3KKFA

Crystal structure of putative antibiotic biosynthesis monooxygenase (np_810307.1) from bacteriodes thetaiotaomicron vpi-5482 at 1.30 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
GAENNMVRLSRIIIDPERLEEYNAYLKEEIEVSMRLEPGVLVLYAVAEKERPNHVTILEIYADEAAYKSHIATPHFKKYKEGTLDMVQMLELIDATPLIPGLKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative antibiotic biosynthesis monooxygenase (NP_810307.1) from Bacteriodes thetaiotaomicron VPI-5482 at 1.30 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Oxidoreductase
molecule keywords Putative antibiotic biosynthesis monooxygenase
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kkfA00
1YG0A 2ROGA 4FNIA 1URRA 4Y2KA 1AFJA 3FGVA 1N5VA 2K2PA 2KYZA 2RU9A 2N7YA 4A47A 1Q8BA 4Y2MA 1OQ6A 2LQ9A 2HQIA 2XMJA 5IXUA 3T9NA 2OAUA 1FVSA 1N5QA 5B0EA 2RMLA 3FRYA 4EFAC 3DXSX 4F67A 2GCFA 5B0DA 2OP5A 3I9ZA 1KVIA 1JWWA 3BN7A 2LDIA 2GA7A 1Q4RA 4HH1A 2KT2A 1TL4A 3HHLA 1N5TA 1OPZA 1S6OA 2QLXA 2RSQA 5B0FA 2HFOA 4A48A 1FESA 2XMKA 1TZ0A 2ASYA 2BJDA 1MWZA 2XMMA 2XMUA 1KQKA 1SI9A 1MWYA 3HHLC 4NPOA 5K9FA 1JK9B 1X8DA 1YJUA 1Q8LA 2HLUA 2BUNA 1Q53A 3KG1A 1KVJA 2HLTA 2G9OA 1VQSA 3TRGA 1YJTA 3TNVA 4OJ3A 1OQ3A 1VQYA 1W2IA 2CRLA 3BGUA 1LQ9A 2RILA 2XMWA 3TOQA 1TUVA 3GZ7A 1TL5A 2GGPB 2W4DA 3BR8A 2K7JA 2AJ0A 2QYCA 2EW9A 1YJVA 3HHLB 3VTIA 1FE4A 1P6TA 1APSA 3BM7A 1SB6A 2JDJA 1YRXA 4ZOSA 1WD6A 3HDSA 2ROEA 1Y3KA 1OSDA 3WDOA 2IYGA 2GFFA 2HFNA 4ZA1A 3LO3A 4DPOA 3LGMA 1CPZA 2KKHA 2KT3A 2HIQA 2IYIA 1SQEA 3DCAA 1FD8A 3K7RA 5A6PA 2AP6A 1TR0A 2XMVA 2ZDPA 1FVQA 4OJ1A 2LXFA 1ULRA 2GGPA 2IFXA 1CC7A 5A6WA 1IUJA 4HH0A 1RJJA 2K1RA 3MZIA 1AW0A 4A46A 3KG0A 2K1RB 2PGCA 2ROPA 4DN9A 1K0VA 2OFHX 3QMQA 4QOTA 4U9RA 4HI2A 4DL0C 3KKFA 2LQBA 5B08A 4NL5A 2N4CA 2N4DA 3BDEA 1R6YA 2GO8A 3HF5A 1N5SA 2PD1A 1S6UA 1GXUA 2VV5A 4Q2LA 2BBEA 1Y3JA 2K7KA 2OFGX 4Q2MA 5B0BA 5F0UA 4OIXA 3HFKA 2VH7A 1Y0HA 1V3ZA 2FTRA 2OKQA 5F0WA 3F44A 3MCSA 2QIFA 1AFIA 1YJRA 2AW0A 4YDXA 2BYCA 3LGNA 2ZDOA 5B0AA 4OJGA 3KNGA 2XMTA 3CJKB 2OD4A 1P8GA 4YEAA 3CJKA 3IWXA 1Y9OA 3QGPA 3HX9A 4Y2IA 1U7LA 3BB5A 3IWLA 3E8OA 4HL9A 2QLWA 2OMOA 2FB0A 1X7VA 1XBWA 2W4PA 3UDCA 5B09A 3HHLD 3BF4A 2W4CA 2BJEA 2OD6A 5B0CA 2FHMA 2L3MA 2GV1A 2ACYA 1GXTA 1X0PA 4HI1A 5B0GA 4OJHA 2Q3PA 1FEEA 4FNHA 2AJ1A 4A4JA 2FIUA 1FE0A 5T7LA 3FMBA 5KAKA 1QUPA 5T7LB 1CC8A
chains in the Genus database with same CATH superfamily
1PYTA 4QIGA 2NREA 5KG3A 3DHWC 3KK1A 3FGVA 4J9MA 2M4MA 3RG6A 5DGBA 3BQ2A 3UQSA 2R2RA 2N7YA 5HROB 1Q0NA 1RB0A 4DUZJ 2C2RA 1NPPA 1U6ZA 2MZJA 4G1QA 2RRBA 1YIJS 1N8RT 2FYXA 3ZTRA 4NI2A 3R7NB 1S5ZA 3EGNA 3JSYA 1LWEA 4Y2AA 4ZN1A 1W2BR 4WZMA 4F67A 1RTZA 2XI3A 4WWSA 2W2MP 2YKQA 4MK9A 2BQRA 1LKZA 3G82B 2C3OA 4P2XA 2E5GA 1UPMB 1SL2A 3KHHA 1MWZA 4LT6A 3VAFA 3N6MA 1JXVA 2KT5A 3MEGA 1LXJA 2MKIA 2ZBPA 1YTYA 2RDIA 4IYQA 4U96A 2RRAA 5GAEI 3IO1A 4OYMA 4AE5A 3R6GB 1VQSA 2UU9J 2CG8A 1FT8A 2VJVA 3GG0A 5CD4H 3TOQA 2YWHA 3K17A 2M3DA 1PYOB 1WG5A 2BANB 2YWWA 4I56A 3QAEA 1CS4A 1NHVA 1UVKA 3ELHA 3NCQA 3MCMA 3U27A 3CCUS 3QT5A 3V4IB 3G82A 4K4ZA 2XZDB 1C0UA 4NYPA 3ZTOA 3OUYA 3KLEB 5DS7A 4LFAF 2PN6A 4K5RA 2OPRB 2V8HA 3AAWB 4ZCMA 4F50A 2W2OP 2IM0A 2VC0A 3H90A 1XN9A 3ZZPA 1BLUA 1XMOJ 2E1RA 2V67A 1FTRA 1QE1B 2GFFA 3E3XA 4DPOA 1XEZA 5I4MA 1FFSB 2CJAA 2VBXA 3OL8A 1AYEA 2XGQA 4JI7J 1ZA2B 1YRUA 2WVFA 3IWNC 3DLKB 2K8GA 3CDUA 1HBOA 3EDQB 3MM8A 4F0KA 3GV8B 2RDDA 1J5OB 1VISA 2FC8A 1T05B 2XHCA 1UA1A 4A8KA 1FKAF 3KG0A 1M5PC 3ZTQA 4M5NA 2YXLA 4OX8A 4MIAA 2GS8A 3I0RA 3KK3A 2UU9F 4U9RA 3TWZA 4C7QA 2CADA 2ILZA 4IH6A 3JB9k 1RABB 2XEXA 3FZ2A 5F8IA 4TQRA 1NK0A 2E9TA 3P6YC 2XI2A 1U0HB 3PEHA 1QSLA 4Q2MA 2YBVA 1Y4ZB 5F0UA 4L75A 3CCLS 3HP6A 1H6KX 4F25A 4LSZB 3G2XA 2DRAA 4DL4A 3L7UA 1X5SA 1HNVA 4DV3F 2HNDA 1YZ7A 3IR7B 2EKYA 3JTOA 4CLTA 3T5LA 3NCRA 5IC6B 2GZOA 5J2PB 1BWEA 4KGXB 4H4MB 2CNNB 1G7CB 2FJEB 3VVTA 5E3QA 4WFNQ 3CJKB 1XMOF 4DR1F 4WP9A 5HROA 4GVBB 2Z2YB 1S10A 2I2YA 1N33F 4ZVUB 3CJ3A 3A12A 1XJWB 1R0AA 2UUTA 3RGIA 1HBUB 4PWDA 2Y1RI 3BDPA 2AJ2A 1C1BB 1ZAVA 4MFBA 3ZO7A 4AYBD 3GG1A 1RHQB 1T7PA 1JLBA 4H4KA 1V3RA 4DV2F 1OMSA 3QGHA 4TU8A 5DRKA 4MH8A 1FE0A 2IM1A 1CJKB 4BWMA 1W7WA 3KUHA 3ILIA 2R9LA 1RAGB 1CJTB 3M8YA 1URRA 3FQLA 3T41A 4AQYJ 4FYDA 1P27B 3FEXB 2RE1A 3JYTA 2UP1A 2RU9A 5KT6A 3V5RA 2E1CA 5DQGA 3SYZA 1SC3B 4L72B 1IVZA 2ABYA 3EMTA 4ZVEA 4DL6A 2IBOA 3W1YC 1U1OA 1D0EA 2YNFA 1GNKA 1S99A 1PBAA 3S1TA 3CCES 1LWFB 3EPIA 5HVFA 1HHQA 3QPIA 3A8KA 4RW9B 1AROP 2AGQA 4F36A 2PA8D 3DXSX 3MUVP 3BO2A 1C4AA 2GCFA 1WEZA 5B0DA 1PJ7A 1R8PA 1ZBTA 1S1XB 2ZNZA 2BE9B 3I9ZA 4ZVQB 3JAMU 1XMQF 3M7VA 7AT1B 1QVGR 4RU9A 2RKIB 1PJ5A 3R7SB 4DV1F 2GIFA 4NLQA 3KLHA 2OIHA 4J91A 3SFGA 5DG8A 1UZDA 1RLDA 4HR2A 5DZ7A 1NXIA 2HBYB 1O6XA 2JH3A 5HI7A 3UDVA 4HHHA 5KFGA 1BY9A 1SH3A 2YNFB 3KG1A 4OI4A 4ETXA 2G9OA 4DV0F 1CJVB 1IR2A 3TUZC 3KDNA 4RW9A 2DD8S 1W2IA 1R31A 2E44A 1IKVA 1KHWA 2VDIA 4J9VA 4PABA 1S1VA 5HBMB 1YWXA 5IOLA 3CJ8A 3GV5B 3NGSA 2AX0A 1T05A 4IO9Q 1CS4B 1B0PA 2G0CA 4WFXA 4U6PA 2QA4G 1NJZA 2FQQB 1XNRJ 4QU7A 2JL9A 3I56S 4NA2A 5J2MA 1EETB 3HVAA 2JDJA 1BC6A 1TMMA 3T5JA 3D54A 1X31C 4JI8F 1M5HA 4DFKA 4F26A 