3KKMA

Crystal structure of h-ras t35s in complex with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
155
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 58
structure length 155
sequence length 166
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kkmA00
3FKSA 1NG9A 2C9CA 2OCYC 3EXAA 2F43B 1XTKA 2PLRA 5FR1A 2XZPA 4Q9KA 1NF3A 4M21A 2F3RA 2PX3A 1VCOA 1TU4A 2JIZD 2OBLA 4DLRA 2IL1A 2FEMA 4GRAA 1Y3AA 2QG6A 2N1BA 2EWVA 3N2IA 4JL5A 1OHHA 2JGNA 3TSZA 2XNDD 1S8FA 1TUIA 1T8UA 2RGGA 1WDTA 1E1RD 2YC4C 1KJYA 2QMHA 4HUQB 3H1TA 5DN6D 3T1TA 1Q0UA 2DWQA 3CIOA 1FP7A 5BQ5A 2BDTA 3HR7A 1ANKA 2DBYA 2UZIR 4IFBA 1DE0A 2DCUA 3CWZA 1NVUQ 2WSMA 1U99A 2J0UB 5FPTA 3K0CC 4PHGA 1KZ7B 5TVKA 3TJZA 1Z0IA 2QTFA 4PO9A 3UMSA 2F55A 1S0UA 2ZUBA 3KX2A 1BO6A 2C8VA 4OQLA 1N6PA 2FV8A 4II7A 1GOTA 1Z8FA 4TMZA 2WBLC 4Q03A 4RD4A 3RWMB 5EZ5A 1R0ZA 2A5GA 3GFPA 3KB1A 3PEUA 4TTRA 3ZQ6A 2GJ8A 3GLGA 2HF8A 1AGPA 3K0CA 4JKYA 4HAXA 5F2EA 2WJVA 1XDBA 5HE9A 4ITRC 2IYTA 2EFGA 2WOOA 4FMBB 5G41A 3CUEF 3I72A 3BFVA 5DYGA 1L4UA 2VHUA 2VP2A 2YVUA 1XEWY 1KDRA 3MWKA 2QY9A 4O2LA 2Z0MA 5E7IA 4NP6A 4DVGA 2ZYWX 2FJUA 4Q4AA 2OFOA 2QSYA 2V7QD 3RVBA 4AURA 1G6HA 1T0HB 4KV9A 3RS0A 3THXB 1A2KC 2CNWD 1DBSA 2OSBA 3OAAD 4FCTA 3PUYA 4TYPA 1KYIA 5BN3A 3AVVA 1E0JA 1CULC 1XBTA 4NCKA 4Y0AA 2MMCA 4KFSA 3M6AA 2C96A 3LRPA 4KLNA 3SBDA 3SEAA 2QT0A 2NPIA 1W36D 2IXEA 1P6XA 4LC1A 1E79D 2VP0A 3UANA 4DLWA 4KVGA 2OZEA 2VSFA 3NBZC 4AY2A 3E2IA 3LBIA 2OCAA 4W5WA 2OE2A 2IX3A 2ZSAA 2CVFA 1AKEA 4OHVA 4C30A 4FMCB 4JJKA 4P4SB 3VR4A 3ZYCA 3DDCA 5J40A 2ZREA 2Q21A 2D7DA 5FUVA 2Z5FA 4LHZA 4ZPXA 5EE1A 5FPYA 3B82A 1HYQA 1VECA 2GZHA 4RD0A 1J2JA 2H18A 2NOAA 1XTIA 1TQ2A 1GL6A 2O8CB 1ZC3A 3PXGA 2O8DA 3QE0A 5IK2D 4LYAA 3A8TA 1P7CA 1TF7A 2PT5A 3Q72A 4CW7A 1P73A 3C14C 4DHEA 3GLIE 1F2TA 3FFBA 4YQFA 5FL3A 3B6EA 4PSKA 1Q21A 1YJ5A 2VBCA 3P26A 5CK5A 5LBIA 2J0QA 1VHTA 1RKBA 1X8JA 2ZJ8A 2EU8A 3DM5A 1OXTA 1YR8A 1VG8A 1E32A 2R6GA 2BM1A 1FTNA 2D7CA 1KK0A 1OE0A 2YJTD 3SJZA 4HB3A 1YE8A 2ORWA 2QPTA 3HPRA 1XTSA 1AQYA 2IS2A 1MO4A 3N2EA 1AN0A 3KQHA 4BFVA 4YMVA 1T5IA 4BZXA 2ZJ5A 3LQQA 2ANBA 4MDFA 3RRMA 4V0KA 5CITA 2C99A 2P3SA 1JR3E 3QKTA 4JMPA 1M8PA 3KKPA 4CYMA 4GOKA 4B71A 2GTPA 4AWXA 1KK3A 3VMFA 4LV8B 3WNCA 2ZJOA 2ZJBA 2JLUA 3BFKA 4IDHA 1HH4A 2GVDC 3PUZA 4D81A 4KFTA 4HAVA 3U7HB 1Z0KA 5SZKB 2ZANA 2NQ2C 1UDXA 4KBGA 3SC3A 1YRBA 4HDQB 1NI3A 4KXFB 2VHCA 4HEJA 1IOZA 4N1AA 2GNOA 3MCAA 1S3GA 2D2FA 4US0R 1Z28A 2DHRA 1OB2A 4QM7A 3TUIC 2R44A 1L2TA 3O8RA 2REOA 5CK4A 3THWB 2OILA 1N6NA 4URUR 1YZLA 3MWLA 2MSCB 3K0FA 2Y8EA 4LHVA 3SI7A 1MO6A 3WBKA 1EFRA 3AVXA 2ODNA 4LY6A 4NH0A 1W5SA 4KJZA 4PZYA 4B3DA 5E4FA 3DMNA 5EXTA 4JS0A 2A3RA 4C0KA 1GRRA 1TAGA 2GRJA 3PJRA 1UF9A 3V00A 2AK2A 4OHXA 3K09A 1XMVA 4OQMA 1CJVC 4LJ6A 1P2SA 3CNLA 3GMTA 4PO1A 4QGHA 1XCGB 4TMTA 5DI3A 3T15A 3BOSA 3SHFA 1AKYA 2REXB 3BIFA 2P5SA 3MUFA 2RMKA 1LW7A 3TMKA 3EA5A 1KAOA 1GG2A 3ZIAA 4XSHA 4FWIB 5UKDA 4C0QC 4DDUA 4OI4A 3X2SA 4URVR 3EPLA 3AVUA 2QBYB 3RRZA 1E2EA 3RWOA 2BMDA 5EUQB 4D82A 1H8HA 4US2R 4DIEA 4CEHA 2YOHA 5P21A 4ACBA 2QM8A 3C8UA 2OAP1 2GJKA 3WRXC 4BECA 4YMSA 3BWDD 1SVOA 4IDNA 1QVRA 1AM4D 1YKSA 3PV0A 3AUXA 4OJKA 5LD2B 4QJ3A 2P67A 1T91A 3W5IA 4QNRA 4ESVA 1KY3A 1FW6A 4Q1CA 5A4JA 3FMOB 3SS8A 3OEED 1R0YA 4HDCA 1G7SA 2G88A 3SFVA 3W8NA 1ZM7A 3U7FB 2C5LA 3GJ6A 1D8TA 4JBWA 2IXFA 2Q6TA 1ZUHA 4DJTA 3WRYC 1FOEB 2CCKA 3MMPA 4LJ7A 2H92A 2ZJYA 1FUKA 4MKFA 5HE8A 4EQ6A 3QXHA 4DRZA 4A82A 1UM8A 1Z0AA 1G64A 1GRNA 2RGAA 3LVRE 4O0MA 1P4SA 3FYHA 1LS6A 2W83A 2OBMA 1Z3IX 4A15A 2IS4A 1ZRHA 1ZCAA 4NYMQ 1Q22A 4HAZA 5CM9C 2KE5A 4XD7A 1SKYB 4YC7A 4Q7LA 1E3MA 4Q9JA 1DS6A 1RW4A 4K8OA 5D3MA 4M1TA 3SJBA 4M0LA 5GJBA 2ZJAA 1KKMA 4B3GA 4NYJR 5FBVB 4POAA 3KDSE 4B75A 1Z06A 2KSQA 2ZRMA 2A30A 3QG5A 2YHSA 1FTSA 1TTTA 1Q1ZA 1W49A 1FL9A 3K9NA 3Q8XB 4CT5A 4Q02A 3TVDA 4BRWA 2YOGA 1XRJA 4LSGA 3BAFA 1IQPA 1CRQA 3R7WB 3R8FA 4Q00A 3KL4A 1UADA 1PV4A 2NGRA 2PLFA 1K5GA 1JBKA 1CLUA 2NZ8A 1G16A 1SHKA 1TU3A 1XXHB 5CJ2A 4F92B 2AWNA 4A6PA 3QF7A 3ZVMA 2IS1A 2XB2A 1P60A 1QBKC 4LBVA 1N0WA 4TTPA 3QBTA 3W3AA 3UMFA 2IYVA 3I8SA 3AP2A 2E87A 3ECCA 2GKSA 4RY2A 4WA7A 4TQ9A 1OH8A 1VIYA 1SXJB 2J3EA 2WSSA 3SDZA 2V8OA 4OHZA 5G53C 3TGPA 2IEYA 4Z1MA 4CT4B 4AKEA 1G7CA 1IAQA 1X1SA 4ZIRA 1BMFD 1CJTC 1CIPA 2PH1A 4DEYA 4C2UA 2GCOA 2V7QA 4WIAA 1A5TA 3CF6R 3NHBA 2H57A 2OAQ1 3I92A 5L3SA 3C5HA 3KTAB 4BLOA 4CDGA 2W2VA 1W1WA 4UXIA 1OYYA 2REBA 3LV8A 2X77A 4WZ6A 3T5GA 3UK6A 2J45A 1GL9B 4DLZA 3ADDA 4CEIA 3VHXA 1CXZA 4DKXA 2ZRHA 4I1OA 1U8AA 1YZNA 1XEXB 3MD0A 4O25A 1TPZA 1D2NA 2W6ID 3WBJA 3OIWA 1YZGA 2HEIA 3IQWA 4PO8A 4DCSA 1ZD9A 1WXQA 3R9IA 1NMZA 2AFIE 5JI3E 4FWTA 4LJYA 5JHGB 1VDZA 5EE5B 4B48A 1UKVY 5E7MA 3LWNA 3CZQA 3TRFA 4OQNA 1FX0A 2G0NA 1XD2B 4A2WA 5FBRB 1XP8A 4ZI3A 2JA1A 4A0RA 3CR8A 5DNYB 3BRWD 3CLVA 4RD1A 1AJEA 2QU8A 2BJVA 5DH9A 2WJIA 2ZRIA 4PZZA 4TYNA 2GAAA 4JYBA 4Q1BA 1NVWQ 1T0JB 4Q4JA 3T34A 3CO5A 2ZXUA 3NBYC 4WAUA 1UKEA 1BMFA 3AV0B 4ILEA 3TE6A 3W9YA 4ZCMA 2FNAA 2OM2A 3OEHA 4NYMR 5A5GA 1Z29A 5SZIA 4TMKA 4IVRA 1CJUC 1X6VA 4PC7A 1UAAA 3QVVA 