3KKIA

Plp-dependent acyl-coa transferase cqsa
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
386
structure length
386
Chain Sequence
b'PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAI-1 autoinducer synthase
publication title The Vibrio cholerae quorum-sensing autoinducer CAI-1: analysis of the biosynthetic enzyme CqsA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 143
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3kkiA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3kkiA01
2AY6A 3UWCA 4F5LA 2QA3A 3HDOA 4Q75A 3FQAA 3IF2A 2VMQA 3MBBA 5EIGA 4A6TA 3FZ8A 3WKRA 4EB5A 4F5IA 3E6GA 1ASDA 3HQTA 3WGCA 4M2MA 3AOWA 3NYTA 1P3WA 4R5FA 4PFNA 1WKGA 3K28A 2HUUA 3F9TA 4OC9A 1M0QA 1Z3ZA 3EI9A 1DGEA 2OKJA 2R5EA 1PG8A 1EJIA 3ASBA 1AJSA 2C81A 3FDBA 3B1EA 4IY7A 3TFUA 3M5UA 2YRIA 1IX7A 2C44A 4XAUA 1AHYA 3A8UX 3PIUA 1TOJA 3FFRA 4O6ZA 3DZZA 1G4VA 2YKUA 2OQXA 3LVKA 4WXBA 3KGWA 3PDBB 4ITGA 4AZJA 1QGNA 3F6TA 3UE8A 1RV3A 4F5FA 3A9ZA 1ZC9A 5D95A 4ZLVA 1S08A 3FKDA 3FVSA 3PD6B 1AIBA 3CQ4A 4FL0A 3MC6A 4UQVA 4IYOB 2BI2A 2BYLA 5EFSA 2TPLA 2Z20A 3BCBA 4A6RA 3E2FA 2R5CB 3AEJC 4ADBA 4DQ6A 4ZDPA 3E77A 3NTJA 1GC0A 3DRDA 2HOZA 4WYDA 3BV0A 3L44A 1J32A 1CQ6A 1G7XA 2Z1YA 4MQPA 4WXFA 2VMRA 1EQBA 3AEJA 3EIAA 4XJPA 1OXPA 4IX8A 3WY7A 1X0MA 3WCNA 1YJSA 2DOUA 5M49A 1WYTA 3DXVA 4WB0B 4EB7A 1ASFA 5LHAA 3B8XA 4RKCA 2AY5A 1ARGA 3FTBA 4JEZA 3HL2A 2VMTA 2QB3A 2W7JA 4U2HA 2W7HA 1GC4A 5I92A 3K7YA 1DKAA 1PMMA 4F5JA 5DX5A 2Z9VA 5E4ZA 1PFFA 2E54A 1WYVA 2OATA 2X8UA 3ZRRA 3ZRPA 5C6UA 3A9XA 3BB8A 3A9YA 3BC8A 2Z9UA 3HLMA 3WX9A 3ZZJA 3LVLB 5JAYA 1ASLA 1BJNA 2EH6A 4WXGA 3W1IA 3AENB 4CBSA 5LH9A 1AHFA 1TPLA 1ASBA 4WYEA 3MAFB 1ASNA 4ZDOA 1YIZA 4W1VA 2BI1A 2QMAA 3TCMA 1D7SA 1BKGA 3QGUA 4GEBA 4BHDA 2VMPA 4P7YA 2ZP7A 1CL2A 4LNJA 4ZDLA 1B9IA 1SF2A 2VMVA 3FDDA 1C7GA 2JJGA 4JE5A 4JEYA 2W7EA 3BWOA 1UU1A 2EPJA 1BW0A 3RCHB 1AAWA 4IW7A 1Y4IA 3BCXA 1GCKA 3VAXA 3ZZKA 2C0RA 3EUCA 4ZM3A 4F5GA 1MLZA 1TASA 3CBFA 1KMKA 3EI8A 2RFVA 5DJ9A 4U1TA 2VMXA 2BKWA 3E2ZA 3KE3A 4MSOA 1YJYA 4J5UA 2ZYJA 2VLHA 4M2KA 1V72A 3II0A 3NUIA 2BWOA 4K2BA 2AY7A 2YCTA 2F8JA 2D7ZA 3FRKA 3GR9A 3TQXA 1CQ7A 4AO9A 1M0OA 1XI9A 4LNMA 1N8PA 1E5EA 3LY1A 1M0PA 1IAXA 1RV4A 4BA4A 1O61A 4W5KA 2VGZA 1C0NA 4CXQA 1KL1A 2WK9A 1QJ3A 2CB1A 2D66A 2GMUA 3FVXA 3FFHA 4LW4A 4A72A 5M46A 3FSLA 1ORDA 2W7GA 4WD2A 5G2QA 1WYUB 2VMSA 3BCAA 4GE9A 5G4JA 1U08A 1XEYA 1TATA 4R8DA 4DGTA 1OHVA 5FT5A 2CH2A 3ISLA 1SZSA 4L0OA 1JF9A 2YOBA 1M6SA 5D5SA 1ASAA 4MKJA 2BIEA 4MKKA 2BWPA 2W7FA 2DGLA 3QI6A 4E3RA 3D6KA 1KKJA 1IX6A 1MLYA 1IX8A 3FQ7A 4XQ2A 4WYAA 2DGMA 4JF1A 3QN6A 2VGTA 2ORDA 2O1BA 2CH1A 4OCAA 5EAVA 4RJYA 4RJ0A 1IUGA 3H14A 1BS0A 2D7YA 2HP1A 4ZWVA 2EZ1A 2HOXA 1G4XA 2YHKA 2Z61A 4EU1A 4XJLA 2HZPA 3MAUA 1JS6A 4FFCA 4K2MA 2AATA 4WBTA 1B5PA 4BQ0A 4A00A 3I5TA 1CS1A 1AMRA 1JG8A 1S0AA 3H7FA 4WYGA 2VI8A 1BQAA 3GWPA 2FM1A 3Q8NA 1LC7A 1V2DA 2W8VA 3B46A 5G09A 3QBOA 3WZFA 4J8LA 4ZASA 2W8TA 3QPGA 4OBVA 3JU7A 4MY5A 4B9BA 1SZUA 1X2AA 1S07A 4EFFA 4JEWA 5FT8A 3GETA 1DJ9A 3QHXA 4ATQA 3ELPA 1YIYA 3AV7A 3WGBA 4ZM4A 1ARTA 1JS3A 2WKAA 3OP7A 3A2BA 2ZSLA 1C7NA 3BWNC 1BJOB 5G4IA 3NDNA 1BT4A 3DU4A 3KGXA 4UHOA 3FZ6A 1MDZA 2BWNA 1ASCA 2VYCA 3CQ5A 1OATA 1AIAA 1AY5A 1CL1A 3GZDC 4A6UA 1GC3A 2XBNA 1M32A 1MGVA 1ARSA 1VEFA 4ZWMA 3NYSA 2W7LA 1N2TA 3AEMC 1SVVA 4W8IA 2AEVA 3BS8A 3GZDA 1DJUA 3PD6A 4ZSYA 4OTLA 1FG7A 4Q76A 4BMKA 5EUEA 4CXRA 3PDXA 1ELUA 4IXOA 2HUIA 5E5IA 3UAKA 2AY3A 1AICA 3PPLA 1ECXA 5DJ1A 5HHYA 1GEWA 2R5CA 1I43A 1WKHA 1D7VA 2GQNA 1W7NA 3NX3A 2EO5A 3W1HA 5EQCA 3ATHA 3NU7A 1ASGA 1D2FA 3FQ8A 1SFFA 1OXOA 4LNLA 1YAAA 1ELQA 2HUFA 3FZ7A 3USFA 2AY8A 4WP0A 5IWQA 4UHNA 4QGRA 4F5MA 4RM1A 3CAIA 1M7YA 4MGRA 1LW5A 3WCOA 2Z9WA 3FCRA 1EG5A 1X29A 1QIRA 4WB0A 2VMZA 1AHGA 2Z9XA 1ZODA 2C7TA 1DGDA 4ZSWA 1AKAA 3HT4A 5EAAA 1SZKA 1T3IA 3DC1A 3AEOA 4WYCA 3NYUA 4PIWA 3IHJA 3E2YA 3NU8A 2GMSA 2VMUA 3PA9A 4RKDA 2HOYA 5BJ3A 3LG0A 1M0NA 1UU2A 2V0YA 1RVUA 3WLXA 1RVYA 4Q31A 4ATPA 4HVKA 3N75A 4A0RA 3DR4A 1KL2A 2YCPA 2NMPA 7AATA 2VIAA 3AEPA 1W23A 1VJOA 3FVUA 3NUBA 2VMNA 4XK1A 3AOVA 4ADCA 4CBRA 4OMAA 1CJ0A 1I29A 4KYOA 4WLJA 3ELEA 1AKBA 4GSAA 3VP6A 2GB3A 4P3MA 2JGTA 3LVMA 4F5KA 8AATA 4AO4A 2R2NA 4LW2A 3B1CA 2BIGA 1IAYA 1G7WA 1YOOA 2PB2A 3P1TA 2YKVA 4R2NA 4Y0DA 1DJEA 1MDXA 2BHXA 3K40A 3EI6A 4ISYA 4TMRA 1O62A 3PGYA 1B9HA 5EIGB 2WK8A 1D7UA 3NRAA 4W91A 1V2FA 4ZAHA 4TV7A 1LKCA 4WLHA 2FQ6A 3HMUA 1OHWA 3P6KA 3PJ0A 3VK3A 4CVQA 1ARHA 1ASMA 4MQQA 2ZY5A 1GEXA 4LC3A 3RQ1A 2YKYA 3TATA 1YJZA 4NOGA 1AJSB 2FN6A 4DBCA 2DKJA 3PAAA 4AZKA 4IXZA 5HXXA 1H1CA 2BIAA 3TFTA 4MQRA 4B98A 4K2IA 3B1DA 1LW4A 2CSTA 3RBLA 1ASEA 4AH3A 2Z67A 2W8WA 4ITXA 3ZRQA 1GC2A 1YNUA 4JE5D 1B8GA 5EUNA 2AY2A 2ZUKA 5EUDA 1QISA 2VGUA 2D65A 1WYUA 1E5FA 3ASAA 5J8QA 1PMOA 4A0FA 1AJRA 2W7MA 3VOMA 3EZSA 4RIZA 4F4EA 1QITA 2VMYA 3BN1A 3RUYA 1N31A 1OHYA 1FG3A 2HORA 4KAMA 3WKSA 4RLGA 1C9CA 5E3KA 2CY8A 2X3LA 9AATA 3HVYA 2CJDA 2E7IA 4BA5A 5BJ4A 1AMAA 3G8MA 2BI3A 1S09A 2AEUA 2V1PA 1GBNA 2VGSA 1FC4A 2QLRA 4R5ZA 3R9AA 2ZY2A 1MAPA 2YRRA 2JISA 2AY1A 4ADDA 2FYFA 1J04A 3EZ1A 4N0WA 1BJWA 2WK7A 2W7IA 2OGAA 3I16A 1B4XA 2CTZA 1GD9A 2DKBA 1WYTB 3MC6C 3PDBA 4WYFA 1GEYA 4A0GA 3RBFA 3VK4A 2PB0A 3BWNA 1I48A 3LWSA 1AY4A 2FNUA 1D7RA 2HP2A 2W8UA 1WYVB 1DTYA 1AMSA 1W7MA 3EI5A 3MKJA 5HDMA 4W1WA 4IYOA 4ADEA 2OKKA 3G0TA 3R4TA 2YKXA 3AEMA 5K8BA 4E77A 4E3QA 3AELA 1I41A 1W7LA 1V2EA 2DGKA 3EI7A 1C7OA 3JWBA 4M2JA 5DB5A 3GBXA 1C4KA 1DFOA 1UKJA 2QBTA 4Q6RA 2G6WA 1UU0A 1BJOA 2EGYA 3ACZA 4EMYA 1IJIA 1LC5A 5G2PA 2W7DA 4OBUA 3DODA 1WSTA 3I4JA 2YCNA 1ZOBA 2JJHA 2CINA 2VIBA 3DYDA 2ZY4A 4RITA 2X5DA 3JW9A 3LV2A 2E7JA 2VMOA 1TOKA 2CANA 3RI6A 2Q7WA 3F0HA 4XJMA 5FT4A 1VP4A 3LVJA 1B5OA 1IBJA 4Y0HA 1M4NA 4H51A 1CZEA 2BYJA 1GDEA 1QZ9A 2PO3A 1KKPA 4KXKA 3MADA 2VLFA 3DR7A 1AY8A 1QJ5A 2D64A 3KKIA 5F8VA 2O0RA 2VGVA 2JJFA 4E1OA 1LS3A 4UHMA 1CZCA 3NNKA 1IVRA 1AAMA 1CQ8A 3ECDA 2X5FA 4GE4A 5FT6A 5TF5A 3G7QA 3EIBA 1O69A 1BJ4A 3AENA 5G0AA 2AY9A 2EZ2A 3E2ZB 3AATA 3N0LA 2Z1ZA 1AHEA 2DR1A 2BI5A 4TN4A 1LC8A 2R0TA 1MAQA 3MAFA 1KMJA 3OKSA 2D61A 4AOAA 1LK9A 2VMWA 1O4SA 1TOIA 4IXSA 2XH1A 1TOGA 3GJUA 3N5MA 3GZCA 4W1XA 4UOYA 2AY4A 2CJGA 2VGWA 2W7KA 1BQDA 4JF0A 4OT8A 2CJHA 1W3UA 3DXWA 2BI9A 3JZLA 1TARA 2JJEA 2OGEA 2QB2A 3W1JA 1Z7DA 2ZY3A 3HBXA 3JWAA 4RAEA 3RCHA 4GRXA 2ZJGA 1ARIA 4JEXA 3T32A 4F5HA 3E9KA 5M4DA 1S06A 1AX4A 2D63A 3GSBA 2VI9A 2JG2A 2GSAA 4XEWA 3JTXA 3FD0A 1AHXA 1AKCA 3COGA 4GE7A 3VK2A 4A0HA 1H0CA 3L8AA 4HF8A 2ZC0A 4PVFA 4Y0IA 2FNIA 4XJOA 1TOEA 5F9SA 4N0BA 1SPAA 4GDYA 2CFBA 2W8JA 2E7UA 2O7CA 1X28A 2ZSMA 2D5YA 1MDOA 3MEBA 3QM2A 4I8AA 3CQ6A 4OYTA 4JEVA 1AMQA 5M4BA 5AX8A 4PFFA