4KAIA 4TKTA 3BKUA 5KG4A 2M70A 2Z2MA 3D6HB 3ZC4A 1DRZA 2X51A 4ILLA 5BXIA 3MTKA 2HRUA 1TL1B 1S57A 3NLCA 2HFNA 2D7SA 2QA4S 4UY85 5DZ6A 5F8JA 2IYIA 1GK8A 2H5IB 2DH9A 2V2QA 4LF7J 3KMQA 4DR1J 4DX7A 3V81B 2ZC3A 1U2RA 1FI4A 4P73A 2BVZA 1RSCA 2KN4A 5J2PA 1IJFB 2LU2A 3FSYA 1FERA 1RJJA 1S7HA 3NGRA 3OTEA 3SBMA 3W8GA 4RWWA 3HT0A 5A0YA 2YKMA 3PRVA 3W9HA 2QZ8A 4KHMA 4O4GA 4DU8A 4DV0J 2UUBJ 2ZZTA 4OX9F 3TUJC 2MKSA 4P7VA 3JXOA 3NCPA 5ETSA 1GMVA 3CF5Q 4TY9A 4CH0S 2Q1LA 4F2SA 1VQNS 2ZHBA 2NUHA 1G3OA 1G1XA 1SJ4P 3R1HA 2A1BA 2BJ1A 1JLGB 2YX7A 1PC4A 1NJYA 2WBRA 4PAAA 4EI2A 1S6QA 4P75A 2JEFA 3F44A 3PEJA 5KFTA 2G1DA 3M8QA 5B7WA 2O01C 2NXNA 5LXYA 2AYBA 3ZZRA 4CO5A 3OXGA 4PYDA 2OJ3A 3H5YA 4OJGA 3OV7A 2VOPA 3QBCA 3U1LA 1TK0A 1S12A 2EFQA 3ENQA 4C3MA 3OD2A 1NUEA 1R0AB 1GT8A 4Y2IA 4K5SA 4OI2A 1DQAA 2FB0A 3M6UA 1X7VA 4OZ5A 4Z2XA 4IOBA 3PW7A 3UWTA 3FKBA 3Q83A 4ZIWA 5B0GA 3M1VB 3SFUA 3W2WB 4M5MA 2QFJA 2AJ1A 1HWUA 5DM7Q 2XQCA 2CAJA 2CQ2A 5LMNJ 5T7LB 1CC8A 1X5PA 3UN5A 2R8KA 1RKJA 2UV8G 3EX7B 1DHMA 1Q81T 1WACA 1NCLA 4L76A 1RT7A 2R7QA 4RNMA 2HQDA 1PAEX 2OPPA 3A8JA 3DHXA 4WE1B 2WVCA 2V4JB 2D69A 3TYTA 4CO4A 4CLSA 4ATNA 3LH2S 4C6AA 4LSNA 4N47A 3DOMA 5CCMA 1TV6A 1SIWB 1KHVA 5KT3A 4M95A 1R8CA 3ENWA 1SV5A 2DGUA 2JJ4D 3GJQB 1VQOS 3TAMB 2VG5A 4B9SA 4LF2A 4QWEA 2EBEA 3BS9A 1KS2A 5HANA 2GA7A 3HFZB 2WVDA 3HHLA 2J7UA 2KXHA 2VUGA 2RSQA 3H5SA 1URNA 2BRKA 2BJ3A 3C16A 3OL9A 3MMBB 4WFAQ 1SQFA 1KQKA 2UUCJ 4QCLA 1NK9A 1JK9B 1TKTB 3DRRA 1KFDA 4CH1A 3BREA 4JI6J 3QGIA 4CRJA 2CJKA 4NI2B 1NKCA 2CRLA 2H4WB 4PUOA 2WOMB 3W60A 4ECSA 5I3UA 1FK9B 2XB2D 2EI5A 2DR7A 2IA6A 2HVIA 1NDLA 4ILRA 3SSSA 4F4YA 2DGXA 2W1BA 4YY3J 3RW7A 4JI7F 4C0HA 2JWNA 3LF0A 4LBHA 4OYPA 1VQKS 2LQ8A 1S0VA 5IQ6A 3SQGB 4YB5A 1WEYA 1QUVA 2MZQA 3HKWA 2RU3A 2EC0A 4N77A 1S9GB 3W65A 3KJVA 3UD4P 2UXDF 3CMQA 4F04B 4PWUA 4GRSA 1CULA 4JP8A 2VFRA 3LWLA 3A4TA 2MB0B 3TUPA 1F6TA 1ZPWX 2UV8A 1GTHA 4EO8A 1NSKL 3VGSA 4UTGA 1WG4A 3TA2A 1DURA 4EMDA 2HGMA 1MU2B 1FCAA 2F9DA 2DT9A 2POKA 3TVZA 4DMZA 2D3ZA 5FJ4A 3S7RA 3UVJA 2V9KA 2ZH8A 1C4CA 1RISA 2BANA 2XYGB 1Z2ZA 2DRDA 5IZHA 2FJWA 1IN0A 3IAM9 2W7AA 2WW8A 4B9TA 3FFIA 3AJ1A 3CW2C 1SPBP 5IM0B 2A6OA 4A46A 1PC5A 2FVRA 1OY6A 4DN9A 1S72S 2IMWP 2W01A 2ZHOA 4QOTA 4IFYB 4NRUA 2VFTA 2HPUA 2E5LJ 1FJGF 3FBBA 3Q0AA 1HLWA 2B51A 1NH7A 4LF6F 1CEZA 1FX2A 2FJBB 3L7OA 2PD1A 4L74A 3HHKA 1GXUA 1N54B 3NS5A 5ETRA 4DZDA 2HHUA 3CCWA 3GILA 1FHTA 2Y8WA 3NBPB 4PG5A 4XAKA 3HHNB 2IC3A 4K0KF 2OSQA 2ALYB 1RAFB 3AOAA 3CJTA 1KSPA 4NX9A 4RW4B 2V4RA 2ZBCA 2EEYA 3C6UA 3LGNA 4NA1A 4BC9A 1VLYA 2XHWA 4H4KC 4TNOA 3GWCA 4KY3A 1RWKB 1K44A 3LP2A 3POTB 4X4PA 2O66A 3KYLA 4YEAA 4LF7F 4QIEA 4RNFA 4ZK7M 3CIMA 3VZIA 4F2RA 3QGPA 1RACB 4MIBA 4LQ9A 3D4JA 5LXRA 2MZTA 3M2VB 2CZ4A 4QIVA 5LL6d 1A7GE 2Y9HA 2RAQA 1FJGJ 3MM7B 3M9NB 1SV5B 1BQNB 4MAKA 2DNHA 4YB7A 2P6TA 4CZCA 3IP0A 4JI4J 1NPRA 2I6WA 2GJ2A 2MQMA 1A0OB 2DHGA 2A2DA 3NGUA 3Q8QB 2R7TA 2FJAB 2X1FA 4O3RA 2AMCB 1OIAA 3N9UC 5KAKA 3H20A 2IFXA 3W64A 3EVMA 4IR9A 1QAYA 3M4XA 3MMBA 3PYFA 1U1RA 1NK5A 2A6MA 2K2PA 2NZCA 4TXSA 5EN1A 3OXLA 2V4JA 1XERA 1FRLA 3EICA 4WP8A 2MMYA 2R2SA 3DRRB 5KG5A 2AWZA 2V2ZA 3DGVA 4ID8A 4DEZA 2X7IA 1N33J 1UAWA 2XY7A 1YHQS 1RYRA 1LWFA 3CCTA 2KJVA 1IM4A 1TV6B 4UOHA 5DDOC 5H9FK 3I9V9 3HMJG 1CBKA 2CQ0A 2B5JB 5IC4B 4ILMA 2LQJA 3R2DJ 1FKOA 3NEKA 4KKOB 2HVHA 2XWXA 1NZAA 2XO7A 1AUSL 2RNEA 5DG9A 2I5JA 5KFVA 5B0FA 4NCAA 1LFWA 4KJIA 3OJSA 4KRWA 4OX7A 3TARA 3KLHB 1HI0P 4A8WA 4OHWA 3R7BB 4ZVPB 3DKDA 3MCNA 3PG9A 3RZAA 3W5YA 4DX6A 1YJUA 1HBMB 1Q8LA 5HAOA 4U8VA 2OELA 1ZTTA 4B3TJ 1RT2A 1Q95G 4RNHA 1S49A 3D6TB 3GP9A 2J9EA 5DETA 4FVCA 1B64A 4ELVA 4OJ3A 3ULHA 2J6TA 4W98A 2E1PA 2SXLA 4B3OB 1TUVA 3D1HA 3GZ7A 3MM8B 1HWKA 4ICLB 2IHR1 3BEGB 4O4RA 5HBMA 5DG7A 2DH7A 4M8LA 3JQKA 4KKOA 2HZAA 5IM0A 3O8WA 2I5JB 1YLXA 2LEPA 2YQ3A 3GE9A 4YHHJ 4M5IA 5A8WA 3UPFA 2HZCA 2IDLA 1EB0A 1EETA 1YRXA 3HDSA 1JQGA 3V6DA 4IH5A 2QSWA 1NHUA 2QRRA 3Q23A 4CLKA 3GFXA 1X0FA 2VBZA 3NKYA 3VGUA 4NRTA 3GV7B 1ZM3A 1TQLA 2BZ2A 2AYEA 2L48A 2EG2A 4QIWD 5D78A 2N3OA 4DUTA 1Q7YT 4ALZA 2LU1A 3MXHP 2JLEA 4Z37A 2H51B 2HBRB 1U26A 2V0NA 1ULRA 5EHHA 1IUJA 3C6UB 3DC2A 4Y3CA 2GIQA 2P2CB 2WTFA 4CCHA 4FS2A 2L9WA 2W8KA 5KG0A 1KONA 2AYMA 3J7ZT 2DJWA 5C7PA 2J76E 3CD7A 5HN0A 4CM2A 2NCKL 4P7TA 1BE4A 2NLWA 5EWEA 4M5LA 3K57A 1NPKA 3PYGA 5KFNA 4Q2LA 5G4DA 4B3RJ 3QFHA 4USMA 1FO1A 4ZPCA 2FVCA 4EYIB 1Y00A 1MG7A 1SXLA 3HFKA 3O3LA 1RP5A 5ETOA 2VH7A 2CQ1A 1V3ZA 2FTRA 2OKQA 1VQ4S 1HNWF 4DR7J 2NXCA 2CQ4A 2MLYA 3TANA 3CCSS 2Y3YA 3NS6A 3B4DA 5B0AA 4ZCLA 5KT2A 2C22A 3M8WA 3CCRS 1MROB 3L09A 4NCBA 4G1PA 1HYSA 2V2KA 1VRTB 3E51A 4DCJB 1F3FA 4ED7A 5CXTA 2F9JA 3IAS9 3MM5B 4R25A 3T6BA 3PHTA 1RTHA 1NK8A 5J2NA 1JLFB 5HMXA 2CJBA 4I2QB 3SIPB 3GMGA 1GEHA 1U8SA 5DDRC 4WFYA 4DPYA 1D8YA 4YDDB 3BR9A 3MEKA 4FYYB 2ZFHA 2HS4A 4B3OA 1B7FA 2PO4A 1T03A 4ZVRB 3CJ2A 2HHHF 3ZXWA 4CLPA 1SC1B 4DSJA 3G8QA 5CHCB 2VG6B 3MM6B 1RT3A 1IM6A 2VBYA 2XNQA 2UUWA 1R8AA 1FXRA 2ZUGA 5AT1B 4ER8A 3PW2A 5D8HB 2AQ4A 1WC4A 2CPJA 4A47A 3BKFA 4KGMA 1YJNS 1TUWA 2PFDA 4A8XA 2B9YA 4B9VA 3QIDA 4LF5J 2DHSA 1WTFA 2DIUA 2QYGA 1K0TA 4EFAC 4FXVA 4NLOA 