3KKMA

Crystal structure of h-ras t35s in complex with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
155
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 155
sequence length 166
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkmA00
4UNNA 4P3YA 1D9XA 1GNRA 4UXHA 4CT4B 3RVBA 4TL6A 1YZQA 3MAAC 4PSAA 2A78A 4AYXA 1GAJA 5FPYA 4KITB 3QVVA 1NP6A 4UQOA 1G6OA 3ZS9A 2G1JA 5EE1A 2WKRA 1DG3A 4DBLC 1FZQA 1TL7C 2JATA 3U7EB 2IYZA 3QPUA 4LCBA 4M9SA 3NEJA 3MD0A 1Z0KA 5FOSA 3T61A 1HTWA 3CW2A 1XTJA 5K8LA 4EKDA 2AL7A 2RGAA 3H4MA 1RJ9B 2VP6A 2JLUA 3LBIA 4MRRA 3FPAA 4RFVA 1F2TA 4LC0A 2G0TA 4IOMA 4C0HA 4Q4AB 3TAHA 3K9GA 4KAXA 3K9HA 1JB1A 4RD2A 4DLVA 1NVXQ 3OEED 1AN0A 2WWWA 1IBRA 5JFGA 3ASYA 2A5FA 3OE7D 1Z6GA 3LAWA 3UMSA 3WNCA 1BIFA 1U8AA 2X2FA 1ZM4A 3FHCB 2O8DA 4XD7D 2IEZA 2RGBA 3EWSA 4A0RA 1Z06A 4KLNA 1NMXA 1IOZA 1UBFA 1U0LA 2QPOA 3BD9A 5EXTA 3QG5A 4C0SA 3NTUA 1H65A 3HU2A 1BYUA 4O25A 3SJCA 3KTAB 3QY0A 5L3QB 2KJQA 3ZGXA 4QGHA 5FFMA 4M9XA 2QRNA 1EFRA 3T1TA 3H1TA 1NSFA 4BECA 3GLFE 1FUKA 3WNDA 2CEAA 1LF5A 1U9IC 1ZU4A 5BWMA 1KK2A 1G17A 2AR7A 1ZUHA 3QXJA 1XJ0A 2Z43A 2ZE6A 1EX7A 3GQBA 5CB6A 5J4LA 3W5JA 2ZS7A 3FKSA 1XNJA 1KGDA 1XB2A 2QE7A 2HJVA 1NVVR 2CLCX 2JCSA 4Q4HA 4ASUD 1SXJA 2C95A 1IQPA 2R6GA 2B8TA 4XVUA 3OAAA 1A4RA 2FSHA 3BRWD 4OHZA 3W6OA 4ZDKA 5CJPA 2Z83A 1KDPA 2CE2X 4C7OB 1CRQA 1M6NA 1NLFA 3LX5A 2FFAA 2ZSBA 4N0EA 4PXAA 3VU9A 5LDDC 3GLIA 2WWHA 5EXPA 3A4MA 2F7SA 1RVDA 1FP7A 2Z0MA 2ZS8A 4WXPA 2GEDA 2V6IA 4Q4JA 3KQUA 3QIAA 2H57A 3QEOA 3V9PA 4B6FA 2H16A 1W47A 3LLMA 4PQRA 1CR2A 4H1VA 4NZYA 2EFGA 4K46A 3LQRA 4RZUA 1IXRC 2WOJA 4NCKA 5TV2A 1HV8A 1XCPA 2QP4A 3MMPA 1P6XA 2CK3A 2IT1A 2NO7A 2P3SA 3LLUA 3GFPA 1KAGA 4AG5A 2KB0A 2WTUA 4LHVA 4FCVA 4P31A 5SZHB 1SKYE 4HLDA 1S3GA 1XEFA 4C9BA 3LX8A 1XCGB 3SBEA 5DHFA 3CPJB 3A1TA 3KFVA 2EFHB 3NHAA 1KI1A 1RRGA 4BASA 4YMUA 4JLAA 3IBGA 3VR1A 4MKIA 2PH1A 3RNLA 3SYKA 4GMXA 5EP4A 5C4GB 1E1QA 4EPVA 1S1MA 4TYWA 2ORVA 1G19A 1DAFA 3V00A 4Q18A 4BFYA 1DBSA 1LNZA 2P6UA 2GJKA 2YV5A 3OHMA 4LI0A 5AJZA 4QGFA 2CCJA 2JA1A 2ZI9A 1L7VC 3FB4A 4L5BA 2XEXA 4Q47A 1GRNA 3N2IA 5IDVA 1DPFA 1HURA 6Q21A 4BRWA 2QT1A 1NF3A 1SVOA 1IONA 3ETLA 1Q57A 1TQ4A 2RH5A 2C99A 1QHNA 2QMEA 4NU0A 4P32A 1G3RA 1IM2A 2IHYA 5JRJA 3U6KA 3BB3A 1E4VA 2BHRA 3GLHA 1OH8A 5JBQA 1XD2A 4V03A 2H18A 2JJ1D 3VR2A 4TMKA 4X8OA 1OT3A 4JLVA 4WZAE 4DWJA 2VA8A 4L4UA 4UJ5A 3KQHA 3GEHA 5D3MB 3SFVA 4AYTA 3SFZA 2BJWA 1XPUA 4BFZA 2AXNA 2QL6A 5LB4A 3CWZA 3BH6A 4DJTA 4PQYA 1HE8B 3P32A 3GEIA 4ERNA 4D25A 1DO2A 4G3XA 1XRJA 4NYJR 4QRHA 1IY2A 3AB3A 2JIZA 3R9WA 1ONBA 2F1RA 1LF0A 2GDJA 4FXPA 1YKSA 5FL7A 2AFHE 1QF9A 1ZRHA 3OZXA 2O8CB 4OK5A 1G1MA 1XTIA 2V54A 3HP1A 5HCIA 1RYHA 2OFOA 1BO6A 1K5GA 3PITA 3EPLA 2IUUA 5J4YA 3RANA 4A6PA 1V43A 3CF6R 5EP3A 3EPJA 1RZ3A 2ZEJA 3NHBA 4TTPA 2PX0A 2ZRIA 3P27A 2DWPA 4L15A 3BAFA 1T5IA 3LY5A 4LPSA 4OHXA 4OHYA 2BEKA 2V9PA 5DYGA 3TMKA 5C1BA 4DLZA 3L0SA 3RSOA 3QUSA 3C7KA 4H1UA 2UVQA 3TR0A 4BFXA 4JVSB 4B2LA 3TUZC 1UDWA 3IEUA 3V4RA 2WBLC 4LGMA 1PVOA 4M0LA 1MABB 4KXFB 1J90A 3W6NA 1FQJA 5JRZA 2ZRHA 3IKJA 3P20A 3PEWA 3C14C 2XITA 3N5CA 1Z2CA 4PSVA 2OBMA 1SULA 5AJXA 2IX3A 2F3RA 2W2VA 4NL4H 1E9EA 3FTQA 3UMRA 4WZ6A 4BFUA 3CF2A 1NN1A 1QHSA 2IXEA 2GJ9A 3VQTA 5EXSA 1OB5A 4I1VA 4KO8A 3EX7C 4DSUA 1VCOA 1UKZA 1E32A 2ZYWX 3KDSE 1TTTA 1SKQA 2GAOA 3LRPA 2J1LA 2QT0A 4GRAA 3TAUA 5KU1A 2F6RA 1TQ6A 2FSGA 4JLMA 3RRMA 4V0MA 3NG1A 4IEIA 3LV8A 4FMCF 3U7FB 4JKIA 4BLQA 4EFMA 5E4FA 4A82A 2AKAB 4BLTA 1NJGA 1SXJC 1E6CA 4P0TA 2GF0A 3V4FA 5TMPA 2IS4A 1EFHA 1CLUA 4JLPA 2FU5C 5EP2A 2ZI7A 2RCNA 3HR7A 1W36C 3O47A 1AGRA 4IOLA 4BLPA 4EDHA 1US8B 1P2TA 2ZJZA 1MRNA 3KZ1E 2XB4A 3T5GA 3SYNA 1NBME 3FGNA 2RMKA 1Z83A 2CCGA 2IXFA 2NOAA 2CMKA 1KSHA 2N42A 4MGIR 3TUIC 2J7KA 2VP0A 3QQ5A 2KI5A 5FOWA 1XF9A 2YZ2A 3PEYA 4UNPA 2GWHA 3A1UA 4OI1A 3KUDA 1UF9A 2ZROA 4Z8XA 1KI6A 5DNYB 4BLRA 2YOGA 2HCBA 4RKFA 3PG5A 3K0CC 3H0KA 4W9MC 2QM7A 5A4JA 3OIUA 2J59A 3MJRA 1EX6A 5JZVA 1JAIA 1YR8A 1NKSA 4JLJA 4QFMA 3RRYA 4B33A 2AHOA 1KSJA 1P2UA 5DLQC 2ASEA 3G5UA 4M8NE 4YLGA 3IIMA 3FKQA 1R0WA 4EPWA 2VF7A 1E99A 2ZYVX 3RS5A 2O8BA 2FMXA 2BBSA 5AJVB 3U44A 3IEVA 1E2NA 2R6AA 3GJ4A 2R6FA 2PT7A 1KI4A 3CWQA 1XJCA 1QHXA 4DSOA 4A0FA 4KSCA 3A6PC 2DPXA 2YYZA 4EAQA 1Y63A 1S1CA 4LJ4A 3LXRA 2ZI3A 2WWYA 3PR1A 1QVRA 1XEWX 4DEYA 1AZSC 3LNCA 2ZS9A 1GILA 2R6CA 2CNWD 3TUJC 1NN5A 1RYFA 4AURA 3TKLA 1JEDA 3KKQA 4YONB 1QVAA 1F6BA 4AC9A 4HLQB 2GKSA 1DTSA 2A5YB 2IS1A 2YJTD 3L0PA 1W4AA 2ZR0A 1NKTA 4NBSA 2O0JA 3CX7A 3GD7A 3SR0A 5JCPA 1HA3A 1F48A 2FGKA 2R62A 1W5TA 3SN6A 4GZMA 3CH5A 5JLJA 5KDDA 3ZIAA 4TSFA 3LXXA 1N5KA 4L8GA 2W6JD 5HZKA 2JEOA 1DAEA 1EFTA 4GP6A 3QXHA 3CNLA 5D3MA 4ABYA 2ZM5A 1E0JA 5J5CA 4HZIA 3W8RA 3KJGA 5FBWB 5JHGB 4FMDF 2PBRA 3LVRE 1Z2AA 1ELOA 4RCYA 5L3VA 4WVFA 1DO0A 3G0HA 4PPQA 3LWNA 1X6VA 2QENA 5IF9A 3R7WB 4OQXA 2W6ID 3Q5EA 4HYYA 2CJWB 1M74A 3NKVA 4NYMR 2VYFA 3AF4A 5IK2A 1Q20A 2OZEA 2IXGA 4TLBA 1BS1A 1XXHB 3HR8A 2DB3A 2PEZA 1AK2A 4GSYA 3K0FB 4HAXA 4CEHB 2QU8A 4IDHA 4LZZA 1E9CA 3VHLB 2O0KA 3GJ0A 2IYRA 1WE2A 2HF8A 4JS0A 