 4G1QA 3DGVA 3UCUP 2ZH3A 3O8WA 4IG3B 2DRBA 5HVHA 1UCNA 1HBOA 5GADP 4FWKA 4PKIA 2L3MA 4CIOA 4Q8FA 2VJUA 3UD3P 4NO7A 3OS1A 1KSPA 2N4CA 2BW7A 1WSEA 3K2PA 2WSEC 1NMEB 4B3OB 1B0VA 1GH8A 3WQTA 1PBAA 2VKRA 1B9FA 1UVMA 3JAMO 2VFRA 4KGZB 4PZVA 3BO4A 3TR5A 2CPDA 4FJGA 1AT1B 2LMIA 1W0HA 2ZHAA 3C15B 3PW5A 1U0HB 2W4DA 2BRLA 4KPCA 2V4JA 4NLCA 3M8PA 4WFNL 3TA2A 3TTFA 1RKIA 2HBRB 4W4MA 4GKJJ 1IBLJ 1Z25A 2ZH1A 4C1NK 3MR2A 4JI8J 3OYFA 3FLCO 2YWGA 5F8LA 5AQKA 3W1YC 3OYHA 1DGKN 1I39A 5HMWA 1GQEA 2I5JA 5H9EJ 5KOXA 2R2TA 3U3GA 4CZJA 2IVNA 3AFGA 4A47A 2CUYA 2ASJA 2MLZA 2XY5A 4YDXA 3HHLC 1DLOB 4RBUA 4ECSA 1LAWA 1CLFA 2UVVA 1GMWD 4CFDA 1N32F 1N56A 5KAKA 1VCTA 2QMUB 4GVMA 3NE6A 2VG6A 3I0SA 1ZBLA 3D1OA 3VQ7A 2DR5A 4OJRA 3CC2N 4ZPDA 3HHNB 2E6LA 4ID5B 4CEQA 3R5JB 4B3SK 5F3TA 3GV5B 4M5HA 1WTFA 4L3KA 3VENA 3P38A 3KJVB 5M1FA 2D3UA 4EO8A 4IEEA 2IAJA 1O8BA 2RQCA 3DRRA 4ZPWR 4I0WA 4JAXA 2V2VA 1FFGB 2FY1A 2BEFA 5CD4H 4K41A 4Y2AA 3ZTSA 4K59A 1U48A 3KWIA 3ETMA 3WNFA 2FBVA 2U2FA 3MCOA 4ISGA 4ZTFA 4AXJA 3LDPA 4UQGA 2B43A 4DV6J 1K8AT 5LY3A 2DITA 1Y11A 1VQNN 3HCXA 2WCXA 4RW7B 4CYUA 4DR2F 1KFSA 3L4IA 2A5XA 1BUXA 1IBMF 4DKWA 2UUCJ 3OR1A 4CHQA 2AYBA 3AV9A 1FKPB 1WC1A 3Q83A 3MMAA 4CBUA 1VC0A 4ECVA 3KHHA 2QWOA 4X2BA 2V68A 4QIEA 4B1ZA 1X4HA 4ZVFA 4IOXA 4RNMA 4TY8B 5CYMA 3PSFA 1WC4A 3V6DB 2NQPA 2ZH6A 5F0UA 4M63C 4CNZA 1RT2B 1E6YA 4CFBA 4DWIA 2FC0A 3WZ0A 1YJWS 4AUKA 2L9NA 3JB9k 3V5RA 4GO5X 5HBMB 2EW9A 4DN0A 2GO8A 4ZVSB 3AVFA 2ETJA 1C0UB 5F1XA 4CJFA 3RAMA 2HVHA 4OHVA 5IZHA 4RCHA 1FTRA 3TQ1A 3EEQA 2ZVIA 3H5XA 1IBCB 1J5EF 4ZJOA 5B7WA 1VRUB 2KU7A 4NB4A 2CAJA 3M6WA 3DGPB 4CJEA 4ZP6A 4YOWA 1S9GB 1HD0A 3MMVA 3CMEN 4HLBA 5A8WB 2P1JA 4WXOA 1TZ0A 5EWFA 1OPIA 2BH1A 2HBQB 3G71S 4OZLA 4H03B 1HNXF 4J37A 1RWNB 5L46A 2MZRA 4WIIA 4F50A 2IDOA 3LAMA 5HSPA 3I87A 1U4BA 2UVWA 4A4JA 2A1RA 4LFAF 3Q22A 3WNHA 1IV0A 2K7JA 4R0JA 2YHXA 5H9FJ 2IFXA 2IGIA 3WC0A 3RRHA 4WCEL 3ZSVA 4WP9A 4TU8A 1J9AA 1XC9A 5D15A 1VQMN 4QPTA 1RWPB 2GA7A 4QIVA 1Q7YT 2CPXA 3CEDA 2UP1A 3AVNA 1C4CA 2KFZA 3OTOK 2LLZA 1NKCA 4KQZA 1FTCA 2FHJD 1MLAA 2Q1NA 4N76A 1VOMA 3PYEA 3LPTA 4G6VB 3ZZRA 5D3GA 3L4QA 3AD9C 4KGXB 5HVFA 3VEXA 2QG9B 3Q8VA 3CD5A 2P6TA 3BGUA 2F5GA 2WUSA 3FFIA 2M70A 2YX1A 2YY3A 1NKEA 1AFJA 4URGA 1S72S 3BR9A 3M8SA 3PM9A 4LF5K 1FRIA 3ZZ0A 3CMAS 2ZH5A 3T9NA 2EEYA 5JXSA 1EZZB 3QFHA 3SUQA 2OMLA 4EYIB 2BQRA 4Y2KA 4F4YA 2XO6A 1NGGA 2AW0A 4YR0A 2EG2A 3FE1A 3HHLB 4B9QA 2OGUA 4P73A 3H08A 2HQGA 3VEYA 4O3OA 4OZJA 5E26A 2QM1A 3RMAA 4OV1A 3KD5E 1VSFA 1KOHA 1Q8LA 1WUUA 4I2QB 2LEPA 