5EX0A 4XPEA 4R5PA 2D41A 4B9UA 1UWAA 4KT0C 1JWWA 1FKPB 5I42A 4O0IA 3ENVA 3I31A 1FKOB 4L6V3 1VQMS 1OPZA 1HHSA 3BJYA 4K4XA 5D3GA 2MDAA 4RBTA 2ZBIA 4A48A 5KFQA 3FEZA 1JLCB 1HARA 3RU0A 2KFZA 1VIXA 3THTA 2OH2A 3A3NB 2ASLA 2ZJQQ 2GNKA 2A18A 1E6VA 4EZ6A 4UW2A 2DR8A 1NBEB 2R2UA 2CDQA 1A6LA 4D3GA 1UP1A 3MAHA 1F60B 3OTOJ 2ADBA 3EGZA 3TNVA 2RHSB 1MMDA 1PILA 2QC3A 4DHVA 3DLLQ 4B3MF 2E7WA 4J9SA 2I0XA 5HMWA 1ACMB 5HQLA 3BR8A 4ICLA 3MDFA 3MWBA 1S6PA 1GX6A 4DXLA 2YX4A 1HL6A 1ZZFA 3GCXP 2HVEA 5A8WB 1FJ7A 4QZVB 3VTIA 4OMFG 2RUGA 1KR4A 1R27B 1L3SA 4ZMMA 3RR8A 3SQGA 5EWGA 4A8MP 1E6VB 3EDRB 4ENOA 3CDAA 1C1CA 1DBDA 1OSDA 3EM1A 3VWSA 1QSSA 1PCAA 5J2QB 2D1CA 2Y8YA 3KFWX 3FNNA 4DUYJ 2AP6A 4LUBA 3BBCA 4A8OA 1WKLA 2CZ9A 3M2RA 5E3PA 3LP0A 3MAAB 3QLHA 5CYQB 3TJAA 4DS4A 3AD8C 1RCXB 2WONA 1VRTA 5C2CA 4NXMF 3GJRB 4LIWA 4U7UK 5GAEU 5KT7A 4NLUA 3FSXA 3BBBA 2ZVSA 3MR6A 3HF5A 1NB7A 1S6UA 3VCDA 3FCVA 1TL7B 3AY0A 3HULA 4ZITA 2R7OA 1RT4B 5K5MA 3MR5A 1FRHA 5KFUA 1H98A 3LW5C 1HNIA 4BLGA 4LQ3A 1ICEB 3I4PA 4E8UA 3C46A 1RGVA 4CWBA 3ZZZA 1LV5A 4FYXB 1OPIA 1VRUB 4NASA 5JJBA 3M8PB 3C15B 1X5OA 2KHCA 2ZDOA 3ET6A 5CZXA 2E1MC 2IMOA 1J27A 3NS7B 2IA0A 4Q7AA 1U1KA 4LVNP 1VQ6S 3MEEB 2GJIA 4WE1A 3CULA 1ZYQA 2BRLA 1GMWA 4RLEA 1RU2A 4XPCA 3GLJA 2LLZA 1N88A 4IQMA 5F8NA 1F0XA 3D9BA 3DN9A 3DRXA 2XZTB 1H2TZ 3C14B 1R6VA 4R8UA 2HS0A 3BF4A 5ETPA 2MZRA 3GIIA 3MI7X 3PFOA 2FHMA 1RTJB 4I2QA 9RUBA 4F4AA 2XC9A 1LK5A 2B4OA 3M30B 4QQBA 4BBYA 2IC3B 1RT6B 2BW2A 2U2FA 3WQPA 2VB6A 4YMEA 3FQKA 1DTTA 2CVEA 3N6LA 1N6QB 1U24A 1M5VC 3UO0A 4JI3J 3HO1A 1HQUB 1IBKJ 3C15A 5BR8F 1JLCA 5HSPA 2VQEJ 1GFWB 3MPYA 4TLQA 1X4BA 3LA0A 2OPQB 4ANDA 5E41A 3CCQS 4OZ1A 2QX0A 4IFVA 4OLOA 3SDEB 3P45B 1TKTA 2PDAA 4ZLPA 4WCEQ 2MQOA 2LQ9A 4JI5F 1WUUA 4AL7A 4X66J 3GFHA 1Q7LB 3DGPB 4HT5A 3BGOP 3C14A 1FVSA 4R8UB 3KHLA 3P96A 4I7FA 4DOZA 2RDJA 3DU6A 4UOFA 3VHQA 3W8PA 5EGYA 4WFBQ 3EPGA 2FLOA 3PM9A 4B17A 4DLGA 3KOAA 4ES3A 1Q8KA 5D4NA 4E2FB 5J1EB 4DV3J 4WYWA 1RWMB 2DR9A 4FF3A 1ITPA 2J6UA 4U7UD 1HD0A 4C8YA 1TL4A 2HWHA 4LR9A 1N6QA 4Q8EA 4CLZA 2HFOA 4X4VA 2DNMA 3GFYA 4CYUA 1TELA 3WZ0A 2VQFF 3HZEA 4FYWB 3W9IA 3CUNA 3IN5A 2J0WA 1X8DA 4GO7X 4JYAJ 3R27A 1IWAA 5D0HA 1S9EA 4PQAA 5H9EJ 1RZMA 5A2QY 3G4SS 4F3MA 2HW3A 2IAJB 1VQLS 4LFBJ 2HNYA 2XMWA 3CDWA 3UDEA 1TL5A 5CAAA 1YVFA 1TKXA 2GGPB 3QJPA 1KRPA 2IIHA 2O3DA 4NYZA 1S4EA 2CVIA 2B7BB 4DI6A 2CQIA 3QLHB 2MYFA 1MNEA 5CYQA 1REGX 1VBXA 1FDDA 3T5HA 3PCOB 2EFOA 3CJ4A 4KR0B 3BM7A 2VKZG 5AJ3F 4YB1P 2F65A 4I6AA 3DI6A 4OL8A 2FD2A 1IJEB 4WPAA 4UZBA 2Y0SD 3OLAA 3C3LA 1C1CB 1X5TA 4PEOA 1T11A 1T9VA 1XK8A 3TI0A 2NS1B 1RBLA 4EGLA 1YBUA 3DOKA 4MJKA 2KT3A 1I6JA 2YPZA 5D15A 1SQEA 2E66A 3RBZA 2FY8A 2VZ9A 1K47A 4NLWA 3BSNA 2GJFA 2MHNA 4KFBA 1SL1A 2F63A 2CIMA 2FHKA 2YNGA 3P5BP 3LAKA 1F5BA 4Y34A 3MAAA 5AE3A 3TUIC 4ZHRB 1AW0A 5F8GA 4GKJJ 5BYSA 2PGCA 2GHWA 5CYJA 2FLPA 2HHPA 3W7BA 1VR6A 4QBUA 1K0VA 2WAQD 2V68A 3OVAA 1RWWB 2DNNA 1YQHA 2IJRA 2YKAA 1S0OA 4KE5A 4W92B 2N4CA 2UXDJ 1QAIA 2EG1A 2AX1A 1ZOTA 2KXNB 1QM9A 3TJ8A 1BQNA 3KG4A 2P8IA 4DV4F 2BR0A 2JEJA 1TL3A 4Q43A 1UJ4A 1RDRA 1LW0A 3UCGA 3MD1A 4KFBB 1HWLA 3BQ0A 1IBKF 4XDCA 2QIFA 1KBRA 2BACA 1YKWA 4HACA 5H1SV 3J81Y 2B43A 2VG7A 3T19A 3OPKA 5KFSA 3K5OA 3ZTSA 1X4EA 4X4RA 3KLFB 3GJTB 2F40A 4KBIA 3T1HF 4ZVSB 3GR0A 1WI6A 2FVQA 2X3GA 3V4MA 2IDEA 2HS3A 3NGDA 3T1YJ 1DTQA 1RT1A 3HX9A 4F0MA 2G2OA 4I68A 5DQIA 4ECTA 1TMJA 3HHLD 1NK7A 5B0CA 2H5JB 2BEFA 4FVMA 2ACYA 2DNYA 3PJXA 2IVYA 1X9WA 2C3PA 4EUVA 2DR6A 3OLBA 3RBEA 4TYAA 1TAQA 3IMQJ 4XDDA 2E1AA 2W9CA 2FIUA 5K8NA 4I6WA 2MQQA 4HI2A 2BA9A 4RBVA 2B3TB 5KFHA 1YG0A 4DL2A 1YJWS 2VDHA 4J90A 1XR5A 3MM6A 4MMOA 1RHUB 3QRQA 4OHVA 2V94A 1MROA 5LSOA 2BW7A 1H3DA 2CJYB 2G1HA 4DPTA 1IBLJ 1HYSB 2XBPA 4Y2MA 2Q6CA 4FZVA 2V69A 2NSBA 3RBDA 1FWPA 2KZZA 3MTJA 2VFVA 2P9EA 2V6AA 1WF1A 4RBUA 4C0OC 4Y65A 1EP4B 2KYXA 1NDKA 5M2RA 3BO3A 4K4VA 1G4CA 5HQMA 3C66A 3WC2A 2CJ9A 4ZJQA 2EBGA 5F8HA 1NDPA 1ZPVA 5KOWA 2PIIA 2VG6A 5GAGI 2HSEB 5AE1A 4DR6F 2DNLA 4UOGA 1FESA 1HMVB 1T95A 3N79A 4UF4A 2XSJB 5D4OA 4XO0A 2AGOA 2YVSA 2ZWPA 2DHHA 2W9AA 4X4SA 3D3BJ 1JLQB 1UEVA 2BQ3A 2GMLA 2X3DA 4LF9F 4IDKA 5AXLA 3OVSA 4LMZA 3B6BA 1EAYC 1S1WB 4KH0B 1FK9A 5C24A 3VQTA 3CVKA 1JLAB 3QSIA 1L3KA 1EP4A 2AEFA 1WOOA 2EFGA 2IAJA 3DDNA 1XQIA 4ZS6A 1YJ7A 3BQ1A 4BDPA 1QTMA 3NAHA 4JV5J 1R8BA 3G6VA 4RX6A 2LA6A 3EXCX 3PX6A 4YS2A 3DM2B 1YJVA 5C25B 1X9MA 4K4UA 1I1GA 3IC1A 3CJSA 5FLXY 2YH1A 2BOAA 1SC4B 2KXFA 4WK1A 4FF4A 3PZPA 5A2QU 4LF5F 4DPWA 1CJUA 3ENAA 4K59A 2MZ1A 1EKSA 2CNLB 2DCLA 2DBBA 3LALA 3HJVA 1OWXA 4F02A 2JLGA 1TKZA 1ZM4A 1DJ0A 5GADU 5HL7Q 1UJ6A 2P5VA 2KKHA 3ILLA 4LRDA 4ZVFA 3SSQA 5C24B 1OS5A 2YH0A 3VVUA 1LW0B 3K58A 2RH3A 3X3UA 5LSRA 2XZWA 3IBFB 3DLEA 1IBMJ 4HACB 5KFRA 1RYSA 2PC6A 3GYNA 4YR2A 3I96A 3AXMA 2ACMA 2K1RA 4BCAA 3GJSB 4C48A 3D5MA 1EQMA 2P6SA 2J0XA 5H9FJ 2XLIA 4DL0C 4QJVA 3K59A 1OJ4A 1OY9A 1NSPA 3RBXA 3K5NA 1L3VA 1R6YA 5HMYA 1BD6A 3CO9A 3RB6A 3RB0A 4DSIA 4OX6A 2K7KA 1TL3B 2J0SD 3QRPA 1JMTA 2YQ0A 3QYYA 4OIXA 1JLBB 3IGVA 2AU0A 3CD0A 3OR1B 4NLVA 3OFGA 4L3NA 3ZZYA 1WHYA 1S1TA 3MMCB 1AFIA 2G0JA 1PAUB 1B99A 1F2HA 3DRSB 