5LD2C 3MWLA 4XIGS 4TL8A 2V1UA 1S96A 3R9XA 4ACAA 3NBXX 5TARA 2Q9CA 4TT3D 2VSXA 1M2OB 3ZS8A 1XMVA 3VR3A 1JECA 2XZOA 3KQLA 3Q7PA 1KZGB 2XSZD 1OV4A 1P2SA 3BS4A 1Z22A 4JT2A 4URZR 1DEKA 2OCYC 4PHGA 2E87A 4AIIA 2VHQA 1ESNA 4DCSA 1GG2A 1VG1A 3IILA 1CRPA 1SHZA 1R8SA 4QGAA 3LBNA 1KKLA 1UJ2A 3B6EA 3TQCA 5BN3A 3BC1A 2CDNA 1F2TB 1NNEA 1UM8A 4BLOA 4TMZA 1OW3B 1ZM9A 3I5YA 2IYLD 3FHOA 2CLSA 1P73A 1SVLA 3X2SA 2F9LA 2ZE8A 5DHAA 2MMCA 2IYUA 2RGDA 3I4LA 3H86A 4WBSA 2OUKA 3WXMA 1FP6A 4ZCMA 3L8ZA 2O8DB 4Q1BA 3RRZA 4CEJA 2FA9A 2AWNA 2DFLA 1QDEA 1XJQA 1UKYA 2YOHA 5GJBA 5TVKA 4M1TA 4W5HA 4Q1DA 4PX9A 2VH5R 1OPXA 1Q0UA 3NBZC 4MRVA 3B1XA 4RKEA 2UZ3A 2AWOA 2OFWA 3Q8XB 1RPZA 4PC3A 1MH1A 1NBMA 3AF1A 2BCGY 1KIMA 4KHZA 2CHGA 3QOFA 3C15C 1L4YA 4KYUA 1IJEA 2ZVPX 4BFWA 4ZV4A 3HDTA 2BM0A 3SOPA 2PCJA 4GOJA 5EXXA 1W1WA 4LV8B 5FTNA 2FPMA 2IYVA 1N2CE 3CF0A 1I4DD 1X8JA 5DI9A 5LB2A 1KO5A 2WICA 5CLLA 4JYBA 4Y0AA 4C0JA 3W34A 4A36A 1WF3A 2WKPA 5SZKB 3U6BA 4Q4HB 4F92B 1SXJB 4MYCA 3LQQA 1XMIA 1CTQA 1X1SA 2VLIA 1W36B 4AG6A 1ZYUA 5C2JB 1OFHA 2F1JA 3KXIA 1E2KA 3VU9B 3GLIB 3IPYA 2EFCB 4OI2A 2CHVA 3UXMA 5JS7A 5C18A 3A1SA 4PO8A 4UXIA 4Q4JB 5KSPA 2GA8A 2QQ0A 1E2EA 1JAHA 2V4ZA 4URYR 5HKKD 5DN6A 1PV4A 1YZUA 1QHYA 4G5SA 3GJ5A 3MWKA 4KFUA 3ND8A 1E0KA 4CZ2A 2CCKA 2C77A 1P7CA 4Q1FA 1T4GA 1GITA 3QF4A 3WYGA 1W0KA 1A1VA 1E2JA 5JS8A 3J81k 1YRBA 4MKHA 4UXJA 4AK9A 2FF7A 4PHFA 4QJ4A 5TY0A 2CL6X 3EAQA 3VAAA 2ODBA 5HTKA 3ZVNA 2BOVA 2ZRLA 2GXAA 2J0UB 3K70C 4LJ6A 3EXAA 4Q1CA 1AS3A 3CX6A 3FMFA 3OFND 5G3ZA 4JJKA 4NYIQ 3PENA 5E7IA 1ZD1A 3OEHA 4B47A 4US0R 4JVLA 2WM9B 1WBBA 1F2UB 4B48A 2ORWA 3QXCA 3A36A 1Z0FA 2DBYA 2XJ4A 4IVQA 3TVDA 5H8WA 3RYTC 2VHUA 1KI2A 4DT1A 3CNNA 2RGNA 1KK1A 3X1WA 5F3WB 2MSEB 2FGJA 4KV9A 1GUAA 4PZYA 3P4XA 2OXCA 1KO1A 2G6BA 3MJHA 2WKQA 2ZSAA 3GJ8A 5E7JA 3F0TA 5GJCA 2V3CC 4DDWA 1FOEB 3I92A 3VFDA 1DAKA 4F38A 3GLHB 1L8QA 1XD2B 1GIAA 1Q44A 2GVDC 4S35A 1N0WA 1PLLA 2OSBA 1P62B 1R6BX 3EC1A 5EE9A 2NO1A 1G4UR 1N5IA 4A8JA 1NN3A 1ZD8A 2JJ8A 3DKVA 3ND9A 4PPNA 1DAMA 4RD3A 2RGGA 4D2IA 2X19A 1Q1ZA 3R7WA 2YC4C 2HV8A 2ANCA 2TMKA 2IYTA 5KPDA 1ZM2A 3AKEA 4HAVA 3MGCA 3I62A 4BZXA 2AXPA 3K0FA 4CEHA 2QGNA 4JLNA 1IXSB 1AS0A 5CJ2A 4BFTA 5CIWA 3EA0A 4G0NA 3VR4A 2QA5A 2O0HA 3BGWA 4DSTA 4HB0A 4OKSA 2BVNA 4RD0A 1L4UA 3B8HA 2ZRBA 1D2EA 1JXMA 4GFDA 2HLDD 1UKVY 2J3EA 1E98A 2E9SA 5DGXA 2IF2A 4AI6A 4EPRA 5H70A 5EJEA 1UPTA 4I1SA 5F98A 1PUIA 2HJGA 1QG4A 1J2JA 3HYRA 4LX0A 4PC1A 5K8IA 4K81B 1CP2A 4W5WA 3EWAA 4OQLA 4M21A 1HT1E 2KBFA 1E2IA 1D2MA 2GAAA 1N6HA 1BH2A 5FBRB 2GCOA 1WP9A 3DEFA 1FW6A 2ZRCA 3AVTA 5GADl 1U98A 5LD2B 3NDPA 4GBMA 1QRAA 5D3QA 2NZ8A 1RFLA 5FR2A 2EW1A 4KFTA 2X2EA 4EUNA 3CONA 4HDCA 3AF2A 3U3MA 4C2TA 2BDTA 4A2WA 1YJ5A 5FTKA 2ODWA 3GMTA 3IIJA 2KBEA 4RZXA 1W7AA 1T9HA 2GRJA 1GL9B 1L2TA 3VMFA 1H8HA 1UEJA 4B73A 4A1FA 1UBCA 1DS6A 2H5EA 1E69A 5EE5B 1WQ1R 2GETA 1H8EA 2VBCA 4D80A 2QAGC 3KL4A 2QMUA 2IHBA 1W0JD 5KYKA 3THWA 2H17A 3G82C 4B76A 1E9FA 3EA5A 4CYMA 4MRNA 2WPDD 2BV3A 1O3YA 4ZDWA 2PZGA 4TZ6A 3WBKA 4WW0A 2REXB 1ZBDA 3CPEA 3LW8A 3R20A 3DMNA 3EPKA 4FIDA 2W0SA 4S2EA 3NH9A 4ZI3A 1KSGA 1I4LD 1VMAA 3IIKA 3NEYA 3RWOA 3ZLJA 4TMWA 2IL1A 3SJZA 3W3ZB 4HAYA 2RB4A 1RKBA 3B2EA 4MUAA 2ZRMA 1NIJA 2A5GA 4EQ6A 1GNPA 1TEVA 2KSQA 4Q00A 5AJYA 4FCTA 3THXB 1PJRA 4G5GA 1YZKA 2J41A 4GOKA 1KI6B 2ZREA 2ZJBA 2B8WA 4E22A 1FMJA 5B2ZA 4BRUA 4YMVA 4B44A 2VSFA 2AKYA 2J0VA 1T8UA 621PA 1TUEA 5EUMA 4MA4A 2XB2A 3O8RA 1G291 3AF0A 1MO4A 1CJVC 2C9OA 4NCHA 5AUPB 3UKDA 3ICEA 2IC5A 4QHTA 2EU8A 4GZLA 3ICQB 1SKYB 2ZRGA 2C8VA 3RC3A 4BUJA 2X77A 3LDAA 1T3HA 4K8OA 1KK3A 2ZRAA 1GKUB 1MO5A 1JXOA 2C98A 3K0CA 4ZPXA 1YR9A 1HT2E 4I81A 3C16C 4B71A 4E03A 3FHTA 3I3SR 3FFBA 2J0SA 3VNUA 2O8BB 4PAQA 5BYKA 2G3YA 2PZEA 3U44B 5DH9A 3K1JA 1K5DA 3WHLA 3SEAA 1NRJB 2XOKD 2OE2A 4Q9JA 4EPXA 2WZQA 3SDZA 2RGNC 2J0UA 1II0A 3RS2A 2CE7A 2IYYA 4I99A 5CYPA 3VX3A 1R0XA 3SBDA 2BEJA 2OAQ1 4IRUB 3RWMB 3QI2A 2HUPA 2N46A 2QPTA 2HYDA 1F2UA 4Q19A 5M04A 4XWKA 4PC2A 3KXKA 5FOVA 3OEEA 1WDTA 5F2EA 4M1MA 1NL3A 2WJJA 2GCNA 5FTMA 1S2MA 1P75A 3OE7A 4XVQA 3D8BA 2B6HA 1GSIA 2HEIA 4A8JC 2IS2A 2Q3MA 3IPXA 4XD7A 4A4DA 4TL7A 2VP9A 4XSHA 4JYCA 2BWJA 1GL6A 2LKCA 3K70B 3A1VA 4DLYA 2AD1A 4NKRA 2FSFA 3QXXA 3HPQA 4QL3A 3OIYA 2C96A 5IT5A 2YNMA 1AIPA 5BYJA 3SQXA 1HQCA 2REBA 3B9PA 1I4TD 3KB2A 1E2HA 1G8YA 1G7SA 4HDQB 4UNQA 4Q03A 1OIVA 2DFTA 2WWGA 3A1WA 3L8YA 1AS2A 1N6RA 2JDID 1KDRA 1ZAKA 3EZ9A 1G8GA 2UZIR 3Q5DA 3EARA 4KLZA 2QEQA 3OIWA 4LBVA 3T12A 1LB1B 3AM1A 4IJMA 2KE5A 3ADDA 2ZITA 1TAGA 4R2HA 5DE3A 2N1BA 2J9RA 4M2LA 1AZTA 3BH0A 4LSGA 1N25A 4MGYR 2ZUDA 2IYXA 1KZ7B 2ZI4A 5BXQC 2V7QD 2QQEA 4I1OA 4C3ZA 2C5LA 4ASUA 1MT0A 2G0NA 2FX3A 5IRCD 1Z5ZA 4POAA 1D9ZA 3QEJA 3AP3A 3N2EA 4PO9A 4AY2A 1X86B 2GF9A 1U90A 4DDVA 3MWJA 3EG5A 1OIXA 2GJAA 1UEIA 4IFBA 5EE0A 3IDQA 1HH4A 4JL5A 1ZUIA 3CRQA 2R44A 2WSSD 1SVIA 4DIDA 2GCPA 3I1FA 1G41A 1A82A 4AYWA 2AD5A 3W9YA 4G5OA 2EVWX 1NVVQ 1U8ZA 1JR6A 4OHWA 3BFXA 1Z6TA 2PX3A 5K8UA 5FUWA 2RGXA 1KMQA 421PA 1E0SA 1OXVA 1VDZA 1Z47A 1AGPA 1XFAA 4MGKR 5JHHB 5AK0A 1AQYA 