chains in the Genus database with same CATH superfamily
2AY6A 3UWCA 4F5LA 2QA3A 3HDOA 4Q75A 3FQAA 3IF2A 2VMQA 3MBBA 5EIGA 4A6TA 3FZ8A 3WKRA 4EB5A 4F5IA 4K05A 3E6GA 1ASDA 3HQTA 3WGCA 4M2MA 3AOWA 3NYTA 1P3WA 4R5FA 4PFNA 1WKGA 3K28A 2HUUA 3F9TA 4OC9A 1M0QA 1Z3ZA 3EI9A 1DGEA 2OKJA 2R5EA 1PG8A 1EJIA 3ASBA 1AJSA 2C81A 3FDBA 3B1EA 4IY7A 3TFUA 3M5UA 2YRIA 1IX7A 2C44A 4XAUA 1AHYA 3A8UX 3PIUA 1TOJA 3FFRA 4O6ZA 3DZZA 1G4VA 2YKUA 2OQXA 3LVKA 4WXBA 3KGWA 3PDBB 4ITGA 4AZJA 1QGNA 3F6TA 3UE8A 1RV3A 4F5FA 3A9ZA 1ZC9A 5D95A 4ZLVA 1S08A 3FKDA 3FVSA 3PD6B 1AIBA 3CQ4A 4FL0A 3MC6A 2EYQA 4UQVA 4IYOB 2BI2A 2BYLA 5EFSA 1KAFA 2TPLA 2Z20A 3BCBA 4A6RA 3E2FA 2R5CB 3AEJC 4ADBA 4DQ6A 4ZDPA 3E77A 3NTJA 3N4RA 1GC0A 3DRDA 2HOZA 4WYDA 3BV0A 3L44A 1J32A 1CQ6A 1G7XA 2Z1YA 4MQPA 4WXFA 2VMRA 1EQBA 3AEJA 3EIAA 4XJPA 1OXPA 4IX8A 3WY7A 1X0MA 3WCNA 1YJSA 2DOUA 5M49A 1WYTA 3DXVA 4WB0B 4EB7A 1ASFA 5LHAA 3B8XA 4RKCA 2AY5A 1ARGA 3FTBA 4JEZA 3HL2A 2VMTA 2QB3A 2W7JA 4U2HA 2W7HA 1GC4A 5I92A 3K7YA 1DKAA 1PMMA 4F5JA 5DX5A 2Z9VA 5E4ZA 1PFFA 2E54A 1WYVA 2OATA 2X8UA 3ZRRA 3ZRPA 5C6UA 3A9XA 3BB8A 3A9YA 3BC8A 2Z9UA 3HLMA 3WX9A 3ZZJA 3LVLB 5JAYA 1ASLA 1BJNA 2EH6A 4WXGA 3W1IA 3AENB 4CBSA 5LH9A 1AHFA 1TPLA 1ASBA 4WYEA 3MAFB 1ASNA 4ZDOA 1YIZA 4W1VA 2BI1A 2QMAA 3TCMA 1D7SA 1BKGA 3QGUA 4GEBA 4BHDA 2VMPA 4P7YA 2ZP7A 1CL2A 4LNJA 4ZDLA 1B9IA 1SF2A 2VMVA 3FDDA 1C7GA 2JJGA 4JE5A 4JEYA 2W7EA 3BWOA 1UU1A 2EPJA 1BW0A 3RCHB 1AAWA 4IW7A 1Y4IA 3BCXA 1GCKA 3VAXA 3ZZKA 2C0RA 3EUCA 4ZM3A 4F5GA 1MLZA 1TASA 3CBFA 1KMKA 3EI8A 2RFVA 5DJ9A 4U1TA 2VMXA 2BKWA 3E2ZA 3KE3A 4MSOA 1YJYA 4J5UA 2ZYJA 2VLHA 4M2KA 1V72A 3II0A 3NUIA 2BWOA 4K2BA 2A1VA 2AY7A 2YCTA 2F8JA 2D7ZA 3FRKA 3GR9A 3TQXA 1CQ7A 4AO9A 1M0OA 1XI9A 4LNMA 1N8PA 1E5EA 3LY1A 1M0PA 1IAXA 1RV4A 4BA4A 1O61A 4W5KA 2VGZA 1C0NA 4CXQA 1KL1A 2WK9A 1QJ3A 2CB1A 2D66A 2GMUA 3FVXA 3FFHA 4LW4A 4A72A 5M46A 3FSLA 1ORDA 2W7GA 4WD2A 5G2QA 1WYUB 2VMSA 3H9XA 3BCAA 4GE9A 5G4JA 1U08A 1XEYA 1TATA 4R8DA 4DGTA 1OHVA 5FT5A 2CH2A 3ISLA 1SZSA 4L0OA 1JF9A 2YOBA 1M6SA 5D5SA 1ASAA 4MKJA 2BIEA 4MKKA 2BWPA 2W7FA 2DGLA 3QI6A 4E3RA 3D6KA 1KKJA 1IX6A 1MLYA 1IX8A 3FQ7A 4XQ2A 4WYAA 2DGMA 4JF1A 3QN6A 2VGTA 2ORDA 2O1BA 2CH1A 4OCAA 5EAVA 4RJYA 4RJ0A 1IUGA 3H14A 1BS0A 2D7YA 2HP1A 4ZWVA 2EZ1A 2HOXA 1G4XA 2YHKA 2Z61A 4EU1A 4XJLA 2HZPA 3MAUA 1JS6A 4FFCA 4K2MA 2AATA 4WBTA 1B5PA 4BQ0A 4A00A 3I5TA 1CS1A 1AMRA 1JG8A 1S0AA 3H7FA 4WYGA 2VI8A 3N4XA 1BQAA 3GWPA 4H63Q 5KTBA 2FM1A 3Q8NA 1LC7A 1V2DA 2W8VA 3B46A 5G09A 3QBOA 3WZFA 4J8LA 4ZASA 2W8TA 3QPGA 4OBVA 3JU7A 4MY5A 4B9BA 1SZUA 1X2AA 1S07A 4EFFA 4JEWA 5FT8A 3GETA 1DJ9A 3QHXA 4ATQA 3ELPA 1YIYA 3AV7A 3WGBA 4ZM4A 1ARTA 1JS3A 2WKAA 3OP7A 3A2BA 2ZSLA 1C7NA 3BWNC 1BJOB 5G4IA 3NDNA 1BT4A 3DU4A 3KGXA 4UHOA 3FZ6A 1MDZA 2BWNA 1ASCA 2VYCA 3CQ5A 1OATA 1AIAA 1AY5A 1CL1A 3GZDC 4A6UA 1GC3A 2XBNA 1M32A 1MGVA 1ARSA 1VEFA 4ZWMA 3NYSA 2W7LA 2QSRA 1N2TA 3AEMC 1SVVA 4W8IA 2AEVA 3BS8A 3GZDA 1DJUA 3PD6A 4ZSYA 4OTLA 2KFPA 1FG7A 4Q76A 4BMKA 5EUEA 4CXRA 3PDXA 1ELUA 4IXOA 2HUIA 5E5IA 3UAKA 2AY3A 1AICA 3PPLA 1ECXA 5DJ1A 5HHYA 1GEWA 2R5CA 1I43A 1WKHA 1D7VA 2GQNA 1W7NA 3NX3A 2EO5A 3W1HA 5EQCA 3ATHA 3NU7A 1ASGA 1D2FA 3FQ8A 1SFFA 1OXOA 4LNLA 1YAAA 1ELQA 2HUFA 3FZ7A 3USFA 2AY8A 4WP0A 5IWQA 4UHNA 4QGRA 4F5MA 4RM1A 3CAIA 1M7YA 4MGRA 1LW5A 3WCOA 2Z9WA 3FCRA 1EG5A 1X29A 1QIRA 4WB0A 2VMZA 1AHGA 2Z9XA 1ZODA 2C7TA 1DGDA 4ZSWA 1AKAA 3HT4A 5EAAA 1SZKA 1T3IA 3DC1A 3AEOA 4WYCA 3NYUA 4PIWA 3IHJA 3E2YA 3NU8A 2GMSA 2VMUA 3PA9A 4RKDA 2HOYA 5BJ3A 3LG0A 1M0NA 1UU2A 2V0YA 1RVUA 3WLXA 1RVYA 4Q31A 4ATPA 4HVKA 3N75A 4A0RA 3DR4A 1KL2A 2YCPA 2NMPA 7AATA 2VIAA 3AEPA 1W23A 1VJOA 3FVUA 3NUBA 2VMNA 4XK1A 3AOVA 4ADCA 4CBRA 4OMAA 1CJ0A 1I29A 4KYOA 4WLJA 3ELEA 1AKBA 4GSAA 3VP6A 2GB3A 4P3MA 2JGTA 3LVMA 4F5KA 8AATA 4AO4A 2R2NA 4LW2A 3B1CA 2BIGA 1IAYA 1G7WA 1YOOA 2PB2A 3P1TA 2YKVA 4R2NA 4Y0DA 1DJEA 1MDXA 2BHXA 3K40A 3EI6A 4ISYA 4TMRA 1O62A 2WB6A 3PGYA 1B9HA 5EIGB 2WK8A 1D7UA 3NRAA 4W91A 1V2FA 4ZAHA 4TV7A 3N7NA 1LKCA 4WLHA 2FQ6A 3HMUA 1OHWA 3P6KA 3PJ0A 3VK3A 4CVQA 1ARHA 1ASMA 4MQQA 2ZY5A 1GEXA 4LC3A 3RQ1A 2YKYA 3TATA 1YJZA 4NOGA 1AJSB 2FN6A 4DBCA 2DKJA 3PAAA 4AZKA 4IXZA 5HXXA 1H1CA 2BIAA 3TFTA 4MQRA 4B98A 4K2IA 3B1DA 1LW4A 2CSTA 3RBLA 1ASEA 4AH3A 2Z67A 2W8WA 4ITXA 3ZRQA 1GC2A 1YNUA 4JE5D 1B8GA 5EUNA 2AY2A 2ZUKA 5EUDA 1QISA 2VGUA 2D65A 1WYUA 1E5FA 3ASAA 5J8QA 1PMOA 4A0FA 1AJRA 2W7MA 3VOMA 3EZSA 4RIZA 4F4EA 1QITA 2VMYA 3BN1A 3RUYA 1N31A 1OHYA 1FG3A 2HORA 4KAMA 3WKSA 4RLGA 1C9CA 5E3KA 2CY8A 2X3LA 9AATA 3HVYA 2CJDA 2E7IA 4BA5A 5BJ4A 1AMAA 3G8MA 2BI3A 1S09A 2AEUA 2V1PA 1GBNA 2VGSA 1FC4A 2QLRA 4R5ZA 3R9AA 2ZY2A 1MAPA 2YRRA 2JISA 2AY1A 4ADDA 2FYFA 1J04A 3EZ1A 4N0WA 1BJWA 2WK7A 2W7IA 2OGAA 3I16A 1B4XA 2CTZA 1GD9A 2DKBA 1WYTB 3MC6C 3PDBA 4WYFA 1GEYA 4A0GA 3RBFA 3VK4A 2PB0A 3BWNA 2FKIA 1I48A 3LWSA 1AY4A 2FNUA 1D7RA 2HP2A 2W8UA 1WYVB 1DTYA 1AMSA 1W7MA 3EI5A 3MKJA 5HDMA 4W1WA 4IYOA 4ADEA 2OKKA 3G0TA 3R4TA 2YKXA 3AEMA 5K8BA 4E77A 4E3QA 3AELA 1I41A 1W7LA 1V2EA 2DGKA 3EI7A 1C7OA 3JWBA 4M2JA 5DB5A 3GBXA 1C4KA 1DFOA 1UKJA 2QBTA 4Q6RA 2G6WA 1UU0A 1BJOA 2EGYA 3ACZA 4EMYA 1IJIA 1LC5A 5G2PA 2W7DA 4OBUA 