1OY8A 2C2KB 4JBCA 3GSIA 3POTA 2M88A 4ZLLA 3HSZA 5AXNA 1N34J 2HHHJ 1U1MA 2XMTA 2XS7A 5C5JA 4WK3A 2PMZD 3VGVA 5IV4A 4QR2A 2MGZB 5AXMA 3IR5B 1BGXT 3W5XA 4DCOB 2DY1A 1Y9OA 2FDNA 3OL7A 3TZXA 3H25A 4M5DA 2DGOA 4UUWA 3I0SB 1HBNB 3JAMY 1XBWA 4RZRA 3SCKE 2PI4A 4WU3A 5ETMA 3ZZ0A 3G8SA 1S77D 2QEXS 1T9YA 2Y0BB 2OO4A 4MKVA 1VS3A 4CTAA 8AT1B 1X4FA 3CCJS 3PNIA 3KHRA 2C2EA 4NXMJ 4NLGA 1NZ8A 2F8MA 1S1TB 3MMCA 4DR6J 3OBIA 2VD3A 4RW7B 3NG8A 5T14A 2KDOA 5I3PA 3PR5B 2XSJA 1JIHA 2AGPA 2JC1A 4PCQA 4EO6A 5HO4A 2E5LF 2DNOA 4JV1A 2Y1LB 4FXWA 1QVFR 1VQ5S 2M9KA 4FPRA 1NKBA 1VRQC 1HBNA 2J9CA 1U6BA 1FRJA 1JLAA 2Z8QA 3IM8A 1NAQA 3DLGA 3Q8YA 1YZ6A 2RQMA 4ZP8A 1UJ5A 5L1LA 1FRXA 2OP5A 3FDSA 1S7IA 4NWBA 3BGRA 2H48B 1H2UX 3BN7A 4M94A 1N36J 3CCZA 2WSFC 3MMAA 1XTZA 3K8WA 1AUDA 2BABA 4OLPA 4ZP6A 4IKAA 4BWJA 3BSAA 3OL6A 3RTVA 2OTJS 2KZMA 4NPOA 2YKOA 1YK9A 5M2UA 5L1KA 5E33A 5C42A 3QAUA 2HLUA 2HQCA 1HQEA 1S1WA 2RVJA 3EZUA 3OXFA 4USIA 4WKRA 1REVB 1NMEB 4NXNJ 3BGUA 2ZKUA 4E98A 2CZVC 3HD1A 2J5AA 1ZM9A 2QA2A 2CPEA 1T3OA 2V2VA 3HSDA 3N01A 3UFCX 4EEYA 2C2ZB 2CQHA 2DTJA 2DEIA 2C1EB 2FHOB 2K7JA 2MJUA 3M2RB 5HK4A 2ZE2B 4TU7A 4K50A 3CWJA 3R5CA 2HHQA 5J2MB 1MW7A 3T6JA 2MKHA 3DM2A 4O4GB 3K5LA 1F2GA 3AD7C 1QLNA 2DKOB 2ZC4A 4ZDNA 4HTJA 2CPIA 5HQ8A 2J7KA 1SVDA 1H74A 1UEKA 2CNKB 2ZVIA 1Y5LB 3IA0A 1HI8A 2G2YA 2MLZA 1E6YB 2BM0A 3DYAA 3EE3A 3MECA 3QGGA 2XCPA 1N34F 3LGMA 4KGVB 4O3QA 4N5SA 3H5XA 2HIQA 2XG8A 4WYLA 4P2SA 3W9JA 5HMZA 3H40A 3UD3P 4E0DA 1HNIB 3C6TB 1SBRA 2VOOA 2LXFA 3CO0P 5ITHA 3FSIA 1L3TA 5SUHA 1S79A 2XTJP 3G6YA 1U25A 4X84A 1R43A 2IM3A 3M2UA 3JS9A 4P2FA 2GX8A 3A13A 1O0PA 2F7VA 2GAGC 1KQGB 2DNPA 3H0PA 4DSEA 2HZVA 2MKJA 4EBEA 5AE2A 1LEOA 5KG6A 1HFEL 2DNRA 5LMUJ 1FJEB 1KN6A 1CULB 2H54B 3Q2TC 1IR0A 4K4WA 4A8FA 1RTJA 1RXOB 3D6FB 1JJHA 2R7WA 3EJMA 4RW6A 1HA1A 8RUCA 4AL5A 3TZWA 1IQTA 4J9QA 4WIIA 1Y0HA 5F0WA 5D4PA 4CH7A 5AJ3J 2AD9A 2KTQA 4OI1A 1X9SA 2MQNA 4NLXA 2OPSA 1T9XA 4PZVA 4RW7A 4DV6J 2HEKA 1C0TB 1LFPA 1QTNB 2V34A 4ECQA 2Z58B 3MM5A 4FF2A 2R7UA 3CJKA 1HHTP 1HNXF 3OTBA 4KB7A 4IFYA 2FZKB 4ED0A 1SH2A 3D6MB 3CTRA 3K8VA 4Q44A 4QWAA 4C8KA 1Z4UA 2KB2A 2QLWA 3GONA 4M5DB 1RU1A 3HSJA 3I5BA 2HNZA 3J81j 1SUQB 3KTQA 1VHIA 5CYMA 3BGFA 2FGCA 3AT1B 4FKXA 3FUYA 5EUHA 2MSTA 5ADZA 2D9PA 5IFMA 5GMKa 4LF8F 4MFBB 3AHPA 4A4JA 1F5AA 3MGJA 5KFAA 5T7LA 1SJ3P 2XLKA 1RT3B 1RA7A 1VBZA 5L9XA 1CJKA 3P8BB 5ETNA 4X4TA 3C16B 4ECUA 2CWXA 3OTDA 2O67A 3TX8A 3M9OB 2GW8A 5JMNA 1NSQA 2DGVA 2OUGA 4CNZA 2AEJA 2MKKA 4OI0A 1UMJA 2VASA 3GFZA 1WC3A 1B7YB 1JLEA 5LM7E 1SQGA 2KH9A 3UW1A 2HQIA 3B78A 5HATA 2C2DA 1FF2A 3CDBA 1LWCA 1N56A 3CSKA 3F73A 2PMHA 2FJVA 3H59A 4B3SJ 1WC5A 2HNYB 2QLBB 5THWA 1K9MT 4YY3F 4LFAJ 3E2EA 1MMLA 2ZH9A 1M90T 3LOUA 1U1PA 2V50A 5BR8J 1U4BA 1KLNA 2QG9B 2KT2A 1GTEA 2CQBA 4DUYF 2NXEA 1YSJA 4ANEA 7FD1A 2ASYA 2BJDA 4CO3A 1IBMF 1M1KT 1CQNA 3LWMA 1DLOA 1ELOA 2H3EB 1DZ5A 3FJ2A 4QPTA 4B9NA 4DV5F 3KLIA 3US5A 5HLFA 4G1QB 2HHWA 3BYRA 2I9SA 4CLLA 1U2CA 2BE2B 2K3KA 3D28A 3PKYA 3GPAA 3QO9A 4DX8H 1CJVA 2VC1A 3L9ZA 3RB3A 3CD6S 4IRKA 5JUMA 1HKAA 4UY8T 1S0MA 1J5EJ 1W26A 4ECYA 2OMLA 1B70B 4PKDB 7FDRA 2CUYA 4ZHRA 1HR0F 3ITHB 1RWOB 3EZOA 4J9UE 4NEYA 4DZ6A 4U7CA 4DL7A 2UXCJ 1R0CB 5A8RA 3OTOF 2UVVA 1N32J 3GCWP 1DFDA 3IR6B 4WTOB 4GMKA 5FLXU 1L3UA 1VOMA 2D9OA 2C3MA 4DL3A 1E6YA 2F4VF 2EFPA 3V6JA 2J9DA 1SJ1A 5J1NA 2HYIB 1EX8A 2HBQB 1S1UA 3C6TA 4G65A 2B0GA 2F4FA 3Q24A 2JVOA 1UKUA 3BZQA 4USWA 4KO0B 4IRDA 4KH1B 2V8GA 3FFIB 1EZZB 4TY8B 4YB6A 2B9XA 2V5HG 3AQPA 2YKMB 1SCJB 2PA3A 3M2UB 3KLFA 1YI2S 1TVRA 1S0NA 4DR4J 1NO8A 3NOGA 2KRRA 2VBWA 5IV3A 1KQFB 1M5KC 4ECWA 2CQDA 2ZD1B 5B08A 2M52A 3J81U 2FVPA 4JI4F 5CZVA 4FDFA 2HQ3A 2W24A 3OFHA 4I69A 2HNZB 4JI5J 2ZUAA 3PIPQ 1C1BA 1JXEA 2BBEA 4J7CA 4NCGB 3DRPA 5FDLB 4ZJLA 4EU0A 3BGLA 2C42A 5KG1A 4C8LA 1SKRA 2DYAA 2W9CB 4UOCA 4USUA 4DFMA 1VK3A 1RT5A 3FCHA 2JSXA 4DU7A 3M8PA 2YKNA 3KHGA 1C0TA 3J7Z5 1U1LA 4CIOA 2JEIA 2OPSB 2BKNA 3KK1B 2KU7A 1JJCB 3DOLA 2VPYB 4KHRA 4JI0F 1I94J 1RBOB 5I3QA 1F5CA 2YWKA 4LRAA 2ASJA 3P4UB 3QNWB 1RUSA 2HBZB 3BB5A 4HL9A 2H4YB 4WBFA 2EFVA 5KFIA 3WIUA 3M9MB 3B82A 2UVUA 5LOQA 4NLYA 1KQSR 5B09A 1V5VA 2C2OB 2FHJD 3AB2B 3UDCA 2JC0A 2OD6A 3F0NA 3IFEA 1J2VA 3M30A 4P2MA 4QYZK 3R5AA 2EPIA 3DLHA 1GXTA 1R7IA 4HI1A 2KM8B 4LF6J 1ZETA 3T5KA 1RWVB 3OR1A 1FRIA 3QATA 4NLDA 4USJC 2DY9A 4OHZA 1U6FA 2PMWA 4X4OA 1QAJA 4WFZA 3HT3A 3N0VA 4FBTA 3DU5A 2PEHA 2XCAA 2R3VA 3KJQB 2ZNYA 4K2JA 4P72A 4PR6A 4IR1A 1NK4A 1RAAB 4ETZA 1D1UA 1IBCB 3CNQP 4O0NA 4LF4F 2R7XA 2W7PA 1RT7B 3PDNA 4X65F 4F3QA 1EIYB 3PO4A 1Q78A 1LXNA 1VDHA 3GYGA 2DNQA 3MPVA 2XMJA 1H0HB 3SSRA 5J2NB 2NZ4A 2BE2A 2ADCA 4DV5J 3MOZA 3W2VA 1F9HA 1G6BA 4PXCA 5KOXA 3BKTA 5HJXA 1GMWD 1M1HA 3LPYA 5LJ3Y 3W2WA 1IKWA 2PFFB 2OSRA 2UVWA 4J9KA 3RRGA 3TW0A 2R7VA 1EARA 3ITHA 3ISZA 3U1MA 1FXDA 5HVGA 4O3SA 1S6OA 1EHWA 2F1FA 3V6KA 4G3IA 1CJTA 1WKKA 1GXLA 2A10A 3GB0A 1YDLA 2XMMA 2XMUA 3Q2SC 1T0TV 3L95X 1WTBA 1NK6A 3EUNA 2BQUA 2L08A 3B54A 1F9EB 5GMEA 5RUBA 1IKYA 3LP1A 5E5NA 5HVHA 4Q0BA 2YX1A 1WDTA 3VALA 3M6XA 4MK8A 3H8YA 1KD1T 3SCJE 3LUYA 4CLUA 2QLFB 3TR5A 3SI8A 3S8SA 5KFMA 4X65J 5L1IA 2V8PA 