3KKRA

Crystal structure of catalytic core domain of biv integrase in crystal form i
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
GSHLWQMDNTHWNKTIIWVAVETNSGLVEAQVIPEETALQVALCILQLIQRYTVLHLHSDNGPCFTAHRIENLCKYLGITKTTGIPYNPQSQGVVERAHRDLKDRLAAYQGDCETVEAALSLALVSLNKKRGGIGGHTPYEIYLESEHTKYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of catalytic core domain of BIV integrase: implications for the interaction between integrase and target DNA
pubmed doi rcsb
source organism Bovine immunodeficiency virus
molecule tags Dna binding protein
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kkrA00
4RW6A 2HNDA 5HRPA 4I9LA 4Q5VA 5I42A 2IOCA 4GMJB 3SUNA 1TK8A 1BL3A 3ZCMA 2QXFA 3VQ7A 3OJUA 3AO3A 4HCBA 3L8BA 4HUFA 1NK9A 2YHAA 4OPJA 4DS4A 1C1AA 3QEXA 3TAQA 3K5LA 2IGIA 4ID1A 3DM2A 3MEGA 4CJQA 4E1MA 1G15A 1SKWA 3T19A 1KFSA 2P5GA 3NCIA 3V1QA 3VQEA 5T7BA 2YKMA 4FJNA 5D3GA 3C94A 3U6FA 1CZ9A 1I3AA 4GW6A 3PX0A 1KLNA 4HHTA 2KTQA 1UWBA 2FBVA 3AA2A 3L2RA 3PX6A 1S5JA 3TAEA 3SQ0A 4CK2A 4DTUA 3NH2A 1JXBA 4KPYA 4CEQA 2Q3SA 1GOCA 4O55A 5SWMA 2R7YA 3DRSA 4CF9A 3AO4A 3M8SA 4B08A 1D8YA 3QLHA 4Z4EA 4FJJA 4CJEA 3OYDA 3PX4A 4FW1A 3UIQA 4PUOA 2VWJA 1QQCA 4CJSA 4E7KA 1XI1A 3HPOA 4JRPA 1TV6A 3AVIA 1JLFA 1RTDA 4Z4IA 3OY9A 2I5JA 3CM5A 4O5BA 3MEDA 4CFBA 1ITGA 1HJRA 1VSLA 3RTVA 1IH7A 4FJKA 3OYHA 4KHWA 2VG5A 5I3UA 4KB1A 3V6DA 1CXQA 3P1GA 1N6QA 2FC0A 1KRPA 3DOLA 5FROA 2HNZA 1NK0A 2YNGA 5KI6A 1SKSA 4OLBA 2DTUA 2BGGA 4OGEA 4CJUA 1GOAA 1X9MA 4ZTJA 3L2QA 3LZIA 2YNIA 2OPRA 2WOMA 4CEOA 4CGIA 3DOKA 4FJXA 1KCFA 3LP3A 4KFBA 2X78A 4CJVA 4MFBA 2O4GA 3NE6A 1XHZA 4B9NA 4CCHA 4CK1A 2D0BA 5K14A 1WLJA 2B6AA 4JS5A 2P1JA 1JLAA 3L3VA 4CFAA 4YFUA 4CHQA 4FK2A 4Z4CA 3QESA 1ASUA 4CIEA 4CEDA 1EKEA 1SL0A 4E1NA 1VRUA 1RBUA 3EYZA 4KREA 4DQSA 3MECA 1A5WA 1GOBA 4CGJA 4CHYA 1LWEA 4LD0A 4XIUA 4DSLA 3AVBA 2ZD1A 1RCHA 2DFEA 3TARA 2E6LA 5DK5A 1WSHA 1S6QA 3OJSA 3S3NA 1FXXA 1XHXA 3C6UA 4F3TA 1RNHA 3LP1A 3PUFA 4LH5A 4HUEA 4KTQA 3KLGA 3CM6A 4DSFA 4FM1A 1TKZA 2PYLA 3AVAA 1J5OA 3TI0A 4RW7A 2DFFA 3DRRA 3S3MA 4B9SA 3HJFA 4FJHA 2OA8A 4OLAA 1S9GA 1D5AA 3AV9A 3VQCA 3ZT3A 4DF4A 2HHQA 1B9FA 2HVIA 4AHUA 3QNNA 1NK5A 2ZQBA 3K2PA 5J1EA 4ZHRA 3S3OA 3A2FA 1RBRA 4F8RA 1TKDA 1WSGA 2BANA 3AVNA 3P83D 1Q9YA 4KHSA 4OKEA 1LV5A 2XHBA 1S1TA 1Z26A 2E6MA 1VSFA 3DLKA 1L3VA 4PWDA 4Z4HA 1LW0A 4FJLA 2GBZA 3ISNC 3OYAA 4HTUA 4CEBA 4DQQA 2HHWA 3KD1E 2PY5A 1QSYA 5CYQA 4H4OA 4N47A 2DY4A 2G8UA 2HHXA 1BCMA 1RILA 4DU1A 1X9WA 2PYJA 4FZYA 4KO0A 4NCGA 3ZSZA 4BDZA 3CFRA 4ID5A 2B4JA 4CEFA 2Y1IA 3SCXA 3V9UA 5J2PA 5HRNA 3O4NA 4NCBA 3G0ZA 3VQDA 5FRNA 4Z4GA 3OYJA 3TABA 1ZBIA 4CESA 1HPZA 5JS2A 4FM0A 1KFDA 2PZSA 4DFJA 3NDKA 4C8OA 1LWCA 5E41A 4N41A 4Y1DA 4R5PA 1BCOA 1QSSA 1LW2A 1EXQA 3AA5X 3CQ8A 5CYMA 4ELVA 1KTQA 4IDKA 3V81A 5KTQA 3SI6A 3L2UA 2QK9A 1RBTA 2JGUA 1BGXT 1VSEA 1T03A 4AILC 1B9DA 3OYGA 3SUQA 4CJ5A 4CIFA 1HNIA 4BDPA 1HQEA 3OYNA 4PA1A 1A5XA 3SZ2A 1T7PA 3NF8A 1NOYA 4B3OA 3ALYA 1C0UA 3RMBA 1X9SA 4CF8A 4FLZA 3OYEA 1NK6A 2AJQA 4KTWA 2Z1IA 1WSIA 4E3SA 3M8QA 4W5QA 4KKOA 4DTRA 4KB0A 4RW9A 3NFAA 4BE0A 2ATQA 3OYCA 1ZBHA 4O0IA 1ZBUA 2XY8A 1SKRA 3BGRA 1JLQA 3VA0A 1L3SA 1RBSA 1C0MA 2FBYA 1S1XA 1X1PA 5CY4A 3VQ4A 3SQ1A 3DLBA 1YTUA 2ZE2A 3LPTA 5C25A 3DI6A 3HP9A 2FBTA 4AHSA 3HSTB 3LWLA 2G8WA 1KVBA 4M42A 2IAJA 1SL2A 3KLIA 3AO2A 3P5JA 3HVRA 1YTAA 1HRHA 3AVJA 4J2DA 4KAZA 3AVMA 4FZZA 4FXDA 4FLXA 4NYNA 1VSMA 1HYVA 2ETJA 2Z1HA 4RW4A 3ZSOA 3WNGA 3KLFA 1U45A 4OGCA 1SL1A 4B9VA 4BE1A 3RWUA 2GUIA 1W9HA 2OZSA 3OYBA 4H4MA 3D0PA 4JS4A 4CEZA 4ICLA 1K6YA 3KLEA 3VQ6A 4DF8A 4M3TA 4KHYA 5DMRA 4KI4A 2F8SA 3L2VA 1FKOA 3KTQA 4DG1A 3LAKA 1IKXA 3MXJA 1BISA 1RTHA 4Z4FA 3AVKA 3KK1A 4CJKA 1J53A 3HP6A 3KJVA 4FCYA 2G8VA 3O4QA 1TVRA 4O4GA 3K59A 2HMIA 4DQPA 3VQ8A 3AVCA 4E7IA 2RN2A 3DLEA 3PY8A 1WSFA 4FJ8A 3AVFA 1RT5A 4M3WA 3LP0A 4CGHA 3OS1A 4E19A 3KKSA 3KLHA 1U47A 3HT3A 5SZTA 3PV8A 2VG6A 2HHTA 4CJPA 1N5YA 4BACA 1JLEA 2XRIA 1QTMA 1BIUA 4I7FA 4AHTA 4C8KA 4N76A 3I0SA 2DFHA 1NJZA 3RR8A 3E01A 3ULDA 3WNHA 1JL2A 4CECA 2XY7A 3T1AA 1VSJA 2EX3A 3VN5A 2D0AA 3O3HA 3TAPA 2OPQA 3LP2A 3ZT2A 1RT2A 1T05A 2XY6A 4F2SA 3TAMA 2HHSA 3QINA 4CJFA 1FKPA 4RW8A 3EZ5A 3VA3A 4FK4A 3ZSVA 4Z0UA 4IBNA 3DMJA 3KIOA 4F3OA 3HVTA 3AO5A 5HBMA 1RDBA 4C8NA 1EETA 4HVJA 4DU4A 2D5RA 2RKIA 4AHVA 4ELUA 3HXMA 4J2BA 2QKBA 4KRFA 4OKJA 1S6PA 1W0HA 3NAEA 3RMAA 3MXIA 1D9DA 1RT6A 2W42A 2G8HA 4HCCA 3T3FA 3RR7A 1RTJA 4IFYA 1U49A 1ZYQA 4J2AA 1QHTA 3ZSXA 2P51A 4CGFA 3PO4A 2YKNA 3LPUA 4CGDA 1SUQA 3QIOA 2YNFA 4G1QA 4CHPA 1C1CA 1HYZA 3K58A 4DWIA 1UA0A 1VSHA 3D45A 4JLHA 1S1WA 4M45A 3M8RA 3LWMA 4DSIA 4FJGA 2FBXA 5CZ1A 4B9TA 2XO7A 3DLHA 1HMVA 3VQPA 3NHGA 1RTIA 3ZT1A 4CJLA 1VK0A 2G8IA 3NF9A 4EZ9A 3RRGA 1NK8A 3SUPA 4DSKA 4FK0A 3K57A 3QEWA 4CJRA 4DFPA 1RT3A 4DQIA 4OJRA 4KI6A 1C6VA 3VQBA 4DMNA 3O3GA 4CFCA 3LALA 1TK5A 4DLEA 4FVMA 4FJ9A 1REVA 5KRSA 4CEAA 1JKHA 3K5NA 5KGWA 4LSLA 1WSEA 3JYTA 1BQMA 