3DODA 1WSTA 3I4JA 2YCNA 1ZOBA 2JJHA 2CINA 2VIBA 3DYDA 2ZY4A 4RITA 2X5DA 3JW9A 3LV2A 2E7JA 2VMOA 1TOKA 2CANA 3RI6A 2Q7WA 3F0HA 4XJMA 5FT4A 1VP4A 3LVJA 1B5OA 1IBJA 4Y0HA 1M4NA 4H51A 1CZEA 2BYJA 1GDEA 1QZ9A 2PO3A 1KKPA 4KXKA 3MADA 2VLFA 3DR7A 3N4SA 1AY8A 1QJ5A 2D64A 3KKIA 5F8VA 2O0RA 2VGVA 2JJFA 4E1OA 1LS3A 4UHMA 1CZCA 3NNKA 1IVRA 1AAMA 1CQ8A 3ECDA 2X5FA 4GE4A 5FT6A 5TF5A 3G7QA 3EIBA 1O69A 1BJ4A 3AENA 5G0AA 2AY9A 2EZ2A 3E2ZB 3AATA 3N0LA 2G7JA 2Z1ZA 1AHEA 2DR1A 2BI5A 4TN4A 1LC8A 2R0TA 1MAQA 3MAFA 1KMJA 3OKSA 2D61A 4AOAA 1LK9A 2VMWA 1O4SA 1TOIA 4IXSA 2XH1A 1TOGA 3GJUA 3N5MA 3GZCA 4W1XA 4UOYA 2AY4A 2CJGA 2VGWA 2W7KA 1BQDA 4JF0A 4OT8A 2CJHA 1W3UA 3DXWA 2BI9A 3JZLA 1TARA 2JJEA 2OGEA 2QB2A 3W1JA 1Z7DA 2ZY3A 3HBXA 3JWAA 4RAEA 3RCHA 4GRXA 2ZJGA 1ARIA 4JEXA 3T32A 4F5HA 3E9KA 5M4DA 1S06A 1AX4A 2D63A 3GSBA 2VI9A 2JG2A 2GSAA 4XEWA 3JTXA 3FD0A 1AHXA 1AKCA 3COGA 4GE7A 3VK2A 4A0HA 1H0CA 3L8AA 4HF8A 2ZC0A 4PVFA 4Y0IA 2FNIA 4XJOA 1TOEA 5F9SA 4N0BA 1SPAA 4GDYA 2CFBA 2W8JA 2E7UA 2O7CA 1X28A 2ZSMA 2D5YA 1MDOA 3MEBA 3QM2A 4I8AA 3CQ6A 4OYTA 4JEVA 1AMQA 5M4BA 5AX8A 4PFFA
chains in the Genus database with same CATH topology
2AY6A 3UWCA 4F5LA 2QA3A 3HDOA 4Q75A 3FQAA 3IF2A 2VMQA 3MBBA 5EIGA 4A6TA 3FZ8A 3WKRA 4EB5A 4F5IA 4K05A 3E6GA 1ASDA 3HQTA 3WGCA 4M2MA 3AOWA 3NYTA 1P3WA 4R5FA 4PFNA 1WKGA 3K28A 2HUUA 3F9TA 4OC9A 1M0QA 1Z3ZA 3EI9A 1DGEA 2OKJA 2R5EA 1PG8A 1EJIA 3ASBA 1AJSA 2C81A 3FDBA 3B1EA 4IY7A 3TFUA 3M5UA 2YRIA 1IX7A 2C44A 4XAUA 1AHYA 3A8UX 3PIUA 1TOJA 3FFRA 4O6ZA 3DZZA 1G4VA 2YKUA 2OQXA 3LVKA 4WXBA 3KGWA 3PDBB 4ITGA 4AZJA 1QGNA 3F6TA 3UE8A 1RV3A 4F5FA 3A9ZA 1ZC9A 5D95A 4ZLVA 1S08A 3FKDA 3FVSA 3PD6B 1AIBA 3CQ4A 4FL0A 3MC6A 2EYQA 4UQVA 4IYOB 2BI2A 2BYLA 5EFSA 2TPLA 2Z20A 3BCBA 4A6RA 3E2FA 2R5CB 3AEJC 4ADBA 4DQ6A 4ZDPA 3E77A 3NTJA 3N4RA 1GC0A 3DRDA 2HOZA 4WYDA 3BV0A 3L44A 1J32A 1CQ6A 1G7XA 2Z1YA 4MQPA 4WXFA 2VMRA 1EQBA 3AEJA 3EIAA 4XJPA 1OXPA 4IX8A 3WY7A 1X0MA 3WCNA 1YJSA 2DOUA 5M49A 1WYTA 3DXVA 4WB0B 4EB7A 1ASFA 5LHAA 3B8XA 4RKCA 2AY5A 1ARGA 3FTBA 4JEZA 3HL2A 2VMTA 2QB3A 2W7JA 4U2HA 2W7HA 1GC4A 5I92A 3K7YA 1DKAA 1PMMA 4F5JA 5DX5A 2Z9VA 5E4ZA 1PFFA 2E54A 1WYVA 2OATA 2X8UA 3ZRRA 3ZRPA 5C6UA 3A9XA 3BB8A 3A9YA 3BC8A 2Z9UA 3HLMA 3WX9A 3ZZJA 3LVLB 5JAYA 1ASLA 1BJNA 2EH6A 4WXGA 3W1IA 3AENB 4CBSA 5LH9A 1AHFA 1TPLA 1ASBA 4WYEA 3MAFB 1ASNA 4ZDOA 1YIZA 4W1VA 2BI1A 2QMAA 3TCMA 1D7SA 1BKGA 3QGUA 4GEBA 4BHDA 2VMPA 4P7YA 2ZP7A 1CL2A 4LNJA 4ZDLA 1B9IA 1SF2A 2VMVA 3FDDA 1C7GA 2JJGA 4JE5A 4JEYA 2W7EA 3BWOA 1UU1A 2EPJA 1BW0A 3RCHB 1AAWA 4IW7A 1Y4IA 3BCXA 1GCKA 3VAXA 3ZZKA 2C0RA 3EUCA 4ZM3A 4F5GA 1MLZA 1TASA 3CBFA 1KMKA 3EI8A 2RFVA 5DJ9A 4U1TA 2VMXA 2BKWA 3E2ZA 3KE3A 4MSOA 1YJYA 4J5UA 2ZYJA 2VLHA 4M2KA 1V72A 3II0A 3NUIA 2BWOA 4K2BA 2A1VA 2AY7A 2YCTA 2F8JA 2D7ZA 3FRKA 3GR9A 3TQXA 1CQ7A 4AO9A 1M0OA 1XI9A 4LNMA 1N8PA 1E5EA 3LY1A 1M0PA 1IAXA 1RV4A 4BA4A 1O61A 4W5KA 2VGZA 1C0NA 4CXQA 1KL1A 2WK9A 1QJ3A 2CB1A 2D66A 2GMUA 3FVXA 3FFHA 4LW4A 4A72A 5M46A 3FSLA 1ORDA 2W7GA 4WD2A 5G2QA 1WYUB 2VMSA 3H9XA 3BCAA 4GE9A 5G4JA 1U08A 1XEYA 1TATA 4R8DA 4DGTA 1OHVA 5FT5A 2CH2A 3ISLA 1SZSA 4L0OA 1JF9A 2YOBA 1M6SA 5D5SA 1ASAA 4MKJA 2BIEA 4MKKA 2BWPA 2W7FA 2DGLA 3QI6A 4E3RA 3D6KA 1KKJA 1IX6A 1MLYA 1IX8A 3FQ7A 4XQ2A 4WYAA 2DGMA 4JF1A 3QN6A 2VGTA 2ORDA 2O1BA 2CH1A 4OCAA 5EAVA 4RJYA 4RJ0A 1IUGA 3H14A 1BS0A 2D7YA 2HP1A 4ZWVA 2EZ1A 2HOXA 1G4XA 2YHKA 2Z61A 4EU1A 4XJLA 2HZPA 3MAUA 1JS6A 4FFCA 4K2MA 2AATA 4WBTA 1B5PA 4BQ0A 4A00A 3I5TA 1CS1A 1AMRA 1JG8A 1S0AA 3H7FA 4WYGA 2VI8A 3N4XA 1BQAA 3GWPA 4H63Q 5KTBA 2FM1A 3Q8NA 1LC7A 1V2DA 2W8VA 3B46A 5G09A 3QBOA 3WZFA 4J8LA 4ZASA 2W8TA 3QPGA 4OBVA 3JU7A 4MY5A 4B9BA 1SZUA 1X2AA 1S07A 4EFFA 4JEWA 5FT8A 3GETA 1DJ9A 3QHXA 4ATQA 3ELPA 1YIYA 3AV7A 3WGBA 4ZM4A 1ARTA 1JS3A 2WKAA 3OP7A 3A2BA 2ZSLA 1C7NA 3BWNC 1BJOB 5G4IA 3NDNA 1BT4A 3DU4A 3KGXA 4UHOA 3FZ6A 1MDZA 2BWNA 1ASCA 2VYCA 3CQ5A 1OATA 1AIAA 1AY5A 1CL1A 3GZDC 4A6UA 1GC3A 2XBNA 1M32A 1MGVA 1ARSA 1VEFA 4ZWMA 3NYSA 2W7LA 2QSRA 1N2TA 3AEMC 1SVVA 4W8IA 2AEVA 3BS8A 3GZDA 1DJUA 3PD6A 4ZSYA 4OTLA 2KFPA 1FG7A 4Q76A 4BMKA 5EUEA 4CXRA 3PDXA 1ELUA 4IXOA 2HUIA 5E5IA 3UAKA 2AY3A 1AICA 3PPLA 1ECXA 5DJ1A 5HHYA 1GEWA 2R5CA 1I43A 1WKHA 1D7VA 2GQNA 1W7NA 3NX3A 2EO5A 3W1HA 5EQCA 3ATHA 3NU7A 1ASGA 1D2FA 3FQ8A 1SFFA 1OXOA 4LNLA 1YAAA 1ELQA 2HUFA 3FZ7A 3USFA 2AY8A 4WP0A 5IWQA 4UHNA 4QGRA 4F5MA 4RM1A 3CAIA 1M7YA 4MGRA 1LW5A 3WCOA 2Z9WA 3FCRA 1EG5A 1X29A 1QIRA 4WB0A 2VMZA 1AHGA 2Z9XA 1ZODA 2C7TA 1DGDA 4ZSWA 1AKAA 3HT4A 5EAAA 1SZKA 1T3IA 3DC1A 3AEOA 4WYCA 3NYUA 4PIWA 3IHJA 3E2YA 3NU8A 2GMSA 2VMUA 3PA9A 4RKDA 2HOYA 5BJ3A 3LG0A 1M0NA 1UU2A 2V0YA 1RVUA 3WLXA 1RVYA 4Q31A 4ATPA 4HVKA 3N75A 4A0RA 3DR4A 1KL2A 2YCPA 2NMPA 7AATA 2VIAA 3AEPA 1W23A 1VJOA 3FVUA 3NUBA 2VMNA 4XK1A 3AOVA 4ADCA 4CBRA 4OMAA 1CJ0A 1I29A 4KYOA 4WLJA 3ELEA 1AKBA 4GSAA 3VP6A 2GB3A 4P3MA 2JGTA 3LVMA 4F5KA 8AATA 4AO4A 2R2NA 4LW2A 3B1CA 2BIGA 1IAYA 1G7WA 1YOOA 2PB2A 3P1TA 2YKVA 4R2NA 4Y0DA 1DJEA 1MDXA 2BHXA 3K40A 3EI6A 4ISYA 4TMRA 1O62A 2WB6A 3PGYA 1B9HA 5EIGB 2WK8A 1D7UA 3NRAA 4W91A 1V2FA 4ZAHA 4TV7A 3N7NA 1LKCA 4WLHA 2FQ6A 3HMUA 1OHWA 3P6KA 3PJ0A 3VK3A 4CVQA 1ARHA 1ASMA 4MQQA 2ZY5A 1GEXA 4LC3A 3RQ1A 2YKYA 3TATA 1YJZA 4NOGA 1AJSB 2FN6A 4DBCA 2DKJA 3PAAA 4AZKA 4IXZA 5HXXA 1H1CA 2BIAA 3TFTA 4MQRA 4B98A 4K2IA 3B1DA 1LW4A 2CSTA 3RBLA 1ASEA 4AH3A 2Z67A 2W8WA 4ITXA 3ZRQA 1GC2A 1YNUA 4JE5D 1B8GA 5EUNA 2AY2A 2ZUKA 5EUDA 1QISA 2VGUA 2D65A 1WYUA 1E5FA 3ASAA 5J8QA 1PMOA 4A0FA 1AJRA 2W7MA 3VOMA 3EZSA 4RIZA 4F4EA 1QITA 2VMYA 3BN1A 3RUYA 1N31A 1OHYA 1FG3A 2HORA 4KAMA 3WKSA 4RLGA 1C9CA 5E3KA 2CY8A 2X3LA 9AATA 3HVYA 2CJDA 2E7IA 4BA5A 5BJ4A 1AMAA 3G8MA 2BI3A 1S09A 2AEUA 2V1PA 1GBNA 2VGSA 1FC4A 2QLRA 4R5ZA 3R9AA 2ZY2A 1MAPA 2YRRA 2JISA 2AY1A 4ADDA 2FYFA 1J04A 3EZ1A 4N0WA 1BJWA 2WK7A 2W7IA 2OGAA 3I16A 1B4XA 2CTZA 1GD9A 2DKBA 1WYTB 3MC6C 3PDBA 4WYFA 1GEYA 