3KKMA

Crystal structure of h-ras t35s in complex with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
155
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 155
sequence length 166
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkmA00
2A2ZA 4HLQB 2WSMA 4W5JA 4OK3A 3EIEA 1DPFA 1JEDA 3QF7A 1B23P 2O8CA 2TMKA 4QC2A 2ORVA 2D06A 1Z3IX 4YMSA 5IK2A 3U3RA 3X2SA 2EYUA 2OBMA 4C3ZA 2VYFA 3N5CA 4PHHA 2ODNA 5EE9A 3AB3A 1U2RA 1UF9A 4LJAA 3S1AB 1IAQA 4OQNA 3F0TA 2GXAA 3A4MA 3GFTA 4CT5A 4D4MA 1KI9A 1MKYA 3AVYA 2MSEB 4QBGB 1XTJA 4LBYA 1COWA 2A5GA 3W5JA 1NVWQ 3LAWA 1FNMA 3NHAA 3QVUA 1ZP6A 4I4LA 4NCHA 4U5XA 5CM9C 5DLQC 3TUJC 4R7ZA 1M34E 2QM8A 1OXUA 1NBMA 1WB9A 5BYJA 4MDEA 1KI3A 3PCRB 2CHGA 3B2EA 1LVGA 4Q4JB 3EA5A 4LPKA 2QAGA 2ZANA 4DWJA 1FZQA 1SKYB 4PQYA 2ZETA 2C04A 1WBBA 2VP0A 5TDHA 4B3FX 4PFSA 1CTQA 4TMXA 1QHSA 3D31A 3A8TA 2B21A 5EQTA 2OZEA 3BE4A 2CLCX 4Q19A 1EG7A 3FMIA 5IF9A 1W44A 2GNOA 3KB1A 1H8HA 5JI2E 4LDJA 2ZJ8A 1E79D 2ZEJA 1Q1ZA 3L8ZA 3PENA 4IKEA 4UNPA 2PX0A 1NN0A 2XNDA 3B82A 4KFUA 3WP1B 4N3NA 4RZ2A 2Q9CA 3D7MA 1U90A 3THYB 4PC2A 3BFVA 1J90A 5JS8A 4UJ3A 2ZI9A 2WBLC 2A3RA 4Q9LA 4BRUA 1ZUIA 1K5DA 3BIFA 3RS2A 4KCGA 4DDTA 2QQEA 2IUTA 3VX4A 1XD8A 3IGFA 5EP3A 1GUAA 1OIVA 2GJ9A 2IA5A 5E7JA 1ANKA 2Z6VA 4CVNA 1OFTA 2J5XA 4DRZA 3W6OA 1E2EA 3AVUA 4A6PA 2ZJZA 4Q1FA 2IW3A 2ZPTX 1R4AA 3BD9A 2J9RA 3MCAA 2QT0A 2FPLA 2FNAA 3GLFE 4NDZA 5HKKD 3QPWA 4NCKA 3VMFA 1XMSA 3EZ7A 2JAQA 5DO9A 4M22A 3EW9A 3L82B 4Q66C 3DVLA 4C0JA 3GLGE 2OE2A 1I2MA 2GXUA 2OBLA 4DLZA 2W58A 2BMDA 2YKGA 4HUQB 3FHOA 4ZDWA 3OIUA 2FU5C 4OI0A 4URYR 3TMKA 5CM8B 4JLBA 3T1VA 5CB8A 4I81A 5JSZA 3OEED 3SYKA 1G3MA 1E2MA 4NL4H 2AXPA 5CK5A 3IHLA 1NN1A 1P75A 3ZD6A 2FG5A 2N42A 5H70A 4OHYA 4TZ6A 2OESA 2R6AA 3O8RA 3UG6A 2PT5A 4UNRA 4HUTA 1E0AA 3EWSA 5KDDA 3WYFA 2Y8EA 5TARA 1OT3A 2O52A 4KHZA 4H9GA 4XTRA 1VMAA 4P32A 5L3QA 2ZE8A 4KITB 3GJ4A 2PLRA 3K0CC 4C0KA 2QROA 2GZAA 4II7A 3PR1A 1IBRA 1ZU5A 3JVVA 1R0ZA 3CRW1 3QVVA 1N6KA 2XOKA 4P4SA 4TWZA 1FTSA 2G1JA 2PL3A 2GETA 2YC4C 1FP7A 1DOAA 1T0JB 3EXAA 3HYTA 4Z1MA 3KKPA 5CLQA 4OI4A 1BIFA 2F1RA 1E0KA 1RRFA 4IDHA 4AYWA 4KFTA 1F2TA 4I1SA 3RS4A 1P2UA 1II0A 4TQAA 1G21E 2V6IA 2V55B 4M53A 4QOSA 5FOXA 5FOVA 1CJMA 3QKRB 5J4YA 1KO8A 4FMDF 3OIYA 4IOJA 4RZXA 1ONBA 3T1QA 2J0UB 1Q44A 2ZU6A 3AP1A 4NH0A 4B48A 2PZGA 2JLUA 2H7VA 1TL7C 3FKSD 3VR3A 1G7RA 3CO5A 5EE1A 3TNFA 5FPYA 3VNUA 3VU9A 4BWYA 1VG0B 2OO7A 3W8RA 4CEJB 5JJIA 1VIYA 3LVQE 3I8SA 4Q7LA 4I99A 1ZW6A 3NBZC 1A7JA 4D4KA 2WKRA 1ESNA 4CEHA 1ZM7A 3RRNA 1NJGA 2C9OA 1YR9A 2ORWA 3OFND 3CKLA 4G0NA 4TYYA 4YMVA 3IEUA 3CZPA 1W49A 3I1FA 2G1KA 1BYUA 5AK0A 2NQ2C 1K6MA 221PA 3UIEA 4WZAE 3IUYA 1IOZA 3OE7A 3IQWA 1GVNB 5J40A 3PUXA 4YXWD 2D74A 2HUPA 5LBIA 3KJIA 1VG8A 2QSYA 4M1TA 1NG9A 1W5SA 2H18A 4LHXA 2ZVPX 2JLZA 4NCJA 3T5GA 2VRWA 1JAIA 2BKEA 3B1XA 3TSZA 4HAWA 2VHUA 1NI3A 2XJ4A 3AVPA 3VHLB 1XCPA 3NXSA 4LOAA 4HAYA 3GCGA 121PA 3T1OA 1XP8A 4D6PA 4N0EA 3RRYA 2BMFA 4DLXA 2J3EA 2J0QA 2ZR9A 3NIBA 2W6JD 1T9HA 1TEVA 2WSSD 1OFUX 3THYA 1KK0A 3EC2A 3P4XA 4OQFA 5FOWA 3QIAA 5G3YA 4DCVA 4HAZA 3B7GA 4XD7D 1G8GA 1QVRA 4YMUA 4B44A 1IONA 4XVRA 2AK3A 4ARZB 1XB2A 3R8CA 3IBGA 2OG2A 5KNCA 5CIWA 4JLPA 1Q3TA 3JZMA 1ESMA 3BB3A 1WE2A 5KTYA 2AXNA 4R2IA 5BN5A 2NO6A 2MMCA 4M0LA 3ECCA 1Z29A 4BZQA 2CL0X 5B58C 4KBGA 1QHHB 5FH9A 2XGJA 1JR3E 4EFMA 2QBYB 4U00A 4ZDJA 2GBLC 1ZJ6A 3NC1C 1OFHA 4TYPA 2XNSA 3AF0A 4LBZA 4KYIB 3SS8A 4DVGA 3ND8A 4OBEA 2G88A 3CH4B 3U44B 2J87A 4MKHA 1TX4B 4B73A 4TSFA 2CBZA 4M9QA 2O8FB 4EQ6A 4RCYA 5B2ZA 1JALA 1E2HA 3SU8A 3VKWA 2F55A 1DO2A 4A8JC 2IYTA 4P0TA 3VNVA 3ETLA 4HUQA 3KQNA 4PHTA 2YOHA 3U7GA 2VO1A 5EXPA 1S96A 2PEYA 2ZYTX 3AGPA 1MV5A 3PVSA 4NYMR 1RIFA 1VHTA 2ZJBA 4PHGA 4B3DA 1R0XA 1GRQA 1VECA 4Q9IA 1E3MA 4B74A 1NBME 2JJ2A 3J81k 4C2TA 3QKSB 1S3SA 4ZDIA 2GJKA 2ZITA 4F38A 3B1VA 3I32A 1X1RA 1E9CA 3OEHA 2JJ1D 2DB3A 3R7WA 3HPQA 2FH5B 5L8VA 5K8UA 1SZPA 4NBSA 4LGMA 1R7RA 5AJXA 1ZU4A 5FI1B 3SYLA 5BYKA 4HB2A 4X8LA 5CB6A 1S8FA 2QA5A 1CJTC 1KNQA 1WMSA 1N0UA 2V1XA 4PXAA 4H1UA 1XEXB 4Q4AB 3CR8A 4YXWA 2IHBA 3AUXA 4RD1A 4O2LA 2EWWA 2W83A 3TAUA 2RGXA 2FEOA 5AUNB 2B8TA 4FCTA 4EPTA 1X8KA 4BECA 2GTPA 3CRRA 3MUFA 2Q9BA 4CDGA 1HE1C 4GP6A 4FWIB 2IS6A 2GZHA 4DCSA 1CR4A 1N5IA 2QGNA 4HDOB 4OI1A 2HT6A 2XAUA 3GJ5A 4JLMA 2RHDA 1VTKA 3RC3A 2P65A 1XFAA 4RSGA 2FFHA 1LB1B 2YWFA 3X1WA 4B6FA 2WSSA 3K0FA 1WBDA 4XD7A 3WRYC 3W8NA 4G5QA 3GLIB 2PT7A 3A36A 5JJKA 4HEJA 3UMSA 1MO6A 3B85A 4WIAA 3SJAA 2IK8A 4XVQA 4C0HA 2VH5R 1KYIA 3ZVNA 2IL1A 1ZD1A 5FBQB 2IX3A 3BB1A 2ZSDA 1VPLA 3B78A 3FMOB 4HLUC 2J1LA 4US2R 3GFOA 2YOFA 1YZKA 3B9QA 3TR5A 5JHHB 1BKDR 4B2IA 5B64A 4ASUD 5C18A 1X3SA 1CEEA 3DKVA 1E94E 3KX2A 1FUKA 3MWJA 1EX7A 1CR0A 3PUVA 2EFCB 1NMYA 2XJ9A 2CJWB 5HE9A 3QXJA 2VBCA 1DS6A 3AF3A 2X2EA 4QJ4A 4D80A 3EPKA 2REBA 4B47A 5AUOB 3LQQA 3C16C 4JYCA 5JI3E 3AVVA 3GJ0A 2PX3A 2A5FA 5CJPA 2FWRA 3KTAA 4JBWA 4Y0VA 3ZQ6A 4Y0AA 4R9UC 2O8EA 4TQUS 1G5RA 3VR1A 1ZC4A 4DSTA 4TMTA 1EX6A 1II8A 4O2RA 2ZXUA 2BBTA 3DOFA 1Q22A 4AC9A 4A8JB 2HYDA 3B5JA 3ZLJA 2FSFA 2IYLD 4PAQA 1Z0KA 