3AXKA 4P2SA 4FXVA 2OTJN 4EWTA 2D1CA 2OUGA 1HNZK 4JI3F 1AUDA 2QTWA 2AP6A 3OR2B 1NM1A 4P7TA 1Z2ZA 2ZEJA 1F60B 2BANA 2W40A 3CM5A 5J2PB 2MY8A 1MSWD 4LSLA 4ZN1A 4ELTA 1FJGJ 1LK7A 1MWZA 2QWRA 2ZKUA 2CQ4A 2RT3A 2DH8A 1R43A 1QZ5A 4JS5A 2J7UA 1FI4A 3HJFA 1G15A 2E5LJ 3O1BA 4LR9A 1N34J 2BE9B 4EI2A 3PTWA 1BUPA 2V67A 2FVCA 2WK4A 2R7XA 2MQ8A 2PFUA 2EI5A 1W26A 2D0PA 2E1AA 1RP5A 1QUVA 2ZDPA 4OL8A 4LSNA 3MMCA 4IH7A 4BRIA 1VQLN 3Q24A 1JWWA 1KD1T 2W9CA 2CJQA 5HMYA 3QPIA 2ZWHA 3L9ZA 4X62J 3BH7B 3JQJA 3CCQS 3SV3A 2O8EA 2ZC3A 2NXCA 4X4QA 1N36F 1HWIA 3TWHA 3D2WA 5TKWA 1GLEG 1VAZA 4ZHRB 2LQJA 3W9JA 1TL1B 1HARA 3O9TA 2DHSA 3KG0A 3KHYA 4CF8A 5LXRA 2R7RA 3K57A 3KJFB 4FWNA 4K0KJ 2QI2A 5DM7Q 3AVLA 2NCKL 4HH1A 4TY9A 5F8MA 3M6XA 3CJ7A 3I56N 1GX5A 1JXBA 3X1LB 4NLOA 1XHZA 5KG2A 2RB7A 3MTKA 3DAWA 5JVHL 2HIQA 5KFRA 4ES3A 4KR0B 5HP1B 1SQKA 3W9HA 5KFSA 2ZHOA 1N5VA 4CLKA 4FPRA 4J91A 1VFJA 4LF1A 1RDRA 2YNIB 2A41A 1NGAA 2FSKA 3O3HA 2AU0A 5KGWA 3D67A 3M30B 3OT9A 5AFUH 2P9SA 4V19S 4JV1A 3T6BA 3VAFA 3AOCA 1R8BA 5L1IA 2GGPB 4CFCA 4OKEA 4CJVA 2LECA 5ETVA 4HHJA 5F9NA 4M3WA 1DJ0A 2CVEA 3PJWA 3SPZA 4AQYJ 1S5JA 5E41A 3NBPB 3HOTA 2QGFB 1OSCA 3AARA 1GXLA 4DTRA 1XMQK 2OTLN 5KPTA 4JRQA 2I8EA 4P2MA 1VQKN 3QZ8A 5IWAK 1Q82O 2HGMA 4DU3A 4HEA9 2D4WA 2AIRB 4DJBA 4CZFA 4CO4A 1BQNB 3AA5X 3SIPB 3LDNA 1RAHB 1W2IA 2PO4A 2GAHC 2WHOA 4Q7AA 3G0ZA 1NWKA 4DTXA 3D3BJ 1CZ9A 1NSQA 3K5MA 1XR6A 1DFDA 3CJSA 3D6HB 4WK3A 1X5OA 3PNIA 5A8KB 3MEEB 3ZNJ1 2GMJA 4W5TA 4MLHA 1NG9A 3MECB 2JHEA 1NK9A 3BQ2A 4B3MJ 1JMTA 1YJRA 3PO5A 5JVGL 4JI6J 1IWAA 3T1HF 4B02A 2HOEA 4DUZJ 2VA2A 1CJKA 2X1FA 2Y1JA 2PMHA 1Z26A 4UTGA 4KHUA 1NSKL 3MM7A 1WOOA 4RKUC 3O6WA 3Q2SC 2RPIA 1GOAA 4NLGA 4U7BA 1WWHA 3UD5A 1S9EA 2HFVA 1NUEA 1DT9A 3QNWB 2GC8A 4FJKA 1NB2A 1IKXA 5M1NA 4G1PA 1JXLA 2X78A 3EJMA 2G2OA 2PIIA 5G0RA 4H0YB 1R0AA 4OPKA 3M32B 4NASA 3ZYYX 2OPPB 1T9YA 4LF9J 4OZ5A 4O5BA 1N33F 5HLFB 5HANA 4DQQA 2V4RA 4DV2K 2AWZA 5J1NA 2D0BA 4CF0A 2KYXA 3I0RB 2DPIA 1FA0A 3CCUN 4PQAA 1NKBA 3B4MA 3Q2TC 1EETB 1NK7A 2B9XA 2IJRA 5THWA 1NNEA 1HFEL 3CO9A 4PXDA 4DF4A 1N5YB 4GO7X 3ZZTA 2UXDF 2QA1A 4FYXB 2Y0SD 1ZPWX 4ANCA 1GLLO 5AE1A 1QLNA 2LYVA 1Z6RA 4DQIA 4ZCLA 3WEEA 1AYEA 4U8YA 4I2PB 3TI0A 1T3OA 5A2QO 5A8RB 3GIJA 4HHHA 2XMUA 2VODA 3EE3A 1TL3A 3KZBA 4CF1A 3M9OB 1AW0A 3H98A 2CFXA 2KHCA 4DMZA 1VIOA 1N5SA 4DFKA 3I33A 1N4LA 1SUQA 1N6QA 5HQMA 1HW9A 4YHHJ 4NLTA 3SQGA 4OHZA 2CADA 1RILA 2BJ8A 4LT6A 3MAAB 3M1VB 4FJXA 1H2UX 1RTHA 2ZF5O 3VMFB 3O5TB 3KLIB 3K5OA 2PC6A 1G99A 2ZE2A 1TUWA 3M2UA 5HATA 1IN0A 3VQTA 3SNNA 