3KKOA 4DUGD 2QNRA 3UANA 4I1UA 3I5XA 4FWTA 4LC1A 4HEJA 1TUIA 2BBTA 4CRWB 4TN1A 1JPNA 2Z5FA 2VO1A 5KNCA 1XX6A 3QKSB 1Z0AA 3TRFA 1YVDA 4IDNA 1CKEA 5HR5A 4U5XA 2WIAA 3U7HB 3T1QA 2A5DA 4DLUA 4P4UA 1D5CA 3BE4A 3CB4A 3O8BA 1E79D 1ZUNB 4LHZA 4OJKA 3A4NA 4TLAA 4X8MA 3TW8B 3WYFA 5H68A 3GLFA 3A8TA 2J87A 4CEJB 3D3QA 2F1HA 2VHJA 3U2QA 4JBYA 3C41J 2A7QA 3O8CA 3PJRA 1YZTA 1RE0A 3AKCA 2XNSA 3PFIA 4M9QA 2DFNA 1W4BA 3NWJA 2NMVA 1IY0A 1VKJA 1X8LA 1ZNZA 5ELXA 3L2OB 3B82A 4YDSA 1G20E 1UBGA 1Y3AA 1COWD 2OCAA 4CVNA 3CZQA 5FH9A 2R65A 4EJSA 4GNKA 3UWOA 2JJ1A 2VEDA 3JZMA 1I2MA 1T91A 2BC9A 1UADA 1J8YF 3F8TA 4BE7B 2Q21A 1XTRA 3BERA 4D0LB 1ANKA 3GLGE 4KODA 4X8LA 2IK8A 1E96A 2QORA 4OJQA 1HQYE 5E7MA 2AX4A 2QAGB 3AP1A 2OO7A 5FPSA 2J7PD 3IBYA 121PA 4PQFA 4RY2A 1GM5A 1ZJ6A 1FUUA 3THXA 2ECKA 1TMKA 1IN8A 1SVMA 3N70A 4URVR 4B3XA 2OILA 2Z6VA 1JQJC 4LUCA 4MITA 3T06B 3SQWA 4P33A 4DRZA 1GKIA 3PUWA 4TQUS 4Q01A 3B7GA 1KYIA 2BMJA 1G21E 4PPGA 1PUJA 2FEOA 3L43A 2W00A 4LJ7A 3SU8A 4M1SA 3EZ2A 3ZD7A 2ERXA 4ILEA 4V02A 3CUEF 3MWYW 2OAP1 3H2YA 3NDBB 1VG9B 2JLZA 1N6KA 4WZBE 2BMEA 1DG1G 2D2EA 3PIRA 1HYQA 4FMBB 5BQ5A 4CIDA 1OKKD 1WXQA 1QHHA 5FTLA 3AEZA 5J40A 5KNBA 1OF1A 5FPHA 4L16A 4IXMA 4NYJQ 4KFSA 1Q1QA 2YWFA 2RHMA 1OSNA 2GILA 4QBGB 2AK2A 2AFIE 2XTMA 5J4HA 3QF4B 5B58C 3T15A 1DAGA 4BGDA 2HF9A 1KDTA 1SVKA 3ADCA 1G6HA 1WRBA 3ONWA 1BMFD 4W5JA 4HB2A 3GJ7A 3LA6A 1Q3HA 4OQMA 3PVSA 4MRSA 4AKIA 2J46A 3WY9A 3TBKA 4URWR 3W90A 3Q7QA 3DZDA 4E07A 5JSZA 2C9YA 2IYWA 3KFXA 4JLBA 2RAPA 2C2HA 5JWOA 2DWQA 2VPPA 1W2GA 4QC2A 3CR7A 1CR1A 1FNMA 2ODEA 2QGZA 3KQKA 4PHHA 2NO9A 2PMKA 1UBEA 4XH9B 4DT1B 4XVRA 1KJYA 1VCNA 2WJHA 4DDUA 1KI8A 2GNOA 5FPKA 1MKYA 1G8FA 3E1SA 4PR0A 5EE3A 1YZGA 2ATXA 3L0IB 4NCNA 1YZNA 3BFKA 4EIWA 4NE2A 1R2QA 3VX4A 2ZR9A 2K5UA 4YXWD 2I1VB 1N6IA 4QM7A 1JR3D 4Q1AA 1N0VC 4WOPA 4A0HA 2NGRA 3PUVA 4Q4LA 1GNQA 1XPOA 4JT4A 5L3SA 1JPJA 4G1UC 1ZC3A 1EG7A 1QHIA 2Q6TA 3I8XA 5BW8A 2ZYUX 4A8JB 3BH7A 3KKPA 2D62A 4V0LA 4LHYA 1SVSA 3UG6A 1ZU5A 3QG1A 1RRFA 5FBVB 4ESVA 2X1VA 3WMFA 1W48A 2LCFA 2YVUA 3WP0A 2ZVQX 3LVQE 1SZPA 2ZETA 4IKEA 2ZSDA 4IDPA 1KI7A 2WJYA 2VRWA 1VTKA 4LDJA 4JBWA 1M1YE 1QBKC 2ZRJA 5CDFE 3KXLA 5H1YA 2F43A 1VYTA 3QNUA 2ONKA 4KCGA 4NP6A 1CJMA 3T5DA 4AKEA 1GZSA 1OXTA 3B9QA 4M1YA 4Q7LA 3SC3A 3K0SA 3B1ZA 4C0QC 5FUYA 4GP7A 3LBHA 4HAWA 4JSYA 5HPYB 1Z28A 2PLRA 1SVWA 2ZANA 3AQ4A 1ZM3A 2BMDA 5AUNB 3U4QA 4MYUA 2R2AA 2ZQ5A 5B30A 1CS4C 4FW9A 2ANBA 1P3JA 2ZUCA 1XXHE 5KSYA 1KMHB 3U3JA 2GCOB 1NY6A 2P65A 4TLEA 2J45A 4ZKEA 4LV5B 1G5TA 4JZKA 1D2NA 1W46A 5L3RA 4NCJA 4EFLA 1TF2A 1XEWY 2GTPA 4G01B 3VNVA 4JLOA 2D74A 4ZCLA 4F7WA 5HCNA 2XJ9A 4LBYA 4CT5A 3QKSA 3SE0A 2VL7A 4A92A 2OLKA 4PFSA 1XWIA 3X1YA 5TB5A 2Q9AA 1GRQA 5DSZA 3KJEA 5GJWC 5BN5A 2CNWA 3W6PA 2SHKA 1DOAA 1R8QA 3CLVA 4JMPA 4EJSC 3ASZA 1W4RA 1GFIA 1CJTC 2D7DA 4TL9A 4V0NA 4ESHA 4QXAA 5CK4A 1M8PA 4LK2A 5KHOC 3ZQ6A 4MDFA 5EUQB 3RDPA 3CRMA 1BYIA 5B64A 1NY5A 1D8TA 3T1VA 1J7KA 1RW4A 4LHXA 3RS3A 4Z1MD 1JALA 2GEUA 3Q72A 3THWB 4PZZA 1JQLB 1E0AA 4LRWA 1E94E 5FOTA 4N1AA 2W6JA 4TTRA 5JJKA 4RD6A 1W5SA 1ZNYA 3TSWA 3GP8A 1NG9A 2OG2A 4RFSA 1DAHA 2QAGA 4JL8A 1YHNA 2FEMA 2ZRKA 3CIOA 4QHYA 4IVPA 1EESA 5DISB 5DI3A 2WJGA 2RKOA 5KUTA 4B6EA 4BZPA 2JASA 1E1RD 4V0KA 2F9MA 4HLCA 2PJZA 2WVJA 2ZRPA 3X1DA 1DAIA 2W6IA 2PL3A 2XNDD 3IQWA 2JJ2D 4EPTA 3M0EA 2P6RA 4EQ6B 4XTRA 1PLJA 1EWQA 1ZCBA 3H84A 1F5NA 1CR0A 4XWAA 4BEJA 5EZ5A 2F1IA 4MUBA 3S1AA 1TF5A 1T8TA 5JWHA 2D2FA 1P72A 521PA 2ZRFA 5FBLB 3WMEA 3K09A 4I4LA 3ZVRA 4ZI2A 5JWRA 4IDOA 4LY6A 4M53A 1II9A 3SI7A 4D81A 1J70A 3WYAA 4TT3A 2FSIA 1Z29A 4MKFA 1G3MA 2G88A 4WA7A 4LWZA 3SJAA 3M4YA 1OYYA 4QJ3A 2MSCB 3LO5A 5CM9C 3ZZ0A 1EFUA 5ANRB 2HCJB 2IEYA 4NYMQ 2YWGA 2ZSEA 2J5XA 3BORA 2XSZA 3U61B 1P60A 1TPZA 1KNQA 1Z3IX 2A5JA 2OLJA 4DCTA 2BKUA 1E3MA 1FFHA 2DHRA 2IYSA 3Q85A 3GLIE 2OV2A 5LPNA 2G1KA 2FOLA 4AD8A 4FWIB 1VCIA 4DDTA 3PUZA 1T0HB 4FMCB 5CYOA 3R8FA 3MUFA 3TGPA 2ZE7A 1MO6A 3K53A 4LBWA 2JLSA 3EPHA 2YKGA 1ZC4A 2ZPTX 3OIVA 4LYJA 4Q7JB 4XTCS 1CJUC 2ZJOA 2QBYA 2IWHA 1ZCAA 5HZHA 1NLYA 2BMFA 1R5NA 1XMJA 1W4CA 3CBQA 3JVUA 3DPUA 3EIEA 3X1ZA 5F9FA 3QKRB 5G40A 1JJVA 4D4KA 2ZJ5A 2C03A 3WHKA 2OT3B 3FE2A 1FX0A 4TQ9A 1XTQA 2C04A 3KUCA 1TF7A 4PHTA 3AVUA 4C0KA 3KX2A 1DARA 2IYQA 4Q9KA 3CRW1 2NPIA 4IXNA 4RD1A 4B3GA 1R4AA 1K8RA 4B3FX 1E2DA 2EYQA 1N6OA 5UKDA 1QG2A 3REGA 3K0EA 3QBVA 4HI0E 2XTNA 821PA 4HZUA 2WHXA 4JLDA 4TWZA 2ZU6A 4QG7A 2NPFA 5C46F 1EFRD 4TLDA 1KKMA 4URUR 1XPRA 5HE9A 5FPTA 1VG8A 5FL3A 1FNNA 1G5PA 4OQNA 2J0QA 1NI3A 2IW3A 3ZVLA 2JGNA 4FI3C 5FUVA 4AWXA 3B1YA 2QMOA 4F93B 1VYUA 1S9DA 1LS6A 4NPHA 1HY3A 1GDDA 2BM1A 1S8FA 3EZ6A 4TYPA 2P2LA 1EK0A 2Q3FA 3FKSD 4YMSA 2WWXA 2QE7D 4II7A 1Z63A 2W58A 4DC9A 1NVUQ 1SXJD 4N0DA 1VYVA 3OAAD 3R8CA 2H8KA 3CZPA 2O5VA 3WBJA 4B3BA 2EYUA 3I8SA 4ZO4A 1W36D 1G3QA 4L9SA 3BJIC 3UMFA 5F9HA 2QI9C 1ZNXA 4LHWA 2O8EA 4HATA 3ZZTA 1E2GA 3D31A 2CXXA 1M7HA 221PA 1KDOA 2V55B 3AKDA 5FTJA 1I2DA 1B23P 2OESA 4PTLA 3JVVA 3K9LA 5HKKA 4TQAA 2QAJA 3REFA 2UKDA 3AH8A 1KMHA 2GXSA 4US1R 3PXGA 2C9CA 5BN4A 1DVRA 1FQKA 