4A0GA 3RBFA 3VK4A 2PB0A 3BWNA 2FKIA 1I48A 3LWSA 1AY4A 2FNUA 1D7RA 2HP2A 2W8UA 1WYVB 1DTYA 1AMSA 1W7MA 3EI5A 3MKJA 5HDMA 4W1WA 4IYOA 4ADEA 2OKKA 3G0TA 3R4TA 2YKXA 3AEMA 5K8BA 4E77A 4E3QA 3AELA 1I41A 1W7LA 1V2EA 2DGKA 3EI7A 1C7OA 3JWBA 4M2JA 5DB5A 3GBXA 1C4KA 1DFOA 1UKJA 2QBTA 4Q6RA 2G6WA 1UU0A 1BJOA 2EGYA 3ACZA 4EMYA 1IJIA 1LC5A 5G2PA 2W7DA 4OBUA 3DODA 1WSTA 3I4JA 2YCNA 1ZOBA 2JJHA 2CINA 2VIBA 3DYDA 2ZY4A 4RITA 2X5DA 3JW9A 3LV2A 2E7JA 2VMOA 1TOKA 2CANA 3RI6A 2Q7WA 3F0HA 4XJMA 5FT4A 1VP4A 3LVJA 1B5OA 1IBJA 4Y0HA 1M4NA 4H51A 1CZEA 2BYJA 1GDEA 1QZ9A 2PO3A 1KKPA 4KXKA 3MADA 2VLFA 3DR7A 3N4SA 1AY8A 1QJ5A 2D64A 3KKIA 5F8VA 2O0RA 2VGVA 2JJFA 4E1OA 1LS3A 4UHMA 1CZCA 3NNKA 1IVRA 1AAMA 1CQ8A 3ECDA 2X5FA 4GE4A 5FT6A 5TF5A 3G7QA 3EIBA 1O69A 1BJ4A 3AENA 5G0AA 2AY9A 2EZ2A 3E2ZB 3AATA 3N0LA 2G7JA 2Z1ZA 1AHEA 2DR1A 2BI5A 4TN4A 1LC8A 2R0TA 1MAQA 3MAFA 1KMJA 3OKSA 2D61A 4AOAA 1LK9A 2VMWA 1O4SA 1TOIA 4IXSA 2XH1A 1TOGA 3GJUA 3N5MA 3GZCA 4W1XA 4UOYA 2AY4A 2CJGA 2VGWA 2W7KA 1BQDA 4JF0A 4OT8A 2CJHA 1W3UA 3DXWA 2BI9A 3JZLA 1TARA 2JJEA 2OGEA 2QB2A 3W1JA 1Z7DA 2ZY3A 3HBXA 3JWAA 4RAEA 3RCHA 4GRXA 2ZJGA 1ARIA 4JEXA 3T32A 4F5HA 3E9KA 5M4DA 1S06A 1AX4A 2D63A 3GSBA 2VI9A 2JG2A 2GSAA 4XEWA 3JTXA 3FD0A 1AHXA 1AKCA 3COGA 4GE7A 3VK2A 4A0HA 1H0CA 3L8AA 4HF8A 2ZC0A 4PVFA 4Y0IA 2FNIA 4XJOA 1TOEA 5F9SA 4N0BA 1SPAA 4GDYA 2CFBA 2W8JA 2E7UA 2O7CA 1X28A 2ZSMA 2D5YA 1MDOA 3MEBA 3QM2A 4I8AA 3CQ6A 4OYTA 4JEVA 1AMQA 5M4BA 5AX8A 4PFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY6 A;  3UWC A;  4F5L A;  2QA3 A;  3HDO A;  4Q75 A;  3FQA A;  3IF2 A;  2VMQ A;  3MBB A;  5EIG A;  4A6T A;  3FZ8 A;  3WKR A;  4EB5 A;  4F5I A;  3E6G A;  1ASD A;  3HQT A;  3WGC A;  4M2M A;  3AOW A;  3NYT A;  1P3W A;  4R5F A;  4PFN A;  1WKG A;  3K28 A;  2HUU A;  3F9T A;  4OC9 A;  1M0Q A;  1Z3Z A;  3EI9 A;  1DGE A;  2OKJ A;  2R5E A;  1PG8 A;  1EJI A;  3ASB A;  1AJS A;  2C81 A;  3FDB A;  3B1E A;  4IY7 A;  3TFU A;  3M5U A;  2YRI A;  1IX7 A;  2C44 A;  4XAU A;  1AHY A;  3A8U X;  3PIU A;  1TOJ A;  3FFR A;  4O6Z A;  3DZZ A;  1G4V A;  2YKU A;  2OQX A;  3LVK A;  4WXB A;  3KGW A;  3PDB B;  4ITG A;  4AZJ A;  1QGN A;  3F6T A;  3UE8 A;  1RV3 A;  4F5F A;  3A9Z A;  1ZC9 A;  5D95 A;  4ZLV A;  1S08 A;  3FKD A;  3FVS A;  3PD6 B;  1AIB A;  3CQ4 A;  4FL0 A;  3MC6 A;  4UQV A;  4IYO B;  2BI2 A;  2BYL A;  5EFS A;  2TPL A;  2Z20 A;  3BCB A;  4A6R A;  3E2F A;  2R5C B;  3AEJ C;  4ADB A;  4DQ6 A;  4ZDP A;  3E77 A;  3NTJ A;  1GC0 A;  3DRD A;  2HOZ A;  4WYD A;  3BV0 A;  3L44 A;  1J32 A;  1CQ6 A;  1G7X A;  2Z1Y A;  4MQP A;  4WXF A;  2VMR A;  1EQB A;  3AEJ A;  3EIA A;  4XJP A;  1OXP A;  4IX8 A;  3WY7 A;  1X0M A;  3WCN A;  1YJS A;  2DOU A;  5M49 A;  1WYT A;  3DXV A;  4WB0 B;  4EB7 A;  1ASF A;  5LHA A;  3B8X A;  4RKC A;  2AY5 A;  1ARG A;  3FTB A;  4JEZ A;  3HL2 A;  2VMT A;  2QB3 A;  2W7J A;  4U2H A;  2W7H A;  1GC4 A;  5I92 A;  3K7Y A;  1DKA A;  1PMM A;  4F5J A;  5DX5 A;  2Z9V A;  5E4Z A;  1PFF A;  2E54 A;  1WYV A;  2OAT A;  2X8U A;  3ZRR A;  3ZRP A;  5C6U A;  3A9X A;  3BB8 A;  3A9Y A;  3BC8 A;  2Z9U A;  3HLM A;  3WX9 A;  3ZZJ A;  3LVL B;  5JAY A;  1ASL A;  1BJN A;  2EH6 A;  4WXG A;  3W1I A;  3AEN B;  4CBS A;  5LH9 A;  1AHF A;  1TPL A;  1ASB A;  4WYE A;  3MAF B;  1ASN A;  4ZDO A;  1YIZ A;  4W1V A;  2BI1 A;  2QMA A;  3TCM A;  1D7S A;  1BKG A;  3QGU A;  4GEB A;  4BHD A;  2VMP A;  4P7Y A;  2ZP7 A;  1CL2 A;  4LNJ A;  4ZDL A;  1B9I A;  1SF2 A;  2VMV A;  3FDD A;  1C7G A;  2JJG A;  4JE5 A;  4JEY A;  2W7E A;  3BWO A;  1UU1 A;  2EPJ A;  1BW0 A;  3RCH B;  1AAW A;  4IW7 A;  1Y4I A;  3BCX A;  1GCK A;  3VAX A;  3ZZK A;  2C0R A;  3EUC A;  4ZM3 A;  4F5G A;  1MLZ A;  1TAS A;  3CBF A;  1KMK A;  3EI8 A;  2RFV A;  5DJ9 A;  4U1T A;  2VMX A;  2BKW A;  3E2Z A;  3KE3 A;  4MSO A;  1YJY A;  4J5U A;  2ZYJ A;  2VLH A;  4M2K A;  1V72 A;  3II0 A;  3NUI A;  2BWO A;  4K2B A;  2AY7 A;  2YCT A;  2F8J A;  2D7Z A;  3FRK A;  3GR9 A;  3TQX A;  1CQ7 A;  4AO9 A;  1M0O A;  1XI9 A;  4LNM A;  1N8P A;  1E5E A;  3LY1 A;  1M0P A;  1IAX A;  1RV4 A;  4BA4 A;  1O61 A;  4W5K A;  2VGZ A;  1C0N A;  4CXQ A;  1KL1 A;  2WK9 A;  1QJ3 A;  2CB1 A;  2D66 A;  2GMU A;  3FVX A;  3FFH A;  4LW4 A;  4A72 A;  5M46 A;  3FSL A;  1ORD A;  2W7G A;  4WD2 A;  5G2Q A;  1WYU B;  2VMS A;  3BCA A;  4GE9 A;  5G4J A;  1U08 A;  1XEY A;  1TAT A;  4R8D A;  4DGT A;  1OHV A;  5FT5 A;  2CH2 A;  3ISL A;  1SZS A;  4L0O A;  1JF9 A;  2YOB A;  1M6S A;  5D5S A;  1ASA A;  4MKJ A;  2BIE A;  4MKK A;  2BWP A;  2W7F A;  2DGL A;  3QI6 A;  4E3R A;  3D6K A;  1KKJ A;  1IX6 A;  1MLY A;  1IX8 A;  3FQ7 A;  4XQ2 A;  4WYA A;  2DGM A;  4JF1 A;  3QN6 A;  2VGT A;  2ORD A;  2O1B A;  2CH1 A;  4OCA A;  5EAV A;  4RJY A;  4RJ0 A;  1IUG A;  3H14 A;  1BS0 A;  2D7Y A;  2HP1 A;  4ZWV A;  2EZ1 A;  2HOX A;  1G4X A;  2YHK A;  2Z61 A;  4EU1 A;  4XJL A;  2HZP A;  3MAU A;  1JS6 A;  4FFC A;  4K2M A;  2AAT A;  4WBT A;  1B5P A;  4BQ0 A;  4A00 A;  3I5T A;  1CS1 A;  1AMR A;  1JG8 A;  1S0A A;  3H7F A;  4WYG A;  2VI8 A;  1BQA A;  3GWP A;  2FM1 A;  3Q8N A;  1LC7 A;  1V2D A;  2W8V A;  3B46 A;  5G09 A;  3QBO A;  3WZF A;  4J8L A;  4ZAS A;  2W8T A;  3QPG A;  4OBV A;  3JU7 A;  4MY5 A;  4B9B A;  1SZU A;  1X2A A;  1S07 A;  4EFF A;  4JEW A;  5FT8 A;  3GET A;  1DJ9 A;  3QHX A;  4ATQ A;  3ELP A;  1YIY A;  3AV7 A;  3WGB A;  4ZM4 A;  1ART A;  1JS3 A;  2WKA A;  3OP7 A;  3A2B A;  2ZSL A;  1C7N A;  3BWN C;  1BJO B;  5G4I A;  3NDN A;  1BT4 A;  3DU4 A;  3KGX A;  4UHO A;  3FZ6 A;  1MDZ A;  2BWN A;  1ASC A;  2VYC A;  3CQ5 A;  1OAT A;  1AIA A;  1AY5 A;  1CL1 A;  3GZD C;  4A6U A;  1GC3 A;  2XBN A;  1M32 A;  1MGV A;  1ARS A;  1VEF A;  4ZWM A;  3NYS A;  2W7L A;  1N2T A;  3AEM C;  1SVV A;  4W8I A;  2AEV A;  3BS8 A;  3GZD A;  1DJU A;  3PD6 A;  4ZSY A;  4OTL A;  1FG7 A;  4Q76 A;  4BMK A;  5EUE A;  4CXR A;  3PDX A;  1ELU A;  4IXO A;  2HUI A;  5E5I