3IBYA 4EJSB 4I1SA 2XOKD 3BB1A 3MJHA 4TQAA 3LVQE 1BH2A 1GFIA 3MJRA 4DLTA 4DSOA 4QJ4A 2ZSDA 1JJVA 3IIKA 3C5CA 4IDPA 4LJ4A 2VTKA 3A1WA 3U3MA 4Q9LA 2ECKA 1JXOA 5JSZB 2DYKA 3EIEA 4PPGA 4LOAA 1D2MA 4ZV4A 3RSOA 5M04A 5HZHA 2HF9A 3UKDA 3VX3A 4MDEA 1EFRD 2ZS7A 2IA5A 5KUTA 1P9WA 3MFYA 2ZS9A 1LVGA 4DB4A 4PZLA 3W6PA 3TQFA 1FZQA 1YQTA 3BH6A 2ZETA 3QY0A 1E1QA 5BN4A 4NONA 2IK8A 5C4MA 1IY1A 5JCZA 2IEZA 3IQXA 2B21A 2P5TB 3IILA 1KOFA 4TMVA 4XJXA 5BWMA 3AKDA 4HSEA 4PAOA 1N0UA 221PA 5J47A 3ASYA 3K0AA 1NKTA 1KO8A 1DVRA 4OJQA 4L5BA 3LX8A 2JLZA 3K70C 4M8NE 2ZSBA 3IHWA 3VNVA 4JBYA 1RRPA 4LC0A 1QHHB 4DT1A 1DAMA 1Z5ZA 3K0EA 1HV8A 5CYOA 5KNBA 4QFMA 2GF0A 3SOPA 5L3QB 4KFRA 1HT2E 5HCIA 1IXSB 2ERYA 1GL7A 3W5JA 2ZQ5A 1OFUX 2CL6X 1RJ9A 4DCUA 4ZDKA 4XIGS 3FMIA 3NBXX 3I62A 3AB3A 4HLUA 1XNJA 3SJAA 3EAQA 5KDLA 3O47A 1YR7A 2H5EA 5DE3A 1LV7A 4DXAA 1S96A 1EFHA 1AQUA 3A4MA 4HLQB 5JJIA 2VO1A 2FPKA 3OEEA 3OEHD 1E69A 2ATVA 1SXJC 2QORA 5JWHA 4J0QA 4B3CA 3P20A 4DCTA 5JSZA 4IOLA 4HB0A 3FMPB 4MH0R 3AH8A 4GBMA 4AI6A 4O3MA 4FXPA 1CKEA 1NJFA 3VR2A 2P6UA 4R2HA 1UJ2A 2VPPA 3W90A 3GFOA 1DAEA 2H8KA 1H8HD 1KTVA 2EFHB 3QXCA 4PPQA 2HCJB 4JT2A 2VSXA 4IKEA 4K46A 4RD3A 3GLHA 1Z2CA 3THOA 2O8FA 2D3WA 5FOXA 3P32A 3L8ZA 1BIFA 1N6KA 4NE2A 4PR0A 5L3RA 4NCJA 3KJGA 1JECA 1GM5A 4JVSB 1OIWA 4D0NA 2IS6A 5F98A 3BD9A 1JNYA 3TUZC 2VF7A 5DHFA 4Q1EA 4BGDA 1WB9A 3K9LA 2P6RA 1II8B 4BEJA 2PZGA 4EPVA 3GJ5A 1E9DA 2LCFA 1LNZA 3NKVA 3THYB 3B1WA 3L43A 1QZXA 2BC9A 2FMXA 3OESA 4AG6A 1ODFA 1UKZA 3ZVRA 2GA8A 4EPWA 5KU1A 2GXAA 1T5LA 4MITA 3NBFA 1EESA 1Z6GA 2VHJA 4B33A 5AUQA 3SQXA 3RHFA 1KNXA 4RZ2A 2F6RA 5H1YA 1WQ1R 3QKSA 4ASUA 4BE7B 1RE0A 4ZDIA 1DAGA 2FPLA 5JMTA 4HZIA 3FE2A 2JLXA 1DG1G 3KTAA 4KSBA 1DO0A 2AX4A 3ZDQA 1PLLA 1IN7A 2HYDA 1IXRC 3IGFA 1OKKD 4I81A 4NL4H 5G40A 3KQNA 3SYLA 2BJWA 3TK1A 1OXUA 3K53A 2W00A 3CM0A 2D2EA 4A0FA 2I1QA 2BOVA 3VR5A 5L3VA 2OLKA 1AS3A 5B30A 3BFXA 2C03A 1MO3A 1RYHA 2VL7A 2DB3A 2IWRA 3AF0A 4P4UA 3WP1B 2A5FA 3K1JA 4IEEA 4TL9A 1XCMA 4TN1A 3TAUA 4DBLC 3LY5A 4DDTA 3WNBA 3SN6A 1EWRA 3QKRB 5LPNA 3PEVA 1NSTA 2A9KA 1UFQA 3IEVA 1Q57A 1MABA 2IYWA 3I73A 3U5ZB 2B8TA 2DR3A 1FPMA 3EX7C 5FUYA 1U81A 2WMNB 2FGJA 4EPRA 4RFSA 5FUXA 4EPTA 2ZYVX 4JLBA 3U3JA 1H8EA 4JLMA 1X8KA 3H84A 5B58C 1W2HA 1JI0A 1KAGA 1Z0JA 4BEBA 2PJRA 1P72A 1E0KA 1E9EA 2HV8A 3LA6A 4GNKA 4EDHA 1N6IA 4L16A 4R7ZA 1HQCA 2GEUA 4JSYA 1IM2A 1CJKC 3SZRA 4Q7JB 3PENA 3ZH9B 5KYKA 3SYNA 2FFHA 2FA9A 2WKQA 3N5CA 5DHAA 4TSFD 1GAJA 4PX9A 2O8BA 1KSFX 5AJXA 4GPTA 1E2MA 4KBFA 2FU5C 3QI2A 2ZAOA 1E6CA 3P1JA 5D3MB 1B23P 2O8EA 4E03A 4GDFA 1J90A 2HXSA 4YMUA 1N5KA 2Q0HA 4Q5IA 2WWHA 4P4SA 1WBBA 2ZITA 5KOYA 2FWRA 3B9PA 1JQJC 1GITA 4TLAA 2CDNA 3UIEA 1P2TA 4W7SA 4WXRA 2A78A 4ARZA 4OI2A 1E2QA 3AF4A 1ZMXA 4ZKDA 2VHQA 3I5XA 3U3KA 3B5JA 2WWYA 1G5TA 3HP1A 2O0HA 4WBSA 2ERXA 3UPUA 3R8CA 1DAFA 4V03A 1J70A 3EWSA 4X8OA 4QHTA 1M7HA 3A1SA 2HT1A 1RPZA 1XCPA 3GEIA 3GLHB 5DYIA 1QHXA 4Q1FA 5H70A 1U90A 3QKSB 1JR3D 2RGEA 3CRRA 3RSLA 4EFLA 5KNDA 1UBGA 4DCVA 3UATA 2FZLA 4WVFA 2C2HA 2JLVA 3OE7A 1CRPA 2JASA 3G5UA 2BBWA 1M7GA 2C04A 2FH5B 1NVVR 2Q9AA 4QGGA 1Z6AA 3BJIC 3ADKA 3T61A 5B64A 5IRCD 4DLVA 3AKEA 3I61A 2CE2X 1G3MA 4B2LA 2R6CA 4HLUC 1W36C 2CLSA 4BFXA 2Z6VA 1SVWA 3P4XA 2QNRA 1Q3HA 2W58A 4DSUA 1SKYE 3I32A 2GBLC 4JSTA 4X8LA 3VQTA 3Q9LA 3VTKA 1R0WA 3PIRA 3VR6A 1UDWA 1OJLA 1US8A 4OK5A 2CE7A 3KXKA 4DLUA 1W47A 3U2QA 2ZPTX 1A82A 3GLIB 1I4DD 2J7PA 5FI1B 3RANA 1TEVA 5H8WA 3MAAC 1VG0B 2J0UA 4CZ2A 3C15C 4LJ8A 3D6TB 4CRWB 1Z07A 4UJ3A 3QNUA 4LYJA 2HLDA 1US8B 4NZYA 4OQFA 3B78A 3CRVA 2XJ4A 2ZRFA 2CVHA 1OXXK 3EC1A 2BMJA 2GXSA 1ZNYA 2FF7A 4S2EA 4DSNA 5HKKA 2FDCA 3F5FA 5CDFE 2B92A 3DOEA 1Y63A 4M22A 1IY0A 1XTQA 1Q20A 4LYHA 2GHIA 3VR3A 4KLZA 2F7SA 1XEFA 1R10A 5DLQC 1U8ZA 5J5CA 4A9AA 4TZ0A 1G4AE 5JJKA 4PXAA 3SJCA 1MR3F 1CEEA 2G0TA 4IXMA 4Q21A 4URWR 1JQLB 2EFDB 1BKDR 1K6MA 3CNNA 2JJ1A 4JYCA 2YINC 1DELA 4F38A 4JLJA 1GKYA 2EQBA 2FEOA 3TAHA 1CJMA 5AJVB 3RLFA 5IDVA 2RGDA 1E98A 2PBRA 4IXNA 2GF9A 1K8RA 3KJEA 4YLGA 3JZAA 2JATA 5L3QA 4RFSB 2GXUA 3VKWA 1XJ0A 2AXNA 3BE4A 5JEEA 1UEIA 4WZBE 4BZQA 3CX6A 4B2PA 1W5TA 3UMRA 4FINA 3LD9A 5E3HA 4F93B 1DO2A 4U02A 4ERNA 1S9HA 3QKRA 1U0HC 2IYQA 4MRNA 1DG3A 4B32A 4EPXA 1KK1A 4TMXA 3KQKA 4NYIR 2XOKA 2O5VA 2O8EB 4HYYA 1W4RA 2DY1A 3M1IA 4UNNA 1R8SA 4M1SA 4MKIA 4EIWA 5FFMA 3T1VA 3CH5A 3BBPA 2NMVA 5JCPA 1BYUA 4W5HA 2HYIC 3T1QA 1JAIA 2AN9A 1W44A 1ONBA 2VHTA 1MT0A 1NMYA 4D4JA 1KZGB 1M34E 1NBMA 4HB2A 1XPUA 1XD2A 5L8VA 3FKSD 1BOFA 721PA 4YDSA 3V4RA 3IIJA 4Q18A 4ASUD 2XAUA 2BCGY 1ZINA 2WJHA 3RS2A 4M53A 4PHTA 2IYSA 1G7RA 1TEXA 5GADl 1J8YF 3ZVNA 4NBSA 1GKUB 2PX0A 4CGZA 4PSVA 4G5SA 2Z43A 2YOFA 3A1UA 3VHLB 3FHTA 4TL7A 4AK9A 2WICA 2ANCA 3BB3A 1E94E 2AD5A 4BFZA 2B7CA 1KI8A 4XWOA 3X1WA 3UXMA 1M1YE 3QEOA 4D6PA 3G0HA 4IJMA 3SYKA 1T8TA 2ZRJA 4TYQA 2JLYA 1NMXA 3Q7PA 4RZ3A 4XD7D 2PMKA 2PCLA 3PG5A 2ZS8A 4MQBA 3RS5A 2HJVA 2IHYA 3WYAA 2AD1A 3I4LA 2OEPA 1KSGA 2DWPA 4A8JC 3R9XA 4JKIA 3R9WA 1GVNB 3IHLA 1N6LA 1SVLA 3W34A 1E4YA 4QGAA 3GD7A 1TQ4A 2ATXA 4OL0A 1TNDA 3N70A 5FOUA 1DTSA 