1XEXA 2I3BA 4P4SB 2Y8EA 5KSZA 1A5TA 5SZIA 3PEVA 3EC2A 4HUTA 3HYTA 1LS1A 3QBTA 1Q21A 2CK3D 4NMMA 2XGJA 3EW9A 3I72A 1G7RA 2FZLA 4B34A 2ODNA 1IJFA 4NONA 2DWOA 1LY1A 4PC6A 4HUQA 2X8AA 3DDCA 4GI7A 4LYAA 3IHWA 2XX3A 1WB9A 4EFNA 2G77B 3NBYC 2P0EA 2P6NA 4Z54A 3THYA 1PLKA 2MMGA 3OFNA 4F4CA 2L0XA 4OI4A 1KNXA 4A15A 4H9GA 4QGGA 4OK6A 3P1JA 2ZJ8A 5P21A 1NG1A 2W2XA 3CR8A 4FMDB 5A0FA 1E1QD 2FG5A 2GJSA 3GLFB 2VIIA 1M7BA 3NC1C 2JLRA 1OXSC 1O87A 2ZAMA 2BBOA 4DVGA 2OFXA 2VP4A 4F4JA 3AVXA 3PUYA 1LFDB 3FFAA 1YZLA 2NO6A 3K0AA 2WJVA 2FPKA 1YRAA 2IF0A 3P26A 4ACBA 5A5GA 3EZ7A 4JVMA 4UNSA 2YWHA 4MDEA 4OHVA 3AVWA 1P2VA 3NC0C 1E2QA 3B60A 5C4MA 1Z6XA 1P9RA 4EJSB 4C0AC 3NIBA 4FCWA 1R7RA 4ZDIA 2HDNB 1NVWQ 1ESMA 2DFKB 4PC7A 1XTSA 3MRSA 1Z08A 1XBTA 2YOFA 3CX8A 1U99A 4M9ZA 2D7CA 2V1XA 5JJIA 1ZP6A 3K09C 2XXAA 4JKYA 3ZD6A 2VF8A 3DM9B 4M1KA 4DEXA 4AKHA 4KBFA 4V0ME 2E1RA 1E4YA 2JIZD 2DR3A 2Q3HA 3CNOA 4QBFA 1M7GA 5FL7D 4DSNA 5AWFC 5KO2A 4RVCA 1CF4A 4M1OA 1Q1EA 3QE0A 1MRSA 3GJ6A 1MV5A 1G7TA 2ZR7A 3VHXA 2H1LA 4MGZR 5AR1A 2BBWA 2PMDA 4GMDA 2HLDA 4RJLA 1VCMA 1AM4D 1QHHB 3IO5A 4IFEA 4NDZA 1N6NA 1C9KA 2LWIA 4Q7MB 4TLCA 2IWRA 1WA5A 1Z6YA 3AUXA 4B3DA 5DYIA 4A2PA 1X1RA 2QROA 2OEPA 1LW7A 3KKMA 2D3WA 4G5RA 5J4KA 2GJ8A 3U3OA 4LJYA 2IUTA 1XU4A 2O52A 1Z0DA 3TSOA 3A58B 3PEUA 1T3LA 5L8VA 1GRRA 1DADA 3AGQA 1V5WA 4YMTA 8OHMA 3AVOA 4NHOA 2WAYA 5AUOB 4BLSA 4M22A 2Q9BA 3C5HA 1KY3A 4OBEA 4TMXA 2FJUA 3TK1A 2FNAA 4R71A 1W49A 3FWYA 1KO7A 4V0OA 1Q1BA 1G5RA 5JSZB 3UPUA 3HU1A 3QKRA 1OFTA 4BWYA 1BOFA 3VKHA 2OM2A 3UG7A 5GJVC 3AGPA 1KAOA 4F4IA 4O0MA 5DO9A 3RS0A 2CVHA 4A0GA 4QHSA 5CK5A 2ZI5A 3HJNA 3ECCA 1AQUA 2CVFA 4Q9LA 3BOSA 4JL6A 5HE8A 3VR5A 2D4HA 721PA 4JIMA 1U0JA 2WWFA 1WCV1 4U02A 4DXAA 1QHGA 4MKGA 5EQTA 4M1WA 4C0BA 4A2QA 3JZAA 1VECA 2GEVA 2GK7A 1W0JA 1CJKC 1ZD9A 4Q1EA 4WXRA 3CRVA 1T3SA 5L3SB 3BXZA 3RS7A 4BEBA 1B0UA 1KI3A 2P67A 3NXSA 3VTKA 2JAQA 2WPDA 3MSXA 2ZJ2A 4KVGA 1II8B 3SHFA 3KJHA 1UAAA 4PPFA 4HAUA 1IY1A 3B5JA 1KJZA 4W7SA 5EP1A 4CGZA 5JEDA 5K8TA 1NLZA 2RGEA 1E2LA 1OB2A 3D7MA 4IHQA 4NCIA 4AKGA 4J0QA 4Z51A 1ZIOA 2QN6A 3W8NA 3FOZA 4L9WA 4OK3A 3DOEA 3I32A 3ZVMA 3DMDA 4TTQA 2QTHA 3RLFA 4JLKA 1XD8A 4D6PA 1SQ5A 1N6LA 3SZRA 1OIWA 4QM6A 2D06A 3ZZUA 2FV8A 4ON9A 5G53C 1CBUA 1R10A 3X1XA 2F43B 1J99A 3FMOB 4Q66C 1NMYA 3E2IA 2OCBA 4U7DA 4G5QA 2QSZA 2VSOA 4GL2A 5AJWA 3KQNA 4DZZA 2WMNB 2VQSA 4LJ5A 3U5ZB 3UK6A 1YQTA 5GVRA 2JLYA 2R6DA 4DB2A 2DY1A 3M6AA 4CW7A 3U4QB 4GOXA 1A7JA 2GZAA 2PEYA 4P4SA 4QOSA 2A2ZA 5EZ6B 3RABA 3PV0A 4PSKA 3LFUA 1GL7A 1TADA 5J4VA 1E9AA 3CO5A 1SHKA 2KWIA 1KI9A 1Z8FA 1G9XA 2I1QA 3DHWC 4QBIA 1YE8A 4ITRC 4QJ5A 1ODFA 4QNMA 3C8UA 3GFOA 4ZKDA 1P5ZB 3ADKA 2QG6A 2XOKA 4BFVA 1YR6A 1RIFA 3IGFA 3QKTA 2BJVA 3AP2A 4QKQA 4O2LA 2ZSFA 1RJ9A 3F3YA 1G8HA 1OYWA 4MYHA 4PZLA 4OL0A 2VHCA 1U0HC 1WMSA 3HU3A 3RC8A 4ZDJA 4GDFA 5E3HA 2V6JA 3SHWA 1E9DA 1MO3A 2FPLA 4Q4AA 5KNDA 1W44A 4DLRA 1WBDA 2AN9A 2W0MA 3SS8A 4EPYA 1C1YA 4B75A 3CPHA 2BCJQ 4CEIB 1R5OA 1U8YA 4Q9IA 1G7CA 2GVZC 5KDOA 2EQBA 3EZFA 1XZPA 2NQ2C 4OYHA 1XD9A 3GEEA 1IN7A 1XCMA 1NIPA 1ZVQA 3Q3JB 2WOOA 4NH0A 1OH7A 5JJLA 3QJYA 3K70D 3OF5A 3QKUA 2QMHA 3NH6A 3L0OA 4LJAA 2W83A 2FN4A 3U3RA 3ZIAD 3BK7A 2OHFA 3FMPB 3KTAA 4TSFD 5L3QA 2FH5B 1D6JA 4YQFA 3QPWA 1YR7A 2ZXUA 2ONJA 5KTYA 1QZXA 1CXZA 1KO8A 2ZE5A 3B13B 3F5FA 4RFSB 2ZYTX 4HAZA 3WRXC 2IUSA 4Q5IA 1J8MF 1UFQA 2JDIA 4JJZA 4B2PA 5GVSA 3W5IA 5DI3B 1OHHD 1NMZA 1OH5A 4Q7KA 5CITA 1JR3E 2GBLA 3U3KA 2O8FB 4WIAA 1GKYA 3QVUA 1KY2A 1TQDA 2Z4SA 2PLFA 2V8OA 1NSTA 2V7QA 2QP9X 2WMOB 3BB1A 1S3SA 3DL0A 4IEEA 4B32A 3I61A 1OH6A 5IK2D 1Q3TA 3SJBA 2WV9A 4YMWA 3SYLA 3L82B 1FTNA 1CULC 2EWVA 2H7VA 4URXR 3S1AB 2EWWA 2PJRA 4RZ3A 1G4AE 4C7OA 4Q21A 3TLXA 3TSZA 4A9AA 3ZDQA 4BFSA 4D4LA 3SNHA 5G3YA 1BKDR 1Q22A 2WSSA 1TU4A 4LJ8A 1G18A 3O8DA 1YU9A 2GXQA 2YINC 4DLTA 3BB4A 4US2R 3C4JA 4DCNA 1RC8A 3TW4A 2VHTA 3NVAA 1R5BA 1CIPA 1AKYA 3TH5A 1FPMA 2XAUA 3T34A 2QTFA 5DIFA 3MFYA 3ZYCA 2C78A 1X8KA 3RAPR 1OXXK 3LH5A 3QXSA 3EASA 3BBPA 1XZQA 2GZDA 1E2MA 4Q9HA 4Z8YA 4DUGA 4XWOA 5JI3E 1E2PA 1G3UA 1TEXA 2WIBA 4KVAA 4O2RA 2W2TA 4PAOA 1N5JA 4OI0A 1U2RA 3GCGA 4U00A 2G83A 1DE0A 4HB4A 1F60A 3QENA 3AKYA 2QBYB 1ZM7A 5KPJA 5JMTA 2F3TA 3CKLA 1GVNB 1X3SA 5J47A 4C2UA 4HLUA 1IXZA 4ARZB 1E79A 2WAXA 3IQXA 3TQFA 1FX0B 1SGWA 1KK0A 2ZUBA 3E5HA 4KSBA 3M1IA 2QUZA 3AVYA 2R8RA 4E5UA 1UDXA 1S9HA 4KBGA 3A37A 4LOAA 1COWA 2B21A 2NTYC 2QTVB 3HPRA 4HZUB 3U60B 1II8A 2B7BA 1ZNWA 1KOFA 3DO6A 1NBMD 2OBNA 1Z07A 4B3CA 4B35A 4KFRA 3PCRB 3HWSA 1VPLA 1N3BA 3LD9A 3TR5A 1CR4A 4ZIRB 4GPTA 3TNFA 4QNRA 3AF3A 2GHIA 4JVNA 2J7PA 4B74A 2REOA 4D4MA 4MYTA 1OHHA 4JBXA 2QRZA 2MSDB 2ZU0C 2CBZA 2GESA 2PCLA 4DLSA 1KSFX 2EFEB 3WP1B 5FUXA 4RZ2A 5AUQA 2FFHA 4D82A 1C4OA 2QY9A 4IVRA 5CLQA 3AVVA 1JJ7A 2Z4RA 3DOFA 4IDQA 4D0NA 1IN4A 3RHFA 4IOKA 4YDHB 2RGCA 1U81A 3IUYA 3ZH9B 3BFVA 1JBKA 5JI2E 2O8CA 2VP2A 5CB8A 1VG0B 2YC2C 2ZIAA 2O8EB 1P9NA 1ETUA 2G9NA 1EFCA 1KO4A 5JEEA 2OCPA 2ZJAA 1OKKA 2ZAOA 1TNDA 4NYIR 5FI1B 5FOUA 5LBIA 5DN6D 3IO3A 2GXUA 3UIEA 3AUYA 4UJ3A 3VKGA 1XEXB 5IHPA 1UKEA 2PT5A 