4L9WA 3RABA 2J59A 3K8YA 1HH4A 5G40A 1EWQA 3CPHA 1D9XA 1W4RA 3CRVA 5HTKA 4DUGA 4QJ5A 5E7IA 2BDTA 2HCBA 2I4IA 4JJKA 3THWB 1PLKA 3AKCA 3NG1A 1LFDB 3ZD7A 1E2GA 4LC0A 4F93B 1JJ7A 4F4CA 1NG1A 4NYJR 1DARA 3U7EB 5IDVA 2OSBA 1CF4A 3OAAD 4TL9A 2BOVA 3ZVRA 5LD2C 2RGDA 1DVRA 3FVQA 2JDIA 2VPPA 3WYAA 2H8KA 2G77B 5DI3B 4OQLA 1G6OA 4NYMQ 4A2WA 4EDHA 4Q1BA 1P62B 4C0BA 2AHOA 2ANCA 3MGCA 1Z0JA 4FCWA 3K0CA 2BBSA 2UVQA 2WAYA 4RZ3A 4D25A 1G7SA 2VF7A 4PTLA 4Q00A 5HCIA 3OESA 4IOLA 4FMCF 4RFSA 4Z8XA 4BFWA 4KLZA 1KI6B 1U81A 2VP6A 3LNCA 5H8WA 1TF7A 4JVNA 2RHMA 5EP1A 1ELOA 1GNQA 1RZ3A 4ZIRB 1JBKA 3GEIA 1OHHD 5SZIA 1AKYA 1P9WA 5G3ZA 5JECA 1NMZA 2KJQA 3W3AA 1UEJA 3HU3A 2ZRHA 4BFXA 1J8MF 4XIGS 1XXHB 3WBJA 2MMGA 4C0AC 2BBWA 4CZ2A 4K81B 1KI4A 1E9RA 4JLJA 1SVIA 1GRRA 1E2FA 3NWJA 4B3XA 2G83A 2ZRKA 1RJ9B 1N0VC 3AKEA 1W4AA 4IDNA 1GKYA 4DDWA 3MD0A 5FTKA 4EPYA 5CJ2A 3QKUA 3QF4A 2ZYUX 1P7CA 2IYSA 4IFEA 3LX8A 1X8JA 4L5BA 4V0KA 4Z51A 4G5GA 4TQ9A 3VR6A 3U7HB 1SKYE 3AVQA 2VIIA 2YVUA 3TW8B 4BZXA 3I3SR 3CNOA 1AZTA 2VQSA 3EASA 4Q4HA 5H68A 3WY9A 3H0KA 2SHKA 3FMFA 3OIVA 4JT4A 2QE7D 2WOJA 4S35A 4E09A 4YQFA 3W3ZB 3I5XA 3AVTA 4LSGA 4QGGA 1JAHA 1OXSC 4RFVA 4HAXA 2MSCB 1PV4A 1FQKA 2R9VA 3NEYA 5JJLA 1US8A 2X19A 1I4LD 1SXJC 2J0VA 3EZ6A 1GL7A 1HUQA 1QF9A 2FJUA 4C4PA 1CIPA 3BC1A 4ESHA 4BFVA 3GP8A 1N3BA 3WMFA 1ZCBA 2ATVA 3A6PC 2OAQ1 1KDPA 3RNLA 1YVDA 2FV8A 4URXR 1XD9A 1NL3A 1ZM2A 4QHYA 4EIWA 1V5WA 4MQBA 4Q48A 1LV7A 1SVOA 5FTLA 2C5LA 1E0JA 3EZ9A 1COWD 5EJEA 3EX7C 1Z2CA 2X77A 2C9CA 3T61A 3C5CA 2P3SA 1KSFX 2QMEA 1NBMD 1MO3A 2FPKA 3OAAA 2O0KA 2QM7A 2XTZA 4G5SA 4MITA 1G64A 3Q85A 4XH9B 1W36D 1L8QA 1AGPA 3QEOA 4LHVA 3VHXA 4NCIA 3TUIC 4RVCA 4NTZA 2P5SA 3A1SA 3FE2A 2FF7A 4UXJA 3LLUA 2P0EA 3TQFA 3WP0A 1XJCA 1PLLA 4D4LA 3CPJB 2XZPA 4F92B 1YR7A 4JJZA 4YMWA 3HDTA 2REXB 4FCVA 2BV3A 4KAXA 1QDEA 2NIPA 4M1KA 4DJTA 5EXXA 1SVLA 3NBXX 3GLHB 5JBQA 2C78A 1GWNA 2GBLA 1JEEA 3CUEF 1HTWA 2ZYVX 4S2EA 2WPDA 1FFHA 2NZJA 1KSJA 2YV5A 4PZZA 5CDFA 1RRGA 2JJ8A 1QRAA 5DIFA 1Z8FA 1S9HA 4HZUB 5FBRB 3EZ2A 2RGAA 1JQLB 1L2TA 2ZS9A 3AV0B 4Q03A 4NE2A 4DCTA 3PEYA 2G9NA 1NRJB 4IOMA 1KZ7B 4ERNA 4QHSA 5C1BA 5JS7A 5F9HA 2VTKA 4A8JA 2IYZA 5AUPB 2IYUA 1VYVA 5KYKA 1P61B 3FYHA 1H8EA 3CM0A 1EFRA 3TKLA 5LDDC 1ZBDA 2GRJA 4TL6A 4UNNA 5C2JB 2KB0A 1YKSA 3CW2A 3PEUA 4Q1DA 4F4IA 2AX4A 2G0TA 1RRCA 2LWIA 4TYNA 1YZGA 1Z06A 4GP7A 1N6HA 4IOKA 3UMRA 5KOYA 1N6RA 3BH7A 3K0AB 4QJ3A 2DYKA 2FMXA 1TF2A 1Z6AA 2IBMA 3M6AA 2WKQA 4M21A 1HQYE 2H1LA 2ZR7A 2OEPA 1NNEA 3HU1A 1AJEA 2JIZA 2QE7A 4O25A 4RD2A 3IEVA 2QP3A 4KI0A 1T8TA 3ASYA 4NP6A 5EUQB 4JKYA 2DFKB 2NZ8A 4HAVA 5EP2A 3SOPA 2F3RA 3F5FA 2J7PA 3I4LA 3X1DA 1PUJA 4TYWA 1C1YA 3ICQB 1S1MA 3RRMA 3U6KA 4JBYA 4OYHA 1ZM3A 4LJ7A 1BYIA 1T3HA 1SXJB 1BO6A 1E32A 1ZRHA 4JIMA 1R8SA 2PJZA 4GPTA 1KI6A 2JLSA 4PAOA 2H5EA 2EVWX 2FFBA 2QMUA 3D6TB 1G4UR 1ZYUA 2R6DA 2D62A 1AQUA 4ZIRA 5F9FA 1KDOA 1XD2B 1VG9B 3EG5A 3THXB 3U4QA 1OB5A 2PCJA 2QNRA 4M9XA 4U7DA 2ZYWX 2O8DB 3CF6R 1E4YA 1E9BA 1Z83A 3MMPA 1GL6A 2OFWA 1VYTA 1IN4A 4RY2A 2IYQA 4OL0A 3DOEA 4TMVA 5JFGA 3SNHA 4L8GA 3UK6A 2XOKD 1RJ9A 2A78A 4DBLC 4UQOA 2OLKA 5F2EA 1CULC 4GSYA 4OQXA 5E95A 4Z1MD 3KDSE 2HV8A 4XSGA 3C8UA 5FPSA 2WOOA 4B43A 3KJGA 1AK2A 2I3BA 3MJHA 4HLUA 1ZIOA 2HF8A 1XTIA 5CK4A 1Z08A 3MJRA 4QNMA 2OLJA 3T06B 4RCZA 5SZKB 1UBEA 1IY0A 3I73A 2L0XA 4PHFA 2VP4A 2ZI7A 5H1YA 3WNBA 2RH5A 4WOPA 2XTNA 2ZRJA 4IDPA 2XXAB 5JCPA 1DBSA 1KI1A 2BCJQ 2RB4A 4G5RA 3EPJA 2H17A 3PIRA 4JVMA 4L15A 5CYOA 1KMHB 1FX0B 5DISB 2ZSEA 4NHOA 4PO8A 4H1VA 1KGDA 3Q9LA 1NVVR 3LW7A 5FR1A 3SDZA 2QEQA 1XPUA 1C9KA 2ZSAA 3H86A 1GP2A 2WJVA 4F91B 3CRMA 4M2LA 2GDJA 2ODBA 2WIBA 2XB4A 4C2UA 2DCUA 3A37A 3SJBA 4JBXA 2FZLA 5TXGA 4Q9JA 2GK7A 3K0EA 4AKHA 2CEAA 1MT0A 3NHBA 1KO4A 3M0EA 2W0SA 3OE7D 1QG4A 1R6BX 2CCGA 4C0LA 1YZNA 1UEIA 1U99A 5FBLB 821PA 1G8HA 1KSHA 4G5OA 2OV2A 5FBWB 4XWOA 4M9ZA 4ZI3A 3TUZC 3L0SA 2DFLA 4KVGA 4LZZA 5HPYB 4DLSA 3W90A 1JNYA 4DHEA 2ODWA 5J5CA 3CNLA 1XTSA 4Q7MB 2QORA 1KY3A 4DZZA 5TV2A 1KIMA 1XCGB 3VAAA 4MYTA 2GWHA 2O8BB 2XITA 3C4JA 3QOFA 1OLOA 2YWEA 4AG6A 4LUCA 1WA5A 4M4SA 4B71A 4KFRA 4D26A 3W6NA 2QMOA 2YOGA 4LRWA 2WTUA 1GAJA 3SC3A 2GF9A 1XRJA 2ZTSA 4B32A 3KQUA 4MDFA 4O3MA 3A1TA 2JGNA 1IXSB 1TUEA 1BH2A 1UKEA 2VSOA 2GCOA 4P3YA 4DLRA 3SHWA 1RRPA 1IN5A 3BH6A 2FFAA 1VYUA 2UKDA 3AP2A 4W5WA 2GJSA 4WXRA 1E69A 1X6VA 3DO6A 2P67A 5HZHA 1QBKC 4RKEA 4X8OA 1ZCAA 3FFBA 1FMJA 4IXNA 1XPRA 1VCMA 5JWOA 4LYHA 2YWHA 4V0NA 2C98A 2QL6A 2IS2A 2BMEA 2GF0A 4IRUB 2ZREA 4PQRA 4M1MA 3SFVA 1N5LA 4GZLA 4YC7A 1IJFA 3GJ7A 4QHTA 4GZMA 5L3SA 2XB2A 3DKPA 2NPIA 1XMVA 4TSFD 1KK3A 2ZRAA 3RS3A 3LQRA 2C9YA 3IIKA 2GK6A 2IUUA 2CCKA 1T3SA 2E9SA 4OI2A 5JEEA 3P32A 4G3XA 1Z6TA 1TUIA 3FB4A 2J45A 1DEKA 3ZVLA 3K70C 4U02A 3AEZA 1AS3A 1AM4D 2VP2A 1XTQA 3B1YA 3R9WA 1SXJA 4BPBA 1CU1A 1G8YA 4MGYR 3LDAA 5F3WB 3L8YA 3V4FA 1T91A 2JJ2D 5AWFC 2ZU0C 2FEMA 3AM1A 3S1AA 5KO2A 1ZIPA 2WM9B 1AS2A 2RMKA 1KKMA 2R62A 3OEHD 3RLFA 3B1ZA 4AI6A 1NKSA 2HLDD 3Q72A 4EUNA 3LBNA 3D3QA 1G8FA 1B0UA 3THXA 4TLEA 1K8RA 5GVRA 5IT5A 4IJMA 2UZIR 1OIWA 