A;  3UAK A;  2AY3 A;  1AIC A;  3PPL A;  1ECX A;  5DJ1 A;  5HHY A;  1GEW A;  2R5C A;  1I43 A;  1WKH A;  1D7V A;  2GQN A;  1W7N A;  3NX3 A;  2EO5 A;  3W1H A;  5EQC A;  3ATH A;  3NU7 A;  1ASG A;  1D2F A;  3FQ8 A;  1SFF A;  1OXO A;  4LNL A;  1YAA A;  1ELQ A;  2HUF A;  3FZ7 A;  3USF A;  2AY8 A;  4WP0 A;  5IWQ A;  4UHN A;  4QGR A;  4F5M A;  4RM1 A;  3CAI A;  1M7Y A;  4MGR A;  1LW5 A;  3WCO A;  2Z9W A;  3FCR A;  1EG5 A;  1X29 A;  1QIR A;  4WB0 A;  2VMZ A;  1AHG A;  2Z9X A;  1ZOD A;  2C7T A;  1DGD A;  4ZSW A;  1AKA A;  3HT4 A;  5EAA A;  1SZK A;  1T3I A;  3DC1 A;  3AEO A;  4WYC A;  3NYU A;  4PIW A;  3IHJ A;  3E2Y A;  3NU8 A;  2GMS A;  2VMU A;  3PA9 A;  4RKD A;  2HOY A;  5BJ3 A;  3LG0 A;  1M0N A;  1UU2 A;  2V0Y A;  1RVU A;  3WLX A;  1RVY A;  4Q31 A;  4ATP A;  4HVK A;  3N75 A;  4A0R A;  3DR4 A;  1KL2 A;  2YCP A;  2NMP A;  7AAT A;  2VIA A;  3AEP A;  1W23 A;  1VJO A;  3FVU A;  3NUB A;  2VMN A;  4XK1 A;  3AOV A;  4ADC A;  4CBR A;  4OMA A;  1CJ0 A;  1I29 A;  4KYO A;  4WLJ A;  3ELE A;  1AKB A;  4GSA A;  3VP6 A;  2GB3 A;  4P3M A;  2JGT A;  3LVM A;  4F5K A;  8AAT A;  4AO4 A;  2R2N A;  4LW2 A;  3B1C A;  2BIG A;  1IAY A;  1G7W A;  1YOO A;  2PB2 A;  3P1T A;  2YKV A;  4R2N A;  4Y0D A;  1DJE A;  1MDX A;  2BHX A;  3K40 A;  3EI6 A;  4ISY A;  4TMR A;  1O62 A;  3PGY A;  1B9H A;  5EIG B;  2WK8 A;  1D7U A;  3NRA A;  4W91 A;  1V2F A;  4ZAH A;  4TV7 A;  1LKC A;  4WLH A;  2FQ6 A;  3HMU A;  1OHW A;  3P6K A;  3PJ0 A;  3VK3 A;  4CVQ A;  1ARH A;  1ASM A;  4MQQ A;  2ZY5 A;  1GEX A;  4LC3 A;  3RQ1 A;  2YKY A;  3TAT A;  1YJZ A;  4NOG A;  1AJS B;  2FN6 A;  4DBC A;  2DKJ A;  3PAA A;  4AZK A;  4IXZ A;  5HXX A;  1H1C A;  2BIA A;  3TFT A;  4MQR A;  4B98 A;  4K2I A;  3B1D A;  1LW4 A;  2CST A;  3RBL A;  1ASE A;  4AH3 A;  2Z67 A;  2W8W A;  4ITX A;  3ZRQ A;  1GC2 A;  1YNU A;  4JE5 D;  1B8G A;  5EUN A;  2AY2 A;  2ZUK A;  5EUD A;  1QIS A;  2VGU A;  2D65 A;  1WYU A;  1E5F A;  3ASA A;  5J8Q A;  1PMO A;  4A0F A;  1AJR A;  2W7M A;  3VOM A;  3EZS A;  4RIZ A;  4F4E A;  1QIT A;  2VMY A;  3BN1 A;  3RUY A;  1N31 A;  1OHY A;  1FG3 A;  2HOR A;  4KAM A;  3WKS A;  4RLG A;  1C9C A;  5E3K A;  2CY8 A;  2X3L A;  9AAT A;  3HVY A;  2CJD A;  2E7I A;  4BA5 A;  5BJ4 A;  1AMA A;  3G8M A;  2BI3 A;  1S09 A;  2AEU A;  2V1P A;  1GBN A;  2VGS A;  1FC4 A;  2QLR A;  4R5Z A;  3R9A A;  2ZY2 A;  1MAP A;  2YRR A;  2JIS A;  2AY1 A;  4ADD A;  2FYF A;  1J04 A;  3EZ1 A;  4N0W A;  1BJW A;  2WK7 A;  2W7I A;  2OGA A;  3I16 A;  1B4X A;  2CTZ A;  1GD9 A;  2DKB A;  1WYT B;  3MC6 C;  3PDB A;  4WYF A;  1GEY A;  4A0G A;  3RBF A;  3VK4 A;  2PB0 A;  3BWN A;  1I48 A;  3LWS A;  1AY4 A;  2FNU A;  1D7R A;  2HP2 A;  2W8U A;  1WYV B;  1DTY A;  1AMS A;  1W7M A;  3EI5 A;  3MKJ A;  5HDM A;  4W1W A;  4IYO A;  4ADE A;  2OKK A;  3G0T A;  3R4T A;  2YKX A;  3AEM A;  5K8B A;  4E77 A;  4E3Q A;  3AEL A;  1I41 A;  1W7L A;  1V2E A;  2DGK A;  3EI7 A;  1C7O A;  3JWB A;  4M2J A;  5DB5 A;  3GBX A;  1C4K A;  1DFO A;  1UKJ A;  2QBT A;  4Q6R A;  2G6W A;  1UU0 A;  1BJO A;  2EGY A;  3ACZ A;  4EMY A;  1IJI A;  1LC5 A;  5G2P A;  2W7D A;  4OBU A;  3DOD A;  1WST A;  3I4J A;  2YCN A;  1ZOB A;  2JJH A;  2CIN A;  2VIB A;  3DYD A;  2ZY4 A;  4RIT A;  2X5D A;  3JW9 A;  3LV2 A;  2E7J A;  2VMO A;  1TOK A;  2CAN A;  3RI6 A;  2Q7W A;  3F0H A;  4XJM A;  5FT4 A;  1VP4 A;  3LVJ A;  1B5O A;  1IBJ A;  4Y0H A;  1M4N A;  4H51 A;  1CZE A;  2BYJ A;  1GDE A;  1QZ9 A;  2PO3 A;  1KKP A;  4KXK A;  3MAD A;  2VLF A;  3DR7 A;  1AY8 A;  1QJ5 A;  2D64 A;  3KKI A;  5F8V A;  2O0R A;  2VGV A;  2JJF A;  4E1O A;  1LS3 A;  4UHM A;  1CZC A;  3NNK A;  1IVR A;  1AAM A;  1CQ8 A;  3ECD A;  2X5F A;  4GE4 A;  5FT6 A;  5TF5 A;  3G7Q A;  3EIB A;  1O69 A;  1BJ4 A;  3AEN A;  5G0A A;  2AY9 A;  2EZ2 A;  3E2Z B;  3AAT A;  3N0L A;  2Z1Z A;  1AHE A;  2DR1 A;  2BI5 A;  4TN4 A;  1LC8 A;  2R0T A;  1MAQ A;  3MAF A;  1KMJ A;  3OKS A;  2D61 A;  4AOA A;  1LK9 A;  2VMW A;  1O4S A;  1TOI A;  4IXS A;  2XH1 A;  1TOG A;  3GJU A;  3N5M A;  3GZC A;  4W1X A;  4UOY A;  2AY4 A;  2CJG A;  2VGW A;  2W7K A;  1BQD A;  4JF0 A;  4OT8 A;  2CJH A;  1W3U A;  3DXW A;  2BI9 A;  3JZL A;  1TAR A;  2JJE A;  2OGE A;  2QB2 A;  3W1J A;  1Z7D A;  2ZY3 A;  3HBX A;  3JWA A;  4RAE A;  3RCH A;  4GRX A;  2ZJG A;  1ARI A;  4JEX A;  3T32 A;  4F5H A;  3E9K A;  5M4D A;  1S06 A;  1AX4 A;  2D63 A;  3GSB A;  2VI9 A;  2JG2 A;  2GSA A;  4XEW A;  3JTX A;  3FD0 A;  1AHX A;  1AKC A;  3COG A;  4GE7 A;  3VK2 A;  4A0H A;  1H0C A;  3L8A A;  4HF8 A;  2ZC0 A;  4PVF A;  4Y0I A;  2FNI A;  4XJO A;  1TOE A;  5F9S A;  4N0B A;  1SPA A;  4GDY A;  2CFB A;  2W8J A;  2E7U A;  2O7C A;  1X28 A;  2ZSM A;  2D5Y A;  1MDO A;  3MEB A;  3QM2 A;  4I8A A;  3CQ6 A;  4OYT A;  4JEV A;  1AMQ A;  5M4B A;  5AX8 A;  4PFF A; 
#chains in the Genus database with same CATH topology
 2AY6 A;  3UWC A;  4F5L A;  2QA3 A;  3HDO A;  4Q75 A;  3FQA A;  3IF2 A;  2VMQ A;  3MBB A;  5EIG A;  4A6T A;  3FZ8 A;  3WKR A;  4EB5 A;  4F5I A;  4K05 A;  3E6G A;  1ASD A;  3HQT A;  3WGC A;  4M2M A;  3AOW A;  3NYT A;  1P3W A;  4R5F A;  4PFN A;  1WKG A;  3K28 A;  2HUU A;  3F9T A;  4OC9 A;  1M0Q A;  1Z3Z A;  3EI9 A;  1DGE A;  2OKJ A;  2R5E A;  1PG8 A;  1EJI A;  3ASB A;  1AJS A;  2C81 A;  3FDB A;  3B1E A;  4IY7 A;  3TFU A;  3M5U A;  2YRI A;  1IX7 A;  2C44 A;  4XAU A;  1AHY A;  3A8U X;  3PIU A;  1TOJ A;  3FFR A;  4O6Z A;  3DZZ A;  1G4V A;  2YKU A;  2OQX A;  3LVK A;  4WXB A;  3KGW A;  3PDB B;  4ITG A;  4AZJ A;  1QGN A;  3F6T A;  3UE8 A;  1RV3 A;  4F5F A;  3A9Z A;  1ZC9 A;  5D95 A;  4ZLV A;  1S08 A;  3FKD A;  3FVS A;  3PD6 B;  1AIB A;  3CQ4 A;  4FL0 A;  3MC6 A;  2EYQ A;  4UQV A;  4IYO B;  2BI2 A;  2BYL A;  5EFS A;  1KAF A;  2TPL A;  2Z20 A;  3BCB A;  4A6R A;  3E2F A;  2R5C B;  3AEJ C;  4ADB A;  4DQ6 A;  4ZDP A;  3E77 A;  3NTJ A;  3N4R A;  1GC0 A;  3DRD A;  2HOZ A;  4WYD A;  3BV0 