3NH1A 4J9PA 3H42A 4C8LA 1VSIA 4YMEA 4GKJF 3QMQA 1IBLF 1QE1A 3UDEA 2QXLA 3EL2A 1K8KA 2ZKTA 1BI4B 4JI8F 3N01A 1CBKA 5KG0A 1YGYA 1FX2A 4DSFA 5AZIB 3VA3A 2GX9A 4IJNA 4HUGA 2DR9A 4FF3A 5CXTA 5AQFA 1XBWA 2V8HA 5FRMA 2F3JA 3N4WA 1S4FA 3OYMA 3O2IA 2BM0A 2DNGA 1WF2A 4P2FA 3PIOL 2F8HA 3DOKB 5KFTA 3BS9A 3EZUA 2W2PP 1XR5A 4RZRA 1VQ7S 5CYMB 1NHVA 3SPYA 3HHEA 3PDNA 1M90O 1HYVA 3H5YA 1FXXA 2JVRA 1RB0A 2Y8YA 4JKDA 2HFOA 2MKCA 3CDBA 4DR5F 2KT5A 3DXSX 3OVAA 1ROFA 4MFBB 3U9DA 4RL1A 1JL1A 4B3RK 3J81O 5K8PA 1D5AA 2YTCA 1O51A 4B1UB 4K5SA 3PRDA 4IR9A 5DGBA 5AQUA 1WELA 2MQMA 4UQTA 3L4BC 4M8LA 2AX0A 1WF1A 2GUIA 2E66A 1FRHA 2YKOA 3U27A 3TX8A 3QEPA 1QAXA 4DR7J 2V8VA 1WHXA 1TK0A 4BREA 4DV6F 3NNAA 1VQON 4QYRA 5AXNA 1ASWA 1B4SA 2M88A 3NGRA 4KFBA 4DFMA 3QDKA 4F8RA 3E9OA 2UUCF 3CF5L 1S1XA 1CLQA 1QAJA 1F5CA 1D3WA 1LWFB 4ZLJA 1HBMB 2MHNA 5E7OB 1O5JA 2B4OA 5A0YA 3VEWA 1FRMA 3R97A 2ILZA 3AJ1A 2PI4A 3HHKA 2HHUA 1U02A 2QTDA 4QYZK 1DARA 4DLEA 4A8KA 5KG5A 3DLGA 4RNNA 1S1WB 6FDRA 2FJAB 2GV9A 2MKJA 3DDNA 1HI8A 2QSWA 3IN5A 1HHQA 2PY5A 3KLFB 2ZWPA 3AB2B 5K14B 4GVLA 2CDRB 4C6AA 3HSJA 1LFPA 5C15A 3GG1A 3QIPA 4DPYA 2YKPA 3CCEN 4F7VA 1CQMA 2VKZG 2E44A 1VQPN 3UVJA 1Y00A 4YR2A 4F2RA 1CG2A 5SWMA 4L6V3 1RDWX 3VGVA 2GQQA 1TL5A 5AQRA 4OYBA 3NNCA 1P1LA 1ACMB 1F5AA 1HNWK 1G7CB 2R7SA 2KVQE 3T7ZA 1T0TV 4WYLA 3MFIA 4GVEA 3H5SA 1H2TZ 2YBVA 2ERRA 3NCPA 4JYAK 3J7ZO 3DXMA 3T5KA 4E1NA 5M2UA 1KLMB 1QSLA 1VLYA 3OYCA 2O1PA 1MMNA 3CCJS 1YZ6A 1HNIB 2CQ2A 1T8EA 3HVAA 1ILYA 1IQZA 3EE8A 1VBYA 4NLVA 5AQTA 2E20A 4K43A 5FLXU 5BPLA 5ETQA 4PG4A 4GMJB 1WEZA 2KRBA 3O1LA 2ZM6J 3ILOA 3FVYA 5BPNA 1YBTA 3VESA 1X4BA 3F56A 3NNHA 4C3MA 4CGFA 3C6HA 3DJCA 1U1LA 2F8EX 2DY9A 3IBFB 4J9NA 3DKDA 5EVZA 1HR0J 3JSMA 1V3RA 4DTJA 1ATNA 4JI2J 4JI5J 4OI4A 3OUYB 1R6VA 2QN6B 4PUOA 5KFDA 3ISND 1FFWB 4NYPA 5A6PA 2VONA 1R7IA 1WAFA 2L41A 2DFHA 1XNRK 5BN9A 2VOPA 4CTAB 2ZBIA 2H1YA 1LOUA 2CQ1A 5CYQA 4Y3CA 1UEUA 3ZZOA 5KG6A 5L1LA 1L3KA 4C11A 3VQBA 2UUAK 5I3QA 2I7NA 2VA3A 1HWUA 2CQPA 1FNXH 4NXNJ 3AAWB 1WAJA 3IWLA 5E0OA 3H1QA 1S1VB 1U47A 2MEWA 4H4KC 5GAEU 4BRHA 3DM2A 3KD1E 3ENBA 2HBLA 2P9PB 5LJWA 2GHWA 2YHAA 3IR5B 1WNSA 4G9ZA 3LDQA 2A6AA 4CZIA 3AHPA 3GG4A 5K9FA 1WD6A 4M5KA 1NMDA 2HBJA 5D6GA 3GOIA 4AILC 5D0GA 2XYPB 4ECQA 2NSBA 4BHQA 4ETXA 1NHKL 2KTQA 1S3XA 3H8YA 4ILHA 3SMZA 3C14B 3M2RA 3HM9A 1WBBA 1U7LA 1FJGF 1C0GA 4C8NA 1LW2A 2IC3B 1BIUA 2AJQA 3ZLJA 4HDGA 4CHYA 3L7OA 2E5LF 1H1VA 1NMNA 1N34F 2NXNA 4J2EA 5KFOA 5KFFA 3EDRB 5J2MB 2P9KA 3I8BA 2OPSB 3R1XA 3MUVP 3C7NA 4DB3A 2ADCA 4KREA 2E6MA 