3V9ZA 5HRRA 2XY5A 3AA3A 4CHZA 4B9UA 3V9SA 1NJXA 2QKKA 3VQQA 1TKTA 1U4BA 3PO5A 2KQ2A 2OPSA 3HO1A 4EP5A 4FLVA 4CJ3A 1VSDA 3ZSQA 2JLEA 4O0JA 4AHCA 1CLQA 1J9AA 2GV9A 3MAQA 1SV5A 4OKKA 4W5RA 4LH4A 4B9LA 3NGZA 4CJWA 1WN7A 4N56A 2Z1JA 3SUOA 3HPHA 4LSNA 1TL3A 2KZZA 4DTPA 5FRMA 3ZT4A 1DTTA 2LSNA 4CFDA 3NGIA 2G8FA 4DTNA 5J2MA 1UOCA 2A1SA 3I0RA 5J2QA 4LY7A 1ZBLA 4W5NA 1TAQA 3K5OA 3C6TA 2YNHA 4FYDA 3QO9A 1IKVA 1MU2A 4CK3A 1DLOA 1RT7A 5EU7A 3SJJA 4K8XA 1LAVA 3QERA 2RPIA 3FFIA 3V4IA 1VSKA 2VWKA 4CF2A 1TK0A 2KFZA 1B92A 1O1WA 3DYAA 2HHUA 3S9HA 1Z25A 3L2WA 1HNVA 1LAWA 3NBPA 4W5OA 1BI4B 3F9KA 1BI4A 3QETA 1I39A 1DTQA 4M3RA 1NJWA 3AVHA 3AA4A 4I2PA 4M41A 1J54A 1NJYA 4ELTA 4GVMA 4PY5A 3V9WA 1WAFA 3HM9A 3K5MA 3OYFA 2NUBA 3MXMA 4Q0BA 4E7HA 1C0TA 3NF7A 1D9FA 1UAXA 3LZJA 4K8ZA 3IAYA 1U48A 1CZBA 4DS5A 4YNQA 3KK3A 4CF0A 1RT1A 1IKWA 4F4KA 3G10A 4OPKA 3VQ9A 4AHRA 3TWHA 4DSEA 3CYMA 1S9EA 4B8CA 3OYKA 1XWLA 2Y1JA 4NYFA 1RDDA 3SNNA 3SV3A 1TKXA 4DTMA 1JL1A 4B8AB 4FJ5A 3MEEA 4IFVA 2HVHA 4I2QA 1NK4A 3M8PA 4RG8A 1EP4A 4FLWA 4PQUA 4O44A 4M3YA 3V1RA 4FJMA 2IC3A 3SQ2A 4CHOA 2KZMA 2X6NA 4M3ZA 2IDOA 1L3UA 1ZBFA 4WE1A 3HPGA 4UQGA 1RDCA 1BQNA 1U04A 3DLGA 4N5SA 1QS4A 5KGXA 3OS2A 3ZSYA 3B6PA 2X6SA 4DU3A 3SV4A 1R0AA 4KTZA 1HYSA 2HW3A 4DTXA 1NKCA 1WSJA 2RF2A 3LAMA 1RDAA 2KW4A 3QEIA 1ASWA 3ZT0A 4FLYA 5HP1A 4BE2A 3V9XA 1BHLA 4EP4A 4FLTA 4FLUA 4FJIA 2D0CA 2HHVA 1VSIA 4DFKA 1KSPA 3IRXA 3HYFA 2ITGA 4BDYA 4CJTA 3O3FA 1NKBA 1YVUA 1WAJA 4E7LA 1YT3A 4MQ3A 1A5VA 1RBVA 5C42A 3F73A 1S1UA 3ITHA 1Y97A 1JLBA 1JLCA 1L3TA 3U3YA 4DTSA 2Z1GA 3L3UA 3LANA 3I8DA 4F2RA 1L5UA 4FJ7A 3BDPA 1T8EA 4CIGA 4J2EA 4IG0A 3NF6A 4DQRA 1NK7A 3AO1A 3AVGA 1HQUA 2F8TA 1ASVA 3JSMA 4EZ6A 4QAGA 4M3XA 2B5JA 3LDSA 2WONA 3SPZA 1VRTA 1C1BA 1KLMA 3OVNA 2BDPA 4FZXC 4KHUA 1KVCA 2P5OA 2YV0X 3OYIA 3KK2A 5HLFA 4FW2A 1TAUA 2HNYA 4C8LA 3VQAA 4E89A 3SPYA 3KD5E 1EX4A 4C8MA 1JLGA 4QOZB 3U3GA 3C95A 4BWJA 4CF1A 5JS1A 2IS3A 2VG7A 2YHBA 4ZTFA 1IG9A 1LWFA 2HB5A 1JXEA 4CE9A 3ASMA 3TAGA 2OYQA 3DRPA 3RRHA 1QE1A 2BE2A 3NH0A 4Y1CA 3CFPA 3IG1A 3OS0A 3HL8A 1XC9A 4HUGA 2G8KA 3B6OA 4CHNA 5J2NA 3QNOA 3RMCA 4H8KA 4KHNA 3VQ5A 3NH1A 1TL1A 3CFOA 4E0DA 4JRQA 4L8RB 4OVLA 3IS9A 3ZSWA 1FK9A 1IO2A 3V1OA 4CEEA 4DTJA 3WNEA 4W5TA 3SQ4A 5CZ2A 3EY1A 1WNSA 2A1RA 1NKEA 1RT4A 4M3UA 5FDLA 1TGOA 2OZMA 4IG3A 4BWMA 3QIPA 3DLRA 1CXUA 3ZSRA 1Q9XA 3KKRA 5HRSA 3TANA 1F21A 5HROA 4CGGA 4DLGA 4AH9A 3OYLA 3QEVA 4CJ4A 4I9QA 1NOZA 5C24A 2OPPA 1KVAA 4E7JA 2O4IA 4KV8A 3WNFA 4DTOA 1QSLA 3OYMA 2F96A 3H08A 3TAFA 4FM2A 3QEPA 3SYZA 1S1VA 3THVA 3CG7A 4DFMA 1Q8IA 4QCLA 2EHGA 3AVLA 2X74A 4CERA 5KRTA 4B9MA 1IKYA 1BIZA 3TR8A 4IKFA 4TSXA 1UA1A 4DSJA 3RMDA 4NCAA 4KHQA 2E4LA 3HK2A 3NGYA 2KFNA
chains in the Genus database with same CATH superfamily
4RW6A 2HNDA 4Q5VA 2CGJA 5I42A 3SUNA 3A5OC 3OJUA 5CR4A 1NK9A 1E4FT 1BA0A 2IGIA 3ENHA 4E1MA 3T19A 3THYB 1KFSA 4B3TK 4FJNA 4GW6A 3PX0A 1UWBA 3ZX0A 3PX6A 3SQ0A 4DTUA 3GE1A 1JXBA 1GOCA 4O55A 5SWMA 4CF9A 1D8YA 4Z4EA 2GTDA 1S22A 3OYDA 5C10A 5KQDA 3A8YA 2VWJA 3HPOA 4LFAK 5C12A 4DR5K 1JLFA 4Z4IA 4O5BA 3VESA 4CFBA 4EAHD 1ITGA 4WCEL 3RTVA 4CZMA 4CBUA 3OYHA 5I3UA 4H0TB 4KB1A 3P1GA 1KRPA 2FC0A 4H0YB 4B9QA 5BPMA 3DOLA 3R1XA 4BRCA 4JKFA 3WT0A 2BGGA 1QVFM 1GOAA 3AAPA 1X9MA 1IJJA 1QZ6A 4JK9A 3J80O 1YI2N 4K0KK 4CJVA 4KFBA 4FZXC 2O4GA 4CK1A 2D0BA 1WLJA 2P1JA 4FK2A 5C2FA 3O08A 2ZJRL 4H5NA 1ATNA 4CHYA 3WQUA 5AQUA 2E6LA 5DK5A 3HM8A 4BR0A 1HPMA 3S3NA 1XHXA 1RNHA 5FPDA 3R6MA 4DSFA 4FM1A 2PYLA 3MN5A 4GVEA 3ZX3A 1J5OA 4RW7A 3HJFA 3VQCA 1Y64A 4FL9A 3ZT3A 3FZMA 1B9FA 2HVIA 2HHQA 3QNNA 2ZQBA 3T69A 4EIAA 1TKDA 2BANA 3AVNA 2ZM6K 4OKEA 3CQYA 3QICA 4FJLA 1NGJA 4HTUA 5AQGA 2PY5A 1IBLK 5CYQA 5LMUK 3H46O 2P9KB 4BDZA 2VYPA 2GWKA 2B4JA 3SCXA 5I9EB 1ZBIA 3I33A 4CESA 5JS2A 4DFJA 2O8FB 1LWCA 3ZEUB 4DR4K 4R5PA 4JI3K 1BCOA 1QSSA 3AA5X 5E26A 4BY9C 1KTQA 3V81A 2YHXA 4A5BA 3L2UA 3EKSA 4A61A 2UUCK 3OYGA 2QWQA 1KC8O 4CIFA 4BDPA 1HQEA 3BEXA 3CCRN 2IVPA 1A5XA 2UXBK 3RMBA 4L3QA 2VWBA 3CF5L 5LMNK 1NK6A 2Z1IA 5GIOA 4YDUC 2FXUA 2P9UB 3BGRA 3EEQA 5AQMA 3VA0A 3SMPA 4JI8K 2FBYA 1X3NA 3VPZA 1NMNA 5M1FA 1M90O 2Q97A 1ZXOA 3AGKA 4FWLA 5KQ8A 1VQKN 3EKUA 3HSTB 2G8WA 3AO2A 1HRHA 3DJCA 5AZIA 5BN9A 4NYNA 3BF3A 1BU6O 2Z1HA 4DV3K 4OGCA 5EVZA 4B9VA 4IO8A 2GUIA 3SK3A 3D0PA 4QS7A 4CBXA 2F8SA 1FKOA 4DG1A 3MXJA 1RTHA 2NRWA 2YJFA 3AY9A 3KK1A 1J53A 2G8VA 4DQPA 4O4GA 4J8FA 3AVCA 2YI1A 2OCEA 4FJ8A 1RT5A 3OS1A 4YOWA 1U47A 3PV8A 2VG6A 4LF7K 3MWTA 4CJPA 1N5YA 4BACA 1JLEA 2O8CA 2DFHA 3K0SA 1NJZA 3E01A 3TAPA 1T05A 3TAMA 4CJFA 3EZ5A 3ZSVA 1IV0A 2UU9K 5HBMA 2QWRA 4HVJA 5HOOA 2QKBA 4CZHA 4HCCA 1D9DA 2W42A 2G8HA 5AQPA 1RTJA 3VF2A 4RWTA 3CXCM 4CGFA 3QIOA 4PL7A 2YNFA 4G1QA 4CHPA 1C1CA 4B1YB 4DWIA 4IEEA 4H0VB 1SS6A 1S1WA 4JLHA 1NJIO 3L6QA 3SLCA 1RTIA 1VK0A 3LDPA 3NF9A 3DXKB 4FPBA 3QEWA 1JCFA 1RT3A 1MWMA 4OJRA 4DMNA 3O3GA 4U7BA 1SAZA 1REVA 1JKHA 2QW9A 5KGWA 4LSLA 4JI5K 4B9UA 