5T41A 4JV0A 4R5PB 4ELTA 3DLGB 2PT0A 3N4WA 4ZPWR 2WOMA 3D1QA 1FNMA 3DLEB 1WHWA 3I5CA 3AH6A 2QE5A 4ZJOA 3OR2A 3UR3C 2DITA 1LW2A 1NKEA 3PVXA 2DPIA 2HMIB 4Q0BB 3RAMA 3KLEA 4LRCA 3W61A 2ZOGA 3WHIA 2FVSA 3CC4S 2NXJA 2IBKA 1FE4A 2I38A 2C3YA 3Q8SB 1SB6A 1WDDA 1RWUA 2YKPA 4LRBA 4OZLA 5ETLA 8ATCB 3OUYB 1WD6A 3JSMA 2QL5B 4LF9J 1UCNA 1H2VZ 1NDCA 2B56A 2EXUA 3B4MA 3DLJA 2BJ8A 2O1PA 3VF0B 4CLYA 2IYGA 4I2PB 2M8HA 4ZVOB 1RADB 1U0HA 3RW6A 1SJRA 3GYXB 4N56A 2QMUB 1TTHB 2DK2A 2ZBQA 1LK7A 3G87A 1MMNA 4CI0B 2KG1A 1VQ8S 3HZGA 1M5SA 2XMVA 4DPUA 1S6QB 2HRTA 3B8HA 3EZ5A 2W2NP 3BV8A 3G71S 1VLOA 3NRBA 4KYZA 1S6PB 2AT1B 3QT7A 1J5OA 4YR0A 1V5IB 4TN2A 2ZH1A 3TZZA 4FBUA 1UVIA 4ED5A 2DGQA 2ZWOA 2DEJA 4FPIA 4C11B 3G6XA 4ED1A 3SZ2A 1JNZB 2FJDB 4J9OA 2YQ1A 3WIVA 1YBTA 1RTDA 3QWPA 2R42A 2HQFA 3DRPB 5FDLA 1IBLF 4DX5A 3ZFVA 2FPHX 1Y3JA 4LRFA 1I51B 4NLTA 3OVBA 1VIOA 1WC6A 2Z56B 2E5HA 2RJZA 1BHNA 2IRYA 4RW6B 2VONA 2D3UA 4PXDA 4KV8B 3MCSA 3AFGA 4RUBA 2WW4A 1VI7A 3U7JA 4RW4A 4CT8A 4X2BA 1EQ0A 2LMIA 4USKA 4DL5A 2FY1A 1DTQB 1RT1B 4J9LA 1NJIT 1MN7A 2LXUA 5KG7A 4OZJA 1BXNA 1U7LA 3IWLA 3UI3A 5MLCV 1B4SA 4LF4J 2OMOA 1HD1A 5F3TA 3QT6A 1HW9A 1LWXA 4I4BA 1HW8A 3C2PA 2CQGA 1Q79A 2E29A 4OHXA 3PIOQ 1U47A 2L3MA 2CDRB 1RQ0A 3UN2A 5D0EA 4F3OA 4IO1A 5ETQA 4HVZA 1S97A 3WC0A 2HFUA 1M5OC 1ZAWA 2UUBF 2APOA 4QR0A 1VGYA 4C4WA 4RWXA 2OLWA 1UWBA 2B8QA 2OGUA 1VC5A 1XWLA 2AV5A 4Y2KA 1AFJA 1WEXA 1IR1A 1OYDA 2RIJA 3LP2B 2KRBA 2DCUB 2W2PP 4USVA 1Q8BA 2Z57B 2VJUA 1VCTA 4F4WA 2AJFE 2G13A 3MPDA 4NLPA 1OQ6A 4ZLJA 3KK2B 2COLA 5IXUA 1RHJB 4J37A 1HQEB 2FLLA 3ISND 1U8WA 2HHTA 2OAUA 3PFEA 5B0EA 3AQOA 1NRKA 1RE1B 2CPYA 3MAQA 1Y5NB 1WOSA 3R8YA 5I3UB 1UEUA 1RHRB 1HWJA 2MTLA 3H2LA 4C8MA 4ED3A 4JI8J 3W5ZA 2XY5A 2RKIA 3J80Y 3QQCD 2E7XA 3MD3A 2HK2A 1JXLA 2OEMA 3O6QA 1VBKA 5K8PA 2ZJPQ 3SCIE 1UFWA 1TFYA 2U1AA 2HFZA 2FUG9 2WVBA 3BYPA 3RYLA 2LXIA 5ETKA 2OPPB 5BJRA 4ID5A 4IFVB 3DXBA 2E5IA 3PX0A 3MEGB 3VAIA 1DY3A 1WC0A 2KFNA 4LR8A 1Q53A 1MSWD 4NLSA 3JTNA 3SQOP 1IXKA 2A3JA 4DR5J 3CXCR 1YJTA 4FKYA 4PG4A 4Z7CA 3V6HA 4QW9A 2MQLA 3TAMA 4CLFA 1N5YA 1IKVB 1LW2B 2HMIA 1B0TA 1RAIB 2EKNA 1KDNA 2FC9A 3UE2A 1ZH5A 1A9NB 3R2CJ 2A0FB 3CPWR 3W3SA 3HHLB 2ERRA 1UA0A 4IG3B 4DV1J 1CJUB 1WC1A 3CJ5A 2HAFA 2ZKTA 2J7WA 2XWYA 1XMQJ 3PY8A 2QT7A 4ID5B 4R0JA 5GAGU 5MAOA 1KOOA 1RHMB 1TL1A 1WI8A 1AB8A 2DGTA 4C3KA 2HQGA 2CPHA 1WSRA 4DF4A 5HLFB 2UUCF 2VODA 4GC6A 4QWDA 4C9DA 3NBPA 5JXSA 1JLGA 2CQPA 3CD5A 3DCAA 3H7HB 1UTAA 3CDEA 3V81A 1TR0A 4U95A 4CO2A 1T3NA 3M8QB 2EC2A 1Q5YA 4DV6F 2JLFA 4HH0A 1JNRB 1RTIA 2V63A 4DQPA 2QLJB 2DNKA 3AODA 1R0BG 1NSAA 3JTPA 2K1RB 4OV6A 1UL3A 3FMWA 3HLUA 4ES1A 5DQHA 1Q86T 3GQCA 3S01A 1RWNB 2WVEA 2OFHX 3QMQA 1T02A 5F9NA 4DG1A 1Q82T 1XNQF 1PKUA 3DI6B 2ZHAA 2RS8A 2YWGA 4NZ6A 2DXEA 4ZPDA 4ED2A 6AT1B 5L46A 3AOCA 3TQ1A 2BM1A 1Q8IA 2C3UA 2A2CA 2GC8A 2WB4A 3MM7A 2ASDA 2MJNA 2E9RX 4DWIA 2E9ZA 4G1IA 4ANCA 4CO1A 4CM0A 5EWFA 3OHAA 2WBMA 3PR4A 3OJUA 1RAOA 4BC7A 3EXYA 3H42A 4MKAA 1KKHA 2BKPA 1Q16B 2H9ZA 4NOHA 5FIIA 1SJFA 1YJRA 2AW0A 1RTIB 4M5GA 2XSFA 3D66A 1TAUA 3HCXA 1Q5VA 1RAEB 3I6PA 3KNGA 4HHJA 3DLBA 4JV2A 4L73A 4ZVGA 3ADAC 4I6YA 1JLEB 1S4FA 2Z30B 3TVYA 2IY5B 3IWXA 1YJ9S 5H9EK 2H5EA 1FTCA 2B4UA 3E8OA 1RAJA 2J6SA 1DQ9A 1FFGB 4LSNB 4AUKA 3EYZA 4JI2J 1P9YA 3O2IA 2HGLA 4KHPJ 4M1KA 2BJEA 4LREA 3EGVA 3PRBA 4D3HA 3CE8A 1YX2A 1SKUB 3UCUP 4DN0A 2LVWA 4A8SA 4B9LA 4WZQA 2ZOMA 3A3PB 1BWVA 3NWRA 4P74A 1UW9A 3W63A 2BJ7A 1RLCL 3MPWA 4Y28C 2W7OA 2ROGA 3ZZUA 4MYUA 2W2QP 5L39A 1UWBB 1Z1ZA 3DOLB 4NEZA 5DDQC 1CVJA 2NPIA 3IBWA 4B3MJ 2AZ1A 2CFXA 4TVAB 2HVDA 4OYIA 3L4BC 1UZHA 4UUXA 1JB0C 2HGNA 2VFUA 4OQJA 2JEGA 2NR0A 2NYIA 3MUTP 3R5GA 3M2VA 3Q8UA 3QT8A 4I7FB 4RNOA 3FVYA 3T1YF 2ZH7A 3A8IA 4AXJA 4BHQA 2WRMA 1V6HA 1QSYA 3S6EA 3T1HJ 2WSEC 3ILJA 3I82A 4QWCA 1QDUB 2VL1A 5J1EA 1SKWA 1D9FA 3HI9A 3NL0A 1J5EF 1KVIA 3C8YA 3KUGA 4USHA 1FWLA 1N4LA 1S1XA 4OYXA 1KNZA 1IKXA 4H4OA 5HP1A 3PV8A 5LMNF 3D3CJ 1WWHA 4K2XA 3KLVA 2HKEA 3IG1B 1TZ0A 2YNIA 3MMAB 4OYAA 4MIWA 2JVRA 3OFFA 3PW0A 5F8MA 2XGPA 3V6DB 1P1LA 3O1LA 2CPFA 1FRKA 3OQ2A 3GSDA 1CSJA 4ZCKA 5JVGQ 2P9CA 2BUNA 3PYEA 4A8QA 2DH8A 1KVJA 1GAOA 4KIAA 1TP7A 3H2VE 4ED6A 4DBQA 4DR2J 1VQYA 2BV3A 4UZCA 2W9BA 4J9RA 1KLMB 1ZA1B 3DFEA 4DJBA 4EYHB 3KNAA 4GKJF 1FD2A 2HAIA 3Q8VA 1T9TA 2ZE2A 3O44A 5KFYA 5KFZA 2XLJA 3IRXA 4LR7A 2EW9A 4UQTA 3AXKA 3RR7A 2YY3A 4Z7YA 2R8HA 2DXDA 5KFWA 3QSYB 4ZOSA 2ZD1A 4U67Q 5EDWA 3I87A 2UXBJ 1HBMA 2GVDB 3CJQA 3NMRA 5F9LA 2LP4A 1VC0A 3MR2A 3HK2A 1CPZA 4RNNA 4BS2A 2ZH4A 4PQUA 1LOUA 5DLFA 3G96A 4KGKA 3P49B 2QJ3A 2HNDB 5HJYA 2B6AA 1CC7A 2QN6B 3UVJB 3W62A 4K0KJ 4A8YA 5K8OA 2H1YA 4FN5A 4RR5A 5KT5A 3A1YG 4KHPF 1GMUA 3LP0B 4OZ0A 1WELA 3N5FA 2W8LA 1HNWJ 5A0YB 4GVBA 4JI2F 2DHXA 1UETA 2WONB 4IQXA 3H2UB 4FXDA 2LQBA 4FF1A 1NHKL 4DCPB 4CNYA 4JYAF 3IXQA 3UN3A 3AA8A 4C11A 3ICLA 5DGAA 2Q79A 2GVDA 1HBUA 5EX3A 2C2NA 4YN3B 3UR0A 5IWAJ 4ZP9A 4I2PA 4PWDB 2X1BA 1F1BB 5J2QA 2OFGX 1P9QC 4AQYF 3PACA 1K8AT 4QU6A 1X4DA 4DV2J 2ZZNA 5JVHQ 4OZNA 1WF0A 1WSVA 4YQWA 3BPDA 2B6AB 1XNRF 1UFLA 2RRNA 2ZOFA 3R5BA 2CJXB 2FZGB 3ILOA 4CLWA 3MM9A 4OYBA 3HVTB 3JYTB 2MXYA 5GAHU 