1NRKA 3MN6A 4CGHA 1TV6B 5HO4A 5I42B 5F8GA 1CJVB 2HIYA 3RR8A 3RJMB 5JJBA 3QFWA 5IT9O 4YFUA 1PYOB 4O0IA 1T9XA 1RDBA 2VD3A 3GE1A 4BE2A 4J90A 4AHCA 2OELA 3A3NB 4X62F 2FBXA 3PEHA 3SUNA 5DQGA 3TAPA 1IVZA 4N56A 5ELZA 4PWDA 2SXLA 4WQ5C 2NPIA 4A8WA 4FJMA 2GW8A 3MPVA 1VSKA 4W5RA 3MX5A 3V9UA 4OMFG 5FDLA 2HYIB 3LGNA 2F63A 4OI6A 1IKVA 5LSOA 2E5GA 2VGMA 1YLXA 1RYRA 4JI7F 4E0DA 3BYPA 5ETOA 2FVRA 5DQHA 1KRPA 5AQWA 3LGHA 5KFEA 4NRTA 3G9CA 2YKNB 2VC0A 1RDUA 2QFIA 4KIAA 2AGOA 3OLBA 1Q86O 3J7YU 4EBDA 4OV6A 3L09A 1CC8A 2XY6A 3DCAA 4EFHA 1YKWA 3ZT2A 1SJRA 1FKAF 4M3RA 2ATCB 2RHSB 5B0AA 4HUEA 2I38A 3V2UC 5EX0A 2OSRA 2IY5B 4DR1F 5CCLA 4ZP9A 3J81Y 3AA3A 2Q31A 3NGIA 4WFAQ 1NGIA 2FJVA 3KHLA 3BF3A 3R2CJ 4BRQA 4B3TK 2O8CB 1RLCL 1JLGA 3KUEA 4IRCA 3H59A 4KGMA 4F3OA 2DRDA 1XNQK 2VHGA 2DD8S 3L2RA 3VEOA 3VGMA 1HQEB 4DPWA 3SEOA 5DZ7A 2CZ9A 5GAGU 2KDOA 1I5OB 2DIVA 4JP8A 4B3MF 1OVQA 4JI6F 1IBKK 2XS2A 3UN5A 4DUZF 2Q2RA 4CGDA 3CQYA 4U7CA 4M42A 2ACMA 3EN9A 1EJ7L 3BR8A 2UVUA 1RDCA 2NRTA 4RG8A 4LVOP 5C7PA 3OYKA 3CJ0A 1S99A 2JX2A 1NOYA 3F0NA 4XH4A 1Y3JA 2AJFE 4IDHA 4BDPA 4FOEA 4K4XA 2G8IA 1HWKA 1HLUA 3ZT1A 4LF9F 4BC3A 3CULA 3UFCX 3HFVA 3AO3A 3G6YA 4WCEQ 5KFHA 1MN9A 3PX6A 4FXDA 3P49B 3UKRA 4FF4A 4LF7K 4JI1K 2KYZA 4RX6A 5DG7A 4NLSA 4LF8K 4L72B 2KG0A 4CLSA 4YUDA 4J5OA 2MGZA 3MUMP 1Q81T 3PLAA 2CJ9A 2Z2LA 4AYBD 1WEXA 4TNOA 4WYWA 1R0BG 1S0VA 3OYJA 4RUBA 3GU0A 2DGXA 5F8HA 3VQ4A 3NY0A 5ETLA 2DR7A 4Q0BA 2FXUA 3W7BA 4IG0A 2IRYA 4EFAC 4YS2A 4IO8A 1TK8A 3FZMA 1FKOB 4DV4J 1T9WA 3W64A 4LFBF 1RT7B 2YKMB 3I82A 3TWZA 4DV1K 3J8AA 3I32A 4KHMA 4UUXA 1OMSA 4A46A 3QBCA 5RUBA 1RU2A 2NUUG 1NDLA 3EUNA 4Q44A 1DHMA 3PYFA 1D8ZA 2DH7A 3LUYA 2E1YA 4MH8A 4IUFA 1P90A 1WSRA 4DG1B 1CZAN 3VQ5A 3EXYA 4NYNA 2E9ZA 2QWLA 4BE0A 1BL3A 1HPZB 2VQFJ 4YHHF 4EK2A 3CDUA 4NA1A 2VG5A 4J9MA 4HVJA 3VV2B 1RTDB 4F04B 4Z2XA 3SQOP 2V5HG 4QR1A 2XMAA 1AFIA 4Y2CA 5K5MA 2EFPA 2B4PA 4KH4A 4J8FA 3GSDA 3CQ8A 4DL0C 4FJLA 2NXJA 3FRZA 4DTNA 3O9SA 1YTYA 1P6TA 4YB7A 4CHPA 4JLHA 4AT1B 5KG4A 4XTTA 2FBTA 4BLGA 2XSFA 1N32K 1TKTA 4BY9C 4CJRA 3E2EA 3R9PA 2KLAA 1MN7A 3B6PA 3OQ2A 1OQ6A 4A8YA 3PW7A 1QUPA 2OEKA 1FESA 5LL6Z 2XTJP 3MM6B 1U0SA 3R7BB 3EPGA 1SL1A 1E4GT 3S3NA 2Q79A 4ZVQB 3KHGA 1TKXA 3T5HA 4BC2A 2UXBK 1S6PB 4IFEA 4Q45A 4AHTA 5KFMA 1LW0A 1HKAA 1YBUA 4K8ZA 4CERA 2DYAA 4DUTA 3EO3A 3MFHA 4M95A 2HBMA 2CJYB 1VBXA 4LF6K 1EO1A 3QEIA 5AZJB 3K9KA 2MPUA 1B3TA 3TW0A 4A61A 2DGSA 5I9EB 5BYRA 3LP1A 3DFEA 4LC9B 1BOTO 3A8JA 1RT4A 1QAIA 4PG8A 2ZD1B 1RK8A 3DLGB 1QVFM 1IKYB 1HQ2A 3K7RA 3GWCA 4AHRA 