2XY5A 3AA3A 2W6LA 3UKUB 3VQQA 3PO5A 2FF3B 4CJ3A 3ZSQA 3SAGA 3ENBA 1J9AA 3MAQA 1N34K 4W5RA 4MDBA 4B9LA 4N56A 1OH7A 3HPHA 4LSNA 5FRMA 5GAGP 3ZT4A 4JKGA 4DTNA 1UOCA 3I0RA 4XH4A 4BC3A 5J2QA 1ZBLA 1YITN 4W5NA 3C6TA 1P8ZA 3IDHA 4HTLA 3QO9A 1IKVA 1HX1A 1MU2A 1LAVA 4BC4A 4CF2A 5AQWA 3S9HA 3EZWA 3CJ1A 4X65K 4M3RA 4JI7K 4ELTA 1Q7YO 4A62A 4GVMA 1WAFA 3K5MA 5ELZA 3MXMA 1RDUA 4JI4K 3FZKA 1UAXA 3LZJA 3JAMO 4DS5A 3PSFA 4BR4A 3H6EA 3G10A 3J8AA 1S9EA 3BZKA 4B8CA 4NYFA 2YHYA 3QBWA 4CW7B 4DTMA 2GWJA 1QQNA 3MEEA 3M8PA 4O44A 1BUPA 4FJMA 2IC3A 4H5WA 1L3UA 4FWKA 1NMDA 1U04A 5BR9A 1ESVA 3OS2A 3VF6A 1HLUA 2NRVA 2HW3A 5AQVA 3LAMA 3QEIA 1CZAN 1XQSC 4FLTA 3ZLJA 1G99A 1KSPA 3IRXA 2VCPA 4CJTA 3D2EB 4IOXA 4MQ3A 1S1UA 3VMFB 3G6EN 1Y97A 1S72N 3MCAB 4DUYK 2Z1GA 4BROA 4H03B 4FJ7A 4CIGA 4J2EA 4IG0A 2HMPA 3NF6A 1NK7A 1W7AA 1IG8A 3AVGA 1GLCG 2QWLA 4M3XA 1NGIA 4QAGA 1C1BA 3QB0A 4JNEA 4YOYA 2P5OA 3OYIA 3VQAA 4C8MA 3HRGA 4DR1K 5JICA 1HKBA 3NMUA 3O5BA 2HSTA 4IEIA 4GV9A 1IG9A 1LWFA 1T3VA 2HB5A 1FJGK 1BWFO 1VQLN 1QVGM 3DRPA 1QE1A 2WTUA 2KKZA 1XC9A 4HUGA 1YJWN 3RMCA 4H8KA 4L8RB 4OVLA 3CIPA 3IS9A 4FSVA 1IO2A 4CEEA 3EL2A 3E1YA 1NWKA 5M1NA 3SQ4A 2A1RA 1NKEA 4BVPA 2A42A 1EWRA 5FDLA 4IG3A 3DLRA 1CXUA 2P9KA 3ZSRA 3D6RA 5HRSA 5HROA 3R9PA 1Q81O 1NNEA 3QEVA 4I9QA 1NOZA 1WBDA 5AQTA 2O8FA 3WEEB 4OO1J 3SYZA 4IFEA 1Q18A 3W3DA 4NXNK 3WUHA 1IKYA 4DSJA 1IBMK 4KHQA 1NGGA 3GOIA 3CCMN 5BRHA 5M1KA 1TK8A 1BL3A 4HCBA 1GLBG 3L8BA 2YHAA 4DV6K 3TAQA 2O8DB 3U9ZA 3DM2A 3ZX2A 2P5GA 3NCIA 3VF4A 4BC2A 3E66A 2YKMA 5D3GA 3C94A 1I3AA 2P9UA 1S5JA 4CK2A 3NH2A 2Q3SA 2E2OA 3M5RA 2R7YA 2Q1NA 4JI2K 2QWOA 3AO4A 1HNXK 4B08A 3QLHA 1VHXA 3PX4A 4FW1A 5EY4A 4WF9L 4JKCA 4LF9K 4PUOA 1QQCA 4E7KA 1TV6A 1BO5O 3AVIA 1W2BM 1RTDA 4CZJA 3CM5A 1HJOA 1HJRA 3HOSA 1WBBA 1CXQA 1N6QA 1I94K 5KI6A 2P9PB 4OLBA 4CJUA 3O9SA 3L2QA 3LZIA 4FJXA 4CGIA 4CCHA 4GV6A 1VAZA 1VQPN 4CFAA 4YFUA 4Z4CA 3QESA 2YJEA 1KQSM 2J4RA 1NGCA 4E1NA 1VRUA 1RBUA 3EYZA 4O5FA 2W41A 4DQSA 3MECA 1GOBA 4XIUA 2IVOA 1WSHA 1S6QA 3DWLA 5FPMA 2HBJA 4F3TA 1N32K 4YOUA 3PUFA 3OA9A 2FSJA 4MLEA 1SQKA 4KTQA 3KLGA 1TKZA 3ID8A 4CZFA 3AVAA 5CHIA 3TI0A 5E84A 1KXPA 1NLVA 4CD1A 4AHUA 4YDUA 3ATUA 5J1EA 2NLXA 1N36K 3P83D 4CZLA 4FVUA 1LV5A 2GELA 2XHBA 1Z26A 2I7PA 1LW0A 4JD2B 3CCUN 4IOAL 3GDQA 2BUPA 3C65A 5FPNA 4H4OA 4K41A 4BQLA 1VQ5N 2DY4A 2HHXA 5GAHP 1X9WA 4FZYA 3F2KA 4KO0A 5IWAK 3CFRA 4ID5A 4G9ZA 4NCBA 3G0ZA 4Z4GA 4K43A 3OYJA 3TABA 2PBDA 4FM0A 3DXMB 2PZSA 2O8EB 5JVHL 3UKUA 1V4TA 3N4PA 3H1QA 5LY3A 2QK9A 1RBTA 2JGUA 5BRFA 1HKGA 3G71N 3E9PA 4BR2A 4YY3K 4AILC 2E5LK 1EQYA 4PA1A 3OYNA 2UUBK 1TYQB 3IUCA 1NOYA 3ALYA 4CF8A 3OYEA 4KTWA 3M8QA 4KKOA 3FZFA 3NFAA 4EHUA 2ATQA 4BE0A 4O0IA 1ZBUA 2XY8A 1JLQA 1L3SA 1C0MA 3VTHA 4HWIA 1J6ZA 4DQ8A 3LDQA 3P39A 1WOQA 3K9KA 4DV5K 3SQ1A 3DLBA 4LC9B 4M7YA 2ZE2A 4M7XA 3LDNA 3HP9A 4AHSA 1KVBA 4M42A 3HVRA 3P5JA 1GLAG 3AVJA 5AQLA 4FZZA 4FXDA 1VSMA 1HYVA 3KLFA 3RWUA 4CBWA 1BA1A 4XEIA 5M1OA 2A40A 4CEZA 4ICLA 3KLEA 3P31A 3VQ6A 4KHYA 4KI4A 3VEZA 3L2VA 4WFBL 1XNRK 3MWPA 4Z4FA 3MCPA 4FCYA 3O4QA 4C1NK 4DUZK 3VQ8A 1Z05A 4LF8K 3NVMA 3JS6A 4E19A 4AM7A 4AHTA 4UY8O 2ASPA 3RR8A 3UB5A 3J7ZO 3TU5A 3T1AA 1VSJA 3VN5A 2D0AA 1OKJA 2Q0UA 1Q86O 3QINA 4FWQA 1FKPA 4DCHA 2FSKA 4Z0UA 4F3OA 3KIOA 4BRHA 4C8NA 1DKGD 3D2EA 4DU4A 2QTDA 1T03A 2RKIA 4LFCK 1W0HA 3NAEA 3MXIA 2HHSA 1RT6A 3T3FA 1U49A 1QHTA 3SAHA 5KPZA 3WXJA 1HYZA 2ZJPL 3CCJN 2E2NA 3D45A 4M45A 4DSIA 3M8RA 5AFUA 4FJGA 2FBXA 2CH5A 4BRQA 1HMVA 3VQPA 3ZT1A 1ATRA 3CCVN 2HF4A 4EZ9A 4FWRA 4NB4A 4Y0WA 3EE9A 4DSKA 5AZJB 3K57A 1W97L 4A57A 4CJRA 5JVGL 2HF3A 4DFPA 4IJNA 3M1FA 3LALA 4DLEA 4FJ9A 2A5XA 4CEAA 1U2VB 3WXMB 1WSEA 3JYTA 1BQMA 3THWB 5HRRA 3MX5A 4FOEA 5ADXH 1TKTA 4B1XB 2OPSA 2P9NB 4AM6A 1VSDA 3O1WA 3TSPA 2UXDK 4C23A 1SV5A 2A6AA 3MMVA 3NGZA 3SUOA 3F9MA 1YUWA 3AGRA 4DTPA 2G8FA 5J2MA 4LY7A 4CK3A 1TUUA 4K8XA 4A59A 2RPIA 5AQQA 1VSKA 2VWKA 3ID6A 1C0GA 1TK0A 4DR6K 3DYAA 1Z25A 1OVYA 2UXCK 1HNVA 3NBPA 4OPHA 4IXCA 1J5EK 1BI4A 1I39A 1NJYA 3V9WA 3HM9A 3HI0A 4Q0BA 3H3NO 2O8DA 2NRTA 4WQ5C 1D9FA 4IZ9A 1IKWA 4U67L 4CI6A 3VQ9A 3B8AX 3CYMA 3OYKA 1XWLA 2H3GX 1RDDA 3SNNA 1JL1A 2O8BB 1GLFO 4I6MB 1NK4A 3I56N 4FLWA 1M1KO 3UE5A 4RCHA 4CHOA 1RDWX 2KZMA 3TPQA 4BGBA 2YX6A 4WE1A 4YOTA 4UQGA 5KGXA 1OVQA 4DU3A 1K8KB 1NKCA 1WSJA 2RF2A 1RDAA 2KW4A 1VQON 1YAGA 4BE2A 3V9XA 4EP4A 1NGEA 1R59O 4MO4A 2UYTA 3HYFA 1YVUA 1WAJA 2YHWA 3F73A 2OTJN 3U3YA 2QWMA 3L3UA 3LANA 3I8DA 4F2RA 5AQNA 3D2FA 3GBTA 1ASVA 4FWOA 3JSMA 3VENA 2WONA 4ILJA 1VRTA 3OVNA 2BDPA 2F8TA 4KHUA 1KVCA 2YV0X 5JS1A 5HLFA 2HNYA 4C8LA 5KPTA 1KAZA 5AQOA 2VG7A 2YHBA 4ZTFA 5BREA 5GADP 4CE9A 3TAGA 2OYQA 3CFPA 3HL8A 4B3SK 1XNQK 4CHNA 5J2NA 4BRKA 3R3LA 4H0XB 3VQ5A 1TL1A 4JRQA 2ASOA 3G25A 3E9OA 3O1BA 3QFUA 2HHHK 1X3MA 3E9LA 4W5TA 5CZ2A 4CZKA 4M3UA 1TGOA 2D0PA 1IBKK 4BWMA 3QIPA 3ZETB 4BC5A 1Q82O 2UUAK 3KKRA 3TANA 2IVNA 1E3MA 4CGGA 4AH9A 3OYLA 3N4QA 2O4IA 1VQNN 2O8EA 