2HG4A 3GR1A 3CJRA 3MMJA 4O23A 4C98A 2FLNA 2MEWA 3JSRA 4FYVB 1B3TA 2M0GB 4ZPTR 5E7OB 4DR7F 4Y6IA 2NYHA 2Q43A 2EWHA 3HFVA 3PXGa 2R2TA 4DFJA 3L3CA 1K73T 1WNEA 2XYPB 2IRXA 5CH7B 3SV3A 4IUFA 1FDNA 2GV1A 1I5OB 1YGYA 2MZSA 3I5AA 3K89A 4OYZA 1UVLA 1IKWB 4V19X 3R3TA 1U0SA 2DB1A 2PE8A 1KP6A 3N5BA 4JOUA 4P10A 4XIUA 3NNHA 1V9OA 3CEDA 3FMBA 3QFWA 2GAHC 3IS9A 4IG0A 3DMJB 4AD6A 4URSA 3TA0A 2CKWA 2G0IA 1K1SA 2GQ2A 4OZ3A 3HXMA 2C28A 4MT1A 4ZVTB 4B02A 4JV5F 3SDEA 4B3RF 3MEEA 4OHYA 4NE9C 4USTA 1XR7A 2OPQA 2OI2A 4DV4J 1IKYB 3LP1B 2HRYA 2M8DB 3FBEA 1JLFA 4CQ1A 4QPXA 1ROFA 1QAXA 3N6NA 3NXZA 1N5QA 3P3DA 3UD5A 2LEBA 1HNXJ 1HWIA 2IJNA 1KLMA 1MWQA 1NNDA 3LPEA 2NPFA 4F8RA 2MY8A 6FD1A 2M2BA 2B5JA 1U48A 1IKXB 1B0VA 3D7SB 3HHDA 4H4OB 5HP1B 2N3LA 3R6LB 1Q4RA 2L9DA 4NMLA 1T9UA 5G0RB 5C25A 2DVIA 1N5TA 2ZZMA 1HMVA 1MN9A 1X4CA 1S9FA 3D1OA 4WKYA 4QYZJ 3CJ0A 3ZZOA 3QZ7A 4CYUB 3CC2S 5K9FA 3AB4B 4F4XA 4FS1A 2GHVC 2RF2A 3FC9A 1S9EB 3J80U 2R8IA 3K2YA 1XC9A 4X4NA 5K8MA 2CYYA 1AT1B 2HLTA 5J1PA 1JKHB 3TRGA 2QL7B 1OQ3A 1XIQA 3PW4A 2J0QD 1UPPA 4TU9A 2RILA 4LF1A 1VBYA 1ZAXA 2W9BB 2FGOA 1VJWA 2BMBA 2DO4A 3TEHB 3BGRB 2CJQA 3U02A 2I8EA 2KVQE 1Q1KA 2YPYA 4ES2A 3M32B 1N48A 1D09B 2D3O1 5D0RA 2VPZB 2HFSA 2OPRA 4NYOA 1RKIA 1OO0B 1P6TA 5U47A 3FCWA 3SXLA 2ZH6A 3UCZP 3QIPA 2JHEA 2N82B 2GQQA 2AF6A 1O8BA 3PO5A 2ROEA 5DDPC 3D2WA 5C42B 3TAQA 4K8RA 1T9WA 3KJVB 1RI7A 1S1UB 1HI1A 1NB2A 1TL7A 4HYKA 3J7YU 3BN4A 4PQUB 1RT4A 1REVA 3EGWB 1PJ6A 4PUOB 1ZM2A 4P52A 5A6PA 4KO0A 5C2GA 2VQFJ 5L1JA 1ZTWA 2OEKA 3HSGA 1MU2A 5GAHI 3QJJA 3X1LB 4PRFA 4Y0FA 5L38A 3P5TL 4PWWA 3QZ8A 3O5TB 5LJ5Y 1PG5B 4DR3F 1TVRB 4LF8J 4NZ7A 4ZN3A 1I3OB 1D3WA 2HVZA 2MQPA 1R89A 1FWKA 1NH8A 1U09A 4OI3A 2XY6A 3G86A 1HNZJ 3H98A 4PPZA 2IJFA 3J7AN 4WTYA 2KO1A 4F4ZA 4QWBA 4NL5A 3BDEA 3EVWA 1PIEA 2HWIA 3CMAS 4DR5F 2AZ3A 3ZNJ1 2CQ3A 2JX2A 4J9PA 2J8SA 4ZP7A 3IRWP 4JI1F 2FJXA 3MEDA 4MKBA 5F8LA 4IH7A 3DRSA 4X4QA 3T3FA 2VG7B 1RK8A 3PKMA 1GH8A 2R7SA 1X4HA 3LANA 4YDXA 3DDIA 2CPZA 2NXUA 1N36F 4H4MA 4ZKAA 4ED8A 3MM9B 1WF2A 1PBUA 4WU2A 5KFLA 1Y5IB 4YFUA 4DF8A 4DG1B 2AJ4A 2J9DE 5IWAF 3MCOA 1H7XA 1UW4A 2RT3A 1VQPS 3DGPA 1AZSB 4LFCF 1XNQJ 2MQ8A 2WSCC 2XNRA 1F3VA 4U8YA 2VKRA 1KFSA 2Q3PA 4DR4F 1HQ2A 2ZM6J 3CMES 2LKZA 4PG8A 1QY7A 3IS9B 1FX4A 4IG0B 3DDKA 2UZAA 4M5HA 4JUZA 1Z2LA 2ZJRQ 4FNIA 4W4MA 4XTTA 5CD4A 1FDBA 5CA5A 1SL0A 3DMJA 4GO5X 4URQU 1YITS 5LT5A 4KPYA 3NMAA 2KYZA 2QL9B 5IT9U 2ZH3A 1SKSA 1BUXA 1U02A 4NLRA 2QO3A 2RF2B 3GTYX 5KFJA 4C8ZA 2GVZB 4RKUC 3W2VB 4ITSA 1HIYA 4J9NA 1O51A 1SUQA 3AA9A 2R4FA 3FRYA 1WJ9A 3RRKA 2RHQB 3RJMB 4Y00A 2EFNA 2XYHB 5G0RA 5K14B 2F4VJ 1HPZA 1W25A 4PYAA 2UXCF 2BXJA 1HR0J 4HH1A 4EBCA 2UUAJ 1BQMA 1RWXB 1KVKA 1O5JA 3FK4A 3UNGC 6FDRA 4RPFA 2CA9A 3TZYA 3OW2R 2ZM6F 2B9WA 2ZEJA 3IG1A 3HHLC 1MWYA 4ZIVA 3GIKA 1RHKB 1S9GA 2AIRB 1R8HA 5CQGA 3E01B 3W66A 3CCMS 3VV2B 4RUCA 5DO2A 3BO4A 3TAPA 2Z0GA 3EVOA 3KDOA 4F7VA 3CCVS 4DQQA 4V1Ak 4HT7A 3T9ZA 2ATLA 4LFCJ 3TEGA 2IVFB 4WXOA 1RT2B 5BYRA 4I1TA 3I4HX 1U45A 1JKHA 3VQSA 3KWMA 1LWEB 3FBFA 2Y1IA 1TU0B 1G2EA 2C2MB 2RQKA 1S1VB 3IBCB 3ISNC 1VYAA 2AJ0A 3FZBA 2QYCA 1IQZA 2B9EA 3TO8A 4JI3F 1Y11A 4XK8C 1SIZA 3Q89A 5E3AA 3G9CA 2Z2ZA 3M32A 4ELUA 4LBIA 4RJVA 5SZTA 3GU0A 1OYEA 3SCLE 4K4SA 3ETMA 1S48A 2LYVA 4KPCA 4M5JA 1CG2A 4N8OA 1Y3KA 3I32A 5KFKA 2D3OR 3TX0A 4PXBA 4QR1A 2IVMA 3WDOA 4N76A 2LCWA 2LFVA 5IT0A 4C0BA 1YRTA 1FFWB 3HHEA 1L5UA 4DDFA 2WZ1A 3LTOA 4CP5A 1FD8A 2K06A 3SMZA 4YHHF 2HFVA 1FVQA 4OJ1A 3AOBA 3ONQA 1TKXB 2GGPA 1VC6A 3C19A 4RO0A 4OYOA 4LFBF 3MZIA 3ETOA 2XM3A 1QJHA 2ROPA 3QWUA 2DHAA 2LQ5A 4TQSA 3RB4A 3LQVA 5E0OA 3BH7B 2MSSA 2MPUA 4ECVA 3KKFA 3NP5A 4QYRA 2V9WA 3K5MA 3QRRA 5M2PA 5KFCA 5AXKA 4GC7A 4JI0J 5A8KB 1N5SA 2VV5A 5CYMB 5K20B 2MLXA 4NA3A 4OV1A 3F56A 2O5DA 3NNCA 4YUDA 1D9DA 4B9MA 2OEJA 3JSBA 5ETTA 4EWTA 3MFHA 3KJNB 5L9NA 2HHSA 4CDIA 3THPA 3ZZTA 1VRUA 3GIRA 1N52B 2NSCA 4O44A 4KV8A 5A76A 3ET6B 4TY8A 3SV4A 1M0SA 2BYCA 3MPUB 2WK4A 2EVZA 2ZBRA 4WF9Q 3AJDA 4X62F 2V8DA 3PRDA 3IGNA 4LSLA 1DAXA 4URGA 2R7RA 4X66F 1FDAA 5F41A 3M8RA 1RBAA 4YP3A 3D68A 2BE7D 2RB7A 4W90B 1RTHB 4EBDA 2VF3A 2L9NA 1AZSA 2W4CA 1X4AA 2VHGA 1HNZF 1UVJA 2XS5A 1X0PA 3KJFB 4RW8A 2UUAF 5IS2A 4FNHA 1DTTB 1HPZB 2EK6A 4RU2A 4WXWA 1PO6A 4DSLA 4HKQA 4Q5VA 1HNVB 1QUPA 2J8AA 1TUGB 3PJWA 2QMXA 4ZLNA 4ECZA 4ZPAA 4UT4A 2DISA 4H54A 2YNIB 4X64F 3WBZA 4DQRA 4HTIA 1N5VA 3HVTA 3M6VA 4LIRA 2XO6A 3DNCA 1LNQA 4B3TF 3UNYA 2MGZA 1TK5A 3E01A 4DR3J 2YTCA 2B4VA 4DS5A 4OYWA 4C97A 4DQSA 1N0UA 1LWCB 1TFWA 1UFKA 1N32F 2GVZA 3HVWA 5F3ZA 4KC5A 1I94F 1FRMA 2RMLA 1KTQA 5L8RC 1XR6A 3HVRA 4MTPA 5IQQA 2QGFB 2N7CA 4C8NA 2LDYA 4CTAB 5DM6Q 1TKDA 2VG5B 2RUSA 3D67A 2LDIA 5KFBA 4MK7A 3LGHA 4Q45A 1FKPA 2QLXA 5I42B 4Q8FA 3ZNUA 1WHVA 1NJXA 2XMKA 5DLGA 5D3GB 2Z4PA 3CT9A 2KM8C 3H5UA 2KHDA 4N8NA 1SI9A 1GQEA 2JRSA 2QSFA 3KLIB 4OZ2A 5DJBA 2L41A 2XULA 3M8SA 1RWPB 3KUEA 4HLBA 1TK8A 4HDHA 1PGZA 3NAIA 5KFFA 1S59A 2B4PA 2LA4A 2RD5C 1RAHB 1QE1A 4K4TA 1T8EA 1PSDA 2VA3A 5CCLA 2Q6BA 5IT9Y 1YBAA 2FHJA 1K1QA 3ZTPA 3Q8PB 1N5YB 1LQ9A 4MKYA 1NLKL 4TYBA 3VAHA 3PW5A 2XS2A 4CO0A 3N28A 1FNOA 5BYQA 5IT4A 1KTVA 2KVIA 2DGSA 