4D82A 2P6NA 1ZNWA 3HJNA 4PPFA 2IEZA 3I8XA 4MH0R 1Q1QA 1XMJA 1YZQA 3ADCA 1YR6A 3K9GA 1G6HA 4Q4JA 4EPWA 4PX9A 4A2QA 1IXZA 1GITA 2IF2A 1OYYA 2OCYC 1SKQA 2O5VA 3A58B 3LD9A 2Q9AA 2DY1A 1X1SA 2ONKA 1SHKA 2XZLA 1OV4A 3IKJA 1AN0A 1GOTA 3NEJA 1DAMA 4CT4B 3DM9B 2I1QA 1FOEB 2YZ2A 4FXPA 5EXTA 3SN6A 5CDFE 1WDTA 3IBYA 1NY6A 4LHZA 2RGBA 3O8CA 1UADA 4HSEA 4B3CA 2QENA 2YNMA 2PH1A 1FP6A 1EXMA 2Z4SA 4HI0E 2VHJA 3PEWA 1GSIA 4HDQB 5FOTA 1ZNXA 3RC8A 2R6CA 3GJ8A 3QBTA 4HDCA 4P33A 4WW0A 4A4DA 1XNJA 4Q1AA 2WJHA 3CZQA 4ZDKA 2ZRBA 2ZM5A 3TK1A 1VG1A 1U8ZA 1W0JA 3A4LA 2Q21A 3JVUA 2V3CC 1YQTA 5G53C 4DDVA 5EZ6B 3K9LA 3PUWA 4RD6A 5E7MA 3W6PA 1U98A 4LWZA 2RGGA 5FUYA 4CRWB 5F98A 3T5DA 3BAFA 5C4MA 4QM7A 5E4FA 2GA8A 2HJGA 4ZCIA 4X8MA 2V1UA 2GXQA 1RPZA 2C03A 1ZD8A 1UJ2A 3X1YA 2VL7A 2VSXA 5P21A 3U3OA 2G6BA 4RD0A 1MRSA 2FX3A 5AR1A 1ETUA 1GRNA 2R6FA 2ZSFA 4QKQA 1ZAKA 2FSIA 4PPGA 1E9SA 4R98A 4JKIA 4WAUA 1E9FA 4CEIB 3SEAA 3SJCA 1UKVY 4L4UA 4PR0A 1EFTA 4IVPA 1KMQA 2FN4A 4DB2A 2W2TA 1CJKC 1P5ZB 3L43A 4PSKA 4DXAA 2ZUBA 5K8IA 1QZXA 4PSAA 3QY0A 3GLFB 3CIOA 2ERYA 4PO9A 1E9EA 3BFXA 1IY2A 2CVFA 3QXXA 3IO3A 1ZMXA 3EPHA 4DUGD 3GLGB 4BLQA 4OK5A 4LV5B 1AQYA 2WWIA 2WJIA 3OZXA 5JEDA 2QY9A 1T0HB 1P6XA 3REFA 1HT2E 2GZDA 2A9KA 5LPNA 2NO0A 4PZYA 3RWMB 2GESA 4Q7JB 3B6EA 4YDHB 2P6RA 3ZS8A 2HLDA 1NLFA 3CX8A 3FHCB 1W7AA 4K8OA 3GJ6A 4ACBA 4MRNA 3K70B 3QUSA 2LCFA 4LHWA 1Q1BA 2JDID 4IFBA 5L3RA 2WWYA 2ZI3A 3PUYA 4TT3D 4HLDA 2OCPA 5GJWC 5DYGA 2IYVA 3AP3A 4JLAA 1GFIA 4Q7KA 2XEXA 1SQ5A 3EIQA 3P4YA 2ZR0A 3HYRA 1YZTA 3UWKA 3ZZ0A 1N5KA 3C41J 5IHPA 5KUTA 4JLOA 2O0JA 3U6BA 1EESA 4MRVA 4BLTA 1OYWA 3MSXA 5FL3A 3WRXC 2QSZA 4BFSA 4JVLA 1RFLA 2Q3HA 2N46A 1KSGA 5TMPA 2BKUA 4DC9A 2OILA 1HA3A 1TQ6A 2ZUCA 4QL3A 3X1XA 2D2FA 1P2VA 2AN9A 5SZHB 3TW4A 4ZKDA 3QKRA 4MGKR 1Y63A 2KE5A 2BJVA 2J0UA 2IYWA 2CHQA 2QAJA 4BQSA 3FOZA 1DG1G 1ZINA 1XU4A 3B13B 3WBKA 1Q1EA 1ZM9A 3IPYA 4BFUA 2ZQ5A 1L4UA 5FUVA 4L9SA 8OHMA 4CF7A 4CEJA 1ZNYA 5J47A 4GOXA 2JASA 6Q21A 3AVOA 3G5UA 4FW9A 2JCSA 1XZPA 1ZNZA 2QQ0A 3QE0A 2P6UA 5FUWA 2LKCA 2Q0HA 4GMDA 4AG5A 3G82C 2H92A 1P2TA 4DB4A 3Q3JB 2CLSA 2RAPA 3DEFA 1J2JA 1N6PA 3CNNA 1G4AE 3SZRA 5D3MB 4JLVA 4ZKEA 5AJVB 1E2QA 2HF9A 3T35A 4TZ0A 2Q6TA 1J70A 1E98A 3R9IA 3AH8A 4DSOA 1E1RD 2ZRMA 1KK2A 1J8YF 1NSTA 2V9PA 4A0GA 2EQBA 1F6BA 3VKHA 1E99A 3TE6A 4EAQA 5KSPA 2WIAA 2CHVA 1SGWA 2NG1A 2F6RA 1XF9A 2PMKA 4M8NE 2BMJA 1RYFA 2B92A 3NC0C 4IEEA 4Q1EA 2QPAA 4POAA 2WJJA 1OJLA 1IM2A 5D3QA 2QI9C 2ZE5A 1KO5A 4PAMA 1DG3A 3CX6A 3O8DA 4LPSA 1MABB 3WHLA 4NKRA 4QGFA 1VCIA 4Q02A 4D4JA 3P20A 3MWLA 3CF0A 3QXSA 5TB5A 2CNWD 2WWWA 4ARZA 1RW4A 4BGDA 3RYTC 2YJTD 1XEFA 2VF8A 3LA6A 2DR3A 3LW8A 2EYQA 2ATXA 2OHFA 2BHRA 1DTSA 4MGIR 2AFIE 3N2IA 4TT3A 4WZBE 1UFQA 3LBHA 1OPXA 1DELA 4HAUA 1Z63A 4EJSB 3P27A 4K46A 1QHHA 4DLUA 4XJXA 5FFMA 4OKSA 4DT1B 1V43A 2GAAA 5KHOC 4LV6A 1P60A 2QBYA 3R20A 1Q3HA 5BN3A 3ADKA 3FTQA 4LYAA 5BXQC 1HYQA 2IHYA 5AJYA 1NJFA 2WICA 1G8PA 4FIDA 2OCAA 2NOAA 4DSUA 2PCLA 4JL5A 1F2UB 4OHZA 3U44A 3A1WA 1D6JA 1P73A 2CMKA 2EW1A 2EFDB 1E2DA 2WPDD 1W48A 1J99A 2GJAA 5GJBA 2O8FA 4DLTA 3UMFA 3UKDA 3BOSA 3F3YA 2RCNA 1SXJE 2VSFA 4A1FA 4AY2A 2OXCA 1GG2A 4C7OB 4KSCA 5CIQA 2QZ4A 1DAGA 4B2LA 4I1VA 3E1SA 4DCNA 1XMIA 4TMKA 1JQJC 3TIFA 4NYIR 4TL8A 2ZRNA 1OH7A 3AQ4A 1M7HA 2O8CB 1D8TA 2ZE6A 4OK6A 1H8ED 1YJ5A 2IYYA 3F8TA 3PUZA 1EFRD 3TJZA 3TSWA 3UXMA 4D81A 3QKSA 1W46A 5BWMA 2WHXA 1WRBA 1OSNA 2IEYA 2RGEA 2ZJAA 2QMHA 1KHTA 1I4TD 4V0OA 3ZZTA 4FI3C 4MUAA 3R8FA 4GL2A 2N1BA 2ZUDA 2ONJA 3I62A 1D5CA 4JSYA 2JIZD 4M1WA 4DCUA 1XEXA 2FE4A 3NTUA 1G17A 4Q4AA 3U3MA 3E70C 1YZLA 1E1RA 2CXXA 2GEVA 3AF4A 1P9RA 4IW3B 4KYUA 2QAGB 2J7PD 1P4SA 1X8LA 4JS0A 3ND9A 1VHLA 5DGXA 4KO8A 5G41A 2OUKA 4ZO4A 4JLKA 2ZJ5A 2A7QA 4LJ9A 3RS5A 1GIAA 3WHKA 1GTVA 2F43B 2ZI5A 3P26A 4B3GA 4KVAA 1YU9A 1NN3A 4P4TA 1E2PA 1PZNA 1G5PA 4MYCA 3TGPA 2R44A 1DAKA 4LC1A 1D2MA 4MRRA 5CLLA 3EWAA 2F3TA 5JLJA 3EAQA 1G5TA 4AWXA 4TLDA 4ZCLA 2AK2A 2YHSA 4KODA 2E1RA 4TL7A 2BJWA 2ZRGA 4PANA 3RS0A 4BLSA 1JXOA 3BS4A 1R5BA 5DHFA 1QHGA 4IXMA 2ZAOA 4P31A 4CIDA 3GLIA 4YLGA 2CNWA 4C9BA 1VCOA 4KU4A 5FPHA 4BFZA 1YR8A 5DN6D 1OH8A 4W9MC 2REOA 2ANBA 3A1VA 4RZUA 3I61A 1HEIA 2IYXA 4F4JA 2OFXA 2KBFA 4OJQA 2F9LA 1CXZA 3L2OB 4JLDA 2ZRIA 3AKDA 1OH6A 2VHTA 1JI0A 4G01B 3PJRA 4BLRA 3KZ1E 1DAIA 1IJEA 5C4GB 4RD3A 1Q20A 2EFEB 2E87A 2WJGA 2V4ZA 3BB4A 2CJWA 1OFIA 3PG5A 2IWRA 4JL8A 4GMXA 4NCNA 4NYJQ 3PXGA 3DHWC 5KSOA 1UAAA 2QP4A 4MA4A 1I4DD 2ZI4A 1DO0A 3NBYC 3L0OA 1ZUHA 2F7SA 2VLIA 2GHIA 4YMTA 1JJVA 1NVUQ 1XZQA 1TQ4A 5DNYB 3GD7A 3TQCA 2GKSA 1J7KA 3RDPA 2C99A 2IS4A 2EU8A 1UPTA 4JZKA 3ZJYA 1KDTA 2QU8A 4DIDA 1C4OA 1JB1A 3EZFA 4W5HA 4XTCS 2KI5A 2ZI6A 3KB2A 5JHGB 3TVDA 5BN4A 4JL6A 1OKKA 4CYMA 1EFHA 5JSZB 1R10A 4LBWA 1SULA 5DI9A 1KAOA 4AYTA 3KQLA 3AVXA 3THWA 3THOA 2CK3D 2A30A 1NIJA 4EPXA 2JEOA 1JPNA 1UKYA 2OAP1 1MOZA 1NSFA 2AD1A 3LRPA 3ADDA 3Q5DA 4LYJA 1FPMA 1M8PA 2B6HA 4UKDA 3R9XA 2O0HA 1G3IA 4XOIA 4TLBA 3KXIA 1MH1A 5L3QB 2IUSA 3HWSA 5DI3A 2IC5A 3FDIA 5HR5A 3TR0A 1W1WA 1LW7A 4UXIA 4PPQA 5LB4A 4A15A 1MR3F 