A;  3L44 A;  1J32 A;  1CQ6 A;  1G7X A;  2Z1Y A;  4MQP A;  4WXF A;  2VMR A;  1EQB A;  3AEJ A;  3EIA A;  4XJP A;  1OXP A;  4IX8 A;  3WY7 A;  1X0M A;  3WCN A;  1YJS A;  2DOU A;  5M49 A;  1WYT A;  3DXV A;  4WB0 B;  4EB7 A;  1ASF A;  5LHA A;  3B8X A;  4RKC A;  2AY5 A;  1ARG A;  3FTB A;  4JEZ A;  3HL2 A;  2VMT A;  2QB3 A;  2W7J A;  4U2H A;  2W7H A;  1GC4 A;  5I92 A;  3K7Y A;  1DKA A;  1PMM A;  4F5J A;  5DX5 A;  2Z9V A;  5E4Z A;  1PFF A;  2E54 A;  1WYV A;  2OAT A;  2X8U A;  3ZRR A;  3ZRP A;  5C6U A;  3A9X A;  3BB8 A;  3A9Y A;  3BC8 A;  2Z9U A;  3HLM A;  3WX9 A;  3ZZJ A;  3LVL B;  5JAY A;  1ASL A;  1BJN A;  2EH6 A;  4WXG A;  3W1I A;  3AEN B;  4CBS A;  5LH9 A;  1AHF A;  1TPL A;  1ASB A;  4WYE A;  3MAF B;  1ASN A;  4ZDO A;  1YIZ A;  4W1V A;  2BI1 A;  2QMA A;  3TCM A;  1D7S A;  1BKG A;  3QGU A;  4GEB A;  4BHD A;  2VMP A;  4P7Y A;  2ZP7 A;  1CL2 A;  4LNJ A;  4ZDL A;  1B9I A;  1SF2 A;  2VMV A;  3FDD A;  1C7G A;  2JJG A;  4JE5 A;  4JEY A;  2W7E A;  3BWO A;  1UU1 A;  2EPJ A;  1BW0 A;  3RCH B;  1AAW A;  4IW7 A;  1Y4I A;  3BCX A;  1GCK A;  3VAX A;  3ZZK A;  2C0R A;  3EUC A;  4ZM3 A;  4F5G A;  1MLZ A;  1TAS A;  3CBF A;  1KMK A;  3EI8 A;  2RFV A;  5DJ9 A;  4U1T A;  2VMX A;  2BKW A;  3E2Z A;  3KE3 A;  4MSO A;  1YJY A;  4J5U A;  2ZYJ A;  2VLH A;  4M2K A;  1V72 A;  3II0 A;  3NUI A;  2BWO A;  4K2B A;  2A1V A;  2AY7 A;  2YCT A;  2F8J A;  2D7Z A;  3FRK A;  3GR9 A;  3TQX A;  1CQ7 A;  4AO9 A;  1M0O A;  1XI9 A;  4LNM A;  1N8P A;  1E5E A;  3LY1 A;  1M0P A;  1IAX A;  1RV4 A;  4BA4 A;  1O61 A;  4W5K A;  2VGZ A;  1C0N A;  4CXQ A;  1KL1 A;  2WK9 A;  1QJ3 A;  2CB1 A;  2D66 A;  2GMU A;  3FVX A;  3FFH A;  4LW4 A;  4A72 A;  5M46 A;  3FSL A;  1ORD A;  2W7G A;  4WD2 A;  5G2Q A;  1WYU B;  2VMS A;  3H9X A;  3BCA A;  4GE9 A;  5G4J A;  1U08 A;  1XEY A;  1TAT A;  4R8D A;  4DGT A;  1OHV A;  5FT5 A;  2CH2 A;  3ISL A;  1SZS A;  4L0O A;  1JF9 A;  2YOB A;  1M6S A;  5D5S A;  1ASA A;  4MKJ A;  2BIE A;  4MKK A;  2BWP A;  2W7F A;  2DGL A;  3QI6 A;  4E3R A;  3D6K A;  1KKJ A;  1IX6 A;  1MLY A;  1IX8 A;  3FQ7 A;  4XQ2 A;  4WYA A;  2DGM A;  4JF1 A;  3QN6 A;  2VGT A;  2ORD A;  2O1B A;  2CH1 A;  4OCA A;  5EAV A;  4RJY A;  4RJ0 A;  1IUG A;  3H14 A;  1BS0 A;  2D7Y A;  2HP1 A;  4ZWV A;  2EZ1 A;  2HOX A;  1G4X A;  2YHK A;  2Z61 A;  4EU1 A;  4XJL A;  2HZP A;  3MAU A;  1JS6 A;  4FFC A;  4K2M A;  2AAT A;  4WBT A;  1B5P A;  4BQ0 A;  4A00 A;  3I5T A;  1CS1 A;  1AMR A;  1JG8 A;  1S0A A;  3H7F A;  4WYG A;  2VI8 A;  3N4X A;  1BQA A;  3GWP A;  4H63 Q;  5KTB A;  2FM1 A;  3Q8N A;  1LC7 A;  1V2D A;  2W8V A;  3B46 A;  5G09 A;  3QBO A;  3WZF A;  4J8L A;  4ZAS A;  2W8T A;  3QPG A;  4OBV A;  3JU7 A;  4MY5 A;  4B9B A;  1SZU A;  1X2A A;  1S07 A;  4EFF A;  4JEW A;  5FT8 A;  3GET A;  1DJ9 A;  3QHX A;  4ATQ A;  3ELP A;  1YIY A;  3AV7 A;  3WGB A;  4ZM4 A;  1ART A;  1JS3 A;  2WKA A;  3OP7 A;  3A2B A;  2ZSL A;  1C7N A;  3BWN C;  1BJO B;  5G4I A;  3NDN A;  1BT4 A;  3DU4 A;  3KGX A;  4UHO A;  3FZ6 A;  1MDZ A;  2BWN A;  1ASC A;  2VYC A;  3CQ5 A;  1OAT A;  1AIA A;  1AY5 A;  1CL1 A;  3GZD C;  4A6U A;  1GC3 A;  2XBN A;  1M32 A;  1MGV A;  1ARS A;  1VEF A;  4ZWM A;  3NYS A;  2W7L A;  2QSR A;  1N2T A;  3AEM C;  1SVV A;  4W8I A;  2AEV A;  3BS8 A;  3GZD A;  1DJU A;  3PD6 A;  4ZSY A;  4OTL A;  2KFP A;  1FG7 A;  4Q76 A;  4BMK A;  5EUE A;  4CXR A;  3PDX A;  1ELU A;  4IXO A;  2HUI A;  5E5I A;  3UAK A;  2AY3 A;  1AIC A;  3PPL A;  1ECX A;  5DJ1 A;  5HHY A;  1GEW A;  2R5C A;  1I43 A;  1WKH A;  1D7V A;  2GQN A;  1W7N A;  3NX3 A;  2EO5 A;  3W1H A;  5EQC A;  3ATH A;  3NU7 A;  1ASG A;  1D2F A;  3FQ8 A;  1SFF A;  1OXO A;  4LNL A;  1YAA A;  1ELQ A;  2HUF A;  3FZ7 A;  3USF A;  2AY8 A;  4WP0 A;  5IWQ A;  4UHN A;  4QGR A;  4F5M A;  4RM1 A;  3CAI A;  1M7Y A;  4MGR A;  1LW5 A;  3WCO A;  2Z9W A;  3FCR A;  1EG5 A;  1X29 A;  1QIR A;  4WB0 A;  2VMZ A;  1AHG A;  2Z9X A;  1ZOD A;  2C7T A;  1DGD A;  4ZSW A;  1AKA A;  3HT4 A;  5EAA A;  1SZK A;  1T3I A;  3DC1 A;  3AEO A;  4WYC A;  3NYU A;  4PIW A;  3IHJ A;  3E2Y A;  3NU8 A;  2GMS A;  2VMU A;  3PA9 A;  4RKD A;  2HOY A;  5BJ3 A;  3LG0 A;  1M0N A;  1UU2 A;  2V0Y A;  1RVU A;  3WLX A;  1RVY A;  4Q31 A;  4ATP A;  4HVK A;  3N75 A;  4A0R A;  3DR4 A;  1KL2 A;  2YCP A;  2NMP A;  7AAT A;  2VIA A;  3AEP A;  1W23 A;  1VJO A;  3FVU A;  3NUB A;  2VMN A;  4XK1 A;  3AOV A;  4ADC A;  4CBR A;  4OMA A;  1CJ0 A;  1I29 A;  4KYO A;  4WLJ A;  3ELE A;  1AKB A;  4GSA A;  3VP6 A;  2GB3 A;  4P3M A;  2JGT A;  3LVM A;  4F5K A;  8AAT A;  4AO4 A;  2R2N A;  4LW2 A;  3B1C A;  2BIG A;  1IAY A;  1G7W A;  1YOO A;  2PB2 A;  3P1T A;  2YKV A;  4R2N A;  4Y0D A;  1DJE A;  1MDX A;  2BHX A;  3K40 A;  3EI6 A;  4ISY A;  4TMR A;  1O62 A;  2WB6 A;  3PGY A;  1B9H A;  5EIG B;  2WK8 A;  1D7U A;  3NRA A;  4W91 A;  1V2F A;  4ZAH A;  4TV7 A;  3N7N A;  1LKC A;  4WLH A;  2FQ6 A;  3HMU A;  1OHW A;  3P6K A;  3PJ0 A;  3VK3 A;  4CVQ A;  1ARH A;  1ASM A;  4MQQ A;  2ZY5 A;  1GEX A;  4LC3 A;  3RQ1 A;  2YKY A;  3TAT A;  1YJZ A;  4NOG A;  1AJS B;  2FN6 A;  4DBC A;  2DKJ A;  3PAA A;  4AZK A;  4IXZ A;  5HXX A;  1H1C A;  2BIA A;  3TFT A;  4MQR A;  4B98 A;  4K2I A;  3B1D A;  1LW4 A;  2CST A;  3RBL A;  1ASE A;  4AH3 A;  2Z67 A;  2W8W A;  4ITX A;  3ZRQ A;  1GC2 A;  1YNU A;  4JE5 D;  1B8G A;  5EUN A;  2AY2 A;  2ZUK A;  5EUD A;  1QIS A;  2VGU A;  2D65 A;  1WYU A;  1E5F A;  3ASA A;  5J8Q A;  1PMO A;  4A0F A;  1AJR A;  2W7M A;  3VOM A;  3EZS A;  4RIZ A;  4F4E A;  1QIT A;  2VMY A;  3BN1 A;  3RUY A;  1N31 A;  1OHY A;  1FG3 A;  2HOR A;  4KAM A;  3WKS A;  4RLG A;  1C9C A;  5E3K A;  2CY8 A;  2X3L A;  9AAT A;  3HVY A;  2CJD A;  2E7I A;  4BA5 A;  5BJ4 A;  1AMA A;  3G8M A;  2BI3 A;  1S09 A;  2AEU A;  2V1P A;  1GBN A;  2VGS A;  1FC4 A;  2QLR A;  4R5Z A;  3R9A A;  2ZY2 A;  1MAP A;  2YRR A;  2JIS A;  2AY1 A;  4ADD A;  2FYF A;  1J04 A;  3EZ1 