5EXSA 3OIUA 4QM6A 4QBIA 5FUWA 3ND9A 2OV2A 4HB4A 1GKIA 1E2DA 1G20E 1W36B 1I4TD 4LPKA 4ZO4A 1XEXA 3DZ8A 5JEDA 3ADCA 4BPBA 4ACAA 2IYXA 3L0OA 4JL8A 4QRHA 5DGXA 3IEUA 2ASEA 1NNEA 4GZMA 4Q48A 4NKRA 1Z22A 1XJQA 1P75A 4ZDJA 4PANA 1ZUNB 3CF0A 5FTMA 4GOJA 2GZAA 2A5DA 1COWD 3HPQA 1TX4B 3B1YA 3MG9A 2J59A 4QBFA 2ZVPX 1ZUIA 3QVUA 3DHWC 2J1LA 4WOPA 4Q7KA 4DDVA 521PA 4LCBA 3MWJA 1R7RA 3UWKA 2D4HA 2NO6A 2IT1A 3MGCA 3WP0A 2J0VA 2GCOB 3K8YA 2ZIAA 4HATA 2BMFA 4MYUA 1RJ9B 3FB4A 3EZ2A 3RDPA 1AA9A 5AR1A 4U7DA 1ELOA 3NTUA 4BFWA 4B73A 2CK3D 2OCPA 5C1BA 4C0BA 1KJZA 1JPJA 3AP1A 2OHFA 1QHNA 5JLJA 4TSFA 2WPDD 4AD8A 3DVLA 3RRYA 3PFIA 3TSWA 4OI0A 3HYTA 1XFAA 1EFTA 3DL0A 3L2OB 2GEVA 2YYZA 4I99A 2YWGA 2J7KA 5GJVC 2WOJA 3PITA 3K0AB 1YRAA 1YZKA 5BYKA 4V0LA 4MYCA 1XXHA 4FMDB 1OPXA 4G0NA 3LAWA 5J4VA 1Z6TA 3DEFA 1I2DA 4RVCA 3W6NA 1MOZA 2CLCX 2R65A 1I4LD 1SVSA 3EPKA 2Z4RA 3EIQA 3TLXA 2RGCA 4JLKA 3LDAA 4X8HA 1RVDA 1MH1A 2XITA 3O8DA 2QL6A 1N5LA 4XH9B 2VA8A 1L4YA 2QZ4A 4UNSA 3U6KA 2Q9CA 5JRJA 2WTUA 3KB2A 1OV4A 1F3OA 1NG1A 3BH0A 3CZPA 1S3SA 1GRQA 2PL3A 3WHLA 2GCPA 5EQTA 3AF2A 4MRVA 4KHZA 2B7BA 2BMEA 1N5IA 4BUJA 1W0JA 4DT1B 2NTYC 1NLYA 5FBQB 3SFZA 3LFUA 1MRNA 2WPDA 2AR7A 1HY3A 3F8TA 1KO1A 1U8YA 4M1MA 3EPJA 1KO4A 3CW2A 1AGRA 2QRZA 3OE7D 4LJ5A 5KPJA 4UNRA 2EYQA 2ZI4A 3OZXA 4D4KA 2Q3MA 2O8FB 1DADA 4F4CA 2GILA 4HAYA 4P3YA 1UKYA 2ORIA 4TZ6A 1Q1EA 3AEZA 4F4IA 2ZU6A 1VKJA 1G1MA 4PPNA 3HJNA 3GLIA 3CB4A 1IXZA 4NHOA 4LHWA 3A6PC 3AQ4A 4OK3A 3AF1A 1DOAA 1KI4A 2ZRNA 2RGBA 3EZFA 5JBQA 1EX7A 2ZI6A 1ZP6A 3TW8B 2F1JA 4OYHA 1AK2A 2HLDD 2JLRA 121PA 1NVVQ 3GJXC 1GILA 3GJ4A 2NZJA 2HT6A 1NJGA 1Q1BA 2DPXA 3FFAA 3KUCA 3LO5A 4ZCLA 3X1DA 4DB2A 1D5CA 2PJZA 3ZJYA 2XEXA 2QUZA 1GNPA 3THWA 5AUNB 2IWHA 3SU8A 3GCGA 4TL6A 2LKDA 5GVSA 2RGNC 2QMOA 5KTYA 1T4GA 1R8QA 2CL0X 2DFKB 2NO1A 3AP3A 3AGQA 4FI3C 4MUBA 4QOSA 5CB8A 5IHPA 2V54A 3L0PA 2BKUA 2GWHA 3WXMA 1G9XA 4WZAE 1CU1A 1X86B 2WZQA 3T1OA 3NH6A 1XTJA 1KI9A 3MRSA 1TQ6A 1Z6XA 3CKLA 4QHYA 1IN6A 2WWFA 1VPLA 4IOMA 3GJ7A 4Q01A 1E9RA 4ZIRB 3QPWA 2FZ4A 1YZTA 2WSSD 4YMTA 2XTNA 3ZQJA 2CK3A 3LQRA 3U4QB 3W6OA 2YWHA 1QHGA 3AKCA 5FOVA 3ZLJA 1SZPA 2ZE7A 1R4AA 4F91B 3BC1A 1SXJA 2PZFA 3K0FB 3EARA 3G82C 1OH6A 2OT3B 1ZJ6A 4OK6A 2GZDA 2QQ0A 3QQ5A 4FN5A 1E2PA 5CLLA 4DUGA 4KCGA 1PLKA 1J99A 2RHDA 2ZU0C 2DFTA 2IUSA 3ADBA 5FTJA 1NRJB 4CEIB 1OXSC 1KMQA 2JJ8A 3CPHA 1FFHA 1MKYA 5LB4A 2BBOA 3TBKA 4DCNA 3ZZUA 3DOFA 2R8RA 4KO8A 4CVNA 4L15A 4HZUB 1GNQA 2ZE6A 1N6HA 1IN5A 1W0KD 4L9WA 5ANRB 4JVLA 1F48A 3SBEA 3QPVA 4XWAA 1S9DA 4P4TA 3AGPA 1R0XA 1PLJA 3RNLA 4TT3D 2X19A 2J46A 4L4UA 1ZBDA 3H0KA 1W0KA 3RC3A 4B35A 1UBCA 2Z4SA 3U3RA 2N42A 4TLEA 4V0ME 4JLDA 3TNFA 2GDJA 2OXCA 4OHYA 1Z83A 3NWJA 1CR2A 4MUAA 4A92A 2ZYUX 3CR7A 4C4PA 1CR4A 2QROA 4I1UA 2XZLA 3VU9A 4DUGD 1XX6A 2E1RA 4PTLA 1J7KA 4QHSA 2FSFA 1VYTA 3E1SA 4IRUB 4YMWA 2O0KA 3R7WA 5K8TA 1VCMA 2BCJQ 1JB1A 2WAYA 5FTKA 3CX8A 5LD2C 2AKAB 2QSZA 4D25A 1X8LA 4HAWA 5D3QA 3FDIA 5HR5A 4IEIA 5AK0A 1KJWA 2F9LA 4K81B 5BYJA 4B47A 1E9AA 3TVTA 4MKGA 4Q19A 4Z8XA 5SZJA 1Z6YA 2BKEA 2O8CA 3QEJA 3U7GA 1U9IA 4C0JA 5IK2A 3KFXA 4XWKA 2VH5R 4TYWA 1NY5A 4NMMA 2UVQA 5B57C 3MSXA 3SQWA 3GJ3A 1KI2A 4B2IA 1FNNA 2IHBA 3QXXA 1XJCA 2H16A 2IBMA 3WMEA 3FTQA 2W6JD 3AF3A 2IYLD 2CCJA 4ESHA 5GJWC 4AYWA 4ZCIA 5K8UA 5KSZA 4NCIA 1E0AA 4M9XA 1CTQA 3ONWA 2IW3A 4M1KA 4BFTA 1V5WA 1D9XA 2ZRLA 1VCNA 1Q12A 4G1UC 5H68A 2KBEA 2WKRA 1KGDA 2ZRGA 1EK0A 4MGYR 4XVUA 5KSYA 2ZRKA 4B6EA 2G1JA 1P2VA 2BBSA 2GCNA 1T3HA 1VG9B 1KK2A 1P9NA 1ZNZA 2V55B 3QKUA 4PFSA 2K5UA 5FPKA 2N46A 1QHIA 3THXA 2FG5A 3ICEA 2KWIA 1NKSA 3A1TA 1X1RA 2H7VA 1MV5A 5JWRA 4UJ5A 4QBGB 4OKSA 1L7VC 3OIYA 1P5ZB 4GZLA 1R2QA 1KDOA 4E5UA 2NO0A 3QUSA 2F1HA 2HJGA 2YWFA 5HZKA 4BLTA 1OF1A 3A37A 3WYGA 2VYFA 4RKFA 4BFYA 4MYHA 1AZSC 1P62B 5C4GB 5AWFC 1A7JA 4DZZA 4KSCA 3TR5A 4G5RA 3ZGXA 5FTLA 4UQOA 5FBWB 2QTHA 3PCRB 3LNCA 4EFMA 4EUNA 2QBYA 3KKNA 4D80A 3FHOA 4ZI2A 2ONKA 3J81k 3FWYA 1XPOA 3FVQA 4PHFA 5JHHB 4RZUA 3PVSA 2XXAB 3LW8A 5LB2A 2WV9A 4D4MA 4R2IA 4M9QA 4UNPA 3B7GA 3AVQA 3S1AA 3QENA 2Q3HA 1NY6A 2VRWA 5SZHB 1D9ZA 2RGXA 1E96A 4C0SA 2AL7A 2TMKA 4PAQA 4RD2A 4ARZB 4JZKA 2R6AA 3GPLA 2ZVQX 3IUYA 1ETUA 3CF2A 2BBTA 1YVDA 4PC6A 5DN6A 2WWWA 4BQSA 3GLGE 1PUIA 3D3QA 3E5HA 4IW3B 3GEHA 1FUUA 2VP4A 3KKOA 2QGNA 1NP6A 2YWEA 1NN3A 3AVOA 2MSDB 4IVPA 3C41J 4UNQA 5FBLB 2J87A 4G5GA 3L0IB 4YONB 3TW4A 3EASA 2JJ1D 3VKHA 3H4MA 5DI9A 1PZNA 1G8GA 1LB1B 3RABA 3D31A 4MKHA 2O8BB 5FPHA 2W6JA 3PQCA 1FQJA 4I4LA 3EW9A 1JR6A 4E09A 4R9UC 1U98A 1N5JA 3EZ6A 1F60A 4EJSC 2ODBA 1G5RA 2ZI9A 3LBHA 2JAQA 1AS0A 4MA4A 1KIMA 3F0TA 4QXAA 3U61B 1T9HA 1ZD8A 4HDOB 4BLQA 1F2UB 2QM7A 2VSOA 3KKMA 2KI5A 3GJ0A 3DZDA 2GJAA 5DISB 3PUVA 5F9FA 1MABB 2BV3A 4PC1A 2R6DA 5B2ZA 4RJLA 2UZ3A 4LV6A 1JAHA 3ZIAD 1G3RA 2G6BA 2VLIA 4JLPA 1G21E 2QP4A 3FOZA 3DKVA 3ZD7A 1Z0FA 5E7JA 3AVTA 1WMSA 3U3OA 2JDID 2ZROA 2ZM5A 2EFEB 3ZS9A 1WRBA 2AFHE 1XZQA 2F3TA 1ZNWA 4C3ZA 1W2GA 5G3YA 1XEWX 4GMDA 3GJ8A 4Q1AA 1E2LA 2JEOA 2PEYA 4LYFA 5AUOB 1CF4A 1QDEA 2LKCA 5FI0B 4Q9IA 1XXHE 2CBZA 5CLQA 5KPDA 1FX0B 