1CR2A 1JXMA 2Z43A 3E2IA 1W0KD 1WXQA 3CB4A 4P4SB 4UNSA 1CBUA 5EZ5A 3UANA 3KUCA 621PA 4HB0A 2W2VA 4LJYA 2ECKA 3C15C 1QHNA 1FNNA 4J0QA 5TVKA 2V7QA 3U2QA 1NVXQ 4AKGA 2C96A 3EA0A 3C7KA 3KKMA 2OBNA 4O0MA 2H16A 4RD4A 2XZOA 1PJRA 1BOFA 1GKIA 2WWGA 5JWHA 1HY3A 1F2TB 2OFOA 2WMOB 1QHYA 3LVRE 4GI7A 4QGAA 1R2QA 4PC6A 1TMKA 2WAXA 1Z47A 1KZGB 1N6IA 1NIPA 2QRZA 4QGHA 5HE8A 4WXPA 1TPZA 1YE8A 5E3HA 4LYFA 1CRPA 5FI0B 1XXHA 2F1HA 4XWKA 4PO1A 2DWOA 5AUQA 2IS1A 4TLAA 4ABYA 2X1VA 3RSLA 5DN6A 3D8BA 1F3OA 3VU9B 3ZYCA 5FPKA 4MKFA 1CJUC 4LJ6A 1W4CA 1XJ0A 4MYHA 1S1CA 1EFCA 4E03A 1DADA 3QXHA 5HCNA 1N6LA 2NPFA 4CEHB 3V9PA 1GL9B 4BFYA 2CL6X 2FSHA 3OF5A 2ERXA 1Z28A 4AD8A 3O8BA 3C14C 3TBKA 1CLUA 1UDWA 2W0MA 1G291 2B8WA 2NO9A 4HLCA 2BWJA 4B33A 2HT1A 4ON9A 1TEXA 5KSYA 2NMVA 3B1WA 3HR7A 5B30A 4A9AA 2HXSA 4OHVA 1LF5A 2WJYA 3SR0A 2FSGA 4A92A 2FGJA 4BUJA 2VHCA 2F43A 2Q3MA 4Q9KA 2F1IA 1IN7A 2AL7A 1ZM4A 1KNXA 1SXJD 3V4RA 1E2NA 1TTTA 3BH0A 4JLNA 4LX0A 4D0GA 4E22A 1G18A 2W2XA 3CF2A 2PJRA 1PLJA 1ODFA 4FMBB 1WP9A 5J4KA 4YDSA 3BWDD 2DBYA 1YZUA 4X8HA 1F48A 1S0UA 1N6NA 2VHQA 5FTNA 2CK3A 3BORA 2PEZA 2CLDX 3UWOA 3KXKA 3MFYA 4LJ8A 3ZIAA 5UKDA 2XX3A 1T6NA 3GFPA 2NTYC 1XCMA 2I1VB 2W6IA 5DYIA 1TQDA 1U0LA 3GMTA 2Z4RA 1A1VA 1SVSA 3BJIC 4BRWA 4MYUA 1Q57A 4ZV4A 2JLXA 3N70A 4DLYA 2A5JA 2FA9A 1U9IC 2XSZD 5FL7D 3ICEA 4D0NA 3LWNA 1W0KA 3P1JA 2BBOA 1VKJA 1L7VC 2A5DA 2QPTA 3RHFA 4JVSB 1D9ZA 3GLHA 3DMDA 1KDRA 2OT3B 2WV9A 3QNUA 5EP4A 4ESVA 2J0SA 3AVWA 1TNDA 2KBEA 2BM1A 2D4HA 3TRFA 4EQ6B 2H57A 2IXFA 3IO5A 1BMFD 4PC1A 1SVKA 4RJLA 2PBRA 5EE0A 3K53A 4HZUA 2EFHB 1CJVC 1W4BA 2ZJYA 5K8LA 4LJ4A 1AZSC 1W0JD 1QVAA 2BEJA 3C5HA 4AURA 1D2NA 1VDZA 1EFUA 3SI7A 3G0HA 1ZUNB 3PFIA 1EK0A 2BEKA 2GXSA 4MUBA 1E0SA 4V0MA 2V8OA 2AKAB 4QXAA 4QNRA 3IIJA 1II9A 2GVZC 2OXRA 4OHXA 4Q21A 1RC8A 5LB2A 4DDUA 1KTVA 4XVUA 1Z07A 3TH5A 2AR7A 2FFQA 4M1SA 3BK7A 4DEXA 3WXMA 1KY2A 3SFZA 4TN1A 1U0HC 3QKTA 1DE0A 2WKPA 3K0AA 3R7WB 1G9XA 1MRNA 3ZGXA 1Z6XA 3LX5A 4QM6A 2WWHA 3HP1A 5DHAA 3T12A 1SHZA 1LNZA 3GEHA 2VEDA 2QUZA 4AYXA 3EPLA 1E9DA 2WVJA 2OM2A 2ZSBA 3GPLA 2IT1A 4PC7A 1Q12A 3I5YA 2B7CA 2CL7X 1IHUA 3QXCA 3NH6A 1TU3A 5KNBA 3DPUA 2WWXA 1NMXA 3BXZA 4P4UA 2QT1A 2WMNB 2G0NA 3CX7A 5M04A 2R6GA 1NP6A 4IVRA 4QG7A 4FMDB 1UM8A 1QG2A 2Z83A 2AFHE 4D0LB 2HCJB 5B57C 1AGRA 1XTKA 4GBMA 2VP9A 1OW3B 2GEDA 4NMMA 3GLIE 1E79A 1R5NA 2R2AA 3QENA 4BZPA 5FBVB 1XD2A 4B34A 5J4VA 4FINA 2ZIAA 1Z2AA 3N2EA 1M7BA 3Q5EA 3K0FB 5GADl 2V54A 3B9PA 4AKEA 2O8DA 2JLWA 1E2IA 4Q1CA 2CCJA 1CS4C 1E6CA 1N25A 1U8YA 1KI2A 5FOSA 3SQWA 3LH5A 1D2EA 4MRSA 4M9SA 3QQ5A 1I2DA 1NVVQ 2DFTA 2UZ3A 1U0JA 2XSZA 5FL7A 2JLVA 1NLYA 2HDNB 1E2KA 5FTJA 3VX3A 2FZ4A 3FFAA 3CWZA 2QTFA 2C95A 4HATA 1M74A 3K9HA 2P5TB 3GEEA 1KI8A 2ZJ2A 5BW8A 3W9YA 721PA 2PZFA 4OQMA 1CR1A 2O8EB 5HKKA 4KJZA 3VFDA 3CRQA 2XXAA 1E1QD 5HZKA 1XPOA 1BMFA 2W00A 3FMPB 4LI0A 3WNDA 3KTAB 2HJVA 1GKUB 3IDQA 4A6XA 1KMHA 1R0YA 1FX0A 3IPXA 4TTQA 4D2IA 2QP9X 5J4LA 2AWOA 3NH9A 5ANRB 1F5NA 1II8B 3WNCA 4PC3A 4TLCA 4GRAA 3QBVA 2AKYA 2FOLA 2HEIA 1OF1A 3AGQA 3KKQA 3OEEA 4C0QC 2CVHA 1M6NA 3W34A 3FKQA 3MWYW 3L0IB 5KU1A 2HYIC 3I72A 1CKEA 3DZ8A 2DHRA 3UPUA 1OXTA 3K1JA 1G7CA 3U61B 1IQPA 3QG1A 4UXHA 1P72A 1HT1E 1S4QA 3V00A 2JATA 3K09C 4LCBA 3SYNA 4KXFB 1NN5A 3ZDQA 2ZVQX 5EUMA 2A5YB 2ZRPA 3RS7A 2JA1A 1E9AA 2R8RA 3QEJA 3Q7QA 1TU4A 2OCBA 1G3RA 4PPNA 3FHTA 1OE0A 5FTMA 1E4VA 5DE3A 2RGNC 3LXXA 3WYGA 4CW7A 2QTHA 2FPMA 2B7BA 2O8BA 3VR5A 1FUUA 5DSZA 3IIMA 4RFSB 2DFNA 1S3GA 1R8QA 3IHWA 2ZROA 1T5LA 1XXHE 1DAFA 4BEJA 3KFVA 1KJYA 4QFMA 1GILA 1KAGA 1T8UA 1OIXA 3CR7A 1MO5A 2X8AA 3GJXC 1XBTA 1G19A 4L16A 4GDFA 3CBQA 3AF1A 2P2LA 2DPXA 2NGRA 4LY6A 3LFUA 5EE3A 1Z5ZA 4BLPA 4EJSC 4XSHA 4YONB 1U94A 1KJZA 1N0WA 2IF0A 3CONA 3KUDA 5A4JA 4UJ5A 1WCV1 2D7CA 3LV8A 4HZIA 1AS0A 2R65A 3FKSA 4DIEA 2JLYA 1NLZA 1AKEA 3FWYA 5BQ5A 3SQXA 1W2HA 2EFGA 2PLFA 4V03A 2KSQA 3OIWA 4ILEA 1KOFA 4MKGA 1O87A 3GJ3A 3T15A 1RKBA 3T34A 4BLOA 5FPTA 1HQCA 3U7FB 1GZSA 3QF4B 521PA 3LXRA 3PEVA 3QI2A 3VTKA 3HU2A 1XDBA 4Q4HB 1XTRA 3QJYA 3OFNA 4PSVA 5JRJA 3ONWA 4NPHA 3MRSA 2C2HA 5JCZA 2J46A 4LK2A 4E07A 1KJWA 4EPRA 3KKOA 4V0LA 2MSDB 4AKIA 4A0HA 1YHNA 2AD5A 2C77A 3ZH9B 1LTQA 1US8B 5GJVC 5K8TA 3VKGA 1LY1A 4I1UA 4NZYA 4B35A 1E1QA 4GOJA 2BM0A 2YWGA 4WA7A 2IWHA 4R71A 1OB2A 1BS1A 1U8AA 1Z6GA 1Y3AA 3H84A 3PV0A 3ZQJA 2WWFA 4ITRC 1Q0UA 1EGAA 2ODEA 1SVWA 3K70D 4WVFA 4IDOA 4A2PA 5JWRA 1M7GA 2RKOA 3DDCA 1FMLA 3TLXA 4NONA 3PITA 3KJEA 4CGZA 5EE5B 3B8HA 4FD2A 4JSTA 2FDCA 4Q9HA 4KV9A 2W6JA 1G41A 1KI7A 4URVR 3A4NA 5FOUA 5CYPA 1XEWY 4HB4A 2AWNA 1W36C 2QAGC 1Z0DA 1KO7A 2D3WA 4N0DA 4A36A 2JLQA 4W7SA 1ZD9A 1UKZA 1Z0AA 2X2FA 5TY0A 1UBCA 3QPUA 1SVMA 2C8VA 4IVQA 4BEBA 4DKXA 1W47A 1FW6A 2ZRFA 4ZCMA 2GCPA 3A1UA 3GLHE 1T4GA 2QG6A 2YINC 1R5OA 1NY5A 4MRPA 3AUYA 1FQJA 2YC2C 3EARA 3DMNA 1N5JA 3RVBA 4JT2A 1U9IA 1KKLA 4EPVA 2ZS8A 3TSOA 5KNDA 1PVOA 4DLWA 4DEYA 1S2MA 1R0WA 2QRNA 3H4MA 4Q47A 4XWAA 2V6JA 4V0ME 4OJKA 4Q18A 2IXGA 4EKDA 1JPJA 2PMDA 4TYQA 4ZPXA 1VIAA 2PZEA 3KQKA 1AA9A 1HV8A 2ZRDA 1DAHA 3ZZUA 4F7WA 1GM5A 4EFLA 