2F96A 3T1YK 4WQ4C 4FM2A 2P9IB 2Q2RA 2Q36A 3THVA 1Q8IA 4QCLA 4CERA 3FR0A 4B9MA 3HK2A 4BRFA 2E4LA 2F4VK 2P9LB 3MK6A 5KPRA 4GMJB 3ZCMA 3AO3A 4HUFA 1TYQA 4DS4A 1C1AA 3H3OB 5JMVA 3MEGA 1YJ9N 1G15A 1SKWA 5EXWA 3TTFA 3THYA 1YF5L 3V1QA 3VQEA 4B1UB 3U6FA 4M63C 1CZ9A 1KLNA 4HHTA 2FBVA 3L2RA 1T6DA 2Q0RA 3SJHA 4KPYA 4CEQA 3CJ7A 2Q31A 1KAXA 3CCSN 5FPEA 4CJSA 1XI1A 2E8AA 3OY9A 3MX2A 3EO3A 3MEDA 4B1VA 3L0QA 1VSLA 4JI1K 1IH7A 4A5AA 1JCEA 4KHWA 4JEPA 1YXQA 3V6DA 4AQYK 2A41A 4CJ7A 4ILHA 4V19S 2YNGA 4NLCA 1DT9A 4PKGA 3HSCA 3G4SN 2YNIA 3DOKA 4FOIA 1KCFA 3LP3A 3NE6A 4MFBA 1XHZA 1NGBA 3CJCA 2B6AA 1DGKN 5H1SQ 1JLAA 4WFNL 4CIEA 4MO5A 5AQKA 3PSIA 1MA9B 2F9WA 4LF5K 4OX9K 1A5WA 1LWEA 4LD0A 3VEOA 2DFEA 2FSNA 3VEVA 4B1ZA 1VQ7N 3C6UA 3TTDA 4LH5A 4HUEA 4CZEA 2QWNA 4FPAA 1U6ZA 1GLJO 1HR0K 3S3MA 3DRRA 4DR2K 4B9SA 4OLAA 2ITMA 3KWGA 1NK5A 3K2PA 1XC3A 4ZHRA 3S3OA 1YIJN 2GUPA 4JI6K 4KHSA 3VEWA 1S1TA 3SAFA 3QDKA 3DLKA 4PWDA 1NGFA 3OYAA 4CEBA 4DQQA 3KD1E 4PKIA 2G8UA 1BCMA 1RILA 2CGKA 5AZJA 3O4WA 4NCGA 3ZSZA 1OH8A 4PHTX 3V9UA 5J2PA 5HRNA 3MN6A 3FZHA 1U2VA 3KHYA 4YORA 3EE8A 5BPNA 1HNZK 4JYAK 3KVGA 1KFDA 4CD3A 4C8OA 3QMLA 4N41A 3ZEUA 3DLLL 3KZBA 3O9QA 5AQHA 3RSEB 5CYMA 4ELVA 4LF6K 4IDKA 4JV5K 3SI6A 3SUQA 3CETA 4CJ5A 4DV0K 1HNIA 3SZ2A 1T7PA 3NF8A 4B3OA 5C2DA 2V51B 4BR5A 1NU0A 5AQXA 4W5QA 4DTRA 1ZBHA 3OYCA 4JK7A 3LDLA 4DB3A 5AQSA 1S1XA 5CY4A 4NO7A 5TKYA 1YTUA 1MWKA 3LPTA 2JWLA 2FBTA 3LWLA 3VGMA 1WUAA 4H0OA 2IAJA 1YTAA 3O9UA 4KAZA 3AVMA 3TTCA 2ETJA 3ZSOA 1SL1A 3BUZB 3WNGA 1W9HA 4JS4A 1K6YA 4M3TA 4XH5A 3VETA 3LAKA 2O8BA 3AVKA 4I6MA 3HP6A 3K59A 1TVRA 1JJ2M 4JN4A 3DLEA 4FWNA 3FZLA 3AAQA 1WSFA 3AVFA 3OHRA 4M3WA 3LP0A 3KKSA 3KLHA 3I55N 4JKBA 3CCLN 4KHPK 1QTMA 1BIUA 4C8KA 4N76A 3I0SA 4JKEA 4CECA 1JL2A 3ULDA 2XY7A 3O3HA 3ZT2A 1RT2A 4QS9A 3VA3A 4FK4A 1KAYA 3HVTA 3AO5A 4JKAA 1RDBA 4KRFA 2D5RA 3IKMA 4CVNE 4OKJA 1S6PA 3RMAA 2BTFA 3IFRA 1ZYQA 4J2AA 4A2BA 3J81O 3U8XA 4KBOA 3BY5A 4DV2K 5C0YA 4CGDA 2E88A 3T7ZA 3K58A 3T1HK 1UA0A 3CMEN 3LWMA 1NM1A 5CZ1A 4B9TA 3DLHA 3P38A 5A2QO 3NHGA 3DXKA 4B3RK 3ULEB 3RRGA 1NK8A 3RVCA 3VERA 4H0PA 4WQ5A 2E20A 4DQIA 4KI6A 4ISEA 4K25A 5KRSA 3CC4N 3CJAA 3V9ZA 5BRDA 1U4BA 1RGIA 4JI0K 3HO1A 4EP5A 4FLVA 2JLEA 4O0JA 3O6WA 5GINA 4H5RA 4OKKA 4FWMA 1WN7A 3S41A 2Z1JA 1TL3A 1VQ9N 1D4XA 1DTTA 2LSNA 3NGIA 4BRAA 3F5TA 1TAQA 3AARA 2YNHA 1T44A 1RT7A 2NNWA 5EU7A 3SJJA 3QERA 3CERA 3FFIA 3V4IA 1VQMN 2KFZA 2P9IA 1B92A 3L2WA 5AQJA 1LAWA 5EOYA 3F9KA 3CHWA 2P9LA 1NJWA 3AA4A 3CJBA 4I2PA 1J54A 4O8KA 4M41A 4BVOA 5DM7L 3OYFA 3CJ9A 2NUBA 4IDHA 1C0TA 5F1XA 4BG8A 4K8ZA 1U48A 4YNQA 4CF0A 1RT1A 4F4KA 2WC9A 5LJVA 4DSEA 4R79A 4WYBA 1TKXA 4FJ5A 4IFVA 2HVHA 4I2QA 4RG8A 1EP4A 2A3ZA 4PQUA 4FO0A 4M3YA 4K42A 1ZC6A 2X6NA 3O80A 2IDOA 3U4LA 1ZBFA 2PFUA 4N5SA 3C6AA 3B6PA 3ZSYA 4AF1A 3SV4A 1R0AA 3TSQA 1GLDG 4B3MK 2RHKA 3ZT0A 4FLYA 5HP1A 4FJIA 2HHVA 2D0CA 4MLHA 1HKCA 1VSIA 1NKBA 3HTVA 5C42A 1RBVA 2HBKA 3ITHA 3GG4A 1JLBA 1JLCA 1L3TA 5AQFA 4DTSA 2KHOA 4IOCL 1T8EA 1BG3A 3U9DA 3AO1A 4WQ4A 3C6HA 5BR8K 3LDSA 5M1PA 1HNWK 4EHTA 1NGHA 1TAUA 4ISFA 1EX4A 1JLGA 1S3XA 4QOZB 3C95A 4CF1A 2IS3A 1JXEA 4DR7K 2WBNA 5BPLA 3RRHA 4KB0A 3IG1A 3OS0A 2G8KA 4KH4A 4IO9L 3QNOA 2ZGYA 3NH1A 4E0DA 3CFOA 3D7EO 3ZSWA 3WXKA 3V1OA 3H1VX 5F0XA 3EY1A 1OH6A 2ASMA 5B8HA 1ZBSA 3THXB 1F21A 4DLGA 3W0LA 1WB9A 3IMXA 1C0FA 4CJ4A 1KVAA 4E7JA 1P90A 4XH1A 4KV8A 3WNFA 3H08A 3WEEA 3TAFA 2NRRA 3H45C 1GLLO 3RSEA 3UKRB 1S1VA 3AVLA 3TR8A 1YJNN 4NCAA 3NGYA 2KFNA 5HRPA 2D0OA 4I9LA 2P9SB 2IOCA 4JKHA 2QXFA 3VQ7A 4ISGA 3WQTA 4OPJA 3QEXA 3OW2M 3K5LA 4ID1A 2V52B 4CJQA 2YCHA 3MN7A 4BREA 5T7BA 3C0BA 1X9JA 2KTQA 4BRIA 3AA2A 3TAEA 2QXLA 3A0IX 3DRSA 3M8SA 2GX9A 3M6GA 4FJJA 4CJEA 3ENOA 3EN9A 3CC7N 4NLBA 4KH6A 3UIQA 4JRPA 4GV3A 3SMSA 2I5JA 3HOTA 4FJKA 2VG5A 3C7NB 5AR0A 3A5MC 1N33K 4CZIA 2IIRA 1O13A 2WFBA 5FROA 2HNZA 1NK0A 2QM1A 1SKSA 2P9PA 2DTUA 1MDUB 3OBYA 4OGEA 1N8RO 4ZTJA 2OPRA 2WOMA 4CEOA 4FWPA 2X78A 4B9NA 5GIPA 1XMQK 4LF4K 5K14A 1ILYA 3DAWA 4JS5A 3L3VA 4CHQA 2F7TA 1JCGA 1ASUA 4CEDA 3CQXA 5AJ3K 1EKEA 1SL0A 4KREA 4CGJA 4DSLA 3AVBA 2ZD1A 1RCHA 3TARA 1SZ2A 3LM9A 4A2AA 5M1QA 3OJSA 1FXXA 3LP1A 4KH5A 2HBMA 1XUPO 1LOTB 3L4IA 5AQYA 3CM6A 3O9RA 3SBTA 4JHDB 2DFFA 3R8EA 4FJHA 2OA8A 1S9GA 1D5AA 3AV9A 4X62K 5MLCQ 4DF4A 1T6CA 1K73O 3TSUA 5DM6L 3A2FA 1RBRA 4F8RA 1WSGA 3BZCA 2QI2A 1Q9YA 5AQRA 2E6MA 1VSFA 1L3VA 4Z4HA 5F2RA 2GBZA 1GLEG 3ISNC 4JD2A 2HHWA 5C15A 1OH5A 1QSYA 2PAVA 4Z94A 3ULEA 4N47A 2AP1A 4DU1A 2PYJA 4CEFA 3WXIA 2Y1IA 4BRLA 1KD1O 2GEMA 2NRHA 2W40A 3O4NA 3VQDA 2KLAA 5FRNA 4YOXA 1HPZA 4ILGB 3DXMA 3NDKA 5E41A 4Y1DA 2V7YA 2VQEK 1LW2A 1EXQA 3CQ8A 4BR7A 2V7ZA 3J7YP 5KTQA 1BGXT 1VSEA 1B9DA 4H5TA 4OPAA 2QWPA 2WUSA 4JKDA 4BG9A 1C0UA 1X9SA 4FLZA 2E2PA 2AJQA 1WSIA 4E3SA 4RW9A 3QBXA 3A5NC 1SKRA 1RBSA 2ZJQL 4F9OA 1X1PA 3K9JA 3VQ4A 4BRNA 4DR3K 2D1KA 3CD6N 3HZ6A 5C25A 3DI6A 3LDOA 3O8MA 1SL2A 3KLIA 2E1ZA 1NGDA 4J2DA 4FLXA 3I8BA 