1OE0A 2A3RA 4KJZA 1MR3F 2P5TB 1BMFA 1W0KD 2ERYA 1Z0IA 3BWDD 3CRRA 2QSYA 1KJWA 2H92A 1TQ2A 4PAMA 4HUQB 3E70C 4TMVA 3C5CA 4OQFA 1HEIA 1MABA 4D26A 2CLDX 2QP3A 3KB1A 1FTSA 1T5LA 2VTKA 4JSTA 4TMTA 1AJEA 3B85A 1CEEA 3DM5A 3BIFA 3THYB 4BZQA 1JNYA 2QM8A 1PZNA 4QBHA 4R7ZA 3TIFA 3MG9A 4TZ0A 4XJXA 1T0JB 4DHEA 4DIEA 3OEHD 4CEIA 2GZHA 1Q12A 1FMLA 4IOJA 3ZJYA 1TX4B 3B1WA 4RSGA 2FDCA 1N6PA 1ZIPA 3GLGA 1ZINA 5CIQA 4KI0A 3K0AB 2P5SA 3B1VA 2HT6A 2FFBA 4YC7A 3MLEA 4CF7A 4F91B 2GBLC 2JLWA 3EIQA 2AK3A 4HDOB 5CM8B 4YXWA 3GJ3A 5SZJA 1JR3A 1XMSA 3CM0A 2A9KA 1LTQA 2PZFA 1OFIA 3VKWA 4D0GA 1HUQA 2GK6A 3GJXC 3R9IA 1T6NA 2QZ4A 4RD4A 4DKXA 2F55A 3NBFA 3CH4B 2YWEA 4O3MA 3W3AA 1S4QA 3IHLA 3LW7A 1IHUA 2HXSA 4UKDA 2O8FA 5JECA 1EWRA 2B7CA 1R0YA 2QPAA 1GWNA 1Z6AA 3DZ8A 3FYHA 4M4SA 3PQCA 4PO1A 4XSGA 3AV0B 2XXAB 1US8A 2ZJYA 4N3NA 3ZQJA 2VP5A 5FBQB 2JLXA 4DLWA 3Q9LA 5FI0B 3WNBA 3RRNA 1HE1C 4Q48A 4A6XA 4NTZA 4TYNA 1OLOA 1G16A 4TYYA 2BIFA 1A2BA 1IAQA 3K8YA 3TJZA 3WRYC 2BKEA 1P61B 2ZRNA 4DB4A 4MRPA 4LPKA 1LV7A 1NJFA 3AVPA 1P9WA 1GTVA 2IBMA 3MCAA 2FFQA 4FD2A 1W2HA 2IA5A 3B78A 1N5LA 1U9IA 2WJIA 2JLQA 1P4SA 2XZPA 2XTZA 4WAUA 1ZW6A 4E09A 2ATVA 2HYIC 1ZMXA 3T35A 2OXRA 1OXUA 1K6MA 2NIPA 1CU1A 1AKEA 2ORIA 4LJ9A 1KTVA 1OJLA 3UWKA 1GOTA 3I73A 3U7GA 2FE4A 2RHDA 1SXJE 2FZ4A 3ADBA 4KU4A 3QSYA 1VIYA 4LBZA 2ZTSA 4ZCIA 2ZRDA 1R0ZA 4RCZA 3TE6A 4IW3B 3T1OA 1GP2A 3AVQA 2NZJA 2A30A 4DCVA 4HLUC 4XOIA 3A4LA 5KOYA 1S0UA 4R98A 5TXGA 2OBLA 2XZLA 3FVQA 4R9UC 1N0UA 1RRPA 4LYFA 3KJIA 2HXYA 3D6TB 2YHSA 3P4YA 1E9BA 1IN5A 1G8PA 4LV6A 4P4TA 1TU3A 3THOA 2IS6A 1MOZA 4BPBA 4MH0R 4ARZA 1F3OA 3FDIA 1AA9A 5FR1A 3PUXA 4DLXA 5KDLA 2FWRA 1E9RA 5TDHA 4Q02A 3RS4A 1NN0A 1G64A 1H8HD 2CL7X 4C4PA 2CL0X 4DCUA 2HT1A 3WMGA 1G3IA 4PANA 1VHTA 2WWIA 1EXMA 4BQSA 3QF7A 1H8ED 1FL9A 1M34E 3QPVA 1XP8A 4FINA 4HB3A 4Z1MA 1OFUX 3TVTA 5B57C 2NG1A 3GLGB 1XDBA 2R9VA 4KYIB 2LKDA 1DELA 5G41A 4B43A 5CDFA 3DKPA 1VHLA 3K9NA 4R2IA 4Y0VA 3DVLA 4ZIRA 4UNRA 2Q0HA 1E9SA 4TYQA 2JLVA 2I4IA 1JI0A 2DYKA 2NO0A 1U94A 3GPLA 1E2FA 1XTKA 2DCUA 1E1RA 1KHTA 4LYHA 5E95A 1Z0JA 1VIAA 3GFTA 3GLHE 4MQBA 5FOXA 2XNDA 4CDGA 2JJ2A 1LVGA 1JEEA 1A2KC 2ZI6A 1IN6A 3EIHA 4HSEA 5KSOA 1RRCA 2EFDB 3VR6A 2CHQA 4X8HA 4B2IA 4FN5A 1EGAA 2CJWA 5JCZA 4C30A 3FMIA 3RSLA 3OESA 3KKNA 3UATA 4GT1A 1XXHA 2WSMA 4D4JA 2B92A 4C0LA
chains in the Genus database with same CATH superfamily
4NESA 1PBTA 1GNRA 4UXHA 1FE8A 4CN9A 4ETIA 3ZY2A 1H2RS 3PL1A 2ZB3A 4AYXA 3MTBA 2I4OA 2IX9A 3P4UA 5GY7A 5FPYA 3REQA 3EUWA 1QRTA 4UHKA 3AW8A 4KITB 1BHQ1 5CFNA 2I55A 4K0KB 5JD3A 2G1JA 3EVTA 4AJJA 1CV2A 1DBRA 3AUSA 1ZK1A 2B78A 3G2MA 2YZKA 4Y2JA 2L42A 3OH8A 3U7EB 1WX1A 4EUSA 4DRYA 2HSDA 4M9SA 3L18A 1WXFA 3T61A 3SE7A 2VHWA 4F5ZA 4P83A 3BWYA 5H7XA 4DUPA 5CDTA 3TLKA 3VYTB 5AW4A 1L8XA 3TRJA 2AL7A 2VCEA 1YDGA 3OIFA 4PZ0A 4CLEA 1W35A 3H4MA 1O97C 1PZMA 2BKAA 4AY3A 4CCYA 5AVXA 5DBIA 4LRYA 1CUHA 2DPYA 2VHXA 4IDFA 4QGBA 1F2TA 1RQ2A 4PLTA 1A97A 3HUUA 3NAZA 4BB5A 1YIDA 3LMKA 5KJCA 4QQFA 3NANA 4LSZA 2QL5A 1PEYA 3D8RA 1E4EB 3OEED 1IBRA 4HYTA 4PVDA 3EF1A 1DFGA 4G9EA 3OE7D 2QSJA 1BX3A 4Y2QA 1JE1A 3LAWA 3H9JA 4M1ZA 3B1KA 4P54A 4YCNA 2VTDA 1IMOA 3K5WA 5E9WA 1WM1A 3QWFA 3F97A 1Y6JA 5F12A 1LA2A 3IS3A 2IEZA 3RV4A 3ESRA 1ENPA 3QY9A 1NMXA 1CDZA 2Q6IA 4B79A 2GLTA 5ICGA 3PT9A 2JI4A 4C0SA 3HU2A 3G68A 1BYUA 4O25A 3QY0A 5IYZF 5L3QB 5A2GA 4KXNA 4P8RA 5DBGA 1N0IA 3WC4A 2Y68A 3OY2A 4YP5A 3SC2A 4CIBA 3WGJA 2EOAA 2VK8A 1WPGA 3H1TA 1Q17A 5DLYA 2X23A 5DFAA 4UULA 3TJMA 3GLFE 3ABZA 3WNDA 1W9MA 1TVMA 2FEXA 4IUDS 1U9IC 3U56A 3NAGA 3C0KA 2PX2A 3PFKA 3PQ6A 2PQ2A 4QFCA 3G23A 5TC4A 1XJ0A 4HWOA 1L1EA 3T5TA 3WK8A 1D1TA 3AZQA 4ZJPA 1U4OA 4XXHA 4YRCA 4TWAA 3E8XA 2FUNB 4G1BA 3W5JA 1TYBE 2EARA 2J33A 1T4MA 1RSZA 2VJKA 1Y1PA 3AEKB 3BWEA 3H3JA 4UEQA 3RIGA 3EUEA 2HJVA 1L7DA 3KC2A 4KXQA 3GDFA 1OREA 5BT9A 1QFSA 1SXJA 3FCAA 4U6QA 1P0CA 3E4DA 3F73A 1A4RA 4BTLA 1IDOA 2I29A 1FSZA 4OHZA 2Z83A 1KDPA 2I1WA 2BFBA 1NLFA 1OBOA 2YDXA 4C7OB 2CFCA 3FPCA 1Z3CA 4GR4A 4KLRA 4MVJD 4TT8A 2OMKA 4D8VA 2I4TA 1CUUA 1MCZA 1VRCA 3HY6A 4MA5A 2AYXA 2Z0MA 4XPIA 2PL1A 2ZS8A 4WXPA 3BTOA 3TLMA 5HKBA 4LZWA 3FOEC 2Y76A 3PVCA 1L7PA 1TM3E 2AEJA 4BQRA 1SELA 3VI3B 2QLJA 2O06A 4H1VA 4MEAA 4RTPA 2XNKA 1JT9A 1BXKA 2RHOA 3SS7X 1EWYA 4YRNA 4H6XA 4O2BF 1CRLA 4RZUA 1TCAA 4PXSA 1SU7A 4FDLA 4ND1A 4RXMA 2NO7A 2C3MA 2PIAA 1JP7A 3SSNA 4X66B 5HQTA 1P5RA 1KAGA 3GFPA 3BMCA 1QDUA 3HI4A 4HWSA 3WO0A 4AG5A 1SUFA 2RJ3A 3CRZA 4ALKA 3ED5A 2BONA 5SZHB 2HU8A 4BQFA 1UWLA 2OHOA 5COQA 4JWKA 4C9BA 1K98A 1EFDN 4FS3A 1IOLA 1M9NA 2R4TA 3NM6B 4OXIA 4BIMA 2AC2A 4YO7A 4V3CA 4RHCA 5KCMA 1UDRA 1G98A 3EVZA 1DI0A 1UT8A 3CPJB 3UHOA 3H11A 3KFVA 1RRGA 4BASA 3U31A 3A6GA 3EZLA 4B6JA 3URKA 3IBGA 2LIVA 4DGQA 1RC0A 5JAHA 3E35A 2W98A 4GI3A 1DTWA 5C4GB 3RNLA 5LNK1 1E1QA 2FVYA 5K6TA 4TYWA 2ORVA 3CQ9A 1I2ZA 4MSUA 5JALA 1VJTA 4MVJH 3OKPA 1EP3B 4BO2A 4CM7A 4LF8B 1YOVA 2GJKA 4I1RA 3LK6A 2QN3A 5AJZA 3UICA 3UJBA 2H08A 2HH9A 1YMUA 4XASA 3RKUA 1QP0A 3QBJA 1OQAA 4L5BA 2V5AA 4NHEA 1X94A 3OLCX 1GRNA 5BNWA 1UMDA 2ZDGA 5EWJB 