A;  4N0W A;  1BJW A;  2WK7 A;  2W7I A;  2OGA A;  3I16 A;  1B4X A;  2CTZ A;  1GD9 A;  2DKB A;  1WYT B;  3MC6 C;  3PDB A;  4WYF A;  1GEY A;  4A0G A;  3RBF A;  3VK4 A;  2PB0 A;  3BWN A;  2FKI A;  1I48 A;  3LWS A;  1AY4 A;  2FNU A;  1D7R A;  2HP2 A;  2W8U A;  1WYV B;  1DTY A;  1AMS A;  1W7M A;  3EI5 A;  3MKJ A;  5HDM A;  4W1W A;  4IYO A;  4ADE A;  2OKK A;  3G0T A;  3R4T A;  2YKX A;  3AEM A;  5K8B A;  4E77 A;  4E3Q A;  3AEL A;  1I41 A;  1W7L A;  1V2E A;  2DGK A;  3EI7 A;  1C7O A;  3JWB A;  4M2J A;  5DB5 A;  3GBX A;  1C4K A;  1DFO A;  1UKJ A;  2QBT A;  4Q6R A;  2G6W A;  1UU0 A;  1BJO A;  2EGY A;  3ACZ A;  4EMY A;  1IJI A;  1LC5 A;  5G2P A;  2W7D A;  4OBU A;  3DOD A;  1WST A;  3I4J A;  2YCN A;  1ZOB A;  2JJH A;  2CIN A;  2VIB A;  3DYD A;  2ZY4 A;  4RIT A;  2X5D A;  3JW9 A;  3LV2 A;  2E7J A;  2VMO A;  1TOK A;  2CAN A;  3RI6 A;  2Q7W A;  3F0H A;  4XJM A;  5FT4 A;  1VP4 A;  3LVJ A;  1B5O A;  1IBJ A;  4Y0H A;  1M4N A;  4H51 A;  1CZE A;  2BYJ A;  1GDE A;  1QZ9 A;  2PO3 A;  1KKP A;  4KXK A;  3MAD A;  2VLF A;  3DR7 A;  3N4S A;  1AY8 A;  1QJ5 A;  2D64 A;  3KKI A;  5F8V A;  2O0R A;  2VGV A;  2JJF A;  4E1O A;  1LS3 A;  4UHM A;  1CZC A;  3NNK A;  1IVR A;  1AAM A;  1CQ8 A;  3ECD A;  2X5F A;  4GE4 A;  5FT6 A;  5TF5 A;  3G7Q A;  3EIB A;  1O69 A;  1BJ4 A;  3AEN A;  5G0A A;  2AY9 A;  2EZ2 A;  3E2Z B;  3AAT A;  3N0L A;  2G7J A;  2Z1Z A;  1AHE A;  2DR1 A;  2BI5 A;  4TN4 A;  1LC8 A;  2R0T A;  1MAQ A;  3MAF A;  1KMJ A;  3OKS A;  2D61 A;  4AOA A;  1LK9 A;  2VMW A;  1O4S A;  1TOI A;  4IXS A;  2XH1 A;  1TOG A;  3GJU A;  3N5M A;  3GZC A;  4W1X A;  4UOY A;  2AY4 A;  2CJG A;  2VGW A;  2W7K A;  1BQD A;  4JF0 A;  4OT8 A;  2CJH A;  1W3U A;  3DXW A;  2BI9 A;  3JZL A;  1TAR A;  2JJE A;  2OGE A;  2QB2 A;  3W1J A;  1Z7D A;  2ZY3 A;  3HBX A;  3JWA A;  4RAE A;  3RCH A;  4GRX A;  2ZJG A;  1ARI A;  4JEX A;  3T32 A;  4F5H A;  3E9K A;  5M4D A;  1S06 A;  1AX4 A;  2D63 A;  3GSB A;  2VI9 A;  2JG2 A;  2GSA A;  4XEW A;  3JTX A;  3FD0 A;  1AHX A;  1AKC A;  3COG A;  4GE7 A;  3VK2 A;  4A0H A;  1H0C A;  3L8A A;  4HF8 A;  2ZC0 A;  4PVF A;  4Y0I A;  2FNI A;  4XJO A;  1TOE A;  5F9S A;  4N0B A;  1SPA A;  4GDY A;  2CFB A;  2W8J A;  2E7U A;  2O7C A;  1X28 A;  2ZSM A;  2D5Y A;  1MDO A;  3MEB A;  3QM2 A;  4I8A A;  3CQ6 A;  4OYT A;  4JEV A;  1AMQ A;  5M4B A;  5AX8 A;  4PFF A; 
#chains in the Genus database with same CATH homology
 2AY6 A;  3UWC A;  4F5L A;  2QA3 A;  3HDO A;  4Q75 A;  3FQA A;  3IF2 A;  2VMQ A;  3MBB A;  5EIG A;  4A6T A;  3FZ8 A;  3WKR A;  4EB5 A;  4F5I A;  4K05 A;  3E6G A;  1ASD A;  3HQT A;  3WGC A;  4M2M A;  3AOW A;  3NYT A;  1P3W A;  4R5F A;  4PFN A;  1WKG A;  3K28 A;  2HUU A;  3F9T A;  4OC9 A;  1M0Q A;  1Z3Z A;  3EI9 A;  1DGE A;  2OKJ A;  2R5E A;  1PG8 A;  1EJI A;  3ASB A;  1AJS A;  2C81 A;  3FDB A;  3B1E A;  4IY7 A;  3TFU A;  3M5U A;  2YRI A;  1IX7 A;  2C44 A;  4XAU A;  1AHY A;  3A8U X;  3PIU A;  1TOJ A;  3FFR A;  4O6Z A;  3DZZ A;  1G4V A;  2YKU A;  2OQX A;  3LVK A;  4WXB A;  3KGW A;  3PDB B;  4ITG A;  4AZJ A;  1QGN A;  3F6T A;  3UE8 A;  1RV3 A;  4F5F A;  3A9Z A;  1ZC9 A;  5D95 A;  4ZLV A;  1S08 A;  3FKD A;  3FVS A;  3PD6 B;  1AIB A;  3CQ4 A;  4FL0 A;  3MC6 A;  2EYQ A;  4UQV A;  4IYO B;  2BI2 A;  2BYL A;  5EFS A;  2TPL A;  2Z20 A;  3BCB A;  4A6R A;  3E2F A;  2R5C B;  3AEJ C;  4ADB A;  4DQ6 A;  4ZDP A;  3E77 A;  3NTJ A;  3N4R A;  1GC0 A;  3DRD A;  2HOZ A;  4WYD A;  3BV0 A;  3L44 A;  1J32 A;  1CQ6 A;  1G7X A;  2Z1Y A;  4MQP A;  4WXF A;  2VMR A;  1EQB A;  3AEJ A;  3EIA A;  4XJP A;  1OXP A;  4IX8 A;  3WY7 A;  1X0M A;  3WCN A;  1YJS A;  2DOU A;  5M49 A;  1WYT A;  3DXV A;  4WB0 B;  4EB7 A;  1ASF A;  5LHA A;  3B8X A;  4RKC A;  2AY5 A;  1ARG A;  3FTB A;  4JEZ A;  3HL2 A;  2VMT A;  2QB3 A;  2W7J A;  4U2H A;  2W7H A;  1GC4 A;  5I92 A;  3K7Y A;  1DKA A;  1PMM A;  4F5J A;  5DX5 A;  2Z9V A;  5E4Z A;  1PFF A;  2E54 A;  1WYV A;  2OAT A;  2X8U A;  3ZRR A;  3ZRP A;  5C6U A;  3A9X A;  3BB8 A;  3A9Y A;  3BC8 A;  2Z9U A;  3HLM A;  3WX9 A;  3ZZJ A;  3LVL B;  5JAY A;  1ASL A;  1BJN A;  2EH6 A;  4WXG A;  3W1I A;  3AEN B;  4CBS A;  5LH9 A;  1AHF A;  1TPL A;  1ASB A;  4WYE A;  3MAF B;  1ASN A;  4ZDO A;  1YIZ A;  4W1V A;  2BI1 A;  2QMA A;  3TCM A;  1D7S A;  1BKG A;  3QGU A;  4GEB A;  4BHD A;  2VMP A;  4P7Y A;  2ZP7 A;  1CL2 A;  4LNJ A;  4ZDL A;  1B9I A;  1SF2 A;  2VMV A;  3FDD A;  1C7G A;  2JJG A;  4JE5 A;  4JEY A;  2W7E A;  3BWO A;  1UU1 A;  2EPJ A;  1BW0 A;  3RCH B;  1AAW A;  4IW7 A;  1Y4I A;  3BCX A;  1GCK A;  3VAX A;  3ZZK A;  2C0R A;  3EUC A;  4ZM3 A;  4F5G A;  1MLZ A;  1TAS A;  3CBF A;  1KMK A;  3EI8 A;  2RFV A;  5DJ9 A;  4U1T A;  2VMX A;  2BKW A;  3E2Z A;  3KE3 A;  4MSO A;  1YJY A;  4J5U A;  2ZYJ A;  2VLH A;  4M2K A;  1V72 A;  3II0 A;  3NUI A;  2BWO A;  4K2B A;  2A1V A;  2AY7 A;  2YCT A;  2F8J A;  2D7Z A;  3FRK A;  3GR9 A;  3TQX A;  1CQ7 A;  4AO9 A;  1M0O A;  1XI9 A;  4LNM A;  1N8P A;  1E5E A;  3LY1 A;  1M0P A;  1IAX A;  1RV4 A;  4BA4 A;  1O61 A;  4W5K A;  2VGZ A;  1C0N A;  4CXQ A;  1KL1 A;  2WK9 A;  1QJ3 A;  2CB1 A;  2D66 A;  2GMU A;  3FVX A;  3FFH A;  4LW4 A;  4A72 A;  5M46 A;  3FSL A;  1ORD A;  2W7G A;  4WD2 A;  5G2Q A;  1WYU B;  2VMS A;  3H9X A;  3BCA A;  4GE9 A;  5G4J A;  1U08 A;  1XEY A;  1TAT A;  4R8D A;  4DGT A;  1OHV A;  5FT5 A;  2CH2 A;  3ISL A;  1SZS A;  4L0O A;  1JF9 A;  2YOB A;  1M6S A;  5D5S A;  1ASA A;  4MKJ A;  2BIE A;  4MKK A;  2BWP A;  2W7F A;  2DGL A;  3QI6 A;  4E3R A;  3D6K A;  1KKJ A;  1IX6 A;  1MLY A;  1IX8 A;  3FQ7 A;  4XQ2 A;  4WYA A;  2DGM A;  4JF1 A;  3QN6 A;  2VGT A;  2ORD A;  2O1B A;  2CH1 A;  4OCA A;  5EAV A;  4RJY A;  4RJ0 A;  1IUG A;  3H14 A;  1BS0 A;  2D7Y A;  2HP1 A;  4ZWV A;  2EZ1 A;  2HOX A;  1G4X A;  2YHK A;  2Z61 A;  4EU1 A;  4XJL A;  2HZP A;  3MAU A;  1JS6 A;  4FFC A;  4K2M A;  2AAT A;  4WBT A;  1B5P A;  4BQ0 