4KSBA 1GDDA 4ACAA 4GOKA 1N6OA 4OHWA 1M2OB 4QRHA 1Z0IA 1K5GA 4B3BA 3NKVA 5JRZA 3ZS9A 4TMZA 3PQCA 1XEWX 3SBDA 2JJ1A 1HURA 1S9DA 1XWIA 4URWR 1G20E 2DWPA 3AF2A 1Z6YA 3HR8A 3H1TA 1KK1A 2XTMA 4EFNA 1TQ2A 3M1IA 3ADBA 2CE7A 2D2EA 3KKNA 1GNPA 4CEIA 3TVTA 1Z0FA 2J41A 4FMCB 2ASEA 3RWOA 5FUXA 1T5IA 1G3UA 1P2SA 2DWQA 1WQ1R 3SJZA 5L3VA 3GLFA 4Q01A 3U5ZB 4IDQA 4N1AA 3U60B 2NO1A 1ZC3A 3MAAC 1OKKD 1XX6A 4LV8B 1XJQA 3SE0A 3GLGA 3EIHA 1ZVQA 3KL4A 1PUIA 421PA 2GILA 1HE8B 4MGZR 2GVDC 4RKFA 4KLNA 2CE2X 4KBFA 2IYRA 3NVAA 1OXXK 4QBIA 1VCNA 4QBHA 3BRWD 3DL0A 4NU0A 1G7TA 3RANA 4R2HA 3U4QB 1JR6A 2GCNA 5A5GA 4PQFA 4QBFA 2IXEA 2J7KA 3VR4A 4A82A 1TF5A 4URZR 1W2GA 4B76A 3X1ZA 1W36B 3KJHA 3BBPA 1LS1A 1UDXA 2ZJOA 3U3JA 2Q3FA 4URUR 3LBIA 5CITA 3NDPA 1OH5A 2VP5A 1E2JA 1Z22A 2GEUA 2V7QD 1FL9A 2QGZA 3OHMA 1EWRA 3UATA 4DSNA 1NKTA 3K9NA 4ASUA 1QHXA 2GJ8A 1JR3D 3B60A 5JMTA 2FGKA 1LF0A 4ZI2A 4FN5A 3FPAA 3O47A 1NF3A 1UBGA 3SHFA 1FTNA 3CPEA 4GFDA 3UG7A 4A0FA 4TMWA 2QN6A 1A5TA 3KQHA 3QG5A 1LS6A 4FWTA 3Q8XB 4AIIA 3E5HA 4B75A 3VR2A 4TTRA 3NBFA 3K0SA 1UBFA 5IRCD 3ZVMA 5A0FA 5C46F 3WMEA 4B6EA 2K5UA 1O3YA 2QPOA 3QPVA 4V02A 1QHIA 2EWVA 2BVNA 1IN8A 3LY5A 5IK2D 4A0RA 4LHYA 3GQBA 3KFXA 1IXRC 4AK9A 2ZRLA 4BASA 1P3JA 3KXLA 3SBEA 5KPJA 4M1YA 4PZLA 4US0R 2Z5FA 3T1TA 3QSYA 4IEIA 3BGWA 1WF3A 2HXYA 2KWIA 1AIPA 2YYZA 2CDNA 4G1UC 4WBSA 4UNQA 3RAPR 4DLVA 2JLRA 1Q21A 1G1MA 1X86B 3RSOA 4BFTA 3EC1A 3H2YA 3IILA 5D3MA 3Q7PA 1CP2A 5GJCA 3IQXA 4GNKA 1KO1A 4B2PA 2RGCA 4JYBA 4I1OA 3HPRA 1RYHA 5GVSA 2Z0MA 2ZRCA 1OXVA 2NO7A 3MLEA 1IY1A 4US1R 4C30A 4IHQA 1A2BA 3K09A 1CRQA 3NDBB 1A2KC 5J4HA 5LD2B 1DAEA 2ZAMA 3RRZA 4C0SA 1TAGA 2WZQA 3MWKA 3M4YA 2LKDA 3REGA 4Z8YA 1L4YA 3LLMA 1A4RA 1H8HD 2VA8A 4GT1A 1E2LA 3DZDA 1G16A 4HB3A 3I92A 2RGNA 5FR2A 2XNDD 1P9NA 2BIFA 4KFSA 3L0PA 5KDOA 1MABA 4LJ5A 3BFKA 3U3KA 5AJZA 2D7DA 4Q4LA 3LO5A 1H65A 3ZIAD 5JZVA 4Z54A 2G3YA 5SZJA 1F60A 2GCOB 1OHHA 3CWQA 2F1JA 2W6ID 2GAOA 1N2CE 2QTVB 3DM5A 2BCGY 3MG9A 5ELXA 3TAHA 4NYIQ 3WMGA 4EJSA 4LBVA 4M1OA 2F9MA 1YRBA 1JECA 1RVDA 4DT1A 1G3QA 4MKIA 1IN6A 1YRAA 2ZE7A 3AKYA 1GNRA 3VQTA 1T3LA 2ORIA 4BE7B 3FGNA 5KSZA 1MO4A 1M1YE 5KDLA 4HYYA 1A82A 4WZ6A 3JZAA 3BERA 4JMPA 1F2UA 4E5UA 4Q5IA 5L3SB 1JR3A 2ZS7A 3CH5A 2BC9A 1TADA 1RE0A 5KPDA 4TTPA 1W5TA 4C7OA 3ASZA 5DH9A 3CLVA 3W5IA 5AJWA 1E96A 5EXSA
chains in the Genus database with same CATH superfamily
2A2ZA 3M1LA 4TRRA 3STWA 3R0JA 2WSMA 3GUUA 2WWRA 3EIEA 1PVVA 3QF7A 4HFNA 4YCAA 4DYVA 3SQOA 2HSEA 1QE3A 2O2GA 1TA9A 3I01A 1Z3IX 3OFKA 1ZVKA 4C3ZA 2V98A 4B4WA 1DRWA 1FXWF 2X6RA 3CVUA 4EARA 4REMA 1LZKA 4BMZA 2FSVA 3LECA 3NX4A 4K03A 1K4KA 4OQNA 3HM2A 3D0RA 3V1UA 3AJDA 3R7DA 4CT5A 2P3QA 4D4MA 1KI9A 4EYSA 2W7TA 3AVYA 2MSEB 5AHWA 2XUAA 1TK3A 1SC6A 4IL5A 1SKAA 5AK3A 1IM8A 1ZK0A 3X2FA 1ZP6A 3FOFC 1JILA 3ANSA 1T2EA 3WISA 4DC1A 2QM8A 1NBMA 3FZQA 3OLZA 3WGNA 1BXZA 2CHGA 2WTEA 4P80A 5HYVA 4FP9A 2Q5FA 2RGYA 5IMSA 1RCUA 2WIKA 3PDCA 1UMDA 1TT5A 2FUNB 3EA5A 2DQSA 5A4AA 3IR5A 3SP1A 4DV7B 3L5OA 3GIDA 4F21A 2HADA 4PQYA 3LVBA 2ZETA 3U1BA 1A76A 4MV9A 4KQGA 1XRLA 2X58A 4PFSA 1SB9A 1QP7A 1QHSA 2VF4X 3OU6A 6CHYA 1PAUA 2Q1XA 4Q19A 2QTCA 4EBBA 4FOTA 3ETHA 1SRQA 1HWYA 2Z1MA 1H8HA 1P1BA 3GRYA 4NNJA 5H9VA 2PV0A 1FC0A 2KLBA 2ZJ8A 1RYBA 1E79D 2DUNA 1EP1B 1E66A 1U4OA 2ISCA 3AF5A 3W2IA 1Y48E 1NYRA 3E9EA 3H8VA 3SMVA 1J21A 4RQBA 4A6EA 2N9UA 1FFAA 5EMHA 3D7MA 3THYB 3EFOA 1CWUA 4K05A 1GTJ1 3BFVA 1JQ3A 1J90A 3ZLUA 3DGFC 4YTEA 4MTLA 3RVMA 2ZI9A 4F9FA 3A6DA 3FYTA 1JEAA 4CETA 1SRRA 4XLTA 3AESB 2WRZA 2IPNA 4L5AA 2CT8A 1KMCA 4ZT5A 1V48A 4ISBA 2WF6A 4ZO8A 3NASA 1GCUA 4R5HA 4PYMA 1NUUA 1FDIA 1ZXLA 1XD8A 5GONA 1OUMA 1V8DA 2CV2A 2IA5A 3M8KA 2NAFA 4CQMB 1GV1A 1ANKA 3V97A 5JASA 2Y4OA 4BNUA 4CL0A 3AVUA 2DHCA 3GB9A 3VYWA 1CJBA 2PQMA 4JI2B 1R4AA 4RU1A 2QT0A 1J33A 1CUBA 4NDZA 1UBOS 4D56A 4DPLA 4R69A 3QPWA 4EUHA 5HKKD 3VMFA 3HKBA 2GYUA 1XMSA 2JAQA 3EW9A 1C3EA 2KHZA 4FLEA 1UP4A 4C0JA 4FEEA 3B89A 4OYRA 3E3MA 1EJ2A 1NQXA 2MSLA 3RC9A 5LQUA 3N2ZB 5IM4A 3MTGA 3FHOA 2C61A 2YJZA 3GJSA 3R4CA 1L5KA 1QU2A 1EDOA 8MHTA 4F2HA 4BU1A 1XJ5A 4JLBA 1AY0A 1CJSA 2IPMA 5HDBB 3VH1A 4H1HA 4KQXA 3HV2A 3NYWA 2QR3A 4F4HA 1D03A 3TS1A 3OEED 4B7XA 3SYKA 2EGGA 1BXRA 4PHCA 3RQIA 1U8EA 1E3IA 5CK5A 3IHLA 3OLVA 4ND8A 4KSYA 5H70A 4DF3A 5EHNA 3QVJA 3CKKA 2YVQA 1OROA 4P7GA 1PFQA 3F7TA 1OZ0A 1E0AA 3EWSA 2WF5A 4AROA 4MVJF 2Y8EA 2J5QA 5JD6A 1ARZA 3JTEA 3I62A 1QFMA 3ESCA 3HYSA 4Z0TA 1D3AA 5NULA 1KY4A 4ISCA 3U9SA 3AJ8A 2C84A 4J3FA 2PLRA 1YAHA 4LC9A 3K0CC 5F2KA 3ZI0A 4C0KA 3H1BA 4QOEA 1V9CA 3E23A 4II7A 1JIQA 4LHSA 4PF1A 1RMQA 1IVNA 2XCIA 1V26A 2ZWAA 1YBVA 4HVCA 4KRFA 4P4SA 4EMBA 1I5EA 1TQHA 2OBXA 4OHPA 1B74A 2H59A 3BXXA 2GETA 2MHCA 2MDTA 2PA0A 3P19A 2XMBA 4JLWA 4AXBA 3WGVA 1FP7A 1YZ3A 1DOAA 4G1BA 1N34B 1ZOOA 5CLHA 1IPFA 3AI3A 1E7WA 1RAEA 3IFSA 4QATA 4Z1MA 3TL2A 3TW0A 5HRUA 2J3IA 5CLQA 4UVGA 4CXMA 3TFQA 4OI4A 1BIFA 1ODKA 2F1RA 1E0KA 3SZOA 3CV3A 1F2TA 1LGYA 2XCUA 1II0A 1S01A 3C6QA 3M6UA 4WOCA 5BVHA 5I7WA 3G9UA 4QOSA 4RC9A 2NX2A 3N8KA 1CJMA 3QI7A 1SM4A 1F4LA 4OTZA 2FMTA 