4HLCA 1DAIA 1F2TB 1NIJA 3LX5A 3ICQB 1KMHA 4DLSA 2WM9B 4TTQA 4XVQA 5DSZA 3PUXA 1EG7A 3W3ZB 1GNRA 1HTWA 1XD8A 1O3YA 1FQKA 4Z1MD 1Z63A 1ESMA 4GFDA 4BWYA 2QPOA 4U5XA 1ZU5A 5IT5A 1WF3A 4NDZA 1VHLA 1XWIA 1XPRA 1EXMA 4Q4AB 4F4JA 3K9GA 1G8PA 1HE1C 1Q1QA 3THYA 2B6HA 1DARA 1KNQA 1AIPA 3BERA 1W46A 5HCNA 3M0EA 1II8A 2ZE8A 2ZR7A 3B8HA 3T12A 2A7QA 4C7OA 1W4BA 1KI6B 4NCNA 5EZ6B 5AJWA 3LW7A 3GLGB 1RFLA 4JLVA 3LH5A 5KDDA 4L8GA 4QG7A 3QJYA 4B6FA 3B1XA 1OH5A 1U2RA 4OQXA 1DEKA 2D74A 4X8MA 1R5OA 1UEJA 4PQRA 3CONA 5GVRA 3U7EB 3OAAA 4US1R 4A1FA 3A4NA 1T3SA 4KYUA 2RKOA 3RYTC 1R5BA 5KHOC 2JLQA 3WNDA 2EFCB 3QG1A 1Z0DA 3ZVLA 2QN6A 1RZ3A 4M1WA 4URZR 2QT1A 2ZSEA 5KDOA 5KO2A 1W0JD 2WJGA 4ON9A 3LLMA 1KDTA 2GBLA 1RRFA 2C9YA 1R5NA 1EGAA 2ODEA 1QHYA 2XB4A 4LV5B 4Q47A 2R2AA 3MWYW 4ABYA 1E1QD 2AXPA 2FOLA 3KKQA 3HU3A 4IVQA 2JDIA 1J8MF 2BHRA 1ESNA 5DO9A 3TH5A 4C2TA 2HXYA 5IF9A 3RS4A 2W2XA 1HE8B 4LBYA 3VFDA 4DEXA 2A2ZA 2VIIA 3LLUA 4H1UA 1BYIA 4DC9A 3U6BA 2HUPA 3ETLA 1A2BA 4Q4HA 5J4HA 3HWSA 4U00A 2VP9A 2P6NA 4KU4A 4DSTA 3RS7A 4IHQA 4LJ9A 1PUJA 1QVAA 3CPEA 3AM1A 1CBUA 2V1UA 2WIBA 1HUQA 3B85A 4LI0A 1T6NA 3BORA 3QF4B 2OXRA 1U0LA 4HUTA 4PC2A 4AC9A 2XNDA 3QSYA 1QHHA 1P9RA 2SHKA 3PUWA 4RCYA 3ZZTA 1NSFA 2QE7D 1TUEA 2UKDA 4E07A 1L8QA 1CR0A 1E2IA 1E99A 2AKYA 4TWZA 5TV2A 2X2FA 5TXGA 5JI2E 1LY1A 4W9MC 2FFAA 4BLSA 2RGNA 4L9SA 1UBEA 3GP8A 3QOFA 4GL2A 4XTCS 3EZ9A 4IFEA 3UWOA 3L8YA 4GSYA 4EKDA 1W48A 2EWWA 2V9PA 2CNWA 3UG6A 1P3JA 1HA3A 2OFWA 2PMDA 4AKGA 1OFHA 2ONJA 1KI3A 4MGKR 4QJ5A 3PEYA 4GP7A 3DPUA 1MO5A 1EWQA 2FGKA 1Z47A 4A6XA 2I1VB 2GK6A 2OFXA 4H9GA 2RCNA 4YXWA 2FSIA 1XZPA 4G3XA 4D4LA 2XZOA 1OXVA 2VF8A 1ZM4A 2IXGA 3VR1A 3A4LA 5G3ZA 2FSGA 3TR0A 4FMDF 5FL7D 4KVAA 3IKJA 1FP6A 4IOKA 3MLEA 4G01B 4LHYA 2P2LA 4CEJB 2CEAA 2R9VA 4CEHB 4JLAA 3X1XA 1YZUA 1RC8A 4UXJA 2WKPA 3TIFA 4EJSA 2H1LA 1E2HA 1K5DA 2OG2A 4JLOA 2YKGA 2H17A 4M2LA 2F9MA 1IY2A 1G8FA 3QXSA 4A2QA 4YXWD 1YZQA 1M6NA 4RSGA 3QIAA 4P31A 3P27A 4BLRA 4Q4JB 3H86A 4DIDA 3RC8A 4V0MA 4M1OA 3EG5A 3NXSA 5FOWA 1N3BA 4NCHA 1F6BA 4RZXA 3KFVA 4W5JA 5JFGA 3HYRA 4EAQA 4JT4A 3VKGA 2IF2A 1AS2A 5K8IA 2QQEA 1XF9A 3IBGA 2A5JA 5CM8B 821PA 1OB5A 2FE4A 1VG1A 2XJ9A 4YDHB 2WMOB 2PCJA 3Q3JB 4FCWA 4KI0A 2QAGA 2FFBA 4A0GA 1MRSA 3M4YA 2GESA 4NTZA 4B43A 1HURA 2GXQA 1R6BX 2J7PD 4M9ZA 1IN4A 1W4AA 3SNHA 2B8WA 2CJWB 2QMEA 2W0SA 4LGMA 1G8YA 2QEQA 3IIMA 5BW8A 4B3FX 1PVOA 4JVMA 8OHMA 4LJAA 2ZI3A 1G18A 1S4QA 3IDQA 3W8RA 3C7KA 4D0GA 4UXHA 1NN1A 4A4DA 1Q3TA 2Z83A 2V4ZA 1JPNA 4GMXA 2CL7X 2G3YA 5K8LA 1C9KA 3WHKA 1G41A 4OHWA 2XXAA 5ELXA 2IF0A 2WJJA 4URYR 5L3SB 3WMGA 2D06A 1NVXQ 3CWQA 3Q7QA 4O2RA 1KO5A 1ZIOA 5A0FA 2W0MA 1SVKA 3Q85A 5JS7A 2R6FA 2W2TA 3PEWA 3CRMA 3KQLA 1GSIA 2MMGA 5JWOA 4ZDWA 3T5DA 2XTZA 4D0LB 3OIVA 3BS4A 2ZAMA 4LK2A 4D2IA 2GETA 2QE7A 3NVAA 3I1FA 4FCVA 2PT7A 2G83A 3AUYA 3WYFA 1VCIA 5CB6A 1FNMA 1CP2A 1OFTA 1QG4A 1XD9A 2GK7A 2OESA 3GLHE 1S1CA 4PQFA 1VMAA 4OBEA 1S1MA 4NPHA 4JBXA 3Q5DA 1XTRA 4R98A 1XMIA 3BGWA 3FGNA 1N6OA 3K9HA 4XVRA 3IPYA 1N25A 4FIDA 4LHXA 4I1VA 1EFUA 3CBQA 1NN0A 2ODWA 2QP3A 4TLDA 1IN8A 1WA5A 4Y0VA 2W6IA 2KJQA 1UPTA 4BLPA 1WBDA 1II9A 1E2FA 4AKHA 5FTNA 1GDDA 1OIXA 2JJ2A 3B60A 3NC1C 3NIBA 3EIHA 3AKYA 4HI0E 3K70B 2CHVA 3SE0A 2C95A 1GTVA 2IUUA 2QAJA 2F1RA 2G9NA 3ZZ0A 2CLDX 3AVYA 4PAMA 1N6RA 1TL7C 4QKQA 2HCBA 2LWIA 1GZSA 2MSEB 3P4YA 4ZKEA 1TADA 1X3SA 4P33A 3FHCB 1HEIA 3RRNA 2C9OA 1TQDA 2BEJA 1NBME 3I3SR 4LBWA 2YV5A 3AVPA 5KSPA 5AJZA 4GP6A 2KB0A 4Q1DA 2RB4A 3CX7A 4EQ6B 3D7MA 3NEYA 1E9FA 6Q21A 2ZSFA 4WW0A 3HR8A 4KITB 2NIPA 1G3QA 5JS8A 4LZZA 5EJEA 3VNUA 3NEJA 2C98A 3IO5A 5EXPA 3BH7A 3VU9B 1OH7A 4JLNA 5EE3A 3IO3A 4IDQA 1QF9A 1DPFA 2WWXA 3TUJC 1G4UR 1GWNA 1KSJA 3C4JA 1NIPA 3NH9A 4Z54A 1E79A 1KY2A 2QENA 2WVJA 3NDPA 2WAXA 5KNCA 1DAHA 2NO7A 2FN4A 4KODA 2ZRPA 4GT1A 4Q9HA 1Z2AA 4M1YA 2ZTSA 1U9IC 1KSHA 1TF2A 1G7TA 2DFNA 1S2MA 2ZUCA 2G1KA 621PA 5TMPA 1TF5A 4H1VA 1CS4C 1ZM3A 4DDWA 2QPAA 5FR2A 3O8BA 4LBZA 4PSAA 1NLFA 3C16C 5FH9A 4EPYA 1KO7A 1ZCBA 1JXMA 1YR9A 1C1YA 4Z51A 5DI3B 4AIIA 1SXJE 5EP1A 1E4VA 4C9BA 2GEDA 2BM0A 2WJYA 4HUQA 2YNMA 1N0VC 2CCGA 3KJHA 1W4CA 1E0SA 2CJWA 2NPFA 3REGA 5JZVA 4QL3A 4JJZA 2FSHA 3RAPR 4BASA 4MYTA 1ZM9A 1WE2A 1M2OB 4UKDA 5CYPA 3TKLA 3FMFA 1XMSA 2IYZA 2OO7A 1G6OA 4RKEA 1BS1A 4XTRA 2QAGB 1SXJD 1JEEA 3U60B 1SHZA 2J41A 4LX0A 3X1ZA 5CDFA 1I2MA 1SKQA 3CH4B 2F43A 1AZTA 3BK7A 1LS1A 1P2UA 1E9CA 4MGIR 3K70D 1RRGA 4PPFA 3S1AB 2IYYA 3U44B 1IJFA 5E95A 5EP3A 1RYFA 3V9PA 3ASZA 1G19A 2ZI5A 2QRNA 5FOSA 4FMCF 2BIFA 4OI1A 1Z08A 2GJSA 1GUAA 5AUPB 1XB2A 2ZRCA 3T06B 2JIZA 3TSOA 5BXQC 5CJPA 5EE9A 3GEEA 2XSZA 4KYIB 2HDNB 1SVIA 1HT1E 1D2EA 3CRQA 1H65A 4P32A 2PEZA 2ZRBA 2EW1A 2AWOA 1M7BA 2P65A 2I3BA 2ZJ2A 4LUCA 2ZI7A 4Q4LA 1KHTA 1XMJA 4LDJA 2VQSA 4LRWA 3I5YA 3BXZA 2V6JA 2GVZC 5HTKA 1IONA 2AHOA 3SR0A 3OHMA 4AG5A 4JL6A 2RHMA 2GAOA 4E22A 3QBVA 1GP2A 2OCBA 1OKKA 4XSGA 4QC2A 3WY9A 5EUMA 5C2JB 4DLYA 4CF7A 1JEDA 1KDPA 2CMKA 2VP6A 3B2EA 3X1YA 1QHSA 2ORVA 3REFA 2EVWX 4V0OA 2ZR9A 1A1VA 3OFNA 2J5XA 4GI7A 4M4SA 5KSOA 3VX4A 4C0AC 1E9BA 2WIAA 2ZYTX 