A;  4A00 A;  3I5T A;  1CS1 A;  1AMR A;  1JG8 A;  1S0A A;  3H7F A;  4WYG A;  2VI8 A;  3N4X A;  1BQA A;  3GWP A;  4H63 Q;  5KTB A;  2FM1 A;  3Q8N A;  1LC7 A;  1V2D A;  2W8V A;  3B46 A;  5G09 A;  3QBO A;  3WZF A;  4J8L A;  4ZAS A;  2W8T A;  3QPG A;  4OBV A;  3JU7 A;  4MY5 A;  4B9B A;  1SZU A;  1X2A A;  1S07 A;  4EFF A;  4JEW A;  5FT8 A;  3GET A;  1DJ9 A;  3QHX A;  4ATQ A;  3ELP A;  1YIY A;  3AV7 A;  3WGB A;  4ZM4 A;  1ART A;  1JS3 A;  2WKA A;  3OP7 A;  3A2B A;  2ZSL A;  1C7N A;  3BWN C;  1BJO B;  5G4I A;  3NDN A;  1BT4 A;  3DU4 A;  3KGX A;  4UHO A;  3FZ6 A;  1MDZ A;  2BWN A;  1ASC A;  2VYC A;  3CQ5 A;  1OAT A;  1AIA A;  1AY5 A;  1CL1 A;  3GZD C;  4A6U A;  1GC3 A;  2XBN A;  1M32 A;  1MGV A;  1ARS A;  1VEF A;  4ZWM A;  3NYS A;  2W7L A;  2QSR A;  1N2T A;  3AEM C;  1SVV A;  4W8I A;  2AEV A;  3BS8 A;  3GZD A;  1DJU A;  3PD6 A;  4ZSY A;  4OTL A;  2KFP A;  1FG7 A;  4Q76 A;  4BMK A;  5EUE A;  4CXR A;  3PDX A;  1ELU A;  4IXO A;  2HUI A;  5E5I A;  3UAK A;  2AY3 A;  1AIC A;  3PPL A;  1ECX A;  5DJ1 A;  5HHY A;  1GEW A;  2R5C A;  1I43 A;  1WKH A;  1D7V A;  2GQN A;  1W7N A;  3NX3 A;  2EO5 A;  3W1H A;  5EQC A;  3ATH A;  3NU7 A;  1ASG A;  1D2F A;  3FQ8 A;  1SFF A;  1OXO A;  4LNL A;  1YAA A;  1ELQ A;  2HUF A;  3FZ7 A;  3USF A;  2AY8 A;  4WP0 A;  5IWQ A;  4UHN A;  4QGR A;  4F5M A;  4RM1 A;  3CAI A;  1M7Y A;  4MGR A;  1LW5 A;  3WCO A;  2Z9W A;  3FCR A;  1EG5 A;  1X29 A;  1QIR A;  4WB0 A;  2VMZ A;  1AHG A;  2Z9X A;  1ZOD A;  2C7T A;  1DGD A;  4ZSW A;  1AKA A;  3HT4 A;  5EAA A;  1SZK A;  1T3I A;  3DC1 A;  3AEO A;  4WYC A;  3NYU A;  4PIW A;  3IHJ A;  3E2Y A;  3NU8 A;  2GMS A;  2VMU A;  3PA9 A;  4RKD A;  2HOY A;  5BJ3 A;  3LG0 A;  1M0N A;  1UU2 A;  2V0Y A;  1RVU A;  3WLX A;  1RVY A;  4Q31 A;  4ATP A;  4HVK A;  3N75 A;  4A0R A;  3DR4 A;  1KL2 A;  2YCP A;  2NMP A;  7AAT A;  2VIA A;  3AEP A;  1W23 A;  1VJO A;  3FVU A;  3NUB A;  2VMN A;  4XK1 A;  3AOV A;  4ADC A;  4CBR A;  4OMA A;  1CJ0 A;  1I29 A;  4KYO A;  4WLJ A;  3ELE A;  1AKB A;  4GSA A;  3VP6 A;  2GB3 A;  4P3M A;  2JGT A;  3LVM A;  4F5K A;  8AAT A;  4AO4 A;  2R2N A;  4LW2 A;  3B1C A;  2BIG A;  1IAY A;  1G7W A;  1YOO A;  2PB2 A;  3P1T A;  2YKV A;  4R2N A;  4Y0D A;  1DJE A;  1MDX A;  2BHX A;  3K40 A;  3EI6 A;  4ISY A;  4TMR A;  1O62 A;  2WB6 A;  3PGY A;  1B9H A;  5EIG B;  2WK8 A;  1D7U A;  3NRA A;  4W91 A;  1V2F A;  4ZAH A;  4TV7 A;  3N7N A;  1LKC A;  4WLH A;  2FQ6 A;  3HMU A;  1OHW A;  3P6K A;  3PJ0 A;  3VK3 A;  4CVQ A;  1ARH A;  1ASM A;  4MQQ A;  2ZY5 A;  1GEX A;  4LC3 A;  3RQ1 A;  2YKY A;  3TAT A;  1YJZ A;  4NOG A;  1AJS B;  2FN6 A;  4DBC A;  2DKJ A;  3PAA A;  4AZK A;  4IXZ A;  5HXX A;  1H1C A;  2BIA A;  3TFT A;  4MQR A;  4B98 A;  4K2I A;  3B1D A;  1LW4 A;  2CST A;  3RBL A;  1ASE A;  4AH3 A;  2Z67 A;  2W8W A;  4ITX A;  3ZRQ A;  1GC2 A;  1YNU A;  4JE5 D;  1B8G A;  5EUN A;  2AY2 A;  2ZUK A;  5EUD A;  1QIS A;  2VGU A;  2D65 A;  1WYU A;  1E5F A;  3ASA A;  5J8Q A;  1PMO A;  4A0F A;  1AJR A;  2W7M A;  3VOM A;  3EZS A;  4RIZ A;  4F4E A;  1QIT A;  2VMY A;  3BN1 A;  3RUY A;  1N31 A;  1OHY A;  1FG3 A;  2HOR A;  4KAM A;  3WKS A;  4RLG A;  1C9C A;  5E3K A;  2CY8 A;  2X3L A;  9AAT A;  3HVY A;  2CJD A;  2E7I A;  4BA5 A;  5BJ4 A;  1AMA A;  3G8M A;  2BI3 A;  1S09 A;  2AEU A;  2V1P A;  1GBN A;  2VGS A;  1FC4 A;  2QLR A;  4R5Z A;  3R9A A;  2ZY2 A;  1MAP A;  2YRR A;  2JIS A;  2AY1 A;  4ADD A;  2FYF A;  1J04 A;  3EZ1 A;  4N0W A;  1BJW A;  2WK7 A;  2W7I A;  2OGA A;  3I16 A;  1B4X A;  2CTZ A;  1GD9 A;  2DKB A;  1WYT B;  3MC6 C;  3PDB A;  4WYF A;  1GEY A;  4A0G A;  3RBF A;  3VK4 A;  2PB0 A;  3BWN A;  2FKI A;  1I48 A;  3LWS A;  1AY4 A;  2FNU A;  1D7R A;  2HP2 A;  2W8U A;  1WYV B;  1DTY A;  1AMS A;  1W7M A;  3EI5 A;  3MKJ A;  5HDM A;  4W1W A;  4IYO A;  4ADE A;  2OKK A;  3G0T A;  3R4T A;  2YKX A;  3AEM A;  5K8B A;  4E77 A;  4E3Q A;  3AEL A;  1I41 A;  1W7L A;  1V2E A;  2DGK A;  3EI7 A;  1C7O A;  3JWB A;  4M2J A;  5DB5 A;  3GBX A;  1C4K A;  1DFO A;  1UKJ A;  2QBT A;  4Q6R A;  2G6W A;  1UU0 A;  1BJO A;  2EGY A;  3ACZ A;  4EMY A;  1IJI A;  1LC5 A;  5G2P A;  2W7D A;  4OBU A;  3DOD A;  1WST A;  3I4J A;  2YCN A;  1ZOB A;  2JJH A;  2CIN A;  2VIB A;  3DYD A;  2ZY4 A;  4RIT A;  2X5D A;  3JW9 A;  3LV2 A;  2E7J A;  2VMO A;  1TOK A;  2CAN A;  3RI6 A;  2Q7W A;  3F0H A;  4XJM A;  5FT4 A;  1VP4 A;  3LVJ A;  1B5O A;  1IBJ A;  4Y0H A;  1M4N A;  4H51 A;  1CZE A;  2BYJ A;  1GDE A;  1QZ9 A;  2PO3 A;  1KKP A;  4KXK A;  3MAD A;  2VLF A;  3DR7 A;  3N4S A;  1AY8 A;  1QJ5 A;  2D64 A;  3KKI A;  5F8V A;  2O0R A;  2VGV A;  2JJF A;  4E1O A;  1LS3 A;  4UHM A;  1CZC A;  3NNK A;  1IVR A;  1AAM A;  1CQ8 A;  3ECD A;  2X5F A;  4GE4 A;  5FT6 A;  5TF5 A;  3G7Q A;  3EIB A;  1O69 A;  1BJ4 A;  3AEN A;  5G0A A;  2AY9 A;  2EZ2 A;  3E2Z B;  3AAT A;  3N0L A;  2G7J A;  2Z1Z A;  1AHE A;  2DR1 A;  2BI5 A;  4TN4 A;  1LC8 A;  2R0T A;  1MAQ A;  3MAF A;  1KMJ A;  3OKS A;  2D61 A;  4AOA A;  1LK9 A;  2VMW A;  1O4S A;  1TOI A;  4IXS A;  2XH1 A;  1TOG A;  3GJU A;  3N5M A;  3GZC A;  4W1X A;  4UOY A;  2AY4 A;  2CJG A;  2VGW A;  2W7K A;  1BQD A;  4JF0 A;  4OT8 A;  2CJH A;  1W3U A;  3DXW A;  2BI9 A;  3JZL A;  1TAR A;  2JJE A;  2OGE A;  2QB2 A;  3W1J A;  1Z7D A;  2ZY3 A;  3HBX A;  3JWA A;  4RAE A;  3RCH A;  4GRX A;  2ZJG A;  1ARI A;  4JEX A;  3T32 A;  4F5H A;  3E9K A;  5M4D A;  1S06 A;  1AX4 A;  2D63 A;  3GSB A;  2VI9 A;  2JG2 A;  2GSA A;  4XEW A;  3JTX A;  3FD0 A;  1AHX A;  1AKC A;  3COG A;  4GE7 A;  3VK2 A;  4A0H A;  1H0C A;  3L8A A;  4HF8 A;  2ZC0 A;  4PVF A;  4Y0I A;  2FNI A;  4XJO A;  1TOE A;  5F9S A;  4N0B A;  1SPA A;  4GDY A;  2CFB A;  2W8J A;  2E7U A;  2O7C A;  1X28 A;  2ZSM A;  2D5Y A;  1MDO A;  3MEB A;  3QM2 A;  4I8A A;  3CQ6 A;  4OYT A;  4JEV A;  1AMQ A;  5M4B A;  5AX8 A;  4PFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...