1XZCA 2DR2A 1Z2NX 3T3GA 3C0KA 4Q7QA 1P0MA 4PLWA 2J0UB 1RQGA 1ZGZA 1XZNA 3AP1A 4YGYA 2JVIA 3C7TA 4TT8A 10MHA 4PCUA 4RK4A 3HYNA 4LFCB 1Z4OA 2V3WA 5EE1A 1ID8A 5FPYA 4BWYA 1HMPA 5BO5A 4CEJB 5CDSA 3FIUA 2Q1TA 4NJMB 3LVQE 3E22A 4QUIA 3KSUA 5LLTA 5FWYA 5JZOA 2QRMA 3NBZC 4TUYA 4IJ6A 5HCUA 2EERA 4D4KA 1TLLA 4BTEA 4Q37A 3W77A 2HRDA 3VU3A 1LLCA 2C9OA 2G9QA 3F1KA 4HRXA 4UBJA 1AE1A 3CKLA 4G0NA 5EOVA 2XGGA 3CZPA 3I1FA 4N5DA 5AK0A 1A9PA 2I4OA 2NQ2C 1K6MA 4DLBA 4QRDA 1H2BA 3TWOA 2QB5A 3IL2A 4FBGA 3OE7A 3U4MA 3UPDA 2IXDA 1ZLXA 5F7ZA 5J40A 1UDRA 3FRJA 4YXWD 1ACJA 1QO0D 3F49S 1U8UA 2HUPA 5AW1A 1H2YA 4D6XA 2QRKA 2XCOA 5LBIA 4Z49A 2WTNA 2OYCA 2IY9A 2BZ0A 4RK5A 1VRVA 4QAJA 3AEQA 4OSOA 1C30B 4CV2A 3B1XA 2NVBA 5F23A 3FPBA 5GP1A 3WJ1A 4FR2A 4WDQA 4IGAA 3AVPA 4I3FA 5C5EA 3Q8WA 4TGLA 1XCPA 3BDVA 3NRCA 3SR3A 3VHLB 3N8NA 3OJLA 4UUQA 1H9AA 3DL2A 3TLCA 4CIAA 3W7AA 4FD3A 1RQXA 2B4KA 3PFKA 4QVGA 2C3YA 3PX2A 2A92A 4H7FA 4CQLB 4O4HA 3WB0A 3JV7A 2HNKA 1TEVA 4WACA 3A4TA 3WGYA 2WSSD 3THYA 2NTNA 1QR6A 4OQFA 3QIAA 4AS3A 1YL7A 4XD7D 3U3ZA 2AOWA 2QN9A 1LJ8A 1SMKA 4YMUA 1LDYA 2VCHA 4XVRA 1ZOPA 3GZJA 3AESA 4M1QA 3R8CA 4BKUA 4CL8A 4J1TC 4LXIA 1XLWA 2IP1A 3JD2A 5EJ2A 3UGQA 3ESAA 3HABA 5PGMA 4BQIA 3WIUA 1ISJA 1R18A 3BGOS 3FTDA 2A9QA 5BN5A 4RULA 2OZVA 3O3NB 3C1UA 3ECCA 1Z29A 2VRCD 5IBRA 4BZQA 2PE5A 5FH9A 1KVRA 1QHHB 3E9YA 5I01A 3FPLA 3MC1A 1RQ7A 1T6YA 3MS4A 4LTNA 3LI2A 2BJHA 4H0FA 4V24A 1KJQA 2GBLC 2QUKA 1SIUA 1ZJ6A 3NC1C 4RUKA 1OFHA 1JG1A 1V1MB 3LT5A 4LYEA 1NC3A 1WQ4A 3L1KA 3NYIA 2UV8A 4KYIB 3SS8A 3VHRA 4Q6WA 4AIRA 4AQDA 2IEGA 5LNK1 2XY4A 3TQIA 2YJNA 3ND8A 1PFKA 2G88A 3U44B 2E7ZA 3L04A 1KVQA 1KP3A 4B82A 1U31A 2V7GA 1E63A 1TX4B 3FNIA 4YIHA 1A5BB 1EDBA 3BN3A 2ZP1A 1JJAA 3BGIA 3U5TA 3EF1A 3D1LA 1J7JA 3VKWA 3DLTA 5COBA 4QJIA 3CGWA 3GX1A 4P92A 3MF4A 2ODTX 2ZVJA 1ML3A 2GEJA 5EKXA 1KVSA 2I7TA 3HUDA 4PHTA 1XNRB 4WMLA 3TRHA 2EKDA 1DB3A 3MUEA 3GO4A 1S96A 2PEYA 3DFFA 3DE1X 2O7VA 1ZUNA 2IHTA 4ER0A 4LNUA 1VHTA 1Y1PA 5DT9A 4PHGA 1FFBA 3CLSD 4PLCA 1QCZA 4Q9IA 1VECA 4BP3A 1JU3A 2JJ2A 4QUAA 5AW3A 3A0UA 3QKSB 4LZNA 3I9LA 5ITZA 4C2TA 4PQGA 1TD1A 5AKEA 1WM1A 1CZRA 3B1VA 3VH4A 2YS6A 3OEHA 4CTMA 2DB3A 2I9KA 4EENA 3I42A 4CCWA 4MS3B 4PTYA 5K8UA 1P2GA 1SZPA 4GXTA 4HNUA 2ID4A 3NTLA 2I66A 4NFSA 2YFYA 3RHSA 3UCEA 1QK3A 1UWCA 3Q2IA 4JGIA 4X8LA 2V1XA 2ES4A 3B3FA 4KZPA 3LUFA 2XHEA 4EO7A 2G7MC 4H1UA 1XEXB 2XIQA 2DSTA 5DX0A 4LG1A 4YXWA 3OOSA 3KQTA 3UJ8A 4KRXA 1K98A 3GZNB 3JWIA 2W22A 2OFFA 5IC5A 1DQSA 2RGXA 2FEOA 3T7RA 2B8TA 3TEMA 1QFYA 5AUNB 2QUJA 1VJGA 4ZQHA 5LP6B 1XLVA 3WK8A 4TZKA 2I67A 2AQHA 3CRRA 2I3ZA 5HG0A 2XMZA 4BEWA 3B1KA 4N7JA 2AEJA 2C00A 2JGKA 4FWIB 1JLRA 3IODA 4OHMA 5ADUS 3OM1A 2Z8ZA 1OA1A 5GWXA 4DCSA 1U5BA 4ECEA 1G63A 3SZMA 3B3JA 1TIBA 3GVIA 3G13A 3SYRA 3UNXA 1KTIA 4KXNA 4OI1A 2HT6A 4JLMA 4O6VA 1DWOA 2BM9A 1NXSA 3JX9A 3ME5A 3RC3A 2XRZA 4NMHA 2V7WA 5E3JA 3HEBA 1GT91 4PGFA 2WSSA 3CB2A 3K0FA 1NUQA 1NM5A 2H4HA 3R0VA 3ETGA 4XD7A 2AFHB 3P9NA 1Z5PA 3FNRA 2PT7A 1FSGA 1BX0A 4HEJA 4PFQA 3AW9A 4BMPB 1OBCA 3VNQA 1XLUA 1X7ZA 1YZVA 5LXTB 2XZTA 1Q19A 1W87A 1Z37A 4KV7A 1ZPDA 4Y2YA 1HFKA 2HIHA 4XVQA 5GY7A 3SJAA 1DC5A 5KJ6A 2ECOA 4WV3A 4AUEA 1JEQB 1CS0B 1KC3A 3ZVNA 2O05A 2W93A 1JAXA 4YUXA 3BB1A 3M6WA 1P77A 3E8SA 1GR0A 4HBGA 4DMCA 2YOFA 3KD2A 2R7KA 4ZCQA 4BP8A 4M49A 2EF0A 3P5BA 1BGVA 1X3SA 4N03A 1E94E 1QYVA 3MWJA 2OHXA 4DIUA 3HXOA 1BE0A 1CR0A 2F1OA 5HNKA 1Q0TA 2FUG1 3BFPA 2P9QA 3IALA 4W9RA 2YXBA 4OGFA 2BFWA 3ZHTA 3GNLA 4I14A 2EP7A 4Y18A 1OWPA 2C8LA 2X0JA 4OM7A 4E5VA 4QJ4A 1VIMA 4CQNA 2C4HA 3WL7A 1YJ8A 2G6TA 4B47A 3HUFA 5JI3E 3C16C 1EXWA 4PY2A 3UM9A 2HCFA 2XEDA 4QYMA 3ZQ6A 3CIFA 4QUGA 3OJFA 2KM1A 4Y0VA 1YI8A 5CW2A 4G1FA 1BHJA 3V8MA 4J9VA 3VBEA 4EY4A 1LBEA 1FRNA 3JS5A 4ZU3A 2BR4A 2XQGA 2HI0A 4OYLA 4KQ6A 2OLEA 3O0DA 1II8A 4O2RA 2BBTA 5F1KA 1CZUA 1ZEMA 3DT6A 3CVVA 1EJBA 2C9ZA 4FDAA 4PAQA 1JG3A 4QOGA 4F5WA 5BN4B 3K8YA 5G40A 1EWQA 3BX1A 3PNBA 1D9XA 1NV8A 3BJZA 2IIBA 5FAXA 3NORA 2XGMA 4ICIA 1YGYA 4QJ5A 4WLFA 3SSAA 3MT9A 1MAVA 1KJ8A 4IXDA 3R7FA 2Q2NA 4BJ5A 2PU5A 3AKCA 4D5EA 1E2GA 4LC0A 2ZSKA 4F93B 1JJ7A 1O2DA 5IUJC 3KYCB 1IFXA 3OKFA 3OZWA 1WXGA 5C32A 4DNPA 2AS0A 2H6EA 2OSBA 3TIIA 4IRXA 4ZFNA 3BWYA 5DNUA 2B61A 2BOVA 3ZVRA 5C35A 3ZHSA 3R9XB 5A9RA 1DVRA 4V0SA 3DP9A 3F67A 3FVQA 2X0KA 4G81A 2REQA 4EKIA 2VPPA 3QITA 5BW6B 4JB0A 1YA6A 2H8KA 1SURA 1AKUA 4GC9A 5HF5A 1EUCB 2I71A 3LG2A 2H31A 3SQDA 1ZMOA 4WEOA 2BMAA 2OGUA 3PC2A 1P62B 3A1DA 3A9VA 3IMCA 5HRCA 3QEKA 1EDDA 2ANCA 2EJUA 1STOA 2JHAA 2VXCA 3MGCA 2JZOA 2P9YA 5TGZA 1BROA 4MWEA 1KMNA 1TO6A 3IAFA 4HO1X 4DIBA 1Z12A 1MXHA 1V1MA 3WLQA 1JW9B 1G7SA 3I28A 4I8IA 4PTLA 4Q00A 1Z8DA 2ZYAA 5HCIA 4XWGA 4QUBA 4YRKA 2Z8XA 2CFSA 1U2TA 1J0EA 3KOZA 4KLZA 2Y1LA 1RQPA 2JI9A 5JROA 2CJYA 3LNCA 4TSRA 1U7DA 2HK8A 4NAHA 2PKQP 3RBAA 3K20A 5ALFA 4JVNA 2RHMA 4BBPA 3AERA 3LJKA 4IH1A 5BSHA 1OHHD 3EQ8A 1AKYA 4J7AA 5G3ZA 4IUYA 4EGQA 2FR1A 3HN7A 2HZ7A 3RJTA 5JH7B 3UJPA 2M98A 2VXOA 2ZRHA 2CLKB 3HU3A 1XXHB 2I4NA 3OZIA 1ULBA 2B0CA 2BBWA 3WBJA 3WLNA 4C0AC 1P81A 3B53X 5JS6A 2A9RA 