4LFBK 5ADXA 3L4QA 5FLXO 4RW4A 1BDGA 3SBGA 1U45A 1K8AO 1V4SA 1QZ5A 4BRGA 4BE1A 1RFQA 3FLCO 2OZSA 1VQ6N 3OYBA 4H4MA 3M3ZA 4DF8A 2NRZA 5DMRA 3KTQA 1IKXA 1BISA 1TUYA 4CJKA 3KJVA 2HMIA 1HUXA 4E7IA 2RN2A 3PY8A 5EX5A 4CGHA 3HT3A 5SZTA 2HHTA 3VEYA 2D4WA 2XRIA 3CMAN 4I7FA 2ZF5O 3OBWA 1LCUA 3WNHA 2AA4A 4PL8A 2EX3A 2OPQA 3LP2A 4F2SA 2XY6A 3LL3A 4RW8A 4DV4K 4IBNA 3DMJA 4ELUA 1EETA 4J2BA 4AHVA 3HXMA 1EO1A 4CZGA 3NVKA 1BOTO 1K9MO 4B1WB 4WFAL 3RR7A 4IFYA 4O8UA 3ZSXA 4GKJK 2P51A 3PO4A 4IWVA 2YKNA 3LPUA 4PKHA 1SUQA 5LL6Z 3CI5A 3LM2A 1VSHA 4DV1K 4BRMA 2RE2A 2XO7A 4CJLA 2G8IA 1E4GT 3SUPA 2EWSA 2NZTA 3Q7BA 4IJAA 4FK0A 1VQ8N 1NBWA 3CPEA 3BF1A 1C6VA 3VQBA 3VEXA 4CFCA 3QFPA 1TK5A 4FVMA 4C1NI 5AQZA 3KK7A 3K5NA 3FE1A 4BRDA 3P4IA 3THWA 4CHZA 2E2QA 3V9SA 1NJXA 2QKKA 2KQ2A 4MDAA 1FW6A 2P9NA 1ATSA 2DPNA 1QQOA 4AHCA 1XMOK 1CLQA 2GV9A 3VTIA 4LH4A 4CJWA 2KZZA 3THXA 4JK8A 3FFKB 4BGAA 4CFDA 2A1SA 4YOVA 5AQIA 3K5OA 4FYDA 5JLFA 1DLOA 5HL7L 5LJWA 3VOVA 3Q7CA 1O1WA 3UKRA 4E1JA 3PLAA 3MDQA 2HHUA 4BR9A 4W5OA 1BI4B 3QETA 1DTQA 3AVHA 3J7AP 2P9SA 4PY5A 4E7HA 3NF7A 5AZIB 3IAYA 1CZBA 4YHHK 3A5LC 3KK3A 4OPKA 1VQ4N 4AHRA 3TWHA 3BP8A 2Y1JA 4EFHA 3SV3A 3GL1A 4B8AB 2CH6A 1DEJA 2HOEA 3VGLA 1EWQA 5AFUH 4NXMK 4BRPA 3V1RA 2F9TA 3SQ2A 1QQMA 4M3ZA 3HPGA 1RDCA 1BQNA 3CPWM 3DLGA 1QS4A 2X6SA 1HYSA 4KTZA 3C7NA 3MN9A 4DTXA 1K8KA 2O8CB 2FF6A 1YHQN 2E1YA 5TKWA 1ASWA 4BQZA 1BHLA 2QA4N 4FLUA 2VQFK 4DFKA 2ZWHA 4BDYA 2ITGA 3O3FA 4X64K 4E7LA 1YVNA 1YT3A 1A5VA 3HBTA 1L5UA 2FLOA 1NGAA 3WXLA 3BDPA 1H1VA 1QHAA 2I7NA 4DQRA 2OTLN 3O9TA 3D2FB 4RTFD 1HQUA 4EZ6A 2B5JA 3SPZA 1KLMA 3KK2A 3VGKA 4FW2A 4JAXA 3KD5E 4E89A 3SPYA 4QS8A 4JHDA 3U3GA 4BWJA 4DHYA 3OTOK 4DV7K 2BH1A 3CC2N 3PIOL 3ASMA 3FGUA 2BE2A 3NH0A 4Y1CA 4GNIA 3B6OA 4FWSA 4KHNA 5JLHA 4GKKK 5BN8A 1NG9A 1FK9A 2ZGZA 3PIPL 4DTJA 2VGMA 3WNEA 2W6KA 1WNSA 1RT4A 5IT9O 2OZMA 2HBLA 3KWIA 3ZETA 3ZYYX 1Q9XA 3ATVA 4JKGB 3CCQN 1Z6RA 4H5VA 5C24A 2NRXA 2OPPA 2VGNA 2OANA 3JXUA 4DTOA 5CE3A 1QSLA 4DKWA 5GAEP 3OYMA 4X66K 3QEPA 3CCEN 3CG7A 4DFMA 2QEXN 4GY2B 2JWKA 2EHGA 2X74A 5KRTA 1BIZA 4IKFA 4TSXA 1UA1A 3RMDA 2CGLA
chains in the Genus database with same CATH topology
4RW6A 2HNDA 5HRPA 4I9LA 4Q5VA 5I42A 2IOCA 4GMJB 3SUNA 1TK8A 1BL3A 3ZCMA 2QXFA 3VQ7A 3OJUA 3AO3A 4HCBA 3L8BA 4HUFA 1NK9A 2YHAA 4OPJA 4DS4A 1C1AA 3QEXA 3TAQA 3K5LA 2IGIA 4ID1A 3DM2A 3MEGA 4CJQA 4E1MA 1G15A 1SKWA 3T19A 1KFSA 2P5GA 3NCIA 3V1QA 3VQEA 5T7BA 2YKMA 4FJNA 5D3GA 3C94A 3U6FA 1CZ9A 1I3AA 4GW6A 3PX0A 1KLNA 4HHTA 2KTQA 1UWBA 2FBVA 3AA2A 3L2RA 3PX6A 1S5JA 3TAEA 3SQ0A 4CK2A 4DTUA 3NH2A 1JXBA 4KPYA 4CEQA 2Q3SA 1GOCA 4O55A 5SWMA 2R7YA 3DRSA 4CF9A 3AO4A 3M8SA 4B08A 1D8YA 3QLHA 4Z4EA 4FJJA 4CJEA 3OYDA 3PX4A 4FW1A 3UIQA 4PUOA 2VWJA 1QQCA 4CJSA 4E7KA 1XI1A 3HPOA 4JRPA 1TV6A 3AVIA 1JLFA 1RTDA 4Z4IA 3OY9A 2I5JA 3CM5A 4O5BA 3MEDA 4CFBA 1ITGA 1HJRA 1VSLA 3RTVA 1IH7A 4FJKA 3OYHA 4KHWA 2VG5A 5I3UA 4KB1A 3V6DA 1CXQA 3P1GA 1N6QA 2FC0A 1KRPA 3DOLA 5FROA 2HNZA 1NK0A 2YNGA 5KI6A 1SKSA 4OLBA 2DTUA 2BGGA 4OGEA 4CJUA 1GOAA 1X9MA 4ZTJA 3L2QA 3LZIA 2YNIA 2OPRA 2WOMA 4CEOA 4CGIA 3DOKA 4FJXA 1KCFA 3LP3A 4KFBA 2X78A 4CJVA 4MFBA 2O4GA 3NE6A 1XHZA 4B9NA 4CCHA 4CK1A 2D0BA 5K14A 1WLJA 2B6AA 4JS5A 2P1JA 1JLAA 3L3VA 4CFAA 4YFUA 4CHQA 4FK2A 4Z4CA 3QESA 1ASUA 4CIEA 4CEDA 1EKEA 1SL0A 4E1NA 1VRUA 1RBUA 3EYZA 4KREA 4DQSA 3MECA 1A5WA 1GOBA 4CGJA 4CHYA 1LWEA 4LD0A 4XIUA 4DSLA 3AVBA 2ZD1A 1RCHA 2DFEA 3TARA 2E6LA 5DK5A 1WSHA 1S6QA 3OJSA 3S3NA 1FXXA 1XHXA 3C6UA 4F3TA 1RNHA 3LP1A 3PUFA 4LH5A 4HUEA 4KTQA 3KLGA 3CM6A 4DSFA 4FM1A 1TKZA 2PYLA 3AVAA 1J5OA 3TI0A 4RW7A 2DFFA 3DRRA 3S3MA 4B9SA 3HJFA 4FJHA 2OA8A 4OLAA 1S9GA 1D5AA 3AV9A 3VQCA 3ZT3A 4DF4A 2HHQA 1B9FA 2HVIA 4AHUA 3QNNA 1NK5A 2ZQBA 3K2PA 5J1EA 4ZHRA 3S3OA 3A2FA 1RBRA 4F8RA 1TKDA 1WSGA 2BANA 3AVNA 3P83D 1Q9YA 4KHSA 4OKEA 1LV5A 2XHBA 1S1TA 1Z26A 2E6MA 1VSFA 3DLKA 1L3VA 4PWDA 4Z4HA 1LW0A 4FJLA 2GBZA 3ISNC 3OYAA 4HTUA 4CEBA 4DQQA 2HHWA 3KD1E 2PY5A 1QSYA 5CYQA 4H4OA 4N47A 2DY4A 2G8UA 2HHXA 1BCMA 1RILA 4DU1A 1X9WA 2PYJA 4FZYA 4KO0A 4NCGA 3ZSZA 4BDZA 3CFRA 4ID5A 2B4JA 4CEFA 2Y1IA 3SCXA 3V9UA 5J2PA 5HRNA 3O4NA 4NCBA 3G0ZA 3VQDA 5FRNA 4Z4GA 3OYJA 3TABA 1ZBIA 4CESA 1HPZA 5JS2A 4FM0A 1KFDA 2PZSA 4DFJA 3NDKA 4C8OA 1LWCA 5E41A 4N41A 4Y1DA 4R5PA 1BCOA 1QSSA 1LW2A 1EXQA 3AA5X 3CQ8A 5CYMA 4ELVA 1KTQA 4IDKA 3V81A 5KTQA 3SI6A 3L2UA 2QK9A 1RBTA 2JGUA 1BGXT 1VSEA 1T03A 4AILC 1B9DA 3OYGA 3SUQA 4CJ5A 4CIFA 1HNIA 4BDPA 1HQEA 3OYNA 4PA1A 1A5XA 3SZ2A 1T7PA 3NF8A 1NOYA 4B3OA 3ALYA 1C0UA 3RMBA 1X9SA 4CF8A 4FLZA 3OYEA 1NK6A 2AJQA 4KTWA 2Z1IA 1WSIA 4E3SA 3M8QA 4W5QA 4KKOA 4DTRA 4KB0A 4RW9A 3NFAA 4BE0A 2ATQA 3OYCA 1ZBHA 4O0IA 1ZBUA 2XY8A 1SKRA 3BGRA 1JLQA 3VA0A 1L3SA 1RBSA 1C0MA 2FBYA 1S1XA 1X1PA 5CY4A 3VQ4A 3SQ1A 3DLBA 1YTUA 2ZE2A 3LPTA 5C25A 3DI6A 3HP9A 2FBTA 4AHSA 3HSTB 3LWLA 2G8WA 1KVBA 4M42A 2IAJA 1SL2A 3KLIA 3AO2A 3P5JA 3HVRA 1YTAA 1HRHA 3AVJA 4J2DA 4KAZA 