4U9UA 3S2ZA 4YRAA 1IONA 4D9HA 1TQ4A 1PWEA 3RVDA 4CM1A 5JRJA 1IM2A 3K5HA 3GRYA 3HJUA 2X9NA 1XELA 1E4VA 1W2WB 2C3UA 3O0DA 2X9GA 2GNPA 3IJRA 4KX3A 5AKHA 3MB5A 5CT9A 4LDAA 4TMKA 4X8OA 1PJCA 3QYAA 4J43A 1OT3A 4ZYLA 2XUKA 5DV9A 1EDDA 3WTBA 1AOXA 4L4UA 3OIGA 1SU6A 4JITA 3ZR4B 5C32A 2O2SA 4KNVA 4C6HA 3M3HA 3SSAA 3SFVA 3I09A 3FYSA 2BJWA 3OZEA 3SFZA 2ZSKA 5GM2A 1XT6A 5LB4A 3Q10A 4XM1A 2ZZNA 3G79A 4JXZA 1ZS9A 2Z5LA 4PQYA 2D5CA 1D0SA 1Y8AA 3BM5A 2JCYA 3GEIA 3R3HA 1KVUA 4G3XA 1QRSA 3F5MA 3HSSA 3ELDA 1L4EA 2F1RA 3EQ2A 1LF0A 2GDJA 5HBRA 3PPVA 2IXBA 3R23A 1GA1A 5FL7A 3HY3A 3IVAA 2XOXA 4G86A 1QF9A 4LF7B 3VKUA 1N32B 2X9LA 1GQOA 3X0DA 3MMSA 1PYOA 3AV3A 3DE4X 2G9RA 4XYGA 3HP1A 5H80A 7REQA 1T8PA 1P44A 3EPLA 4A7PA 3L01A 1X19A 2JIRA 2WG2A 4LKOA 4JP1A 1D4OA 4W8HA 3CR3C 3PHIA 1PJLA 1V43A 1XQYA 1XDGA 3K2EA 4JJ6A 2LCQA 3NHBA 3BN3A 4C5BA 2W11A 2DQYA 4L15A 3A3OA 3QYJA 4OHXA 2JKVA 1R6AA 4FYWA 1E3DA 3QLVA 4DG8A 3DAGA 1ZVMA 3I2GA 4DLZA 1CUFA 3DUFA 1P33A 1N3LA 3Q9SA 3QUSA 3GFRA 3TR0A 3D9QX 4JVSB 2NV2B 3JCZA 5BPFA 2WBLC 1PK7A 4LGMA 4BMSA 3H1AA 1Z4QA 3L4KA 1WZ2A 2ZQZA 2I3AA 1SC3A 1MMFB 4ZVTA 3WDMA 1FPQA 3QUAA 4BP9A 3HKDB 4PQEA 1O9HA 1OWOA 2ZRHA 3R7NA 4DR7B 4R8SA 4X3PA 5KSWB 2XITA 5FBZA 4B4KA 4OHPA 1G20B 4BWFB 4PS1A 1YJ8A 1I7LA 5AICA 2E55A 3DTTA 4IBOA 3HSYA 2IHKA 3JTEA 4L9AA 1T9GS 5AJXA 3O95A 3ENQA 4O29A 4UZEA 3WB9A 3V4PB 4RAQA 4JY7A 3SVZA 1B8PA 4BFUA 2IU0A 3CH6A 2IXEA 2GJ9A 3VQTA 1SIWA 1H5NA 2ISQA 3ETEA 3A04A 3PUIA 4FOOA 5EHNA 1YULA 4LMAA 5B7PA 4J0IA 5HG0A 3WLAA 3IJEB 3EX7C 2FMTA 4TWJA 2A94A 3EXG1 3S29A 2K6GA 2BFEA 3ZBTA 4R9RA 5KU1A 3CUUA 3MW8A 1T0IA 1WHSB 4GGPA 3PEFA 3PC8A 1RM4A 3NG1A 4I9UA 2FK8A 4FMCF 1F7VA 1QGED 2GK3A 4HDKB 4JKIA 4EFMA 4M8SA 3S2UA 3JAMA 4UEJA 2BTQA 4K7JA 2IQ5A 5PGMA 5E6SA 2ZTHA 4AS2A 1QQ6A 1WUHS 2J4DA 2QMZA 2RCNA 1O6CA 3R1IA 5ECYA 5EUBA 3WIEA 5E7QA 1AGRA 5B7NA 4I55B 2Q5FA 1EM8B 1OC4A 1P2TA 2GKOA 2VXCA 3VYRB 4D8UA 1VP3A 3H2JA 1QRUA 4IIXA 4WGGA 5ELMA 5TGZA 3L9WA 2Q8QA 5HOQA 1R66A 2CLMB 2HK7A 3HM2A 2VH1A 3T5GA 1S4MA 5KVVA 2CCGA 2IXFA 4XGRA 1UK9A 1U3GA 2N42A 3WAKA 1VIDA 2O2ZA 4C0WA 3GCXA 3H9QA 5FKJA 2VP0A 5FOWA 3TUIC 1XF9A 2YZ2A 2GWHA 2Z56A 1NPYA 3A6EA 1XTVA 4FOLA 1W19A 3V6MA 4EELA 1P1CA 2OSVA 1OAKA 2NZUG 2XCRB 4J91A 5JISA 3NIGB 3EGVA 2YOGA 1KEEB 4NS1A 5J2TB 3PG5A 5AM0A 1PR6A 4JP8A 3H0KA 5SICE 3RQSA 2JZNA 4BEVA 5A4JA 3KU1A 1MXFA 2X41A 5JZVA 5CA1B 5A06A 4KREA 1YR8A 1FVXA 2HXGA 3VVCA 3SX4A 2X5NA 4JOSA 3GGOA 3FLEA 1QAQA 2ASEA 2ZCUA 3WLEA 3G5UA 2ILTA 3PQ5A 3IIMA 4YLGA 2Z9CA 1V9LA 2HLNA 2X7XA 3AESB 3ORSA 3HEMA 2VF7A 1ULBA 3QTTA 3KAJA 5CVDA 4Z4GA 1C7FA 1D0IA 2CFRA 4B0PA 2O8BA 3CEAA 3CLTC 2Y92A 1E7QA 4NRDA 1CF2O 1E2NA 2H9AA 4GVLA 4NOLA 3DTVB 1NXSA 2AXEA 3GJ4A 5KMGB 4EARA 3IV9A 3VDXA 2B4YA 2WP0A 3N0VA 4MVJF 2TSYB 1WU7A 4BJ1A 1XJCA 1LX7A 1PGQA 4KSCA 3VZQA 4B6PA 5DTJA 3MCWA 2IOFK 1S1CA 2YMPA 4AX8A 2FR1A 1Z7YA 7ABPA 1XEWX 4FD3A 1L4NA 1O4VA 3DEZA 3FYUA 2R6CA 5BV8A 4DV0B 1JYFA 1W5EA 4PG4A 4L50A 4RKYA 1ECPA 4YONB 2CB9A 2NVUB 3OF2A 1F6BA 4M89A 4O2AF 4R16A 2QLTA 2OGSA 3VKFA 5TSDA 3PTLA 2R79A 3W2IA 2IZ0A 5KU7A 1J20A 1Z17A 2A5YB 4EMUA 4KGDA 1UK8A 4E5NA 1FJGB 3DB2A 3O7WA 3EDOA 2BZ1A 3E48A 3PGJA 5K2MA 3BWMA 3SN6A 3FWNA 4G56A 3CH5A 4GHWA 4UOQA 1WW8A 2AZTA 2HGSA 2QG9A 3IAEA 3EG9A 3LWBA 4QPZA 2PY6A 3UO8B 2AB0A 3LXXA 4ZJYA 3SIPA 1DTEA 4IG4A 3R3WA 5KYWA 1PFKA 4PNHA 5HZKA 4DLKA 2JEOA 4AJ1A 4CL0A 1EFTA 3U7JA 4QJBA 3D3JA 3QXHA 2QTLA 1Z13A 3V8MA 4TS9A 1GYQA 1E0JA 4NVRA 5EY5B 3H2SA 4MIEA 1XQ1A 3GAMA 4FYYA 4FMDF 1JFTA 4NMXB 2VSNA 1BH6A 1DOHA 2GNAA 3EY9A 3I76A 3JY6A 3WLIA 2AFVA 1Z2AA 2TMGA 4BKMA 1G42A 4C4TA 4RIEA 4KNYA 1XQ9A 4PPYA 5B1IA 2XDYA 1NWHA 3C3CA 3LX6A 4OQXA 1YZYA 1XAIA 4L6AA 2JAWA 5TPWA 1CY2A 1GQSA 1M74A 3B6JA 5I8ZA 2PV7A 2YYSA 3NKVA 4EJ0A 2VYFA 5IK2A 4KPUB 2IXGA 3AB7A 1BS1A 4X9XA 4GSYA 4EGAA 3TOCA 4O0LA 3I8OA 1PR3A 4NR0A 5JSKA 1S89A 3QU2A 4CEHB 4M0PA 4P82A 2B83A 5U4XA 1E9CA 2BEWB 3VHLB 5C1OA 2H4WA 4EVQA 4RH1A 4M99A 2JGJA 3GJ0A 1WE2A 2HF8A 5BV0A 2DH6A 1O6BA 1QKKA 3GJRA 3HWX1 3OQHA 5DHQA 3MWLA 4UPEA 1TRKA 2V1UA 3QE9Y 4FB5A 4TT3D 4FC6A 3PUKA 5E6RB 1CERA 1P8JA 3ZS8A 3VZDA 3DDZX 3E3AA 3EAFA 3G7UA 4IMIB 3M5PA 4KLCA 2R1TA 3DSRA 4M49A 4NI5A 5CLGA 4BQEA 3KQLA 2VDNB 2X2PA 1R37A 2J3LA 4PZCA 5BV7A 1OV4A 3TPZA 4UCWA 4YLEA 4URZR 5THQA 2ACVA 2F8MA 1UJNA 1JTEA 3DWIA 1GN9A 5A4FS 1OZFA 2OXTA 4PHGA 1U1IA 2FQQA 4XOUA 3RSGA 1ESNA 3RYHB 4LDQA 2R7KA 1ZY2A 3OSUA 5D3ZA 3EBPA 4OREX 4CHTA 4D4GA 2DERA 3FMVA 4X20A 1CQXA 4MI1A 1RQNA 3JD4A 1KKLA 4ZC1A 3TQCA 4MQ6A 3ORQA 4L8VA 3GRPA 1OW3B 1J33A 3V48A 2IYLD 1QZZA 2CLSA 3FYDA 4PONA 5EHGA 3OLWA 4ZQGA 3ZWXA 3I5AA 5FT9A 2CNKA 1VLVA 4ZVOA 3PK0A 2P90A 4WNYA 2J9FB 4RVSA 3WWDA 1PO7A 3DGFC 2A33A 2XWJI 4HS4A 3F6YA 4EI9A 2OUKA 4AWAA 1FP6A 4ZCMA 4I5FA 4L0CA 3W5UA 4CEJA 3ZLTA 3FNFA 2B5WA 1UKYA 2YOHA 5GJBA 1FNCA 5GIOE 3C3KA 4BN5A 4M1TA 2TYSB 2G8LA 3LOPA 4W5HA 1Y3DE 5KJ1A 2VH5R 1OV6A 3K8OE 1OPXA 1Q0UA 1IY9A 3NBZC 3AINA 3KPJA 4ZYTA 4DHWA 3T99A 2WNIA 5H16A 2Y1CA 3GXOA 3IMGA 3TLYA 1UFOA 3DFIA 3AF1A 3WYEA 2CHGA 3KHUA 1UWVA 4QWMA 2QXUA 