2GPAA 4C6RA 3PXBA 3LCRA 4ZV9A 3I5MA 1SQFA 3JR3A 4EY3A 2ZRKA 4FFNA 5E4YA 5CDUA 1N0VC 3AKEA 5JD3A 4IDNA 5JYCA 3C6KA 5K4HA 5FTKA 1GY8A 1AKWA 1VKRA 1XKTA 3QF4A 2ZYUX 4G5XA 5CJ2A 1P7CA 3JQ8A 4V0KA 2XF8A 4Z51A 4G5GA 4TQ9A 1SK9A 1SKYE 2PQ0A 5D3ZA 2VIIA 1M6YA 2YVUA 3BM5A 3TW8B 3V7WA 1AZTA 2VQSA 3ZW8A 1NATA 1G0OA 3OIVA 1JFRA 1OWMA 4HQ6A 4G0WA 2CMHA 4S35A 1H4SA 3WL8A 1Y98A 4D9NA 1ND5A 4YI5A 1IDN1 1OXSC 5HQJA 3W5SA 3N74A 4F04A 3EXEB 5JVDB 3PDIA 4JNCA 5HIKA 3X43A 1IUKA 4HWOA 3TE7A 2ID7A 3EZ6A 1GL7A 1R6DA 3F6PA 5LP6A 3RT7A 3KT6A 1IQRA 4C4PA 3BC1A 3PUKA 3R6LA 4BFVA 4EI2A 1Z4IA 3DZBA 1K3FA 3ZWVA 3GT7A 4D46A 2ATVA 4RX1A 1RI2A 3RTEA 3PHHA 3HY3A 2YZGA 4YGXB 2PLAA 2WU3A 3OMWA 5HBGA 5KMGA 5HK8A 3CS3A 3GA0A 4Z6KA 3UJ3X 4FYYA 2HR1A 4H3VA 4JJFA 3AHIA 3SG0A 1O97C 2DP4E 1J4AA 4RPKA 5H81A 5FJIA 3UA4A 1NYQA 2C5LA 3WLIA 4D4GA 1E0JA 2CVOA 4KE7A 3PGMA 3TCNA 3UENA 3VUEA 4CNBA 5EJEA 3E48A 2X77A 1NW4A 2C9CA 3QLTA 5AVXA 3EEOA 3WMEA 4J7CA 3RYIB 1FMTA 1RQRA 5B5SA 3MOSA 5CBPB 5CT5A 4E70A 3WGIA 4ZU6X 1JEJA 4L4XA 2HMVA 3T3PB 3I2FA 1ZFNA 3MXOA 4MITA 2RKWA 4XH9B 5LXTA 4FW8A 5DULA 4QFDA 3QEOA 5CFMA 3WKDA 2I22A 4ZI7F 3TUIC 5KYUB 1E1CA 3A1SA 4HJXA 4BV2A 2VH2A 1M2KA 3Q3VA 4Q9DA 2M6LA 3HN2A 4DCMA 4JCCA 2NLOA 4TLMB 1XJCA 3E4CA 1WHSB 1X9IA 3BDAA 3EODA 2RJNA 5IH3A 3RVLA 4A8HA 3CH6A 4MUNA 3CPJB 5CVCA 4F92B 4MKXA 2OV4A 4YMWA 4FBMA 1C4KA 4YP6A 1O0BA 2BV3A 4C08A 1QDEA 3DTNA 3HYLA 4V2IA 1BWPA 1SVLA 2KLHA 2VDWB 3GLHB 3NBXX 4UTZA 4PG8A 5CVEA 3TOZA 2WHPB 2K87A 4PLYA 2C2WA 4WLVA 2NSDA 4RPCA 3PL5A 4JBLA 3BWVA 2JJ8A 4HH1A 1AQLA 4AAYA 5L4LA 2HW8A 5DIFA 1S9HA 4QYWA 3EZ2A 1IOWA 4AJOA 2RGAA 1L2TA 4Q03A 2HHLA 2H1WA 2ZS9A 7REQA 1FSPA 1P7ZA 3CBGA 2VYND 3P9SA 3ZI4A 5LZ5A 1YVPA 5B1IA 2G70A 2Y71A 5AUPB 2IYUA 2D0PB 2QLLA 4UBLA 4ZK6A 3KLMX 3S2YA 1GTRA 3KM0A 5D84A 2JIDA 3CM0A 4RF2A 3AR6A 4Y6OA 3JASA 5A3QA 1ZHOA 5LDDC 1ZBDA 4K6GA 4TL6A 3I9MA 3PEUA 1UZLA 1YZGA 3EXFA 3UMRA 5KOYA 2QQGA 4KGVA 3V4LA 2RKBA 1V3TA 4EI9A 5JO0A 4HXYA 2Q5EA 2DT8A 2FMXA 5TEWA 1TF2A 4A1OA 2CDRA 3UW1A 2H1LA 1LEHA 1QX4A 1GG8A 4UATA 3OT4A 2IZ5A 1GPJA 3U48A 5HOEA 4O25A 1NNEA 1BS9A 2WPNA 2QP3A 3ZV7A 1T8TA 4R9RA 4NP6A 5EUQB 1ZQ1A 1EVZA 1N5OX 3D4NA 3DP7A 3URMA 2CUNA 2MOKA 4Q6BA 2ORED 5EP2A 1T36B 5EERA 3SOPA 3F5FA 4D02A 2COKA 2JNWA 5LU9A 1PV2A 5ENVA 1C1YA 2A6PA 4TYWA 4BOYA 1BW9A 1S1MA 4C06A 4F8EA 5B3LA 3U6KA 4FWTA 4KXMA 5DRTA 1GSOA 3COVA 4W7IA 1XDDA 1KJNA 4WNAB 1BYIA 4BNWA 4QA9A 1K97A 1SXJB 2O1SA 3NKLA 1MA0A 3NC4A 1R8SA 1KYVA 4IYJA 4EHIA 4GBJA 1A0OA 3FLEA 3Q0TA 1PR4A 3VDMA 2EVWX 3C1TA 2FFBA 3ZY6A 1MXFA 4CFZA 3BJMA 2CNBA 4N9WA 4EO9A 3UICA 2R6DA 5K9ZA 4LRUA 2HHCA 1NXXA 1EGVB 1Z2OX 1AQUA 1LVHA 1KDOA 1XD2B 1YIAA 3QA9A 4PX2A 1JA9A 4GI3A 5H59A 1OB5A 1IG3A 1W4LA 2QNRA 4L08A 2AJTA 3QSGA 2Z95A 4IDGA 4JOBA 1E4YA 2D5LA 1CPYA 3BWEA 2FW0A 2WUGA 4X65B 1GL6A 2XBUA 4GVLA 3C45A 5C1IA 3ESRA 5JR3A 1K3TA 5EIOA 3WRYA 2EV9A 5JFGA 2Q2VA 1Z7GA 2B99A 2ZIUB 4LYDA 1KEPA 4RGYA 4J2OA 4LJRA 2QD2A 1O95A 1PO7A 2O23A 3KKKA 3D4PA 2A78A 4DBLC 4UQOA 2QLJA 4WRRA 3K9FC 5F7XA 1SUBA 1DAPA 3MINB 2PU7A 4OQXA 5E95A 3S7ZA 3WDSA 4BX2A 4DV4B 1CZHA 1H2FA 3C8UA 2WOOA 3SIXA 1XELA 1V6CA 1RLIA 5ALEA 1U8FO 3KB6A 3MJHA 4HLUA 1LBQA 5C8YF 2PWAA 4NFYA 5THQA 1ZIOA 3KUKA 2VQ6A 4O02B 3MJRA 3NAGA 5IWCA 3EXEA 5JVDA 4ZV7A 1LTHR 3EB9A 3N2KA 2FETA 5K51A 4WESA 4BBZA 2RH5A 2FMFA 4JR0A 2Y27A 1B0AA 1K92A 3DLCA 4MQUA 5A5VA 1RR6A 2HEGA 2V6MA 1XSEA 5L53A 1HDYA 3EGWA 3WDMA 1M5UA 3QY9A 1KYYA 4MAMA 4WOBA 2ZSEA 5DISB 3OU2A 1PEAA 4F5YA 4H1VA 3I53A 4JUAA 3ZCUA 4Y1FA 5LQMA 2CZGA 2V4MA 5BW4A 5L7WA 2WZDA 1NVVR 3ILYA 3ROTA 3SDZA 4BGUA 2ID9A 2OQRA 2WJVA 2XNCA 1NQVA 3NWBA 4FZRA 4R8SA 4EYKA 1NQTA 3PQFA 3FGPA 1XU9A 5KVQA 5BOSA 1EK1A 3I6IA 1WR8A 2DCUA 3A37A 3GMSA 4KNWA 4KQFA 1M8GA 2HA3A 1JR2A 5IAKA 5CNMA 4RNDB 1U3CA 2X5JO 2GK7A 4JXXA 2CEAA 3OVMA 1LFAA 3OQ6A 4JDPA 1SCUA 4CLEA 4URFA 3NHBA 4L1KA 3BXHA 5U9CA 1GN9A 1R6BX 5A6SB 2DLNA 1UEIA 821PA 1KSHA 2OV2A 3G7NA 5FBWB 4M9ZA 5H3HA 4ZI3A 4KVGA 2DFLA 4XYLA 1S6YA 3L8CA 3PPIA 2IPAB 3NV7A 1JNYA 2Q6VA 3B7PA 4DHEA 4M9UA 2ODWA 3ZC3A 3BT7A 1WHSA 3HCRA 1QH8B 2XRYA 4X7PA 3CVWA 1HPLA 3GPBA 4CHTA 2XOEA 3V4ZA 4MYTA 1DCTA 4QTYA 1U9YA 4YT4A 2E5LB 2YWEA 4AG6A 2B1GA 1IEXA 1WY7A 3P97A 1Q84A 1V96A 4M4SA 4B71A 1CYEA 1Z7YA 1T34A 4H0NA 1C5KA 4D26A 2IW1A 5FUBA 4X45A 3U37A 5AM3A 4W4TA 1DQNA 1B6TA 2A9VA 2GF9A 4LRQA 1IIBA 1K5HA 1Z5NA 3A10A 3WK7A 1L5VA 1KC1A 3A1TA 3KQUA 1MJGA 1RP7A 3CZCA 3P4UA 1BH2A 4W5TA 4P38A 4RKWA 2Q4BA 5EVCA 5KNCD 4DLRA 2Z58A 3BF7A 2GOYA 2WMYA 1ZX1A 3TD2A 2BEWB 5AK5A 1ZRMA 4XIIA 1RRPA 1I7LA 2O06A 1U8CB 1IM5A 1GYRA 1VYUA 2FFAA 2L69A 2UKDA 3AP2A 1M2WA 1K4YA 2P9TA 2GK4A 2OBYA 3QM1A 2XA2A 4M76B 4PO3X 4V3BA 4WXRA 4OUDB 4M55A 3FZGA 5HZHA 1DBWA 2Y1KA 2I6FA 2DPHA 2X86A 1H94A 2VTBA 1IWOA 2QY6A 3VNAA 4IXNA 3A70A 4YR9A 4RIGA 4S2UA 1PHPA 3O4JA 1UWKA 5G1NA 4TZ6A 4LYHA 1NYTA 2JRLA 3CZMA 3ORRA 4M0CA 4NEGA 2BI8A 4DG5A 1YDGA 1DBVO 4IRUB 4Z4IA 1KFCB 1TW3A 4PQRA 4E14A 4CIYA 1CUVA 4I5EA 3BJRA 4GZLA 3QRWA 4C20A 1JQBA 1MDFA 1GZ3A 2R86A 3GJ7A 4QHTA 4YC7A 4GZMA 3IAUA 2NADA 