4QOZB 1XMOK 2XLJA 3QWPA 1Q5YA 1UFWA 1I3AA 1K73O 3R3LA 2NRRA 4ZLPA 2HNYA 3U4LA 3KJNB 3KWGA 2FHKA 4E19A 1VS3A 3R5BA 4AHUA 2YNFB 4BACA 2OA8A 4CEDA 5AQLA 2BE2A 3KLEA 3W62A 1JL2A 1S0NA 3ZTOA 1MW7A 4FYWB 4UOGA 1V3SA 2AX1A 3MM5B 4FZXC 2VBYA 2ACYA 3OSNA 1WOPA 3US5A 2DTUA 3CJ3A 2OAUA 4C8KA 2ZOMA 3GTYX 3TVZA 3QQCD 4PPDA 3CC4N 3QMLA 1VMBA 2BW2A 1FVSA 4ISFA 1EP4A 2HMPA 4BC9A 1D9DA 1RWXB 5IT9Y 4DZDA 3VVUA 3RAXA 3ASMA 1PIEA 2CG8A 2P9LA 2VQEF 5GAEP 1J5EK 4ED8A 1S79A 2UUBJ 3EICA 3BPDA 5CHCB 2J0XA 2GTDA 3IA0A 4CBWA 1HBUA 2R3VA 2E2PA 1QTMA 3MM8A 2P5VA 1YJNN 1WNEA 3EGZA 3GB0A 3C16B 2ZOGA 5CZXA 3PY8A 2DGOA 1FRKA 4QWDA 1L3TA 4PA1A 1ICEB 2OD6A 2HQDA 4PL8A 3J7Z5 4E98A 2DT9A 2VCPA 4LFAK 1TMMA 1FERA 4F4AA 3G82B 4KV8B 3DOLA 2OCEA 4NRUA 1ZOTA 3MEDA 2DO4A 3HJVA 2CQGA 3M8YA 4K5RA 3VAIA 3RW6A 3U7JA 5EX5A 5CYQB 2KZMA 4NLQA 3FQLA 1RT1B 1IG9A 1N8RT 4KPYA 1XI1A 5JVGQ 4WE1B 1VRTA 1BGXT 3CJKB 5BJRA 5I3UB 2APOA 2G4BA 5AT1B 4RW4A 1JLBB 1JLCB 4JK7A 1EWRA 2MB0B 5E5NA 1GOBA 2Z58B 2CG4A 3D1QA 4LFCJ 2GQCA 2D9OA 3IGNA 2D0CA 3P3DA 1LWEA 1C1CB 3EYZA 3D2FA 2IM2A 1KVKA 1VLOA 3K8VA 3FCVA 3THTA 3ZSZA 2KRRA 3OYNA 1XMBA 1VC5A 4EBCA 1S22A 1MWMA 2ZM6F 4BRFA 1FRJA 2FGOA 3ZT4A 2C22A 3D66A 4MT1A 2OI2A 4RO0A 1LNQA 1MROB 2AZ1A 3U02A 2NLWA 5D0RA 2KFNA 1R8AA 4KYZA 1BY9A 3UNGC 4JI2F 3A4TA 4JI5F 1SJFA 2XS5A 3CJQA 1RTJB 4DV0J 3M8ZA 3QNNA 2KO1A 3W66A 2DGWA 3UKUA 1RKJA 1PYSB 3GR1A 1J5OB 3QEVA 4ZCMA 3AO2A 5C2FA 1X4EA 3OPKA 4J9SA 3NCQA 3OVNA 2X1GA 2G1DA 2WVEA 1T7PA 2BKPA 1JKHA 3GQCA 2ZZNA 3QAUA 2EFVA 5KFUA 5SZTA 4NXNF 4UY8T 5KFYA 4B1YB 1UVNA 5D4LA 4BRPA 2ZC4A 3R5DA 3V1OA 3R6MA 4WU2A 5IM0A 2ROGA 3BKUA 3IFRA 1LQ9A 4WKRA 3N6MA 4K7QA 2UXCJ 4B9LA 1VSLA 2XG8A 3W8GA 4D3GA 3RZAA 1SH3A 1IR2A 2MLYA 2KB2A 1VIXA 2FPHX 4KTWA 3TU5A 3EKSA 4BBYA 2DR8A 2JRSA 1I94K 2YX7A 1UOCA 2LXIA 3B4DA 1VK3A 1G6BA 3KKFA 1B9DA 4QZVB 1MWQA 4ERDA 1NXIA 2BM1A 5AQSA 4P74A 1PYTA 4MK7A 3WXJA 2G8KA 2P9EA 1G2EA 3DLHA 2Z1IA 3B6OA 1QSSA 4CHNA 1RHJB 2UV8A 2G0IA 4OLPA 2GWKA 4EBEA 5GAGP 3FSIA 1TVRB 3C6UA 4LRAA 4KKOB 3SCXA 5HQLA 1EKRA 4BRNA 4FJ7A 1T94A 4DF8A 4ECWA 4H4MA 3BEGB 1X4DA 2J9DE 4ZN3A 2FHOB 3D6MB 4B8CA 3FSXA 1YBAA 1YRUA 1RTIB 4JD2A 1S5ZA 3P5TL 4F25A 2WBMA 1UAWA 4QS7A 2QLXA 1YVUA 5AXLA 3EVOA 1N36K 2ZHBA 1BXNA 2ZOFA 3T6JA 2Z57B 3RBDA 4Y1DA 1WHYA 1VJWA 3NRBA 3C19A 4LF4K 4IZ9A 3C6TA 1Z1ZA 3PIPL 2KL8A 3FZ2A 2DNYA 4ED2A 5DLFA 3ULEB 1CJUB 3ADAC 3TYTA 2AD9A 4ZS6A 1BQMB 1H38A 3H7HB 4FWOA 4CP5A 3IS9A 3GL1A 2G8VA 4OZNA 1SAZA 3U3YA 2J6TA 3THWA 4AE5A 3RB0A 1FHTA 2JH3A 2XMMA 4HACA 3UPFA 3KNGA 