1C0UB 3D0GE 3LAMA 2DO0A 1Y10A 1U2FA 2PEBA 3EWGA 3PJ9A 4I64A 4L3KA 2JFKA 3KMSA 2YNHB 2CPXA 2D74B 3TA1A 4IG3A 3R97A 1R3NA 2JFDA 1T94A 3MOJB 2F8HA 1FNXH 2AYGA 3J7A1 2HURA 3M6WA 2CWKA 4DPXA 4DQIA 1XMBA 1NM2A 5D4LA 4F4KA 1WKJA 4YOEA 2F3JA 3KLGA 2PSZA 3LO3A 3BBFA 3MECB 5KFDA 2W25A 2DPJA 3VZHA 4ECRA 4OFZA 2I1RA 1H72C 1HBOB 1NU4A 2WHOA 2ZDPA 2GMJA 4ZVHA 2DIVA 1RT5B 1EKRA 4KQZA 2GHPA 2JNJA 1P1TA 2YKNB 4JB8B 5A6WA 3WX4A 1KEKA 4IOCQ 3I55S 3FBCA 1X60A 4M63A 2F8EX 2V8VA 1QD1A 3MF5A 1BMQB 1C2PA 2EK1A 2HIYA 2OHDA 4MYTA 4LSLB 4QIFA 1IWGA 4AL6A 2B8PA 4EK2A 3QIPB 1VK8A 1D9AA 2QFIA 1V3SA 2ILYA 3CB4A 3HJFA 4N7TA 4X4UA 2BDPA 3D0HE 3DYAB 1H7WA 4O3PA 1TKZB 3R1LA 2QV6A 2UXBF 2YWFA 4ECXA 2B7CB 5KFPA 3MR7A 3A3OB 2CQCA 3OFEA 5B0BA 4K4YA 3RAQA 5GMDA 4IOAQ 3K0JA 2DR5A 1T03B 2VA2A 3MHYA 5E3RA 3JQMA 3Q22A 4J5OA 2F5GA 5ETVA 2WB1D 2OD4A 4G6VB 3THVA 3J7YI 5LMUF 4B08A 3A8EA 2VIHA 3V2UC 3H4BA 2E7VA 3RAXA 1CLFA 3H4DA 4EZ9A 1M1GA 3TVKA 5KFOA 5GADI 4AXIA 1SJQA 4QW8A 2BJ9A 2W4PA 2V4QA 4DLEA 4N41A 4V19J 2K3IA 1UVNA 1NEEA 2VFSA 4RW8B 3Q8RB 2PI5A 3BSOA 4O3NA 1D8ZA 4WJBA 1X4GA 3KXDA 2DXFA 3OTCA 5KTQA 4P9SA 2BKOA 2BX6A 4M5KA 4OI6A 3JQJA 2ZH2A 2KI2A 2AHOB 4DSFA 3CIZA 3MUMP 3CC7S 2LEAA 3VAJA 1RA6A 2OTLS 2KL8A 3T1AA 3MFIA 3F41A 1VMBA 2Z2LA 3FEYB 4NMXA 4I67A 9ATCB 1JJ2R 2G4BA 3BSCA 1JLQA 4ZPVR 3NWGA 3WX8A 4ERDA 2H65B 3T9NA 4I0WA 2GMHA 1GX5A 3OT9A 1U49A 5KFXA 2HHVA 5KT4A 3M1VA 2JOQA 1JX4A 1RT6A 4K7QA 3GIJA 3L7PA 4YR3A 3G8TA 4X64J 4C2MA 3VAGA 1FA0A 5K14A 1UVMA 4WIQA 2ZH5A 1VFJA 3M8ZA 4C8OA 4NXNF 4RUAA 4GKKJ 2DNGA 1AXQA 1HQUA 2YNHA 4HDGA 3RUBL 3TJ9A 1DLOB 4TLRA 1Y7PA 4KGZB 5FD1A 2HK3A 3JSMB 2RS2A 4HEA9 1SC6A 1WHXA 3DRYA 1KWMA 1ZS6A 2G2ZA 2CNOB 4PG6A 2DNZA 2IPOB 3DOMB 3D0IE 1N0VC 2HWTA 1WOPA 5GVQA 4RUHA 4OX9J 4IDKB 1WORA 5D0GA 3TQEA 5E2QA 2KG0A 4DV7J 2WCXA 2VQEF 2CXEA 1RCOB 2YWEA 3OR2B 3PHEA 4ED4A 1U1QA 1OSCA 1S76D 1FEHA 2W4DA 3NY0A 2XMAA 3GIMA 3NNAA 2MKCA 3MURP 1BQMB 2RQCA 1EJ7L 3IRXB 3NOCA 4LVOP 4O3OA 3TP2A 2MY7A 3BPSP 4B3SF 2UVRA 1APSA 5A8RB 2GIRA 2QMWA 4DR2F 1H73A 2JZ5A 2M7SA 1SH0A 4DV7F 4PPDA 3M05A 3HPOA 3OSPA 1NJWA 3KLGB 4ZPBA 1VQ7S 3VGTA 5KG2A 2ATCB 4JI6F 2Y1JA 3AD9C 4ZA1A 3RRHA 4PG7A 3R9LA 3VAKA 4AT1B 3QO9B 2IM2A 3K7RA 3VR1A 4ZCIA 2QTWA 3MEDB 2AJQA 2AKWB 3G6ES 4FP9A 3OSNA 2DRBA 4KSEB 3DLKA 1VQ9S 5D77A 2RQ4A 1PYSB 2GQCA 3V4IA 4HHUA 4UQGA 3PX4A 4GKKF 4GVLA 1F9FA 1WG1A 2DGWA 5D6GA 2VICA 3I0RB 4NZ0A 1JJ4A 2GO9A 4DFPA 2MHEA 3HD2A 2R8GA 2VU5A 3FRZA 2Q66A 3KK3B 1RTDB 1KOHA 1BQXA 2VPXB 3PYDA 2E5JA 2N4DA 3I0SA 3CGIA 3Q86A 2GO8A 4LBPA 4CT9A 2X1AA 4DUZF 2ALZA 1FXLA 1DQ8A 2AEMA 3DOKB 3BH6B 3AJ2A 4LJMA 5CABA 2FZCB 3NGKA 3VAMA 2R8JA 1CQMA 3OHBA 4P6QA 2ZITA 2YNGB 3R5DA 1MLAA 3NGTA 2CG4A 2MKYA 4RL1A 3IM9A 4C3LA 1U1NA 5E3CA 4Y2CA 3SEOA 2NUUG 5KFEA 4PXEA 1P8GA 2VPWB 3MR3A 2QA1A 4IRCA 4KTQA 4AFFA 2IRUA 3QJLA 4R0EA 3HM9A 1FJCA 3UDLA 5LSLA 2P9GA 3KK2A 2LECA 1VJQA 1H38A 4F0HA 5A8KA 3HKZD 1ZZNA 3K5PA 2X1GA 3U1NA 1AA1B 4NCGA 4P71A 1VHFA 2NQPA 2KFYA 3R5JB 2M5YA 4OJHA 2KJWA 2CPDA 4X62J 1FEEA 4S0MA 2BOPA 2HHXA 1DARA 3PTWA 4WP3A 4DSKA 1KC8T 4JI1J 4O44B
chains in the Genus database with same CATH topology
4QIGA 2NREA 5KG3A 3DHWC 3KK1A 3FGVA 4J9MA 2M4MA 5DGBA 3BQ2A 3UQSA 2R2RA 2N7YA 5HROB 2C2RA 2MZJA 1U6ZA 4G1QA 2RRBA 1YIJS 1N8RT 3EGNA 3JSYA 1LWEA 4Y2AA 1W2BR 4WZMA 4F67A 2XI3A 2YKQA 4MK9A 2BQRA 1LKZA 2C3OA 2E5GA 1SL2A 3KHHA 1MWZA 4LT6A 3VAFA 3N6MA 3MEGA 2KT5A 1YTYA 1LXJA 2MKIA 2RDIA 4IYQA 2RRAA 5GAEI 3IO1A 4AE5A 1VQSA 1FT8A 3GG0A 5CD4H 3TOQA 2YWHA 2M3DA 1WG5A 2BANB 4I56A 3QAEA 1NHVA 1UVKA 3NCQA 3U27A 3CCUS 3V4IB 4K4ZA 1C0UA 4NYPA 3OUYA 3KLEB 4LFAF 5DS7A 2PN6A 4K5RA 2OPRB 2V8HA 3AAWB 4ZCMA 4F50A 2IM0A 2VC0A 1XN9A 3ZZPA 1BLUA 2E1RA 3E3XA 1FTRA 1QE1B 2GFFA 4DPOA 5I4MA 1XEZA 2CJAA 2VBXA 3OL8A 2XGQA 3IWNC 1YRUA 3DLKB 2K8GA 3CDUA 1HBOA 3MM8A 3GV8B 1J5OB 2FC8A 1T05B 1UA1A 4A8KA 1FKAF 3KG0A 1M5PC 4OX8A 4MIAA 3KK3A 3I0RA 2UU9F 4U9RA 4C7QA 2ILZA 4IH6A 3JB9k 3FZ2A 2XEXA 5F8IA 4TQRA 1NK0A 2E9TA 3P6YC 2XI2A 3PEHA 1QSLA 4Q2MA 1Y4ZB 5F0UA 3CCLS 3HP6A 1H6KX 4F25A 2DRAA 4DL4A 1X5SA 1HNVA 4DV3F 2HNDA 3IR7B 3JTOA 2EKYA 3T5LA 3UCZP 3NCRA 5J2PB 1BWEA 4H4MB 1G7CB 2FJEB 5E3QA 4WFNQ 3CJKB 1XMOF 4DR1F 5HROA 1S10A 2I2YA 1N33F 3CJ3A 1R0AA 2UUTA 1HBUB 4PWDA 2Y1RI 3BDPA 1C1BB 1ZAVA 4MFBA 4AYBD 3GG1A 1T7PA 1JLBA 4H4KA 1V3RA 4DV2F 3QGHA 4TU8A 5DRKA 4MH8A 1FE0A 2IM1A 4BWMA 2R9LA 4FYDA 1URRA 3FQLA 1P27B 3FEXB 2RE1A 3JYTA 2UP1A 2RU9A 5KT6A 3V5RA 2E1CA 5DQGA 3SYZA 4L72B 2ABYA 4ZVEA 4DL6A 1U1OA 2IBOA 1D0EA 2YNFA 1GNKA 1S99A 3S1TA 3CCES 1LWFB 3EPIA 4RW9B 3QPIA 1AROP 2AGQA 2PA8D 3DXSX 3MUVP 3BO2A 1C4AA 2GCFA 1WEZA 5B0DA 1ZBTA 1R8PA 2ZNZA 1S1XB 3I9ZA 3J7YI 1XMQF 1QVGR 4RU9A 2RKIB 4DV1F 4NLQA 3KLHA 2OIHA 3SFGA 5DG8A 2JH3A 5HI7A 5KFGA 1BY9A 1SH3A 2YNFB 3KG1A 4OI4A 4ETXA 2G9OA 4DV0F 3TUZC 4RW9A 2DD8S 1W2IA 1R31A 2E44A 1IKVA 1KHWA 1S1VA 5HBMB 1YWXA 3GV5B 2AX0A 1T05A 4IO9Q 1B0PA 4QU7A 2G0CA 4WFXA 4U6PA 2QA4G 1NJZA 2JL9A 3I56S 4NA2A 5J2MA 1EETB 3HVAA 2JDJA 1BC6A 3T5JA 3D54A 4JI8F 4DFKA 1M5HA 4F26A 4KAIA 4TKTA 4ILLA 5KG4A 2M70A 2Z2MA 3ZC4A 1DRZA 2X51A 3MTKA 2HRUA 1TL1B 