4YRQA 3EDQA 3DKPA 1XMVA 1MPTA 2C9DA 2VJMB 3HB5X 3O9MA 1KK3A 2AYYA 4RJKA 4EPRA 2XUQA 1ADFA 2YZKA 1EKXA 4JZYA 1Y1SA 1M1YB 2GK6A 1TUGA 2V7EA 2VH1A 2YFHA 1Y4UA 2ZJ6A 4QWMA 1T36A 1OCEA 1KEKA 1Y3DE 1TUIA 1WVMA 5J58A 1Y89A 4LE1A 1UJCA 2P62A 3RV4A 2J45A 2VWQA 5DMXA 3OC0A 3OTQA 2AOUA 4BMNA 2A57A 3K31A 1HG1A 3AEZA 3HCFA 2JI7A 3NUGA 1HZJA 2X0NA 3P0IA 1LWOA 1SXJA 1X8XA 3QJ5A 3AY3A 2WWTA 4MR7A 1YSCA 2FW1A 4DG8A 3L8YA 3TF5A 1YS2X 2I2XB 3ZEIA 2G80A 2ZU0C 5DLYA 3S1AA 3N2GA 1FB5A 2WM9B 1CC1S 5EHIA 1F38A 1JKMA 4IWNA 5GIOE 1V41E 3RLFA 2NT3A 1PSWA 3B1ZA 4EB6A 2HMSA 3LBNA 4MP8A 2QU7A 4GRIA 1G8FA 1Z88A 3IP5A 2V97A 2HMUA 2FP3A 1NVEA 5GVRA 1PEDA 2I4RA 3QLUA 4DARA 2QTZA 2P75A 3D1VA 4PPFA 3I8XA 3PTAA 2J4CA 1YS6A 1Q1QA 1LBHA 4LN1A 1YZQA 1JKJB 4CCYA 1XTVA 4EPWA 3EGXB 4PX9A 4W8HA 2GZMA 2V9CA 2OCYC 4YMGA 3IEIA 2FP4B 3A58B 3LD9A 1YAJA 3KSAC 1X1SA 2O14A 4L95C 4BNTA 3QXGA 3L92A 1SHKA 4JP3A 3SHQA 2O57A 2FPSA 4W1SA 4NOKA 3DM9B 4WCFB 2YZ2A 4FXPA 4MRMA 5EXTA 3SN6A 5JJCA 1COZA 3CRNA 1PNTA 1NY6A 3BTUA 1DJLA 1OI7A 4G09A 5AXCA 1ZZGA 2IEAA 2UYOA 5CW1A 4CF4A 2ZYGA 3GT3A 1C1HA 2G9RA 4YRLA 1QIIA 4HSEA 3QMPA 3S5UA 2DGDA 5KWJA 3DOUA 1BDJA 4ZAZA 3ZGVA 3R0XA 1T9KA 4YJHB 3DWGA 1GSIA 3DB1A 4UZSA 2DX7A 2EAUA 2R6CA 1JDBC 3G2QA 4DPMA 4WW0A 2Y99A 4A4DA 3M6FA 2DM6A 4Z4FA 2EKBA 3O4VA 4PZUA 3K7EA 3GFFA 2W6MA 3H2BA 3NHYA 3TK1A 1VG1A 1W0JA 3EG9A 1ZW1A 3JVUA 3RVOA 4U7FA 3WGTA 3FVTA 5G53C 5K8VA 3NRJA 2FXIA 3AIMA 2PG3A 3G9QA 1BFKA 3K9LA 4RD6A 5CTJA 2E18A 3I01M 3H5AA 2PKQO 3LOUA 3U26A 8GPBA 2HIAA 2RGGA 4PLGA 2QQ5A 3T5DA 1ZGGA 2ZTUA 3TM5A 4AJHA 5E4FA 2HJGA 3OPXA 4D8VA 4QM7A 2V1UA 2GXQA 5KVCA 4Q16A 4GOOD 2YV3A 3O91A 5E0KB 5BN3B 2HQBA 1NVGA 2PL5A 2AN5A 2RSLA 4QDJA 1MRSA 4HDRA 4I9NA 3E3LA 4RQUA 4C3UA 4DANA 2P0AA 1NBIA 3T6KA 2FX3A 3DMYA 1HYBA 4JJ8A 4QKQA 1DX4A 1I3CA 4BVLA 1N2IA 4KNVA 1R37A 4PPGA 4UCXA 1RQ2A 1YCHA 2GN6A 2ST1A 3NT5A 4IS3A 4R98A 1QNFA 5DX1A 2IE0A 1X7HA 2WD9A 3ZU6A 3CISA 3SEAA 2YL2A 3U4GA 1AKTA 1M0SA 3UGKA 1EP2B 2HU5A 5AVKA 2Y0BA 2W2TA 1UH5A 1HOXA 3LT1A 4DXAA 1NX6A 4MB0A 3EXIB 4XKJA 4XEUA 4AS2A 4ENSA 1N33B 4PSAA 6ADHA 4XQ9A 2WDPA 3HVRA 3VGJA 1X2EA 1IY2A 2NU9A 3AZPA 3QKWA 3BIJA 3RYHA 4I50A 1FLAA 4ZRDA 4BLQA 4BZWA 4OH1A 1AQYA 5JEDA 1RWOA 2WJIA 4XUGB 2HOQA 1R9JA 2QY9A 2GZDA 1SU4A 5KOJA 3TMYA 4NV1A 5TX7A 2KQUA 3D2LA 3D4OA 1GKLA 2GESA 4W1PA 3UJCA 5C1PA 1R0KA 4DR6B 2YXPX 1NLFA 5KB3A 3SVLA 1WCIB 1CQJA 2VZEA 4JAVC 1W7AA 3KSRA 3RIXA 2RB5A 4MV4A 4MRNA 5HFAA 3TLBA 3I1YA 3KJNA 3PC3A 2FEAA 4G0QA 5CEJA 2IYVA 1MTZA 1ZKDA 3QFFA 2BCEA 4L8YA 2XEXA 3HA3A 1SQ5A 3AEUA 3VPBA 1BVYF 1T1GA 1A9RA 2ZR0A 3WLEA 4YXFA 2P0YA 1QYRA 1R4MA 3C41J 3USZA 4C7MA 5T4BA 4MRVA 2QZSA 4YWJA 3WRXC 4Z2AA 2HU7A 5H3CA 4C4AA 1RFLA 3D6AA 4X91A 2BGIA 2Q3HA 2R47A 3EFHA 3F46A 4LY9A 1KSGA 2VVTA 3G0IA 3PX7A 2VJYA 4XOUA 4D97A 1HA3A 2YWJA 4IYRA 2ZUCA 1R8YA 3SIPA 2SCUA 1UDCA 4MROA 5C8ZA 1EA7A 3CTMA 1RC1A 4JD5A 5E9JA 2O2IA 3HADA 4DC0A 4RJTA 3TW4A 4ZKDA 2PYIA 3JQFC 1OLSA 2BJVA 4UEQA 1EP3B 3DBHB 3BK1A 2G28A 2IYWA 2QAJA 2PBZA 1GUBA 3FOZA 1DG1G 4CM5A 2FSUA 3IPYA 1JHDA 1LLQA 4BFUA 1EG2A 1L4UA 5FUVA 8OHMA 4HXGA 2EEZA 3ILHA 5D8DA 1ZNYA 2VXYA 1MOPA 3AVOA 3G5UA 5CYFA 5BMOA 3I23A 3WGMA 1DC6A 4BJ3A 4Z3OA 1ZNZA 1TJ3A 3A4YA 1Q74A 3HFSA 3QBEA 2A0FA 1SUCA 2D1RA 3QW4B 2BEUA 4HDKA 1YCGA 1Z8NA 5DX8A 4AG5A 4BX3A 1KOGA 1DC3A 3AZOA 3MERA 1YRLA 5IULC 4BX0A 1IPHA 1SZJG 1U7ZA 2Q50A 3RSHA 3WL5A 5MHTA 3DEFA 1XMQB 1IEVA 4K6CA 3CURA 4ZKEA 5GZ3A 1RAIA 2Q6TA 1E98A 1XZIA 1T1SA 1NULA 3AH8A 1G5HA 4RE6A 3EHEA 2BFNA 1Q1NA 5ALNA 2UZ1B 1DU4A 2DUMA 4IH9A 2HF7A 4JC8A 3VKHA 1E99A 4I0WB 2ONYA 1QNLA 2E82A 2FQQA 4DMHA 3F1LA 3VC7A 5I8WA 3KPJA 1VBFA 3BKWA 2CHVA 4B8YA 3ZIDA 3P8ZA 4NBKA 3NJRA 1NYLA 4N8EA 4UU0A 3TXAA 4RTSA 4A6DA 3M5WA 1RYFA 2B92A 2CZQA 4LVOA 2HWXA 3RT1A 4Q1EA 2WJJA 1UMBA 2Q8QA 2QI9C 3T7AA 5FJJA 4F60A 2WILA 1NUHA 3CX6A 4U63A 5CX1A 2PD4A 1VXRA 5FQNA 3T5PA 3M1YA 1HT3A 5IP5A 1HETA 4CM8B 4YRIA 2CYBA 4U3JB 2ZSIA 2BD0A 3BILA 1JSLA 3CF0A 3D6UA 3MWLA 4LSWA 4L22A 4YAEA 2JH8A 2PVPA 2RI6A 3RYTC 3T1HB 2Q27A 2YHUA 3FN4A 5FLEX 3LA6A 1DQPA 1EJ0A 1V3QE 2BHRA 1DTSA 2AFIE 3N2IA 4PLFA 2FMUA 3LBHA 4GOND 4Y2UA 3CZRA 4I9HA 4HAUA 5EJ5A 1USVA 3VZSA 1SD1A 4I1YA 4K46A 4UBOA 3H5OA 2AG5A 4UCWA 3MZ0A 2O2CA 2JAPA 1GPUA 5KHOC 2PSJA 1GUYA 3R20A 2R5NA 2I55A 5BN3A 1G8SA 2K4MA 2O3QA 1FYFA 4RAOA 4LYAA 4K9MA 3K6KA 4NIMA 5BXQC 2WICA 4LVNA 1G60A 1VE9A 1UBHS 2OCAA 2PCLA 1ONNA 3C8ZA 2WPDD 2CMKA 7ADHA 3NTVA 4OXRA 5TQ2B 2GJAA 4L74A 2O8FA 5B3JA 1ONSA 4Z4EA 1TD9A 5LA6A 1YJCA 2RCNA 3I5UA 3PUHA 1YL5A 1I2AA 5CIQA 2Z9CA 3EZNA 2UUCB 4YCCA 4B2LA 1ZH8A 2AX3A 3E1SA 3EXIA 1NAIA 4PG5A 2GI4A 3NUQA 5EXDA 1KXZA 3SIWA 2W6OA 4TMKA 4IG9A 3LUHA 3QX9A 4N5IX 2NSYA 2AIRA 1E8NA 5KYWA 5AHRA 2C5HA 1ULHA 3H9EO 3KWFA 3ZW9A 2ZE6A 1M1UA 1BU5A 4FU0A 2JHGA 4HPJB 3D7SA 1EFRD 3RKRA 3BK2A 3WTBA 1T1RA 4ROTA 4DR2B 1MQAA 1WDKA 1QCDA 1W46A 3M6LA 5BWMA 1IWPB 1RZVA 3FYUB 4WQMA 5SY9A 2V6BA 5DCWA 1PZEA 1RWQA 2QS9A 2ZJAA 3IMEA 4KRYA 3SKXA 1LDEA 1I4TD 5CJJA 5T3UA 3RVNA 1XP5A 1T5OA 2B1IA 2YV2A 2PNFA 2ONJA 3PDJA 2JCGA 3OOJA 4DCUA