2P51A 4ZVEA 1NCLA 5GAHP 2HHVA 5C25B 4ICLB 1WSIA 3TJ8A 3OYBA 1FCAA 5LMUK 1XQIA 3QBXA 3P5BP 4FOIA 4FLYA 4M5DB 5AE3A 2RF2B 4MYTA 1L3UA 5CR4A 2BZ2A 1Q86T 3A0IX 4DSLA 3G86A 4ZP8A 3HSTB 3TJ9A 1LXNA 2HHSA 3QZ7A 3NGDA 1FK9B 1DQ8A 3B82A 2HZCA 4J9KA 3WQPA 2ZBCA 1BWEA 4CJ7A 2D3OR 4X4TA 3GJRB 4X4NA 2FSJA 2YXLA 3HD1A 2G8FA 2CQCA 4BE1A 3MEGA 2XZWA 3MMBB 4CH1A 2OKQA 4F0KA 2ASMA 5F8IA 1RT6B 3NF6A 5J2NB 4X4RA 1RNHA 5BRHA 4Y6IA 3RWUA 3OTDA 5EUHA 4QQBA 3E01A 5AQGA 2VWBA 3MCNA 1NGJA 3V6KA 1UETA 1V3ZA 4Y1CA 1EKSA 3VOVA 3V4MA 4USKA 3G8SA 2WVFA 4M5MA 3FFKB 1NB7A 2B3TB 2XHCA 2R42A 1VQ5S 3HHLD 2E1RA 2LVWA 2WW8A 4DTOA 1RABB 4QWAA 1NJXA 2QWMA 3VQSA 4PAAA 3GLJA 4L75A 1EKEA 4F4XA 2O8DA 3ITHB 4HL9A 1XR7A 4ITSA 3OXLA 3NGUA 3L95X 4DR6F 4NCGB 4FNIA 3CJTA 3K5NA 1SJ1A 3CJBA 2BYCA 4QIWD 1ZAXA 3TARA 2N3LA 1JNRB 2QWNA 3G6VA 5BPMA 5FPEA 2RRAA 1F9HA 4CDIA 1BC6A 3K58A 4DQPA 4XO0A 3G6ES 3LQVA 2HWHA 4DV5F 3WXIA 4EHTA 3CJ2A 3ZT0A 1RT5B 4PPZA 4UF4A 1TU0B 2LDYA 1EQYA 4C97A 2VH7A 2HNZB 4IG3A 1HLWA 4WIQA 2C2MB 1KHWA 2I0XA 1WBDA 3RVCA 4FN5A 1F2GA 3MCSA 4CHOA 1PJ7A 3FBEA 4YOYA 4Z4CA 1T44A 4X4PA 1ZM3A 1FW6A 4B3OA 2EWSA 3R8YA 1N52B 4FPIA 3D7EO 4EIAA 5DDOC 3RSEB 3MXJA 5F9LA 4EEYA 1B0TA 4K25A 3CFOA 4KGKA 4C3LA 4O44B 4FF2A 1GLCG 2R7TA 4DHVA 3W65A 4CVNE 2DHHA 1U0HA 2J0SD 3MZIA 3CQXA 4HVZA 4DR4K 3RBZA 4PXBA 4IKFA 4U9RA 3IG1B 2FGCA 1ULRA 1RA6A 1REVB 5C10A 2MKHA 5KTQA 1DURA 4CJLA 3Q8RB 4DV4F 2H54B 4DSIA 4OHYA 1RZMA 3D3CJ 3LP3A 1NGCA 1VQ6S 4TSXA 1IBMJ 1RHUB 4QPXA 1YJ7A 4PG5A 4NZ7A 4MK9A 2V50A 1DLOA 3DHXA 3GJQB 2QLJB 3DN9A 4E1JA 1NSPA 2ADBA 3OL7A 1VQ9S 2AF6A 2DTJA 2K2PA 2EX3A 1W2BR 3PX0A 2D0OA 1KC8O 2ALZA 1CULB 3N9UC 1LWXA 1HWLA 1RA7A 5KI6A 3KDOA 4CO3A 2VQFF 3R1HA 3JSBA 4ID5A 2V63A 5GADU 2YCHA 4CRJA 3LANA 1IBLK 3LALA 3EE9A 1HBNB 4YDUA 3KJVA 4JI8K 2LEBA 2RD5C 3ZT3A 2B5JB 2ALYB 3MDFA 4E1MA 1IR0A 5H9EK 3SBTA 3LWLA 4KAZA 2H5JB 3MCAB 1BA0A 5KT7A 2OP5A 4ECTA 5JUMA 1U8WA 1YAGA 3VAJA 4CLLA 3EVMA 2IOCA 4A8SA 3FUYA 2XC9A 1L3SA 1YITS 3BBBA 5KFXA 3HVRA 4WP3A 4RW7A 3IAYA 3FBFA 2IDLA 3S7RA 1PKUA 1V5VA 3M8WA 3OYLA 1RDAA 3I55S 4GW6A 1FKPA 1HW8A 2C3PA 2Q6BA 4DCHA 4HR2A 3P39A 4CJSA 2RU3A 4C23A 2Z0GA 4YY3J 2JSXA 4TY8A 2CGJA 5L38A 2JLGA 4KHNA 3BN7A 3V6DA 2XEXA 2E2QA 4B17A 1RT2A 2HRYA 4FLWA 3AQOA 5HBMA 4DV6K 3SXLA 1C0UA 4YB6A 1HQUB 4FWQA 2DNHA 4ER8A 1K73T 3RG6A 1CXQA 4H5NA 2CJXB 4M5LA 1JX4A 4IOAL 1VRUA 1KONA 1OH6A 2VJVA 3V4IB 3DGPA 4V19X 3MCPA 3CC7N 2AEMA 2Z8QA 1S9GA 1FF2A 3BDPA 4O4GB 2YHYA 4O55A 1JK9B 4DSEA 3HBTA 5A8WA 4FBTA 2EFQA 4DV2J 3L3UA 3BQ0A 3V1RA 