3AVMA 4FZZA 4FXDA 4FLXA 4NYNA 1VSMA 1HYVA 2ETJA 2Z1HA 4RW4A 3ZSOA 3WNGA 3KLFA 1U45A 4OGCA 1SL1A 4B9VA 4BE1A 3RWUA 2GUIA 1W9HA 2OZSA 3OYBA 4H4MA 3D0PA 4JS4A 4CEZA 4ICLA 1K6YA 3KLEA 3VQ6A 4DF8A 4M3TA 4KHYA 5DMRA 4KI4A 2F8SA 3L2VA 1FKOA 3KTQA 4DG1A 3LAKA 1IKXA 3MXJA 1BISA 1RTHA 4Z4FA 3AVKA 3KK1A 4CJKA 1J53A 3HP6A 3KJVA 4FCYA 2G8VA 3O4QA 1TVRA 4O4GA 3K59A 2HMIA 4DQPA 3VQ8A 3AVCA 4E7IA 2RN2A 3DLEA 3PY8A 1WSFA 4FJ8A 3AVFA 1RT5A 4M3WA 3LP0A 4CGHA 3OS1A 4E19A 3KKSA 3KLHA 1U47A 3HT3A 5SZTA 3PV8A 2VG6A 2HHTA 4CJPA 1N5YA 4BACA 1JLEA 2XRIA 1QTMA 1BIUA 4I7FA 4AHTA 4C8KA 4N76A 3I0SA 2DFHA 1NJZA 3RR8A 3E01A 3ULDA 3WNHA 1JL2A 4CECA 2XY7A 3T1AA 1VSJA 2EX3A 3VN5A 2D0AA 3O3HA 3TAPA 2OPQA 3LP2A 3ZT2A 1RT2A 1T05A 2XY6A 4F2SA 3TAMA 2HHSA 3QINA 4CJFA 1FKPA 4RW8A 3EZ5A 3VA3A 4FK4A 3ZSVA 4Z0UA 4IBNA 3DMJA 3KIOA 4F3OA 3HVTA 3AO5A 5HBMA 1RDBA 4C8NA 1EETA 4HVJA 4DU4A 2D5RA 2RKIA 4AHVA 4ELUA 3HXMA 4J2BA 2QKBA 4KRFA 4OKJA 1S6PA 1W0HA 3NAEA 3RMAA 3MXIA 1D9DA 1RT6A 2W42A 2G8HA 4HCCA 3T3FA 3RR7A 1RTJA 4IFYA 1U49A 1ZYQA 4J2AA 1QHTA 3ZSXA 2P51A 4CGFA 3PO4A 2YKNA 3LPUA 4CGDA 1SUQA 3QIOA 2YNFA 4G1QA 4CHPA 1C1CA 1HYZA 3K58A 4DWIA 1UA0A 1VSHA 3D45A 4JLHA 1S1WA 4M45A 3M8RA 3LWMA 4DSIA 4FJGA 2FBXA 5CZ1A 4B9TA 2XO7A 3DLHA 1HMVA 3VQPA 3NHGA 1RTIA 3ZT1A 4CJLA 1VK0A 2G8IA 3NF9A 4EZ9A 3RRGA 1NK8A 3SUPA 4DSKA 4FK0A 3K57A 3QEWA 4CJRA 4DFPA 1RT3A 4DQIA 4OJRA 4KI6A 1C6VA 3VQBA 4DMNA 3O3GA 4CFCA 3LALA 1TK5A 4DLEA 4FVMA 4FJ9A 1REVA 5KRSA 4CEAA 1JKHA 3K5NA 5KGWA 4LSLA 1WSEA 3JYTA 1BQMA 3V9ZA 5HRRA 2XY5A 3AA3A 4CHZA 4B9UA 3V9SA 1NJXA 2QKKA 3VQQA 1TKTA 1U4BA 3PO5A 2KQ2A 2OPSA 3HO1A 4EP5A 4FLVA 4CJ3A 1VSDA 3ZSQA 2JLEA 4O0JA 4AHCA 1CLQA 1J9AA 2GV9A 3MAQA 1SV5A 4OKKA 4W5RA 4LH4A 4B9LA 3NGZA 4CJWA 1WN7A 4N56A 2Z1JA 3SUOA 3HPHA 4LSNA 1TL3A 2KZZA 4DTPA 5FRMA 3ZT4A 1DTTA 2LSNA 4CFDA 3NGIA 2G8FA 4DTNA 5J2MA 1UOCA 2A1SA 3I0RA 5J2QA 4LY7A 1ZBLA 4W5NA 1TAQA 3K5OA 3C6TA 2YNHA 4FYDA 3QO9A 1IKVA 1MU2A 4CK3A 1DLOA 1RT7A 5EU7A 3SJJA 4K8XA 1LAVA 3QERA 2RPIA 3FFIA 3V4IA 1VSKA 2VWKA 4CF2A 1TK0A 2KFZA 1B92A 1O1WA 3DYAA 2HHUA 3S9HA 1Z25A 3L2WA 1HNVA 1LAWA 3NBPA 4W5OA 1BI4B 3F9KA 1BI4A 3QETA 1I39A 1DTQA 4M3RA 1NJWA 3AVHA 3AA4A 4I2PA 4M41A 1J54A 1NJYA 4ELTA 4GVMA 4PY5A 3V9WA 1WAFA 3HM9A 3K5MA 3OYFA 2NUBA 3MXMA 4Q0BA 4E7HA 1C0TA 3NF7A 1D9FA 1UAXA 3LZJA 4K8ZA 3IAYA 1U48A 1CZBA 4DS5A 4YNQA 3KK3A 4CF0A 1RT1A 1IKWA 4F4KA 3G10A 4OPKA 3VQ9A 4AHRA 3TWHA 4DSEA 3CYMA 1S9EA 4B8CA 3OYKA 1XWLA 2Y1JA 4NYFA 1RDDA 3SNNA 3SV3A 1TKXA 4DTMA 1JL1A 4B8AB 4FJ5A 3MEEA 4IFVA 2HVHA 4I2QA 1NK4A 3M8PA 4RG8A 1EP4A 4FLWA 4PQUA 4O44A 4M3YA 3V1RA 4FJMA 2IC3A 3SQ2A 4CHOA 2KZMA 2X6NA 4M3ZA 2IDOA 1L3UA 1ZBFA 4WE1A 3HPGA 4UQGA 1RDCA 1BQNA 1U04A 3DLGA 4N5SA 1QS4A 5KGXA 3OS2A 3ZSYA 3B6PA 2X6SA 4DU3A 3SV4A 1R0AA 4KTZA 1HYSA 2HW3A 4DTXA 1NKCA 1WSJA 2RF2A 3LAMA 1RDAA 2KW4A 3QEIA 1ASWA 3ZT0A 4FLYA 5HP1A 4BE2A 3V9XA 1BHLA 4EP4A 4FLTA 4FLUA 4FJIA 2D0CA 2HHVA 1VSIA 4DFKA 1KSPA 3IRXA 3HYFA 2ITGA 4BDYA 4CJTA 3O3FA 1NKBA 1YVUA 1WAJA 4E7LA 1YT3A 4MQ3A 1A5VA 1RBVA 5C42A 3F73A 1S1UA 3ITHA 1Y97A 1JLBA 1JLCA 1L3TA 3U3YA 4DTSA 2Z1GA 3L3UA 3LANA 3I8DA 4F2RA 1L5UA 4FJ7A 3BDPA 1T8EA 4CIGA 4J2EA 4IG0A 3NF6A 4DQRA 1NK7A 3AO1A 3AVGA 1HQUA 2F8TA 1ASVA 3JSMA 4EZ6A 4QAGA 4M3XA 2B5JA 3LDSA 2WONA 3SPZA 1VRTA 1C1BA 1KLMA 3OVNA 2BDPA 4FZXC 4KHUA 1KVCA 2P5OA 2YV0X 3OYIA 3KK2A 5HLFA 4FW2A 1TAUA 2HNYA 4C8LA 3VQAA 4E89A 3SPYA 3KD5E 1EX4A 4C8MA 1JLGA 4QOZB 3U3GA 3C95A 4BWJA 4CF1A 5JS1A 2IS3A 2VG7A 2YHBA 4ZTFA 1IG9A 1LWFA 2HB5A 1JXEA 4CE9A 3ASMA 3TAGA 2OYQA 3DRPA 3RRHA 1QE1A 2BE2A 3NH0A 4Y1CA 3CFPA 3IG1A 3OS0A 3HL8A 1XC9A 4HUGA 2G8KA 3B6OA 4CHNA 5J2NA 3QNOA 3RMCA 4H8KA 4KHNA 3VQ5A 3NH1A 1TL1A 3CFOA 4E0DA 4JRQA 4L8RB 4OVLA 3IS9A 3ZSWA 1FK9A 1IO2A 3V1OA 4CEEA 4DTJA 3WNEA 4W5TA 3SQ4A 5CZ2A 3EY1A 1WNSA 2A1RA 1NKEA 1RT4A 4M3UA 5FDLA 1TGOA 2OZMA 4IG3A 4BWMA 3QIPA 3DLRA 1CXUA 3ZSRA 1Q9XA 3KKRA 5HRSA 3TANA 1F21A 5HROA 4CGGA 4DLGA 4AH9A 3OYLA 3QEVA 4CJ4A 4I9QA 1NOZA 5C24A 2OPPA 1KVAA 4E7JA 2O4IA 4KV8A 3WNFA 4DTOA 1QSLA 3OYMA 2F96A 3H08A 3TAFA 4FM2A 3QEPA 3SYZA 1S1VA 3THVA 3CG7A 4DFMA 1Q8IA 4QCLA 2EHGA 3AVLA 2X74A 4CERA 5KRTA 4B9MA 1IKYA 1BIZA 3TR8A 4IKFA 4TSXA 1UA1A 4DSJA 3RMDA 4NCAA 4KHQA 2E4LA 3HK2A 3NGYA 2KFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RW6 A;  2HND A;  5HRP A;  4I9L A;  4Q5V A;  5I42 A;  2IOC A;  4GMJ B;  3SUN A;  1TK8 A;  1BL3 A;  3ZCM A;  2QXF A;  3VQ7 A;  3OJU A;  3AO3 A;  4HCB A;  3L8B A;  4HUF A;  1NK9 A;  2YHA A;  4OPJ A;  4DS4 A;  1C1A A;  3QEX A;  3TAQ A;  3K5L A;  2IGI A;  4ID1 A;  3DM2 A;  3MEG A;  4CJQ A;  4E1M A;  1G15 A;  1SKW A;  3T19 A;  1KFS A;  2P5G A;  3NCI A;  3V1Q A;  3VQE A;  5T7B A;  2YKM A;  4FJN A;  5D3G A;  3C94 A;  3U6F A;  1CZ9 A;  1I3A A;  4GW6 A;  3PX0 A;  1KLN A;  4HHT A;  2KTQ A;  1UWB A;  2FBV A;  3AA2 A;  3L2R A;  3PX6 A;  1S5J A;  3TAE A;  3SQ0 A;  4CK2 A;  4DTU A;  