3CRW1 1OYWA 3V4FA 1FMLA 1G3UA 4B44A 2O8DB 4BZPA 2KBFA 3E70C 3AVWA 1JR3A 2L0XA 5TB5A 1FMJA 1VIAA 4MRSA 1G3IA 4PC3A 2XTMA 3L82B 3NG1A 1W7AA 4V02A 1F5NA 5EE0A 1JALA 1LTQA 5TARA 1LF5A 2EYUA 1IBRA 3H2YA 3QF4A 2BWJA 5JRZA 1SGWA 3B1ZA 4B3BA 5TY0A 2JJ2D 3PR1A 4RD6A 2IYRA 1U0JA 3Q5EA 4N0EA 4NU0A 2FPMA 1QRAA 2ZRAA 2X2EA 3GFTA 4TYYA 1KKLA 1G8HA 1SVMA 5CIWA 4HLDA 2A5YB 5C18A 2QP9X 5HPYB 2J0SA 5J4YA 2QA5A 2C78A 3VAAA 1G291 4KAXA 5EP4A 2IUTA 1U94A 4PHHA 1P61B 1OT3A 2V6IA 2G77B 1OW3B 3EWAA 2ZE5A 4WXPA 4A2PA 3K0SA 3WMFA 1NLZA 2BVNA 3DM9B 2WWGA 1KI7A 2GJ9A 4GOXA 1ZU4A 4BFUA 3SHWA 1ZM2A 1ZC4A 4TLCA 4URXR 2YC2C 1C4OA 1XU4A 1DAKA 2OLJA 3KZ1E 3OF5A 4EFNA 3DMDA 1H8ED 2V1XA 4B3XA 1YR6A 4NYJQ 1E2GA 2AK3A 5DIFA 3GLFB 4Z8YA 1HQYE 1OFIA 2XGJA 2CXXA 3NHAA 1ZNXA 1ZD1A 2QMUA 1WCV1 4Q4HB 1CR1A 5CIQA 4C0LA 5EXXA 4MRPA 3BB4A 4BFSA 3EC2A 4N3NA 2FX3A 4C7OB 2XSZD 5AJYA 4HAUA 1T3LA 2ZRDA 3GLFA 1ZAKA 1EFCA 3CPJB 3JZMA 4HZUA 1TMKA 4JVNA 1LF0A 4A36A 1OLOA 1G17A 4XOIA 1II0A 2IYUA 4LPSA 3KQUA 1VYVA 3A36A 1COWA 2QAGC 4V0NA 5F9HA 1NBMD 1G5PA 2ZEJA 1GIAA 4TL8A 3DO6A 1D6JA 5EP2A 5JJLA 2E9SA 5F3WB 1VYUA 2PZEA 4B76A 2VEDA 2XNSA 1B0UA 2FFQA 1QG2A 1SULA 4A0HA 4JIMA 1NL3A 421PA 1KMHB 4TLBA 1A4RA 1M74A 3LXRA 3U4QA 1NN5A 3EPHA 3L0SA 1O87A 2XX3A 3GQBA 4C0HA 3OFND 4CIDA 2YZ2A 3KJIA 1E2KA 4R71A 1SQ5A 4AYXA 2O52A 3DKPA 4MGZR 1IJEA 3HU1A 2D62A 4BRUA 1KI1A 1UBFA 3ND8A 4N0DA 1JJ7A 2C77A 4RFVA 2ZR0A 1KI6A 2O0JA 4D26A 4A8JB 1ZVQA 5BN5A 5J4KA 4TQUS 3RS3A 2JLWA 3QPUA 3FPAA 3K09C 3FKQA 1WP9A 2X1VA 2Q9BA 3NC0C 4IOJA 3ZD6A 4FD2A 2DFLA 1IHUA 1E2JA 4P0TA 1N2CE 2VP5A 4KFUA 4CEJA 2ZJZA 4S35A 2OBNA 3B1VA 3R20A 2QGZA 3F3YA 3UG7A 1F2UA 3ZS8A 4DLXA 3D8BA 4AKIA 4MRRA 1VTKA 2I4IA 4DWJA 2V3CC 1RRCA 2P0EA 4QGFA 3HU2A 1OIVA 2F1IA 4Q7MB 4PQYA 2WWIA 5HKKD 1OSNA 2NG1A 3I8XA 2IC5A 3O8CA 1Q44A 3B9QA 2CHGA 3EZ7A 5GJCA 3JVUA 1V43A 1OHHD 2BEKA 2JCSA 4FW9A 1RIFA 4QBHA 3KUDA 3CNOA 2X8AA 4NYIQ 4LWZA 3A58B 3KXLA 1PJRA 5J4LA 5C46F 2DWOA 3EA0A 4B34A 4QNMA 4TMWA 4G5OA 3TQCA 1YU9A 5TDHA 5JECA 3QXJA 3B13B 4AYTA 3KXIA 3HDTA 4F7WA 3JVVA 3T35A 1E2NA 5LDDC 3A1VA 2Q3FA 2CHQA 2QI9C 5FOTA 5FL7A 1ZYUA 4B74A 3LBNA 2QTVB 2R62A 4Q66C 4IDOA 3NDBB 2WHXA 4RCZA 4M9SA 1E9SA 2JLSA 5FPSA 1ZIPA 1LFDB 2J9RA 4A8JA 1EX6A 3IPXA 3LXXA 1ZW6A 4G5QA 2OUKA 2ZUDA 2RAPA 1E1RA 3GLFE 3U44A 2RH5A 1YHNA 4TT3A 2NO9A
chains in the Genus database with same CATH superfamily
3GLSA 5A9TA 2C9CA 2PLAA 4QGSA 3Q8LA 3EXAA 1NG9A 1EBFA 4PAWA 3EXEB 2PLRA 2EQAA 1QBGA 2AOWA 4QYSA 4QXPA 5ADUS 5JDIA 1VCOA 2B1JA 3LCRA 4K9KA 1YB2A 2ZB7A 3H9UA 4ZK2A 4HEQA 1TXGA 5ALJA 1H1DA 1F1JA 2XIJA 5D5HA 5GPBA 1NRXA 3VUEA 1T9GS 1M0WA 2FEMA 3W5HA 4EA6A 3D2AA 2N1BA 5ICCA 4OGKA 1OHHA 1P1HA 2WB4A 3TSZA 2XNDD 4QPJC 4MHTA 3SX0A 3MXOA 1T8UA 2PMFA 1KF0A 1SUSA 4PS0A 3UUEA 3ZDXB 3PVCA 5DN6D 3HKDA 5CDUA 3CIOA 2EHDA 4F2PA 4L0CA 4LF8B 1ANKA 2DBYA 2YV1A 4PO3X 2UZIR 2ZYAA 3F4LA 1OT5A 2YS7A 3NWBA 3CWZA 4NU8X 4QQRA 4RPIA 2PWBA 2DXIA 2JIOA 4BHTA 4FGZA 4N12A 1Z0IA 3B6JA 1T5SA 3URMA 4FQ7A 5ELMA 4CBVA 1H6DA 2XD9A 3HLKA 4QDUA 3QVMA 2OMKA 4YRIA 1K7YA 2C8VA 2JPDA 3GRAA 4II7A 3WZMA 4AZTA 1Z8FA 2I5PO 5IYZF 1JQDA 1W85B 3MB5A 4F6LA 3RWMB 5SYAA 3I28A 3BJEA 2AZDA 2J3DA 4LYDA 2VPWA 3N53A 3AB7A 1M1NB 1UT8A 4PZDA 4TWRA 4PN3A 3OPQA 5B6IA 5KJ1A 4FOOA 1XYVA 1BMTA 4QNNA 4WLNA 3A3YA 3GMSA 3I72A 2M1XA 2VHUA 3ZHCA 2RBKA 5E7IA 1EBBA 1YZYA 3QEAZ 3BJMA 3P19A 5E6UA 4JC5A 2FJUA 2IYAA 2YX1A 1GGJA 1XELA 4YECA 3D3JA 1C3JA 3HL4A 4YO8A 1PJCA 3C4QA 3JQ6A 5B6PA 4MV9A 1VZ3A 3AW8A 4KDRA 5CTJA 3THXB 6GPBA 3NM4A 1A2KC 2CNWD 3WTBA 5BOSA 3ZLVA 3O0TA 1PK8A 1Q2XA 2Y68A 3OAAD 2PH3A 3ITKA 3PUYA 4NNOA 3EUWA 4TYPA 5A7HA 3AVVA 3OQHA 1E0JA 3SHVA 2QN1A 5J1TB 2JBAA 1CUDA 3OIGA 3JVIA 1BRMA 2JIRA 3H4IA 2C96A 2MSLA 3LRPA 1MB2A 3M6AA 3SBDA 3SEAA 1KMNA 4XB2A 1YZ3A 2BFDB 2G71A 1E79D 3NBMA 4KVGA 2OZEA 2MWMA 3PTLA 2VSFA 3TSYA 3NBZC 4X61A 3T3PB 3WA7A 2RHWA 3A04A 2B2CA 3RVKA 2AW3A 3NEAA 5BVGB 1N2IA 1I24A 1K98A 3OKAA 2CVFA 4JJKA 4YRLA 4ZQEA 2VF2A 3I9FA 1F4LA 1MORA 2ZREA 4ZICA 2OQ2A 4E11A 5FPYA 3LBAA 5EE1A 2EIHA 3B82A 1GAWA 1HYQA 3QY9A 3U4AA 3IPAA 2GZHA 2C1XA 3A26A 4RD0A 1OPRA 5KQRA 3H5RA 4D3FA 3O82A 1U1GA 3K2BA 2Y0EA 3DEZA 1MG0A 3FJYA 3IDZA 2O8CB 1KE1A 3HYLA 2BGUA 1ZC3A 1ULAA 3QE0A 1CUHA 4LYAA 3ANNA 2XHZA 1BVRA 4OGWA 4CW7A 1R64A 2P2YA 3C14C 1FSZA 1SU7A 4NAHA 4JJEA 3TW0A 3J81A 4CMCA 3GLIE 3L46A 1JDSA 1F2TA 1SWVA 3WKAA 4QQNA 4YQFA 3BXOA 1XJWA 4PSKA 1Q21A 4LOKA 1DC3A 2J0QA 3JD0A 1X8JA 3I0NA 4IPTA 2B98A 4UCXA 4KWIA 5ENDA 1LZLA 3O3CA 3C24A 3T7SA 4L02A 1JILA 1SKMA 2ZBQA 1E32A 1M83A 1KIFA 1SXIA 1FTNA 2AE1A 4MIKA 4LRSB 3OTHA 2R4TA 3T4EA 4JXXA 2J9FA 4HB3A 4B7CA 1P1BA 4AQ7A 2XA1A 4LECA 4REOA 1VBMA 3HPRA 1XTSA 1MOSA 1AQYA 1CJSA 1EJ2A 3OTWA 2DPMA 1FZTA 1QO7A 5DTQA 2B7LA 2H48A 4EUKA 2B2XA 3ZBQA 2F00A 1Y7HA 1C3XA 2YVLA 2W6MA 3AG5A 4HGPA 4WV3A 4KR3A 2X3UA 1Z38A 1PEDA 2CJPA 1U3WA 4LQCA 4ND8A 4DMKA 1EK2A 2B4KA 1Q0RA 4KDEA 1BAPA 3IAFA 4AWXA 1QVVA 4ALNA 3C6ZA 2IPMA 4LV8B 4YRTA 3WNCA 3TQSA 2NU8B 1FTWA 2QZ9A 1LK5A 2GVDC 4ARCA 1LDBA 2M1ZA 3U31A 3U7HB 4LZPA 1UUFA 