4GKKK 5IC6B 1TGOA 2BRKA 3J80U 5KGXA 3LP0B 4WQ4C 1FX4A 4I67A 2MQLA 1YHQN 2YQ1A 1X5TA 4CD3A 3OS2A 4DMNA 1FD2A 5HJXA 2AGQA 1XN9A 3W63A 2B4UA 4UZCA 2VFSA 2O8BB 4GVBB 2RRBA 1S59A 4W92B 1RAEB 2IJFA 4ZVHA 4JOUA 2UUBF 3A5MC 5BN8A 4EYHB 2HLTA 2YWWA 2F40A 2BOPA 3TNVA 3OFGA 1QAYA 1WI8A 3FQKA 3PFOA 4MMOA 2YV0X 3F9KA 2BMBA 1T9VA 3O4NA 4R0EA 2WB4A 4O5FA 5LJVA 3MWTA 5KFJA 2E1CA 5LXYA 1RBRA 2ZDOA 3OHBA 2AT1B 2ZITA 3CJRA 5HL7L 1Q78A 1W2BM 2O8FB 2V51B 3GJTB 2BQ3A 4CZLA 2CQDA 4EUVA 3RRGA 4HTUA 5IC4B 3OFEA 5H9FK 2MKSA 2CH5A 4C0OC 3CO0P 3D5MA 4HT7A 4NLRA 4H8KA 2LEAA 2HFUA 1GOCA 2F9WA 5FIIA 3RYLA 1NGEA 3JTPA 2P9NB 4ZPCA 4JKBA 2R7VA 3UNYA 5E3PA 1U49A 3HYFA 3CC2S 2UVRA 2HVIA 1CJTB 1UMJA 3LDSA 1HKCA 2OZMA 1X3MA 4Z94A 4LFCF 4P10A 3HI0A 3HHLA 3EX7B 4OI1A 3KLHB 1U2FA 2YWEA 2NRVA 2CWKA 5HQ8A 4TKTA 2B9WA 1HWJA 5AE2A 4H4OB 2XNQA 3AVJA 3WXMB 4GV6A 3TUIC 5DZ6A 2UYTA 1RCOB 5HMZA 3PEJA 4I2QA 2J9DA 1FD8A 2HWTA 1JNZB 2WW4A 1AUSL 2Z2MA 1E4FT 1C6VA 1VQNS 3NVMA 2CH6A 3OR2A 3ULHA 4B3SF 5HI7A 4N41A 5J2PA 4NMLA 4B3RJ 3K17A 4DV0F 1SI9A 4U8VA 3TUPA 1SH0A 1WDTA 2VG7B 4AFFA 4ILRA 2DR6A 1YT3A 4QW8A 3UIQA 2C2KB 5C24B 4ECZA 3THPA 4X65K 4IO9L 3HZEA 3DDKA 3IMXA 4N5SA 2ZJRQ 3PR4A 3IAM9 4U7UD 5DJBA 4CJKA 3TUZC 5ETRA 1T3NA 5KG3A 2DRAA 4Z4HA 2HRUA 2K3KA 3OFFA 3GFZA 3EZ5A 2UXCF 4Q8EA 1ZS6A 3OYGA 2EC0A 4RTFD 1ZM2A 3A12A 2V52B 5KT2A 2R2SA 1GT8A 4KSEB 3G25A 2IDEA 1EB0A 4M63A 2V0NA 2OJ3A 1RWOB 1BWVA 3UE5A 2EC2A 3Q0AA 3N0VA 1ZTTA 4KRWA 3CMES 4C8ZA 4ZHRA 4U67L 3V6HA 1TL1A 2R9LA 3SAGA 3PACA 3C2PA 2Z2YB 3W3SA 4ZLNA 4PG6A 3NWRA 4YP3A 1I6JA 1KCFA 3MDQA 2YPZA 3ZZUA 2DCLA 1CXUA 1C1BB 1YK9A 1Q8BA 1VGYA 3O6QA 4ID1A 1FDAA 1FJEB 5GIPA 2XCAA 3MN7A 5HP1A 2MTLA 2ZH2A 3PZPA 2BR0A 2DIUA 4MJKA 4I69A 1O1WA 4X62K 2YNIA 4J2AA 3I96A 3QETA 3M30A 1UFKA 3R27A 2D9PA 3H4BA 4K8XA 4DS4A 4ZVPB 2MY7A 4WBFA 3QRPA 2GGPA 2AZ3A 1VQMS 1H74A 5L8RC 1UL3A 3NBPA 3NH2A 3E9PA 4NEYA 4B9SA 2YNGB 5KQ8A 1S49A 1HNWJ 5HJYA 3N4PA 4PKHA 4K0KK 3DNCA 1H7XA 3NGKA 4G3IA 2DB1A 1ZBSA 4FK4A 1BQNA 4ISEA 2V8PA 3K8WA 1R0CB 1LV5A 1N33J 3DLLL 2Y1RI 1X5SA 1YI2N 1KLNA 2PAVA 1RCHA 4GV9A 1YTAA 3WNGA 3RB6A 1S48A 4H0PA 1XJWB 3GIKA 1RLDA 3EMTA 2J8SA 5A8KA 4OYMA 3SSQA 3MEEA 1DQAA 2AYEA 1ZAVA 1BE4A 3BN4A 3MECA 2ZGYA 5F0XA 2MHEA 4P71A 3W61A 5MLCV 2DNZA 2P9UB 4RWWA 2CNLB 2FZCB 1F9FA 1UPPA 5DG9A 4AQYK 4BQZA 1IWGA 2QO3A 3B8HA 3T69A 1BIZA 4DTMA 2HKEA 4OX6A 1EQMA 5KOWA 4DZ6A 2HQ3A 1UZHA 4PKDB 2P5OA 4FM0A 3PR5B 1RT3B 2DEJA 1XNRJ 5GAHI 2DY1A 1BU6O 3CJ8A 2Q3PA 2R2UA 3M32A 3KXDA 2OTJS 2OPPA 4CH7A 2PMWA 3M8QB 