3NH2 A;  1JXB A;  4KPY A;  4CEQ A;  2Q3S A;  1GOC A;  4O55 A;  5SWM A;  2R7Y A;  3DRS A;  4CF9 A;  3AO4 A;  3M8S A;  4B08 A;  1D8Y A;  3QLH A;  4Z4E A;  4FJJ A;  4CJE A;  3OYD A;  3PX4 A;  4FW1 A;  3UIQ A;  4PUO A;  2VWJ A;  1QQC A;  4CJS A;  4E7K A;  1XI1 A;  3HPO A;  4JRP A;  1TV6 A;  3AVI A;  1JLF A;  1RTD A;  4Z4I A;  3OY9 A;  2I5J A;  3CM5 A;  4O5B A;  3MED A;  4CFB A;  1ITG A;  1HJR A;  1VSL A;  3RTV A;  1IH7 A;  4FJK A;  3OYH A;  4KHW A;  2VG5 A;  5I3U A;  4KB1 A;  3V6D A;  1CXQ A;  3P1G A;  1N6Q A;  2FC0 A;  1KRP A;  3DOL A;  5FRO A;  2HNZ A;  1NK0 A;  2YNG A;  5KI6 A;  1SKS A;  4OLB A;  2DTU A;  2BGG A;  4OGE A;  4CJU A;  1GOA A;  1X9M A;  4ZTJ A;  3L2Q A;  3LZI A;  2YNI A;  2OPR A;  2WOM A;  4CEO A;  4CGI A;  3DOK A;  4FJX A;  1KCF A;  3LP3 A;  4KFB A;  2X78 A;  4CJV A;  4MFB A;  2O4G A;  3NE6 A;  1XHZ A;  4B9N A;  4CCH A;  4CK1 A;  2D0B A;  5K14 A;  1WLJ A;  2B6A A;  4JS5 A;  2P1J A;  1JLA A;  3L3V A;  4CFA A;  4YFU A;  4CHQ A;  4FK2 A;  4Z4C A;  3QES A;  1ASU A;  4CIE A;  4CED A;  1EKE A;  1SL0 A;  4E1N A;  1VRU A;  1RBU A;  3EYZ A;  4KRE A;  4DQS A;  3MEC A;  1A5W A;  1GOB A;  4CGJ A;  4CHY A;  1LWE A;  4LD0 A;  4XIU A;  4DSL A;  3AVB A;  2ZD1 A;  1RCH A;  2DFE A;  3TAR A;  2E6L A;  5DK5 A;  1WSH A;  1S6Q A;  3OJS A;  3S3N A;  1FXX A;  1XHX A;  3C6U A;  4F3T A;  1RNH A;  3LP1 A;  3PUF A;  4LH5 A;  4HUE A;  4KTQ A;  3KLG A;  3CM6 A;  4DSF A;  4FM1 A;  1TKZ A;  2PYL A;  3AVA A;  1J5O A;  3TI0 A;  4RW7 A;  2DFF A;  3DRR A;  3S3M A;  4B9S A;  3HJF A;  4FJH A;  2OA8 A;  4OLA A;  1S9G A;  1D5A A;  3AV9 A;  3VQC A;  3ZT3 A;  4DF4 A;  2HHQ A;  1B9F A;  2HVI A;  4AHU A;  3QNN A;  1NK5 A;  2ZQB A;  3K2P A;  5J1E A;  4ZHR A;  3S3O A;  3A2F A;  1RBR A;  4F8R A;  1TKD A;  1WSG A;  2BAN A;  3AVN A;  3P83 D;  1Q9Y A;  4KHS A;  4OKE A;  1LV5 A;  2XHB A;  1S1T A;  1Z26 A;  2E6M A;  1VSF A;  3DLK A;  1L3V A;  4PWD A;  4Z4H A;  1LW0 A;  4FJL A;  2GBZ A;  3ISN C;  3OYA A;  4HTU A;  4CEB A;  4DQQ A;  2HHW A;  3KD1 E;  2PY5 A;  1QSY A;  5CYQ A;  4H4O A;  4N47 A;  2DY4 A;  2G8U A;  2HHX A;  1BCM A;  1RIL A;  4DU1 A;  1X9W A;  2PYJ A;  4FZY A;  4KO0 A;  4NCG A;  3ZSZ A;  4BDZ A;  3CFR A;  4ID5 A;  2B4J A;  4CEF A;  2Y1I A;  3SCX A;  3V9U A;  5J2P A;  5HRN A;  3O4N A;  4NCB A;  3G0Z A;  3VQD A;  5FRN A;  4Z4G A;  3OYJ A;  3TAB A;  1ZBI A;  4CES A;  1HPZ A;  5JS2 A;  4FM0 A;  1KFD A;  2PZS A;  4DFJ A;  3NDK A;  4C8O A;  1LWC A;  5E41 A;  4N41 A;  4Y1D A;  4R5P A;  1BCO A;  1QSS A;  1LW2 A;  1EXQ A;  3AA5 X;  3CQ8 A;  5CYM A;  4ELV A;  1KTQ A;  4IDK A;  3V81 A;  5KTQ A;  3SI6 A;  3L2U A;  2QK9 A;  1RBT A;  2JGU A;  1BGX T;  1VSE A;  1T03 A;  4AIL C;  1B9D A;  3OYG A;  3SUQ A;  4CJ5 A;  4CIF A;  1HNI A;  4BDP A;  1HQE A;  3OYN A;  4PA1 A;  1A5X A;  3SZ2 A;  1T7P A;  3NF8 A;  1NOY A;  4B3O A;  3ALY A;  1C0U A;  3RMB A;  1X9S A;  4CF8 A;  4FLZ A;  3OYE A;  1NK6 A;  2AJQ A;  4KTW A;  2Z1I A;  1WSI A;  4E3S A;  3M8Q A;  4W5Q A;  4KKO A;  4DTR A;  4KB0 A;  4RW9 A;  3NFA A;  4BE0 A;  2ATQ A;  3OYC A;  1ZBH A;  4O0I A;  1ZBU A;  2XY8 A;  1SKR A;  3BGR A;  1JLQ A;  3VA0 A;  1L3S A;  1RBS A;  1C0M A;  2FBY A;  1S1X A;  1X1P A;  5CY4 A;  3VQ4 A;  3SQ1 A;  3DLB A;  1YTU A;  2ZE2 A;  3LPT A;  5C25 A;  3DI6 A;  3HP9 A;  2FBT A;  4AHS A;  3HST B;  3LWL A;  2G8W A;  1KVB A;  4M42 A;  2IAJ A;  1SL2 A;  3KLI A;  3AO2 A;  3P5J A;  3HVR A;  1YTA A;  1HRH A;  3AVJ A;  4J2D A;  4KAZ A;  3AVM A;  4FZZ A;  4FXD A;  4FLX A;  4NYN A;  1VSM A;  1HYV A;  2ETJ A;  2Z1H A;  4RW4 A;  3ZSO A;  3WNG A;  3KLF A;  1U45 A;  4OGC A;  1SL1 A;  4B9V A;  4BE1 A;  3RWU A;  2GUI A;  1W9H A;  2OZS A;  3OYB A;  4H4M A;  3D0P A;  4JS4 A;  4CEZ A;  4ICL A;  1K6Y A;  3KLE A;  3VQ6 A;  4DF8 A;  4M3T A;  4KHY A;  5DMR A;  4KI4 A;  2F8S A;  3L2V A;  1FKO A;  3KTQ A;  4DG1 A;  3LAK A;  1IKX A;  3MXJ A;  1BIS A;  1RTH A;  4Z4F A;  3AVK A;  3KK1 A;  4CJK A;  1J53 A;  3HP6 A;  3KJV A;  4FCY A;  2G8V A;  3O4Q A;  1TVR A;  4O4G A;  3K59 A;  2HMI A;  4DQP A;  3VQ8 A;  3AVC A;  4E7I A;  2RN2 A;  3DLE A;  3PY8 A;  1WSF A;  4FJ8 A;  3AVF A;  1RT5 A;  4M3W A;  3LP0 A;  4CGH A;  3OS1 A;  4E19 A;  3KKS A;  3KLH A;  1U47 A;  3HT3 A;  5SZT A;  3PV8 A;  2VG6 A;  2HHT A;  4CJP A;  1N5Y A;  4BAC A;  1JLE A;  2XRI A;  1QTM A;  1BIU A;  4I7F A;  4AHT A;  4C8K A;  4N76 A;  3I0S A;  2DFH A;  1NJZ A;  3RR8 A;  3E01 A;  3ULD A;  3WNH A;  1JL2 A;  4CEC A;  2XY7 A;  3T1A A;  1VSJ A;  2EX3 A;  3VN5 A;  2D0A A;  3O3H A;  3TAP A;  2OPQ A;  3LP2 A;  3ZT2 A;  1RT2 A;  1T05 A;  2XY6 A;  4F2S A;  3TAM A;  2HHS A;  3QIN A;  4CJF A;  1FKP A;  4RW8 A;  3EZ5 A;  3VA3 A;  4FK4 A;  3ZSV A;  4Z0U A;  4IBN A;  3DMJ A;  3KIO A;  4F3O A;  3HVT A;  3AO5 A;  5HBM A;  1RDB A;  4C8N A;  1EET A;  4HVJ A;  4DU4 A;  2D5R A;  2RKI A;  4AHV A;  4ELU A;  3HXM A;  4J2B A;  2QKB A;  