4WH0A 3SY8A 4ZV4A 3PTZA 1NW7A 4S1NA 2EIHA 4J0HA 2OWDA 4D4IA 1ZR4A 3SOPA 2PCJA 5EXXA 4QA9A 5FTNA 1A8PA 1L6RA 2FPMA 2OWEA 3UOWA 1X8JA 3M6FA 2BJHA 3HXLA 4MO2A 5CLLA 2VDKB 4Y0AA 4C0JA 3BA6A 4ZAWA 2R7NA 4BJ5A 4IFTA 2V7EA 3OFJA 1AV7A 4RZSA 1N0HA 1LD3A 2AMJA 4I4CA 4OG2A 3WO1A 1ORDA 1FP4A 1YVRA 2GD1O 4XAQA 5AI8A 5ITWA 2VJDA 1E5QA 1ZYUA 1Y7HA 1OFHA 2Y67A 3HCCA 1V5EA 5EWMB 4OKNA 3VU9B 4BKUA 2EFCB 4L5JA 1Y89A 2DSTA 5C18A 3DHEA 1PE0A 3A1SA 4XYMA 4YUXA 4FW8A 4PO8A 4NZMA 4BMPB 1I7DA 3BTVA 4KQ9A 5I8WA 5MHTA 4X1IA 3SMQA 4V1CA 4DR6B 1QFJA 2BFPA 4E3WA 4M7PA 5E8JA 5HKKD 1MIOA 5JXGA 4RW0A 4FSHA 3PLRA 3C87A 3R24A 3LHIA 1EDOA 1XDWA 2V6GA 4WKBA 4Z0PA 5KAPA 1QRRA 4G5SA 3MWKA 3OZSA 1E0KA 4RMIA 1PT9A 2CCKA 1TEHA 4EDFA 1P7CA 2Z8YA 4TVOA 2P3LA 3CNEA 3PIIA 4HV4A 5JS8A 1YRBA 1Q7EA 4Y2GA 2C29D 1H6BA 4MKHA 1CY4A 1G1AA 2PPLA 2PWAA 4HMQA 3HBMA 3O4JA 3ZZ1A 1XI2A 5IYZA 5FV7A 2BOVA 2H6EA 2ZRLA 2FKAA 4K87A 3D6JA 4Q1CA 1AS3A 1XVIA 5FWNA 3TRDA 4F60A 3GPDG 3E53A 3TDNA 3UMCA 1LPAB 1ISJA 1GXSB 3CUWA 3V8VA 4B47A 4MAAA 4YJ2F 4E2XA 4LQ4A 3QXCA 4GM1A 3A36A 4N3AA 2NU9B 3G0CA 3KO8A 3MHPA 2DBYA 3V4VB 3TVDA 5KNCH 5H8WA 3RYTC 4J7UA 4L8LA 3X1WA 1Z45A 4MWEA 1JEJA 1V8ZA 2FN7A 1SIBE 3GP3A 4KV9A 1GUAA 4PZYA 5BOSA 3KXPA 3MJDA 4UAVA 5HWSA 5LZ2A 1BWQA 3R7BA 3MLAA 4BO0A 1ZGJA 1S01A 4MUKA 1U0TA 1CY0A 3L7YA 4N0MA 5DZSA 1JJAA 1KETA 1AN9A 1ZFNA 1PD0A 3ETGA 3NYQA 3O1JC 3O2SB 1RJEA 2OGZA 3RVNA 5CJJA 1VI5A 2FCAA 2OCKA 1W88A 2OSBA 1CWUA 4R05A 4S12A 2NO1A 3BHIA 3ZWMA 4RANA 1K86A 1JQDA 3AU8A 4GUAA 2FF5A 4XGIA 2IXDA 3GVHA 3SXPA 2ES4A 4PPNA 4XJVA 3IV7A 4I50F 2ZWVA 4PNZA 1YV9A 4ZZ1A 2A0UA 2W8BA 3V42A 4U8GA 2VHZA 3GCDA 2HV8A 2GEBA 2TMKA 3PUHA 5IN4A 2IEBA 3A6HA 5T3UA 1Z37A 1GA6A 1ZM2A 5ICMA 3AKEA 2WHPB 3QELB 2E5LB 3MGCA 4O2BA 4LFBB 1PR0A 3K0FA 4LX8A 1KYTA 4E30A 5HQJA 2WE8A 2OC4A 6LDHA 3LT4A 1CUYA 2XNCA 1KE1A 4B45A 4W4TA 4P4GA 1G0NA 2NSDA 1NNUA 2B8EA 3NC4A 4HB0A 4OV6B 3E82A 4MOWA 4RD0A 2BFOA 4BO9A 2GTHA 3UOGA 3PC7A 2JGIA 3T7SA 4GFDA 3OPYB 4IIEA 5MN5A 5BVHB 4HR7A 4Z9AA 4WOKA 1M0SA 1I51A 3DKKA 1YB6A 4RIGA 3SC6A 4EPRA 4KAAA 4TVBA 2WMDA 5F98A 5BSVA 5JNRA 3VAYA 3IBFA 2GFQA 4WXHA 4JCCA 1GGMA 2HW8A 1P74A 4HNQA 1QLHA 4ZOEA 3QPDA 4OQLA 4M21A 4HRVA 3ZBQA 1QE0A 5FBRB 1BH2A 1C1HA 4XX1A 2JGFA 3DEFA 4LXYA 2QWXA 2ZRCA 2IXTA 3K7EA 4XQCA 5K3FB 3AVTA 3HZOA 1P4AA 4QFBA 5D3QA 4TV9B 3C24A 2RIRA 1B76A 2ACWA 3G5LA 2AC7A 3IT2A 1NUTA 3GR6A 4FS8A 2MSNA 2VDPB 5FR2A 3U37A 4E7PA 5JHHB 1GVHA 4X97A 4FZ5A 2I80A 3U3MA 1KJ9A 4BBZA 2BDTA 4EKIA 2ODWA 2F62A 2HBRA 4HMPA 3ZQKA 5KHLB 1Z8HA 2KBEA 4EZEA 3HXQA 3PXXA 1W7AA 2GRJA 4NZNA 1L2TA 5CEEA 3FB1A 2JFQA 4ZCQA 4M7OA 3DLTA 1AU9A 4B1FA 4DUZB 3ZTWA 1LRKA 1U9YA 4J1SA 5TQ0A 4AZ0B 1R18A 3W5DA 2UYYA 4ZHSA 5T6MA 1H8EA 4N4AA 1OX4B 4H3KB 5ALYA 1EVZA 4AQYB 3TZCA 3H18A 3BL8A 1MNAA 2WW8A 2C2MA 2H1RA 1ZD5A 4Y8VA 2HHCA 1SY7A 3D5QA 1N2CA 3GZTB 2IHBA 4DR3B 1EFAA 3TGWA 3WZ2A 4KWEA 3DZIA 2H17A 1WG8A 1E9FA 4JP2A 4D96A 2WFZA 1K8XB 4ZEWA 3JSAA 1QUEA 1VGRA 1Z36A 1CB7A 2HWUA 2WPDD 3GAZA 3QFSA 1JFVA 1M1ZA 1NBHA 3MCZA 4LOJA 5CXQA 2REXB 2CJXA 4GZ5A 3DMNA 5A3VA 3OZCA 3TLBA 3PDHA 3WL5A 5JZOA 4S2EA 4XWTA 1XF1A 2B82A 2VOJA 2CXPA 2W2OA 3JQFC 3U7RA 1KSGA 1HI9A 3F3MA 3IIKA 3RWOA 4IDAA 3RYFA 4BNFA 1O9BA 1RM0A 4LOKA 1N2BA 5AW8A 2FMKA 3G1UA 4Q24A 2XUFA 4E13A 3HDQA 4ARVA 2NZYA 4YBRA 3ONVA 2BRUC 4MAFA 4GKKB 4ZT2A 4CM9D 3Q3GE 3THXB 4FCTA 4IWXA 1MAHA 1CNFA 4G5GA 4PLHA 3BRQA 1DRWA 2E5WA 3RT1A 4EY7A 1KI6B 5M5BA 2ZJBA 5U1PA 1SNYA 1YS7A 3USCS 4BRUA 3GLRA 2EG5A 3H42B 1OX6A 4KN9S 2CMFA 1E5DA 2VSFA 2PXHA 2JGRA 6GPBA 1H1LA 1R27A 2FAXA 3DDHA 4O5OA 3OT1A 3RQIA 3UY4A 5A9SB 3FSRA 1XGKA 2O8EB 2C9OA 2HHJA 4JUBA 3M3PA 4DV7B 3R3VA 4MV4A 4CMEC 2EU8A 3UW3A 3ICQB 2I4LA 5KQLA 4JEHA 5B6JA 4BUJA 1HF3A 4YI5A 4K8OA 2LNDA 2OZLB 2HWYA 4OOEA 1WAMA 4RJJA 5I4BA 2ABWA 4HDRA 1OFVA 1MO5A 1JXOA 1T0UA 4BX8A 1CUAA 4L3VA 4BNUA 1X80A 3W7AA 2J0SA 3ESYA 2GAFA 3PKZA 2HSWA 5KJ6A 4PAQA 3DL4A 2G3YA 4P3KA 1M0EA 5TGDA 3HB7A 3OZGA 4IHKA 3HUFA 3SEAA 2FB9A 1T1GA 4LC9A 1IZ8A 2EZ4A 3ZE7A 4FZ3A 2C1XA 2RGNC 4G0VA 4MP6A 1VJRA 2CE7A 2IYYA 4TTVA 2CLOB 2FPSA 5CYPA 3RUIA 4Y2HA 3SBDA 5JXIA 2OAQ1 5L6MB 2A1UA 2TRSB 2YW2A 2UYQA 1EX9A 3Q88A 2ATIA 3PPYA 2E6KA 2HUPA 4GLLA 4JQCA 1TM7E 1F2UA 2X1HA 2YY5A 1XRNA 4Q19A 4AZWA 1J0EA 1V5FA 4A16A 4DMGA 4PC2A 1O95D 2JIMA 3OEEA 5CCEA 4JBGA 3QV1A 5FTMA 3T9FA 1W6RA 3OE7A 4XVQA 5JWOA 4JC5A 1B74A 4J0GA 4PGMA 3HGQA 1NW3A 2CXSA 2HEIA 1C7IA 4A8JC 3SD7A 2Q3MA 2KW5A 4U5QA 5EYPA 1G5IA 1M6EX 1CIVA 1OOEA 1K0UA 1DLJA 2JBHA 3G0BA 4WZAB 4XSHA 1QG6A 3ZXSA 4I4IA 1UJ6A 1M2KA 2LKCA 4REOA 2FSFA 1NI4B 1GTJ1 4QL3A 3OIYA 2C96A 2BR4A 3CB2A 5DM70 3ZBPA 1ZXBA 2Q5HA 4RIFA 4QYTA 5BYJA 1HQCA 5JASA 3B6ZA 4IS3A 5B3JC 5CH5A 3KB2A 3K92A 5F73A 1E59A 1JSLA 1CQPA 1QYRA 1QTNA 3AJRA 4UNQA 4Q03A 3DBRB 3ODPA 1QPZA 1DMSA 4X7BA 1S2GA 1PUXA 4GECA 3L8YA 1AS2A 1RZUA 1ZAKA 2JDID 4KLZA 3U81A 3RYIB 4RH0A 2AFHB 3AEQA 3O4RA 2V0NA 3L1HA 4C3OB 3MS2A 1XK7A 5EWLA 2ZITA 5DE3A 4R2HA 1N57A 2VTVA 2ZJFA 3VUEA 3BQ9A 2YBEA 3BH0A 4LSGA 2O3QA 2GD0A 5ILGA 2UV8A 3K32A 4C08A 1EFVA 4HNTA 