2OC9A 2QTMA 1UDXA 1LLUA 4XEHA 1YRBA 3LA8A 2PA3A 1YT5A 2VHCA 4KXFB 4OP1A 5INTA 1FLVA 4PG6A 5ESWA 1IUOA 1HL3A 2GD0A 3NUGA 1OYVA 2D2FA 4L73A 4US0R 2DHRA 3L06A 2R1TB 1Y80A 2DUJA 2I3GA 1Y7IA 2REOA 3O8RA 3THWB 1ESZA 2OILA 3AG6A 1B41A 4URUR 1L7EA 2H3EA 3E1GA 3KVRA 2MSCB 3MWLA 1DINA 4GR5A 5EJ2A 3LC7O 4P80A 3RJMA 4C7KA 3W5BA 4GX2A 4N0PA 1U3FA 2FWAA 4EGCB 2ODNA 4JNKA 2UUOA 3NS7A 4LY6A 3CEPB 4NH0A 4KJZA 1YS7A 3QPBA 5AYVA 3GNTA 1TC2A 3CPSA 1MT3A 5EXTA 1RE1A 1QGOA 1CUGA 1O9GA 4NU6A 3JAKB 2V59A 2A3RA 4RIHA 1GRRA 1TAGA 3PIDA 4UPDA 3F3KA 2R00C 2VA9A 4MHSA 1D0VA 1QAOA 4QREA 3HRIA 1HLFA 4OHXA 5ALEA 3CH7A 4FYJA 1XMVA 1A72A 4FBMA 4MS4B 2WY2D 3D1JA 1AU9A 3IDSA 4EG7A 1T10A 3L79A 5AVYA 4PO1A 3GMTA 1H1TA 1UK6A 1XCGB 1NYLA 3K6RA 3BOSA 1AKYA 4W4TA 2REXB 2OOKA 1KFEB 1PWZA 2P5SA 4H2DA 3OZIA 2AC7A 2CV0A 5B1YA 5BVHA 1QYXA 1U0GA 2DU8A 3JALB 5UKDA 5FQNA 4UAVA 4MW0A 1CRZA 3IIIA 4XB1A 1WMEA 1YDEA 2L17A 4NESA 2FSUA 5E2IA 2IZ1A 4HY3A 3RWOA 4BP8A 1HT3A 3G89A 5EQDA 2H31A 5FNVB 3ZU6A 4RSMA 2HA0A 3KEMA 4D82A 5HJEA 1ORRA 1W29A 4US2R 1EHIA 2YOHA 4ACBA 5JG7A 4YJFB 2O1SA 4MR9B 2CDAA 3KSRA 4ROSA 1SVOA 2B3TA 4MROA 1ZJ4A 2IP4A 1VMKA 4IDNA 3U19A 5DWVA 1AM4D 1KPGA 1QE0A 2Z2XA 4P0QB 3ZHZA 4OJKA 2F1OA 4FHCA 4QJ3A 3S2EA 5H16A 4OHUA 3W5IA 4Z7JA 1FW6A 3QEMA 4I9UA 3LT5A 3RIMA 5A4JA 4JGGA 3I3OA 4YJGA 1ML4A 3KUXA 4BC1A 3R0JA 2ZJ6A 3WGOA 4EENA 3I1JA 2D1SA 5K1ZA 1IVNA 3W8NA 1ZM7A 8LDHA 1HDXA 3KELA 3U7FB 1SUIA 3GZNB 2WYOA 3USES 1QPGA 3ZCTA 3M6UA 3DV9A 3Q41A 4E2YA 5L4LA 2GLTA 2ZYRA 1FOEB 2XY4A 1NM5A 5BORA 4MKFA 1CYEA 1ABFA 2HRBA 3ISJA 2ZBDA 1KP3A 1UM8A 1MNQA 3WLOA 4A82A 4DABA 4Y18A 4DRZA 3LVRE 1RHJA 1PJTA 4EI2A 3GPIA 1XHEA 2Q49A 1QH8B 5EZQA 3JCZA 4MUHA 3EXG2 2OPHA 1OZAA 4FM9A 3HKCB 1ZCAA 4ZCQA 2FVXA 4HAZA 2G4CA 2KE5A 1YDHA 4XD7A 2BZSA 2IHKA 1UOPA 2QL5A 4DBZA 2X76A 1RW4A 2O2EA 1HMYA 2GYVA 2CC2A 3DTVB 5CVEA 1QKIA 3ACCA 1QR2A 2I4LA 3VOAA 4JQYA 5DNVA 3PNQA 4EMTA 3SJBA 1RXVA 2LD4A 4YNBA 1U2PA 4FHZA 3UW1A 4POAA 2JD1A 4X6UA 2KSQA 3PXXA 2G7ZA 3QG5A 4RQTA 1BW9A 4GDMA 3UF0A 2Q07A 3W9UA 5DM60 1F4VA 1ORHA 2O2IA 4BTVA 4KX5A 4Q34A 4XQGA 1FL9A 1BHQ1 5BSEA 1N5DA 4Q02A 2QOEA 3SAJA 4AF8A 2YOGA 1U63A 1XRJA 2HCTA 5EINA 4TUYA 1N2OA 1IQPA 3MXTA 3EGDB 1CRQA 4LXQA 4MV7A 2WKWA 3RVSA 1GZVA 4K88A 1PV4A 2NGRA 2PLFA 1G16A 1CLUA 4M55A 4CKZA 1FTQA 3BCSA 2AWNA 1QCDA 3MMSA 3CLUD 4XGRA 2Q99A 3TGWA 4OGLA 1JVSA 3CNHA 3HADA 5CNJA 2NVOA 5B36A 1Q77A 1P60A 4DQXA 1IYZA 4TTPA 4QYIB 5LA6B 1EK1A 3QBTA 4C07A 1LA2A 2IYVA 4UUQA 3AP2A 1JLMA 3TQOA 2E87A 5JSHA 2GKSA 4WA7A 1OH8A 3QMMA 5BMVF 1SXJB 2J3EA 3OUUA 3UN1A 1YJ8A 3S55A 1EYZA 2H2GA 4I50F 4ML3A 5KREA 3JWGA 1N7HA 3AFMA 4FMPA 1PG2A 1P19A 2XB8A 3HYCA 4CT4B 4Z4QA 2VZEA 3OZCA 3UMMA 1R18A 3EDOA 1IAQA 3AEYA 1X1SA 3QOWA 3L1IA 3UYKA 4AY6A 3ER8A 1L5SA 4WBNA 2ZKIA 5KTKA 4YRCA 1CJTC 2AOUA 3PWSA 1YB1A 5EHZA 3CVUA 1NR7A 3GCXA 4XJTA 2GCOA 4F1KA 5IYZB 1A5TA 5CRIA 4FT2A 1B2RA 5DEIA 3ISVA 1CZUA 1JHDA 5C51B 2GS9A 2Q5EA 5LXTA 4MDYA 1RXSA 5FAKA 3SF0A 3JX9A 4PWZA 4CDGA 1TLTA 1W6UA 2JC3A 1KVQA 2PKQP 3GFRA 1OYYA 1QYRA 2REBA 4PBRA 4TT8A 3ZWCA 3UK6A 3GUHA 2PQ6A 4DLZA 2F8MA 1DQYA 1D2AA 2VHWA 3BTVA 3K9BA 4CQLA 3H2IA 2C29D 2CF5A 2JRCA 4MWOA 4I1OA 4J6FA 5IEJA 3Q10A 3MD0A 1TAHA 1I36A 2R84A 2R8EA 3KUKA 2W6ID 4MAMA 4R8SA 3GJZA 3OIWA 5EKDA 3L8FA 4PO8A 3VSBA 4OXXA 4BQOA 5A1JA 4MGHA 3THRA 1NMZA 4PVDA 1L4HA 2C9MA 3HO6A 2BW0A 2BLLA 5JHGB 1O58A 1VDZA 2JFHA 2JAPA 2EZUA 4B48A 1UKVY 5E7MA 1P3Y1 1NNI1 3CZQA 4OQNA 3TRFA 5AO9A 2G0NA 1UIRA 4HXEB 3EY4A 4R4JA 3KPVA 5LQKA 1AUPA 2JA1A 1BQ3A 5I7WA 1T9ZA 1GY8A 4RD1A 1MIHA 3QPDA 3WLEA 5HIAA 2XZTA 3NHKA 2UVPA 1ODLA 1DC8A 3HY4A 2WA2A 3R6GA 5DH9A 5A2GA 2ZRIA 4PZZA 5FPPA 3B51X 3ZE2B 4TYNA 4KZPA 4U2GA 2PUGA 3L05A 2ZXUA 3CO5A 1P80A 3NBYC 4BPRA 1LPMA 1UKEA 3AV0B 3DLAA 4M0DA 3ZGLA 4OYLA 3NBKA 3ZK7A 5I7FA 1TPYA 4NYMR 3JQFA 1NV8A 3ELUA 3HACA 3EC7A 3WAKA 5KNLA 2NXEA 1UAAA 3QVVA 2BEUA 1T6BY 3BB1A 2ZJFA 3MJHA 3PGXA 1BH2A 2X9GA 3CR3C 3TNYA 1YNSA 2E82A 4CTMA 4PLVA 3C5CA 1KP2A 1ZVVA 2QJRA 2IHVA 3U3MA 1N8NA 2ISQA 2K7ZA 2ECKA 4I8XA 4RETA 1KZHA 2OBBA 1AZLA 1P18A 3ZHOA 4ZV4A 2FDRA 4S1VA 3H9GA 4LXYA 4ZD6A 4UTRA 1DWUA 5M04A 1M67A 3EGDA 4MDEA 2GM9A 2G9ZA 3OT1B 4LE1A 2ZS7A 2IA5A 4XDZA 5ERYA 2R6ZA 1Q1NA 2ZCVA 3IDFA 4PGAA 4WJZA 1Q7RA 4HXGA 5KUTA 1P9WA 4QLBA 5E9QA 4LWQA 4FU0A 5JIBA 3FETA 2VBFA 4PZLA 1PO7A 2ZWPA 3PYLA 3W6PA 1DB3A 4G4SO 3TQFA 3HYNA 1Q0HA 1R6DA 2UYQA 1E1QA 3Q98A 5CB4B 5H3HA 4YXFA 4M9CA 2GAIA 3GELA 2NTEA 2ZPUA 1IY1A 2PL5A 2E18A 1V1MA 1AXEA 2P90A 2XUHA 1KEWA 5LQSA 3DL4A 4TMVA 4C03A 3OJEA 1XE3A 3UPTA 5EPUA 2EQ5A 1NKTA 1KO8A 3OG9A 1DVRA 4HQLA 4JWKA 3DWIA 4OJQA 5CCDA 5DLEA 3CKYA 3NPAA 5F1YA 4D74A 4HNTA 2AVDA 4M8NE 2DECA 2JAWA 4NZPA 2FETA 3VNVA 1QHHB 4ZC1A 5ALNA 3TJMA 2HSJA 3K0EA 4B0OA 1KVUA 4HUJA 1HV8A 5CYOA 2IU0A 4QFMA 5GQSA 3RGWS 4G0YA 3T7DA 5L95A 4TKMA 3L6DA 5LUAA 3E81A 3RAEC 2A0KA 1QYVA 4PXSA 3WIEA 2GAJA 2BDUA 4ZRDA 2AX3A 1JDTA 5CH3A 5JZ9A 2CL6X 4DCUA 1I1OA 1JV2B 5D87A 4L95C 3FMIA 4YAWA 1BQ4A 3AR7A 3CIFA 4TS9A 3WL5A 1FFDA 1UK7A 3JVDA 4GGOA 1K5HA 3NHSA 5KDLA 3MMXA 