3NLCA 2HFNA 2D7SA 2QA4S 4UY85 5F8JA 2IYIA 2DH9A 3KMQA 3V81B 2ZC3A 1U2RA 2BVZA 2KN4A 5J2PA 1IJFB 2LU2A 3FSYA 1FERA 1RJJA 1S7HA 3OTEA 4IR1A 3HK2A 4RWWA 5A0YA 2YKMA 2QZ8A 4KHMA 4O4GA 4OX9F 3TUJC 2MKSA 4P7VA 3NCPA 3CF5Q 4TY9A 4CH0S 2Q1LA 4F2SA 1VQNS 2ZHBA 2NUHA 1G3OA 1G1XA 1SJ4P 3R1HA 2A1BA 1JLGB 2YX7A 1PC4A 1NJYA 2WBRA 1S6QA 2JEFA 3F44A 3PEJA 5KFTA 2G1DA 3M8QA 5B7WA 2O01C 5LXYA 2AYBA 3ZZRA 4CO5A 3OXGA 2OJ3A 3H5YA 4OJGA 3OV7A 2VOPA 3U1LA 1TK0A 4C3MA 2EFQA 3ENQA 1R0AB 1GT8A 4Y2IA 4K5SA 4OI2A 1DQAA 2FB0A 3M6UA 1X7VA 4OZ5A 4Z2XA 4IOBA 3PW7A 3UWTA 5B0GA 3M1VB 3SFUA 3W2WB 2QFJA 2AJ1A 1HWUA 5DM7Q 2CQ2A 5T7LB 1CC8A 1X5PA 2R8KA 1RKJA 2UV8G 3EX7B 1DHMA 1Q81T 1WACA 1RT7A 2R7QA 4RNMA 2OPPA 4WE1B 3DHXA 4CO4A 2V4JB 3TYTA 4ATNA 3LH2S 4LSNA 4N47A 3DOMA 5CCMA 1TV6A 1SIWB 1KHVA 5KT3A 4M95A 1R8CA 3ENWA 1SV5A 2DGUA 2JJ4D 1VQOS 3TAMB 2VG5A 4B9SA 4QWEA 2EBEA 3BS9A 1KS2A 2GA7A 3HHLA 2VUGA 2J7UA 2KXHA 2RSQA 3H5SA 1URNA 2BRKA 3OL9A 3MMBB 4WFAQ 1KQKA 4QCLA 1NK9A 1JK9B 1TKTB 3DRRA 1KFDA 4CH1A 3BREA 3QGIA 2CJKA 1NKCA 2CRLA 4PUOA 2WOMB 4ECSA 5I3UA 1FK9B 2XB2D 2EI5A 2DR7A 2IA6A 2HVIA 4ILRA 3SSSA 4F4YA 2DGXA 3RW7A 4JI7F 4C0HA 2JWNA 3LF0A 1S0VA 1VQKS 5IQ6A 3SQGB 4YB5A 1WEYA 1QUVA 2MZQA 3HKWA 2RU3A 2EC0A 4N77A 1S9GB 3KJVA 3UD4P 2UXDF 4PWUA 2MB0B 2VFRA 3LWLA 1ZPWX 2UV8A 1GTHA 4EO8A 1WG4A 3TA2A 1DURA 2HGMA 1MU2B 1FCAA 2F9DA 2DT9A 2POKA 3TVZA 4DMZA 2D3ZA 5FJ4A 3S7RA 2V9KA 2ZH8A 1C4CA 1RISA 2BANA 5IZHA 1Z2ZA 2FJWA 1IN0A 3IAM9 2W7AA 2WW8A 4B9TA 3FFIA 3AJ1A 5IM0B 4A46A 1PC5A 2FVRA 4DN9A 1S72S 2IMWP 2ZHOA 4QOTA 4IFYB 4NRUA 2VFTA 2HPUA 1FJGF 3Q0AA 4LF6F 2B51A 1NH7A 1CEZA 2FJBB 3L7OA 2PD1A 3HHKA 1GXUA 1N54B 3NS5A 2HHUA 3CCWA 3GILA 1FHTA 3NBPB 4PG5A 4XAKA 3HHNB 2IC3A 4K0KF 2OSQA 1KSPA 4NX9A 4RW4B 2V4RA 2ZBCA 3C6UA 3LGNA 4NA1A 4BC9A 1VLYA 2XHWA 4H4KC 4TNOA 3GWCA 3KYLA 3POTB 3LP2A 4X4PA 4LF7F 2O66A 4YEAA 4QIEA 4RNFA 4ZK7M 3CIMA 3VZIA 4F2RA 3QGPA 4MIBA 4LQ9A 5LXRA 2MZTA 3M2VB 2CZ4A 4QIVA 5LL6d 1A7GE 3MM7B 3M9NB 1SV5B 1BQNB 4MAKA 2DNHA 4YB7A 2P6TA 4CZCA 2GJ2A 2MQMA 2DHGA 2A2DA 3Q8QB 2R7TA 2FJAB 2X1FA 4O3RA 1OIAA 3N9UC 5KAKA 3H20A 2IFXA 4IR9A 1QAYA 3M4XA 3MMBA 1U1RA 1NK5A 2K2PA 4TXSA 5EN1A 3OXLA 2V4JA 1XERA 1FRLA 2R2SA 2MMYA 3DRRB 5KG5A 2AWZA 4ID8A 4DEZA 1UAWA 2XY7A 1YHQS 1RYRA 1LWFA 3CCTA 2KJVA 1IM4A 1TV6B 5DDOC 3I9V9 3HMJG 2CQ0A 2B5JB 4ILMA 2LQJA 1FKOA 4KKOB 2HVHA 2XWXA 1NZAA 2XO7A 2RNEA 5DG9A 2I5JA 5KFVA 5B0FA 4NCAA 1LFWA 4KJIA 3OJSA 4KRWA 4OX7A 3TARA 3KLHB 1HI0P 4A8WA 4OHWA 3RZAA 1ZTTA 1YJUA 1HBMB 1Q8LA 1RT2A 4RNHA 1S49A 2J9EA 5DETA 4FVCA 1B64A 4ELVA 4OJ3A 3ULHA 2J6TA 2SXLA 4B3OB 3D1HA 1TUVA 3GZ7A 3MM8B 1HWKA 4ICLB 2IHR1 3BEGB 4O4RA 5HBMA 5DG7A 2DH7A 4M8LA 4KKOA 5IM0A 3O8WA 2I5JB 2LEPA 2YQ3A 3GE9A 3UPFA 5A8WA 2HZCA 1YRXA 1EETA 3HDSA 3V6DA 4IH5A 2QSWA 1NHUA 2QRRA 3Q23A 3GFXA 1X0FA 2VBZA 3NKYA 3GV7B 4NRTA 1ZM3A 1TQLA 2BZ2A 2AYEA 2L48A 2EG2A 4QIWD 5D78A 2N3OA 1Q7YT 3MXHP 4ALZA 2LU1A 2JLEA 4Z37A 1U26A 2V0NA 1ULRA 5EHHA 1IUJA 3C6UB 3DC2A 4Y3CA 2GIQA 2WTFA 4CCHA 4FS2A 2L9WA 2W8KA 5KG0A 1KONA 2AYMA 3J7ZT 2DJWA 2J76E 3CD7A 5HN0A 4P7TA 2NLWA 5EWEA 3K57A 5KFNA 4Q2LA 5G4DA 1FO1A 4ZPCA 2FVCA 4EYIB 1Y00A 3HFKA 1SXLA 3O3LA 3V2UC 1RP5A 1VQ4S 2VH7A 2CQ1A 1V3ZA 2FTRA 2OKQA 1HNWF 2CQ4A 3TANA 3CCSS 3NS6A 3B4DA 5B0AA 4ZCLA 5KT2A 2C22A 3CCRS 4NCBA 1MROB 3L09A 1HYSA 4G1PA 2V2KA 1VRTB 3E51A 4ED7A 5CXTA 2F9JA 3IAS9 3MM5B 4R25A 3T6BA 1RTHA 1NK8A 5J2NA 1JLFB 5HMXA 2CJBA 4I2QB 5DDRC 3GMGA 1U8SA 4WFYA 1D8YA 4YDDB 3BR9A 3MEKA 2ZFHA 2HS4A 4B3OA 1B7FA 2PO4A 1T03A 3CJ2A 2HHHF 4DSJA 3G8QA 5CHCB 2VG6B 3MM6B 1RT3A 2VBYA 2XNQA 2UUWA 1R8AA 1FXRA 2ZUGA 5D8HB 3PW2A 2AQ4A 2CPJA 4A47A 4KGMA 1YJNS 4A8XA 2B9YA 4B9VA 3QIDA 2DHSA 1WTFA 2DIUA 1K0TA 4EFAC 4FXVA 4NLOA 5EX0A 4XPEA 4R5PA 2D41A 4KT0C 1JWWA 1FKPB 5I42A 4O0IA 3ENVA 3I31A 1FKOB 4L6V3 1VQMS 1OPZA 1HHSA 3BJYA 4K4XA 5D3GA 2MDAA 4RBTA 2ZBIA 4A48A 5KFQA 3FEZA 1JLCB 1HARA 3RU0A 2KFZA 1VIXA 3THTA 2OH2A 2ASLA 2ZJQQ 2GNKA 2A18A 1E6VA 4UW2A 2DR8A 2R2UA 2CDQA 1A6LA 4D3GA 1UP1A 3MAHA 1F60B 2ADBA 3EGZA 3TNVA 1MMDA 1PILA 4DHVA 3DLLQ 4B3MF 2E7WA 4J9SA 2I0XA 5HMWA 3BR8A 4ICLA 3MDFA 3MWBA 1S6PA 1GX6A 2YX4A 1HL6A 1ZZFA 1FJ7A 5A8WB 4QZVB 3VTIA 4OMFG 2RUGA 1KR4A 1R27B 1L3SA 4ZMMA 3RR8A 3SQGA 5EWGA 4A8MP 1E6VB 3CDAA 1DBDA 1C1CA 1OSDA 3VWSA 1QSSA 5J2QB 2D1CA 3KFWX 3FNNA 2AP6A 4LUBA 4A8OA 3M2RA 5E3PA 3LP0A 3QLHA 5CYQB 4DS4A 2WONA 1VRTA 4NXMF 4U7UK 4LIWA 5GAEU 5KT7A 4NLUA 3FSXA 2ZVSA 3MR6A 3HF5A 1NB7A 1S6UA 3VCDA 3AY0A 2R7OA 1RT4B 5K5MA 3MR5A 1FRHA 5KFUA 1H98A 3LW5C 1HNIA 4LQ3A 4E8UA 3I4PA 3C46A 1RGVA 3ZZZA 1LV5A 1OPIA 1VRUB 5JJBA 3M8PB 5CZXA 1X5OA 2ZDOA 2KHCA 5EX3A 2E1MC 2IMOA 4Q7AA 1U1KA 2IA0A 1VQ6S 4LVNP 3MEEB 2GJIA 4WE1A 3CULA 1ZYQA 2BRLA 4RLEA 4XPCA 2LLZA 1N88A 4IQMA 5F8NA 1F0XA 3DN9A 3DRXA 1H2TZ 4R8UA 2HS0A 3BF4A 2MZRA 3GIIA 3MI7X 3PFOA 2FHMA 1RTJB 4I2QA 2XC9A 1LK5A 2B4OA 3M30B 4QQBA 4BBYA 2IC3B 1RT6B 2BW2A 2U2FA 2VB6A 4YMEA 3FQKA 1DTTA 2CVEA 3N6LA 1N6QB 1U24A 1M5VC 3HO1A 1HQUB 5BR8F 1JLCA 3MPYA 4TLQA 1X4BA 2OPQB 5E41A 3CCQS 4OZ1A 4IFVA 3KHRA 4OLOA 3SDEB 1QAJA 1TKTA 2PDAA 4ZLPA 4WCEQ 2MQOA 2LQ9A 4JI5F