2QN8A 4H7KA 2Q2WA 2WF5A 5WRFA 2VDUE 4C4AA 3OFKA 2P41A 1C9EA 3C5WP 2QN9A 1MT0A 2QJOA 5IRCD 3R9WA 5ELLA 1IG3A 1X7XB 1T5SA 3TM4A 3RVPA 1KYVA 5B6PA 1OLXA 4DDMA 4MVJA 2DVMA 3DWGA 3IEPA 5LA6B 3EG5A 1UEIA 4CV2A 5EE0A 3IDQA 3NRJA 4HC4A 3PE6A 4N65A 3OA0A 2WSSD 1TYCA 5C80A 3L7DA 3KETA 1XMXA 1TE2A 4KXYA 3ZD8A 3ETHA 2VDWB 1IY8A 3VSCA 1JG1A 2FRVA 1WQ4A 5CURA 4AYWA 4CUJA 2AD5A 2PGDA 1NXTA 1T34A 2WKSA 2EVWX 1NVVQ 1E89A 3DQQA 1IHPA 5AOCA 4B6GA 4O2AA 2L17A 4C4RA 3AFIA 3Q7TA 3AIOA 3HDGA 4YQZA 3UVEA 3ZWKA 3NOXA 3P2YA 1Z6TA 1ESCA 1KPHA 2O4UX 4L2IB 5KJEA 4XIFA 1RYZA 4RVNA 5BSMA 4QEZA 421PA 1OXVA 3T3OA 1Z47A 1XFAA 4LFCB 1E1YA 1LC0A 3FUWA 1N7IA 5CVTA 2OK8A 4I1UA 4BMYA 3I5XA 2B61A 1NM5A 3RHZA 3V46A 5BN3B 2OM6A 3M5WA 3G1TA 4LC1A 4NMLA 1TUIA 3RSZA 3VZBA 2R1VB 3IKLA 2WF6A 3HJHA 2VUHB 1PDVA 4XGNA 2XT6A 1Z6ZA 3QKSB 4RK1A 2I0FA 5T4HA 3SXJA 5HR5A 5KTNA 4URFA 1HXHA 5E2BA 3CEPB 4EL5A 1NOJA 1C1XA 1HDOA 3HU5A 3IEIA 3U7HB 1GQ2A 2J9XB 1D5CA 3BE4A 3E7PA 1EHCA 1E79D 1UBMS 2QTMA 1YDEA 2X9QA 4PBRA 4RSHA 4WHMA 1L8OA 1NQ5A 1QV9A 3K6KA 3NHYA 4X8MA 4OJNA 1IIRA 1AUOA 5EMJA 1JG3A 3ZY3A 5LVAA 1HQDA 2J87A 3NHUA 4RA6A 2F1HA 5HJEA 2EQAA 4JBYA 1AUQA 2A7QA 2MYUA 1U6JA 3I28A 5AQEA 3O8CA 2PQ0A 1PI3A 1HETA 1YZTA 5DM2A 4TSRA 2DFNA 2G5TA 3WS7A 1KAHA 1KDVA 3UT5B 1X8LA 2WIJA 3CGGA 1W25A 4ILKA 4C29A 4YRKA 1BDIA 1L7BA 2YRFA 1UBGA 3PWKA 1WMBA 2HZ7A 4B40A 3GCZA 2JGAA 2EEZA 2WM8A 5C1IA 1NDUA 2A6PA 2QTCA 5GAJA 5IBRA 4AVYA 2GEFA 2XTAA 2YL2A 1NULA 3FBGA 1T91A 3PFCA 4BE7B 3F8TA 2C9ZA 2EF0A 3MYRA 1QGUB 4WLEA 3NX4A 2IY9A 2IK8A 5LR6A 4OUDB 5DKFA 4B82A 1HQYE 1NZDA 1K4KA 5BWOA 2COEA 3AP1A 3RD5A 2OO7A 5FPSA 3OIDA 4HDSA 2NYUA 4RIHA 5EHQA 1GM5A 2CMGA 4XVCA 5D8DA 3IUSA 2PAFA 3JATB 2BDEA 1SVMA 3MPOA 4IUBS 2OILA 1Y48E 1NXQA 1RT9A 3T06B 1TZJA 3UHAA 1H05A 1Z2OX 3SQWA 2CY0A 2EKLA 2FEWB 4P33A 2EJCA 3PUWA 3RK0A 5LQKA 1XZJA 2J0EA 3B7GA 4Q01A 4R0NA 5IM5A 1JYSA 2Z1NA 4LXUA 1CF9A 3QNWA 1TAHA 2W00A 3E7WA 4ZV7A 3SU8A 2E4XA 1A3CA 3ZD7A 1GR1A 3TKAA 3MWYW 3ORRA 1TYEB 3H2YA 4YXFA 5KVAA 2Z98A 2BMEA 3DVAB 1SQFA 3MTEA 4FMBB 4MW5A 5BQ5A 2C9DA 2VK2A 3ZI0A 4FHGA 1EBFA 5CLJA 1OZGA 1M6VA 4Q3DA 4L16A 3R3UA 4UE6A 3DLBA 5JATA 1IBMB 1Q1QA 2VUUA 2JFUA 3L1KA 2QUHA 2XVXA 5J4HA 1RWVA 3QF4B 5CHEA 4TTTS 5BNFA 3TMYA 3A3NA 5B58C 1NUHA 3ONWA 1BMFD 4IWNA 4CUZA 2P1ZA 4WGFA 3TF5A 3LA6A 1Q3HA 3DV0B 3IAFA 4OXQA 4OFBA 2EJVA 2HL6A 3A9RA 1P8AA 1L5HA 2CHUA 3HB0A 2HCRA 3MA0A 4Y2RA 3PFNA 2IHVA 3NBAA 4Q93A 4GZ3A 5B1DA 3W90A 1MAAA 2JIQA 3L02A 3TLCA 2HD4A 1E6UA 2IYWA 2J31A 3KFXA 4G37A 3WLQA 3DO5A 3NWPA 4M6WA 1E3QA 3AHIA 1H3NA 4KMRA 5TNXA 5SYAA 5KWSA 4QC2A 2ZQYA 4I1IA 3PXUA 2ODEA 3M89A 3GMDA 4EW1A 1ML3A 3W04A 3ER9A 3OJWA 4KO3S 2AKEA 3LYLA 5BW5A 1FFEA 1UBEA 4OSOA 3QOXA 1VCNA 1QO9A 2RHBA 2WJHA 2FMHA 4MV7A 5ALRA 2GNOA 2P6MA 3KWMA 1UIRA 1A95A 1G8FA 3PX3A 3IODA 4GIBA 3COVA 4TMFA 1YZGA 4QQKA 2BH2A 3CXRA 1E3WB 3ADPA 1VIMA 3BFKA 1M2VB 4EIWA 2XZDA 2IKQA 2K5UA 2XPCA 1N6IA 1A9XA 3G7NA 4JLSA 4QM7A 1N0VC 3P2KA 1JL3A 2NGRA 2O8NA 5DP2A 4A0HA 4RTSA 4KR6A 2DPGA 4JT4A 1Z0ZA 3O6VA 2GN6A 1ZC3A 1QHIA 4NZ9A 3WAGA 1HK7A 4C6RA 2GSWA 2ZYUX 4A8JB 1E6LA 5KWIA 5REQA 5B1HA 3EZXA 3LPCA 4KXXA 4W7IA 1D2CA 4B3IA 2I78A 3OHSX 4X6LA 1RLJA 5GP1A 4CG1A 3QG1A 2A9PA 4ZHQF 1NWCA 4F6LA 3UENA 3UHFA 4JXXA 4YJHA 1QIHA 1W48A 3WJ2A 5HW0A 1NVBA 2VRCD 3AOGA 2YVUA 3WGOA 2CV2A 1E18A 2K7FA 2P9FA 2ZVQX 2I7DA 2F67A 4OXYA 1B93A 2ZSDA 3K4QA 5F2KA 3TTWA 2XUIA 1YUBA 2VRWA 2WJYA 2X40A 5DIZA 3VJMA 3O8LA 1SBHA 1E1MA 5J1TB 1Y81A 3EQZA 1SD5A 4FNMA 2F1OA 4AO7A 1RAAA 1OPRA 1Y7IA 2ONKA 4R84A 3NEPX 4NZOA 3DMGA 4AKEA 3BSYA 1OFUA 1OXTA 2HADA 2AOTA 2I65A 4M1YA 4QX6A 3C3YA 1IM5A 4K9MA 1XDSA 2G04A 2V3VA 2VWGA 4MGHA 4C0QC 1I6LA 1V11B 3EGEA 3FSGD 5EZYB 5LC1A 1KH3A 1SVWA 2ZANA 1SOVA 4Y9RA 3TNYA 1TK3A 5IT0A 3IQZA 1FU4A 2AE2A 4PWZA 3U4QA 4PCUA 4YJ2A 3N3BC 3MD9A 2UXCB 5B30A 1SRQA 1UZMA 3C7TA 1XXHE 2JCBA 3G2JA 3KLPX 1DT5A 5CM2Z 3U3JA 4W9NA 2W5UA 5GWXA 3CLUC 4RXTA 1CD5A 4M9RA 2BFCB 1HYBA 4ZKEA 3RS9A 4M46A 4EFLA 2BCEA 2C9MA 2GTPA 1SMKA 3VNVA 4JLOA 4FGUA 2D74A 4ZCLA 4BKQA 4MWTA 4WK2B 4F7WA 5K6AC 2XJ9A 1VE1A 2ZTVA 3WOVA 2OLKA 3X1YA 3PRYA 1GRQA 3WL3A 3KJEA 1T9GR 1ZUNA 4KE9A 2FSPA 3KB6A 4O1IA 2YHIB 4XB1A 1M54A 5I9TA 1K6IA 3FZQA 2XVAA 3R41A 4U2KA 3UXEA 1APBA 2UYHA 4F8YA 1AUVA 1Z25A 3ASZA 4AJ4A 2EGHA 4PLZA 4LF5B 4I50A 2JI7A 5D87A 1T24A 3FOFC 2WYVA 2XWBF 4ESHA 5H5JA 4H1HA 4DTCA 2HPVA 4LK2A 1JFFA 3U4HA 3ZQ6A 5B37A 4DLNA 3OZTA 4KXMA 2IUFA 1CRWG 4WX2B 3RDPA 4BX2A 3N0TA 3CRMA 3H2GA 3H1EA 2PAAA 1D8TA 3DCYA 5TF0A 3DYIA 4DLAA 3UH1A 5B64A 1OLUB 5DSTA 3RS3A 4B8ZA 3TZEA 2ZR8A 3EIWA 3Q72A 4HS9A 3H6KA 3NPMA 3T7JA 1E0AA 1STOA 4LVNA 1KFKB 2X0RA 2EL7A 3SSMA 3FNEA 4FDUA 4N1AA 1JH9A 1OI2A 4TTRA 1I7PA 1OZAA 1W5SA 3Q8LA 4HLNA 5KWVA 2GS9A 2OG2A 4RFSA 1YB1A 2O4CA 5CFPA 5EN4A 2QAGA 1SD1A 4KBYA 4JL8A 1YHNA 2CHEA 3JYOA 2R25B 3CIOA 1EESA 3ILXA 4YRLA 5NULA 4NFYA 4IZ6A 1L1FA 3NDJA 4L28A 1HFJA 1BHJA 4XD2A 2JASA 2IE0A 1EK6A 2PYIA 2F9MA 2RI0A 1JEOA 3FF1A 4MUYA 4EGQA 3ZNPA 4CPDA 1XZEA 4K6GA 4F5EA 5KOJB 1ZH6A 2XNDD 4D6XA 1BMTA 2XCLA 3DZGA 1GPDG