4DV3J 5AJ3J 3FRYA 1WORA 5HLFA 4JI6K 4CLYA 1DAXA 3P4UB 3BO3A 1YJVA 2OD4A 3I0RA 1VQ4N 4CEZA 2VICA 2RQMA 4WPAA 3BJYA 1IR1A 3HT3A 2GMHA 5DG8A 1KVCA 3UN3A 1JLAB 1EETA 4DLGA 2D41A 3MD3A 1CPZA 3BBCA 3LP2B 3RUBL 3RTVA 2KHOA 3VGLA 1KN6A 3VF2A 1TMJA 4FLXA 5KFAA 4R5PB 4B08A 1N5YA 3CCRN 3KMQA 3GBTA 4BR0A 3B54A 3ET6B 2QJ3A 2PYJA 4N8NA 3VF0B 2AA4A 3OYAA 5ETNA 4JN4A 1DBDA 3QJJA 1KQSR 1SQFA 2EBEA 2YVSA 2XY7A 1VQLS 1UA1A 4I2PA 1IG8A 4A2BA 2X3DA 4PG7A 1R6YA 2BJ7A 3MAQA 5A8RA 2I2YA 1SC1B 2LA6A 3OTEA 4LH4A 3JTNA 3CJ1A 1S10A 2CPIA 2JEFA 2D69A 2RAQA 2FQQB 2KT3A 2I6WA 1Y4ZB 1NJIO 3AO5A 1WJ9A 2A3JA 1UJ4A 2BKOA 3AVIA 4KE5A 3DOMB 4DR5J 3TA1A 2M8HA 3T9ZA 3R5GA 4HCBA 3MAAA 3M1VA 4USVA 1SBRA 3VQ6A 1HYSB 3OHRA 2NLXA 3D7SB 4CK2A 4KBOA 2HF4A 3KLIA 4DOZA 4FO0A 3I56S 1S12A 2HGLA 2WB1D 4KHSA 3AVKA 3W2WB 3H2LA 3CDWA 4W5OA 3GE9A 2HBKA 1HX1A 1F9EB 4FL9A 2LDIA 4AL6A 1RE1B 5DDQC 2AP1A 4ELVA 3JYTB 2XULA 3RMBA 4DU7A 4YORA 2V6AA 3CM6A 1BI4A 3HFZB 5FPNA 3F44A 1RSCA 1T02A 5AQMA 2E1PA 2FB0A 4KH0B 1DY3A 3AY0A 3QERA 4NLBA 5AZIA 3LZIA 5C42B 2MXYA 3UR3C 4DU8A 3D0HE 4USMA 1RWUA 4C2MA 2A2CA 4YHHK 3V9WA 2M9KA 4FDFA 3MOZA 1WSGA 2HBZB 2OTLS 3KYLA 2MKIA 4OKKA 3ISNC 1VQKS 1KXPA 2P9IB 1KC8T 3MR6A 4K4UA 1D0EA 3DOKA 3W5ZA 1OYEA 3MMJA 3GYGA 2E7XA 1GMUA 3HKWA 2XMVA 1ZH5A 1N5TA 4CLPA 2HHQA 2O67A 4MFBA 3QYYA 3N5BA 4TQSA 1UTAA 2CPEA 2CA9A 5AQOA 3GV7B 2AKWB 2J5AA 1CS4A 5F8JA 1XMQF 1UVJA 1HUXA 3OL9A 1T95A 3TVYA 2XLIA 4OLBA 4N7TA 4MKAA 3PUFA 1N54B 3P4IA 3C95A 1SQGA 1M1GA 4BDYA 4B1VA 3KK1B 4ED1A 4IEIA 3TO8A 2OANA 2XNRA 2QK9A 3PJ9A 2NXUA 4B9TA 1XNQJ 2IM3A 2JEIA 4W5QA 4LRFA 1FNOA 2DHXA 1URRA 3QEXA 3MK6A 4EZ6A 1WOQA 3C65A 3CJ5A 3BSOA 1T6CA 2N4DA 2LKZA 1OH8A 1S1UB 3SUPA 2HHHJ 1LWFA 4A57A 1N0UA 4YY3F 2FTRA 1HBMA 2IVPA 1U2VB 3H90A 5DLGA 4CO2A 1X31C 3CCMN 1FE0A 2HNDB 2AYMA 1ATSA 4C3KA 4BWJA 3PRBA 4OGEA 2FJEB 3JTOA 4KY3A 4DR7K 3B8AX 3ZEUB 2ZH4A 3CCUS 1NZAA 4ED0A 2VIHA 4N8OA 4DPXA 1S1WA 4HI2A 4ZVOB 2DCUB 3NWGA 3CCTA 3EGWB 2VC1A 1KQSM 3ENVA 2B7BB 4URSA 3KLFA 3W9IA 2O4IA 5K14A 3S6EA 1XC3A 1F3VA 2MQPA 1AZSB 3LGMA 4FW1A 3C66A 3BREA 3I31A 2HQFA 1WKLA 4ES2A 2W2QP 1RAGB 2Z4PA 1BCOA 4DV2F 4JI1J 3L2UA 4UW2A 3I4PA 1G3OA 2JEGA 4IOCQ 5GMDA 4IKAA 1RBSA 4B1XB 2ZJPQ 1U1NA 1SV5B 3AAPA 4LREA 3PJXA 4C4WA 2RVJA 2J6SA 4OI3A 2V2ZA 2DXDA 5KPRA 4LIWA 3CCWA 4OHXA 3W60A 2HAFA 5CYJA 3ZZPA 3EVWA 1KLMA 4USHA 5KFQA 3R7NB 3AA4A 1T05B 4AM7A 3KLVA 2DNPA 2FYXA 4BG9A 3LF0A 1HNIA 1A5VA 1VSJA 3FEXB 1IJEB 2VDIA 3AO4A 4HWIA 2GJFA 4K42A 4XH1A 4M94A 1NPPA 3IRXB 1UAXA 2KKZA 2GO9A 4FWLA 2K1RB</