3O47A 3WLQA 1LWOA 1O5IA 1XA4A 2PHZA 4JK3A 5DE3A 1LV7A 3VBEA 4J0EA 3A4MA 5NLLA 3R41A 5JJIA 4KV7A 3PNBA 3HSYA 3KQSA 3T5BA 2XVAA 3DFKA 4TTIA 3A11A 4CJXA 4N0MA 1SURA 4WI1A 4XQEA 3VR6D 5ITWA 2V0GA 3PJDA 2HO5A 2HNBA 4DTIA 2QIPA 3H5TA 4B3CA 2IHJA 4EKYA 3ZY3A 3OZWA 4IOLA 4HB0A 4BO2A 2FLWA 2A8YA 1GPH1 1PVVA 5IBCA 3WIBA 4KMSA 1T9DA 4AI6A 2P9FA 1Z4QA 3VR2A 1AUQA 1U7DA 5A9RA 3FFXA 4MWZA 2BYTA 3DKKA 1OAKA 1M1ZA 2GLUA 1DPGA 4NK5A 4I4IA 1DRUA 1TM5E 1B3RA 2G82A 4K46A 4L3WA 4RD3A 4BGEA 3GLHA 5IDQA 4WHMA 3C6QA 5BVHB 1TM7E 1KRHA 3P32A 5K2OA 1E1CA 3SOZA 4BJ3A 1NLMA 5A1TA 2IXDA 5L3RA 3H9BA 4Y2GA 1QMGA 3HY3A 1L1EA 3CRNA 3KJGA 4X1KA 3DV2A 1AHIA 5DBIA 1GM5A 4JVSB 2GSDA 2GEBA 1C3LA 1C7RA 1FYVA 3EN0A 1N2CA 1W4LA 3IVRA 3PNVA 3BD9A 4PYJA 3QNMA 3VNAA 3DZKA 5JAHA 3DFZA 3TUZC 3D4PA 3K9QO 3MMNA 3ORYA 4OB6A 1XROA 2BFNA 3E4DA 3AJRA 3DV0B 4EPVA 2XGGA 3QFCA 1KORA 3GJ5A 2R751 1XCBA 3H3XA 2LCFA 2P75A 3B1WA 2BC9A 1ZRSA 1CUWA 3HE3A 4K2AA 4RVGA 1ODFA 1KYWA 3O4IA 1FRFS 5CJJA 4EPWA 5CA1A 2N9UA 3I9KA 1Z0ZA 3Q1KA 3TLYA 3DE6X 5EJAA 1U5CA 4BUCA 2VHJA 4B33A 7AT1A 1Q92A 4C6RA 3SQXA 3WGYA 3RYHA 3TPZA 4WQMA 1H2RS 3WVNA 4ASUA 1RMTA 4BVJA 4ZYLA 1DAGA 4K9NA 1RTKA 3EMBA 3FGOA 4DLAA 4MPRA 3FPBA 3EVFA 1XL0A 1DO0A 4OIMA 4UVDA 1NQWA 1PLLA 1ZGAA 4I81A 1IXRC 5G40A 3HO1A 2X15A 4BNGA 1J23A 3DE7X 4GOND 4HDMB 4J3JA 4UOQA 1XV5A 3TK1A 3COWA 5C8VA 3R6DA 5CM2Z 5I6DA 2W00A 1O96B 2D2EA 2Y1WA 3DUWA 3TM5A 3UT5A 3WNQA 4A0FA 1AS3A 3IPCA 5B30A 5L3VA 4G37A 1DBQA 1S89A 4U63A 4NBNA 1FJHA 1GKKA 3V2UA 2IIPA 5ED4A 3AL3A 3OOWA 1J0EA 1OVGA 1RYHA 1YU6A 3GAAA 4J43A 1MCZA 1PD1A 1D09A 4ODIA 3M3PA 3WP1B 4R54A 2A5FA 3K1JA 4TL9A 3TAUA 4AG3A 3S7TA 1N75A 1C3EA 1EEXB 1OLXB 1EWRA 1XCLA 1GT91 3S81A 2A9KA 5CGQB 1MB3A 4FFMA 3A28A 3U4GA 4F72A 4XIYA 4N5IX 3DAGA 2DR3A 1UMDA 1UINA 1KAMA 5DCUA 4MW5A 3EX7C 5FUYA 2NUTA 1NAIA 4XZ3A 2E4YA 5KKAA 2FGJA 4D44A 1K8XB 1CUSA 4WCFB 1SIUA 1N2JA 5FUXA 2BFBB 1IM8A 1RDFA 2B8NA 3GNLA 2OD7A 3PI7A 4JC0A 3KVYA 1H8EA 2VT6A 4QXRA 4XOUA 4PX3A 3DSRA 4JC8A 1ZLYA 4IDGA 4K6KA 2AYYA 3GO4A 5JT1A 1IHOA 4UASA 2HV8A 1AO3A 3LA6A 3U7QB 1THMA 3CF4A 2CHFA 2W4IA 2XVYA 1MJ5A 3DO5A 5F5NA 5ILQA 5CYGA 1E20A 4C0WA 1VM6A 1JYEA 1OAOA 3BGOS 3DOOA 3GDHA 4RLHA 5KYKA 2OKCA 1U2DC 2WKQA 2FA9A 4FJ0A 1NW5A 1GYQA 1XT6A 1GAJA 5DV9A 2WF6A 3IAXA 3PQ6A 2ZAOA 3NVMB 5D3MB 3CNBA 2JGIA 2QLFA 2BGIA 4JFAA 4E03A 1LPPA 3EIUA 4MQ5A 5KQPA 1E63A 2G6TA 4J75A 4YJKA 4DV4B 4L7VA 1GU1A 1G2IA 4EH1A 1SUEA 4RZQA 1I7QB 3N59A 1UWKA 4CNQA 4FXOA 2XCRB 4GWGA 1JQJC 1GITA 4KOAA 2YMLA 3UIEA 1NBEA 1P2TA 1X7YB 3HL0A 4ZI7F 2YR0A 3MQ2A 3JQEA 5K3EA 3OQMA 4ARZA 1Q83A 2V98A 1E2QA 1O8BA 4M89A 4LDAA 3MSCA 3HP1A 5DNAA 3RLIA 2ERXA 1I0ZA 2J09A 5EJ7A 3E9QA 1O9BA 2I8AA 1V3TA 2WD8A 2QUAA 4GYJA 2Y67A 1DAFA 4H35A 4JKOA 4V03A 2XT9A 3MWEB 2BFMA 3VISA 3X43A 2FW0A 2PIAA 3DGEC 4TRMA 3W1EA 4UE3S 1QHXA 4GSLA 2XVZA 5DYIA 1O6ZA 4QFBA 3W6UA 1OI7A 4C1BA 1N4DA 2RG7A 5TEVA 3NR2A 2X22A 1UBGA 3SIWA 4I5IA 3UJBA 4ZVRA 3HMQA 1TAUA 4ESEA 2BBWA 1M7GA 3CNQS 5THQA 3LVFO 4Z2AA 3ADKA 4DLVA 3LCCA 4LG1A 3G0DA 2BAGA 1M0TA 3I1YA 3ODPA 4YJHB 1MW9X 4Z9YA 4HRYA 1HOXA 2A1TS 3FZQA 3T9AA 1WIWA 2CLSA 4GPEA 4OJMX 2BR4A 4BFXA 3P4XA 5BV1A 5LMCA 1X15A 2VJPA 3MPOA 2W58A 3P7MA 3R4CA 3I32A 4P7KA 3W6ZA 4X8LA 4C04A 4XRGA 4GKJB 3C7TA 2DHCA 3NTVA 1XRNA 5IJAA 3VTKA 1GUYA 2V4MA 2JCYA 5F4ZA 4B4OA 5G4LA 4GZ5A 4BVAA 1M1YA 4ZOLA 1XRLA 5FO1A 2REQB 3U2QA 4DCGA 2YZMA 2ZPTX 5DYWA 1I4DD 4EVRA 5L7WA 2ADFA 4MPTA 1TEVA 1CD5A 3QYFA 4IDAA 3C15C 2DULA 4JX9A 4BO0A 1KEVA 3D6TB 4X00A 1Z07A 5A2QA 2HU5A 3P2MA 1DQNA 2JLBA 2XWQA 1YZHA 3QFRA 4LVOA 1IZ7A 1GA1A 3MD9A 1IBKB 4UD2A 1WW8A 1X1CA 1ZOPA 2CEKA 4HVCA 2ZRFA 3SQDA 2CVHA 1L7RA 1OXXK 1LNQA 1PW5A 2FQXA 3KR2A 1YACA 3OEYA 4J0KA 2W70A 3VO2A 2EKQA 1QFYA 4KH0A 3ZD8A 2YNMC 4DSNA 3O1HB 4P86A 1WZIA 5J5AA 3H5AA 1L6IA 4RA6A 3DOEA 1R6AA 3DWGA 5CX1B 3GBVA 3CW9A 2RKBA 3GT7A 4N18A 3TZKA 4C4YA 2PBLA 1UPAA 1V1RA 2PG3A 2HPZA 2F7SA 4TZ0A 5FI5A 3ZNNA 5IWCA 3LECA 1C9EA 1NRIA 2VUTA 5JJKA 2ZT6A 4KX3A 4QPZA 4BMVA 2G0TA 5I9NA 1SK9A 3PPWA 4Q21A 3UJ9A 5BMVA 1OI4A 3E1KA 4BU1A 1RYZA 1XQ9A 4OKNA 4S1WA 3RR2A 2PXCA 1GKYA 4ECEA 1T9GR 3NFRA 4KLAA 1UOEA 1CJMA 3IOBA 1IJBA 1FNDA 3AXTA 2PBRA 4MLCA 4DIOA 3KJEA 3A9TA 3FWZA 2W6CX 3ZQ4A 2JBWA 3UCXA 5L3QA 4RFSB 3FZEA 3AOEC 4EG5A 1EUDA 4ZREA 2II6A 3RG2A 3NGXA 1UBNA 4GLFA 4OUKX 1U4NA 4BZQA 3AM3A 3N2YA 4RL4A 1GR1A 1W8IA 3RFUA 3V1UA 1X7YA 4D5EA 3LD9A 1OWNA 3UXHA 1S2LA 4WL0A 3ABOB 3K15A 3D7SA 2Z5LA 1ZVMA 1DG3A 4PYNA 1A0OA 1DDOA 3KQKA 2AZTA 4I1YA 1PR5A 3JU3A 5F4BA 4QEZA 4ARSA 4RORA 5JDCC 2O8EB 1VPEA 3M1IA 4EIWA 2WUDA 3H1BA 5AK5A 5GTDA 2GCGA 1PI3A 1T3GA 5I3CA 2GD1O 4EWLA 1UBSB 4YREA 3LF1A 4DCPA 1ZR4A 1BYUA 1YQGA 4W5HA 2RHJA 3O3NB 3B48A 3BX1A 3QHAA 2PUJA 1ONBA 2VHTA 3OICA 4I2NA 1NMYA 5TRTA 3TRKA 4DBLE 3EJWA 5IX8A 1TVKB 2CDCA 2IITA 4WINA 1V7PC 2D0DA 1BOFA 1L5LA 4YDSA 2W5UA 4O4HB 4FGSA 2XXJA 4Q18A 4WJLA 2XAUA 2BCGY 1ZINA 3VZRA 3WGVA 1OZHA 3ID6C 4DSAA 2ZBFA 4PHTA 1B8PA 4ZOAA 3VJMA 4TYMA 2DJ5A 5GADl 3ZVNA 5I9IA 3OY2A 3WLHA 2CXRA 3MRVA 1D07A 3V5NA 4IXWA 2JZOA 1IZYA 3FZGA 4Q0MA 2XWBF 3IEIA 4KAAA 2QRMA 4PSVA 1OGJA 4G5SA 2YOFA 4CGZA 2EF1A 1JSZA 3WK5A 3FZNA 4P53A 4MRMB 5DVZA 1F3LA 1F5SA 5EZSA 4YP9A 3T5CA 3L3BA 1TCCA 6REQB 3BB3A 2A33A 2GUWA 4BFZA 2G09A 3FPJA 3A05A 3ZU2A 4BDTA 4XWOA 2P7IA 1Y6FA 3GGDA 1PT6A 1L5VA 3QEOA 1OTYA 1NJSA 1QFSA 4W8GA 4QLAA 3C3YA 3VXKA 4FS8A 3G0HA 3VZCA 3W5SA 4BY9E 1CJBA 5D51S 1XHFA 3Q7PA 1XO1A 2OGUA 1DRJA 2JBHA 4RZ3A 4YP5A 3D6MA 4A27A 3KZNA 3VNRA 4ZRNA 4J0IA 3K5WA 4QATA 4KK4A 3MUNA 4RDXA 3N1UA 4BMCA 2FN8A 3DBLA 2O2ZA 2DWPA 3PXAA 1VL2A 3ONNA 4RNDB 4JKIA 3FPEA 4UAGA 1GVNB 5H3CA 5EJ4A 1SVLA 2BONA 2WHQA 4UE6A 3ETGA 1E4YA 2Q28A 1CQJB 2PUEA 1TQ4A 2ATXA 2ZYIA 1RM5A 3NOVA 3I6QA 3N70A 2V45A 5DHSA 3OHPA 4G0UA 4OP3A 5C7LO 5FUWA 3TPFA 3AHHA 4ZAZA 3WK6A 1JDJA 2JGKA 3ND9A 1E2DA 1G20E 1XK7A 4PU0A 5ALYA 3EGVA 5KYYB 1I4TD 1W36B 4LPKA 1IBMB 2NV2B 1C9YA 3VR6H 2IYXA 4KXVA 1T8YA 2PPVA 3BMOA 1ZAYA 3IA7A 1E3JA 2ASEA 4DM3A 9GPBA 4AJLA 4NDAA 5GV8A 1Z22A 2IXBA 2QVCA 3NVKI 3GZJA 4G5HA 4PANA 1AV6A 3EHEA 3KKLA 3BXPA 3HPQA 4LGCA 2QJTA 2OOSA 3MG9A 1UJ6A 4UBJA 5HFNA 2ZVPX 1TUBA 4DDVA 1YS4A 1W2WB 4CIWA 3MWJA 1TVKA 1R7RA 2WQ7A 3UWKA 5IPFA 1QH9A 4XVHA 5BWCA 2D4HA 4CCYB 2FR8A 4RE5A 5IBQA 3F74A 3BREA 3ZI7A 3WQSB 3CCCA 2Z6AA 4HMOA 1OWPA 2OVFA 3BWXA 5EIHA 2VDWA 3HNRA 1D7OA 3RDPA 5KNBD 1HEYA 1E1YA 1Z25A 4U7DA 3C0KA 3A9SA 3NTUA 4BFWA 4DV2B 3RVOA 2AUMA 2CK3D 2OCPA 4QODA 5DT2A 3ZGZA 4YRAA 1C3OB 2AOTA 1NC3A 2OHFA 4GE0A 3VR5H 3BZUA 5KWEA 1KS2A 1PT8A 3DVLA 4NE7A 4Y9DA 1YMVA 3PFIA 3TSWA 3HWRA 3KAJA 5ITZB 3IUQA 4GX1A 3V4LA 1K4YA 1VLZA 3TD2A 4DNXA 1NVMB 1JNXX 2GB4A 3WL4A 5KYNA 1XXHA 2O2HA 4B7UA 1OPXA 2J6CA 4IIXA 3UKJA 3ETNA 5J4VA 3ZCSA 4DE5A 1XVUA 1WAMA 3A7EA 5I7OA 3D43A 4GPAA 1OX6A 2QSUA 2XBLA 2YVQA 4NBUA 3EPKA 2HJ9A 2XAAA 1ACMA 3EIQA 3I5UA 1KAHA 2OB1A 3H65A 5IT9A 2QTLA 4CLRB 2NVUA 3Q3GE 5DSXA 1GZ5A 1P44A 1WETA 1BCRB 3RS8A 4LZJA 2DQ4A 4D92A 2VXOA 2ZT8A 4OXYA 5EGNA 3S6JA 2QZ4A 4CI0B 3H1GA 1QHEA 4B8WA 3OZAA 4BB5A 1NWCA 3KB2A 4DIFA 1QPBA 2NSHA 1EFDN 2QG4A 1S3SA 2PL3A 1LGYA 3CZPA 3IP5A 2X7HA 3CGWA 3OLCX 4L50A 2P27A 4ER5A 4U8HA 3L01A 2PUWA 4G5XA 3U1BA 4CTOA 4MRVA 4WXYB 2UXCB 5F73A 2W4QA 1WDMA 3S3TA 4BV8A 4C43A 4BUJA 2WIGA 2PUHA 1MDFA 2IYFA 3JQBC 4QO7A 2L42A 1AGNA 4KQJA 2WPDA 3IP8A 2C9BA 3IKLA 1QG0A 4EF5A 1HY3A 2QD2A 1M6YA 3NRJA 2FN9A 1QNFA 4RF2A 2H85A 1KO4A 1Z36A 4U7JA 3EPJA 2ZQYA 1AGRA 4MR7A 1EQAA 4E13A 4BKRA 1AZWA 1MIOA 4LJ5A 4Z7OB 2XYVA 5EWLA 3LE8A 2EYQA 2ZI4A 3OZXA 4D4KA 5JSFA 4J1NA 4WN3A 1MF7A 1SCIA 3L0BA 4JU9A 4ERXA 5JCXA 3IEMA 2GILA 1EX9A 2H9AA 4HAYA 4WRRA 4ENSA 4TZ6A 1VBKA 3AEZA 1ZWLA 3E35A 4BQQA 3U39A 5KSWB 2ZU6A 3LIIA 1DZIA 1G1MA 1WF6A 4MWEA 4DMGA 1HZZA 2C58A 1XZKA 2R3SA 4X85A 5CFRA 4LHWA 2Q2QA 4F8YA 2FZGA 3HV2A 4D99A 1KI4A 1N7GA 3ICOA 1HLPA 3WK8A 3I2GA 4N5LA 2F1JA 4OYHA 2J30A 2HLDD 2GN4A 3WSWA 4DGSA 5EUBA 1FXUA 1W88A 1Y4SA 2C5GA 1NVVQ 2RB5A 1ONNA 3GJXC 4C88A 1XG5A 2QLMA 1ENZA 4HS9A 1SR8A 4CKEA 3RRJA 5JRDS 1G5IA 2ECFA 2YHUA 3L8GA 5MN5A 2X0FA 1D5CA 3B9BA 2GPBA 2PJZA 4M46A 4TMYA 2QUZA 3PC8C 4KQCA 4PF1A 4Z0PA 3JD4A 3ZJYA 4X62B 4O5OA 3TZLA 3VMMA 3THWA 3OPYB 3SU8A 1ZHOA 4BB6A 2G70A 5FT9A 1FMFA 1E3EA 2QMOA 3I37X 3PRJA 2DFKB 4X5OA 2CL0X 3H2BA 2W48A 4FI3C 2E48A 2FWBA 2ZTLA 4QOSA 4KIFA 3GCDA 4FSDA 5CB8A 1ABEA 5LJIA 4L3VA 1N1DA 3EYAA 3L0PA 2BKUA 3PA8A 3PZRA 1GV0A 5D5PA 4WZAE 3ZU3A 3T3NA 5KVAA 1D2CA 2WZQA 2C7OA 2CLEB 1U2EA 2W8BB 4NU5A 3G9TA 1ZN8A 1IN6A 4KN8A 1ODCA 2FUG6 3A9WA 4QTTB 4C5AA 1UXKA 3O74A 4QUKA 1NUQA 2RI1A 5J2UF 4K9PA 1PGJA 2FZ4A 3PUJA 4HX5A 4PX2A 1DKMA 2WSSD 4YMTA 1FP2A 1GFZA 2Q2VA 3WRVA 4HVLA 2WSYB 4WWHA 1Y1LA 2VPZA 5IJXA 2PSFA 3ZLJA 4WGFA 1KZYC 2KX7A 2ZE7A 4UVEA 2WI8A 4UTVA 4B3HA 4KOEC 1OH6A 5KYUB 5K0TA 2OT3B 3C8MA 4J94A 1D1SA 2PR2A 3ITNA 1IZZA 1V9CA 2QQ0A 1E2PA 4FN5A 1G2PA 3LP6A 5CLLA 4KCGA 3UEOA 1MW8X 1IIBA 3W5DA 2DFTA 2WP0A 4JNCA 1QO9A 2Y1FA 3C3CA 3NYQA 3R3JA 4N5NA 3V8NA 5BUCA 1MKYA 2PX5A 2C2OA 4KO8A 1FVFA 2C0CA 3BFJA 4XR4A 2O3RA 5CD1A 1IK6A 2ZE6A 4ND5A 1N6HA 1YS2X 1UKCA 2FMKA 1PJ4A 1AKWA 4JVLA 3HJRA 5JAPA 4XYLA 1OLSB 4RGQA 2Q41A 3O3MB 2FSVA 4K05A 3OJOA 4F5WA 3ADPA 2C4UA 4TT3D 2AYZA 2X19A 1B74A 4BGIA 4BWGA 4L4UA 4C3UA 1C1XB 1ZBDA 5JMOA 1DEHA 2A0UA 2X5XA 1I1QB 4IGIA 5I5EA 2QW1A 5AVVA 4W5TA 1WPXA 1Z5VA 1JXAA 1WDLA 2DUNA 4FIZA 3U3RA 3H1EA 3WADA 2Z3WA 5DKFA 4V0ME 4KE7A 4EW3A 3E2PA 1IPHA 1JHZA 2DQKA 3F7MA 4I7EA 5E2BA 1MJFA 2OP1A 3NWJA 1CR2A 1KS9A 3F3MA 4D45A 4MCHA 3FWPA 4QEKA 2GNAA 4C4PA 4DLNA 1IOVA 1CLEA 2D6FA 4O59O 3VPBA 2G9UA 3ESZA 4V3CA 5B4UA 1JKMA 1RQXA 4PZCA 3F49S 1M6VA 5LBTA 4DNFA 1H0HA 4J7UA 2IDJA 4YMWA 1ZBQA 3R7WA 3NHFA 1VCMA 2WAYA 2YN0A 3G6WA 4WPGA 5EQFA 4XFKA 5CW1A 2WRZA 1Z8HA 3K1AA 4WJKB 3R75A 2QSZA 1I32A 4HAWA 1H23A 4EB0A 3KVOA 2JG3A 3M8KA 4H6PA 5IG2A 1FRZA 5HZGA 1MOPA 3TI9A 3W1VA 1J8VA 1IDOA 4GXNA 5E8JA 4B47A 3L7BA 1V11A 2O23A 5HBRA 4Z8XA 3TVTA 1TIKA 2HA4A 4O4LA 3NHMA 2ZB3A 2PXHA 4GPBA 2Q1XA 5CA1B 5AQEA 4ZCRA 1Z3CA 3FJ1A 3SC2A 3F6CA 3LBFA 5KTOA 3SQWA 1EB9A 3GYGA 2I3DA 1PR0A 4FBGA 4OLHA 4B2IA 1BXGA 1DCTA 5C0OE 1K66A 4BVBA 4MVJH 1JHYA 4ZCIA 2HQSA 4TXNA 1YQQA 2F3QA 5GJWC 3L8HA