4KRF A;  4OKJ A;  1S6P A;  1W0H A;  3NAE A;  3RMA A;  3MXI A;  1D9D A;  1RT6 A;  2W42 A;  2G8H A;  4HCC A;  3T3F A;  3RR7 A;  1RTJ A;  4IFY A;  1U49 A;  1ZYQ A;  4J2A A;  1QHT A;  3ZSX A;  2P51 A;  4CGF A;  3PO4 A;  2YKN A;  3LPU A;  4CGD A;  1SUQ A;  3QIO A;  2YNF A;  4G1Q A;  4CHP A;  1C1C A;  1HYZ A;  3K58 A;  4DWI A;  1UA0 A;  1VSH A;  3D45 A;  4JLH A;  1S1W A;  4M45 A;  3M8R A;  3LWM A;  4DSI A;  4FJG A;  2FBX A;  5CZ1 A;  4B9T A;  2XO7 A;  3DLH A;  1HMV A;  3VQP A;  3NHG A;  1RTI A;  3ZT1 A;  4CJL A;  1VK0 A;  2G8I A;  3NF9 A;  4EZ9 A;  3RRG A;  1NK8 A;  3SUP A;  4DSK A;  4FK0 A;  3K57 A;  3QEW A;  4CJR A;  4DFP A;  1RT3 A;  4DQI A;  4OJR A;  4KI6 A;  1C6V A;  3VQB A;  4DMN A;  3O3G A;  4CFC A;  3LAL A;  1TK5 A;  4DLE A;  4FVM A;  4FJ9 A;  1REV A;  5KRS A;  4CEA A;  1JKH A;  3K5N A;  5KGW A;  4LSL A;  1WSE A;  3JYT A;  1BQM A;  3V9Z A;  5HRR A;  2XY5 A;  3AA3 A;  4CHZ A;  4B9U A;  3V9S A;  1NJX A;  2QKK A;  3VQQ A;  1TKT A;  1U4B A;  3PO5 A;  2KQ2 A;  2OPS A;  3HO1 A;  4EP5 A;  4FLV A;  4CJ3 A;  1VSD A;  3ZSQ A;  2JLE A;  4O0J A;  4AHC A;  1CLQ A;  1J9A A;  2GV9 A;  3MAQ A;  1SV5 A;  4OKK A;  4W5R A;  4LH4 A;  4B9L A;  3NGZ A;  4CJW A;  1WN7 A;  4N56 A;  2Z1J A;  3SUO A;  3HPH A;  4LSN A;  1TL3 A;  2KZZ A;  4DTP A;  5FRM A;  3ZT4 A;  1DTT A;  2LSN A;  4CFD A;  3NGI A;  2G8F A;  4DTN A;  5J2M A;  1UOC A;  2A1S A;  3I0R A;  5J2Q A;  4LY7 A;  1ZBL A;  4W5N A;  1TAQ A;  3K5O A;  3C6T A;  2YNH A;  4FYD A;  3QO9 A;  1IKV A;  1MU2 A;  4CK3 A;  1DLO A;  1RT7 A;  5EU7 A;  3SJJ A;  4K8X A;  1LAV A;  3QER A;  2RPI A;  3FFI A;  3V4I A;  1VSK A;  2VWK A;  4CF2 A;  1TK0 A;  2KFZ A;  1B92 A;  1O1W A;  3DYA A;  2HHU A;  3S9H A;  1Z25 A;  3L2W A;  1HNV A;  1LAW A;  3NBP A;  4W5O A;  1BI4 B;  3F9K A;  1BI4 A;  3QET A;  1I39 A;  1DTQ A;  4M3R A;  1NJW A;  3AVH A;  3AA4 A;  4I2P A;  4M41 A;  1J54 A;  1NJY A;  4ELT A;  4GVM A;  4PY5 A;  3V9W A;  1WAF A;  3HM9 A;  3K5M A;  3OYF A;  2NUB A;  3MXM A;  4Q0B A;  4E7H A;  1C0T A;  3NF7 A;  1D9F A;  1UAX A;  3LZJ A;  4K8Z A;  3IAY A;  1U48 A;  1CZB A;  4DS5 A;  4YNQ A;  3KK3 A;  4CF0 A;  1RT1 A;  1IKW A;  4F4K A;  3G10 A;  4OPK A;  3VQ9 A;  4AHR A;  3TWH A;  4DSE A;  3CYM A;  1S9E A;  4B8C A;  3OYK A;  1XWL A;  2Y1J A;  4NYF A;  1RDD A;  3SNN A;  3SV3 A;  1TKX A;  4DTM A;  1JL1 A;  4B8A B;  4FJ5 A;  3MEE A;  4IFV A;  2HVH A;  4I2Q A;  1NK4 A;  3M8P A;  4RG8 A;  1EP4 A;  4FLW A;  4PQU A;  4O44 A;  4M3Y A;  3V1R A;  4FJM A;  2IC3 A;  3SQ2 A;  4CHO A;  2KZM A;  2X6N A;  4M3Z A;  2IDO A;  1L3U A;  1ZBF A;  4WE1 A;  3HPG A;  4UQG A;  1RDC A;  1BQN A;  1U04 A;  3DLG A;  4N5S A;  1QS4 A;  5KGX A;  3OS2 A;  3ZSY A;  3B6P A;  2X6S A;  4DU3 A;  3SV4 A;  1R0A A;  4KTZ A;  1HYS A;  2HW3 A;  4DTX A;  1NKC A;  1WSJ A;  2RF2 A;  3LAM A;  1RDA A;  2KW4 A;  3QEI A;  1ASW A;  3ZT0 A;  4FLY A;  5HP1 A;  4BE2 A;  3V9X A;  1BHL A;  4EP4 A;  4FLT A;  4FLU A;  4FJI A;  2D0C A;  2HHV A;  1VSI A;  4DFK A;  1KSP A;  3IRX A;  3HYF A;  2ITG A;  4BDY A;  4CJT A;  3O3F A;  1NKB A;  1YVU A;  1WAJ A;  4E7L A;  1YT3 A;  4MQ3 A;  1A5V A;  1RBV A;  5C42 A;  3F73 A;  1S1U A;  3ITH A;  1Y97 A;  1JLB A;  1JLC A;  1L3T A;  3U3Y A;  4DTS A;  2Z1G A;  3L3U A;  3LAN A;  3I8D A;  4F2R A;  1L5U A;  4FJ7 A;  3BDP A;  1T8E A;  4CIG A;  4J2E A;  4IG0 A;  3NF6 A;  4DQR A;  1NK7 A;  3AO1 A;  3AVG A;  1HQU A;  2F8T A;  1ASV A;  3JSM A;  4EZ6 A;  4QAG A;  4M3X A;  2B5J A;  3LDS A;  2WON A;  3SPZ A;  1VRT A;  1C1B A;  1KLM A;  3OVN A;  2BDP A;  4FZX C;  4KHU A;  1KVC A;  2P5O A;  2YV0 X;  3OYI A;  3KK2 A;  5HLF A;  4FW2 A;  1TAU A;  2HNY A;  4C8L A;  3VQA A;  4E89 A;  3SPY A;  3KD5 E;  1EX4 A;  4C8M A;  1JLG A;  4QOZ B;  3U3G A;  3C95 A;  4BWJ A;  4CF1 A;  5JS1 A;  2IS3 A;  2VG7 A;  2YHB A;  4ZTF A;  1IG9 A;  1LWF A;  2HB5 A;  1JXE A;  4CE9 A;  3ASM A;  3TAG A;  2OYQ A;  3DRP A;  3RRH A;  1QE1 A;  2BE2 A;  3NH0 A;  4Y1C A;  3CFP A;  3IG1 A;  3OS0 A;  3HL8 A;  1XC9 A;  4HUG A;  2G8K A;  3B6O A;  4CHN A;  5J2N A;  3QNO A;  3RMC A;  4H8K A;  4KHN A;  3VQ5 A;  3NH1 A;  1TL1 A;  3CFO A;  4E0D A;  4JRQ A;  4L8R B;  4OVL A;  3IS9 A;  3ZSW A;  1FK9 A;  1IO2 A;  3V1O A;  4CEE A;  4DTJ A;  3WNE A;  4W5T A;  3SQ4 A;  5CZ2 A;  3EY1 A;  1WNS A;  2A1R A;  1NKE A;  1RT4 A;  4M3U A;  5FDL A;  1TGO A;  2OZM A;  4IG3 A;  4BWM A;  3QIP A;  3DLR A;  1CXU A;  3ZSR A;  1Q9X A;  3KKR A;  5HRS A;  3TAN A;  1F21 A;  5HRO A;  4CGG A;  4DLG A;  4AH9 A;  3OYL A;  3QEV A;  4CJ4 A;  4I9Q A;  1NOZ A;  5C24 A;  2OPP A;  1KVA A;  4E7J A;  2O4I A;  4KV8 A;  3WNF A;  4DTO A;  1QSL A;  3OYM A;  2F96 A;  3H08 A;  3TAF A;  4FM2 A;  3QEP A;  3SYZ A;  1S1V A;  3THV A;  3CG7 A;  4DFM A;  1Q8I A;  4QCL A;  2EHG A;  3AVL A;  2X74 A;  4CER A;  5KRT A;  4B9M A;  1IKY A;  1BIZ A;  3TR8 A;  4IKF A;  4TSX A;  1UA1 A;  4DSJ A;  3RMD A;  4NCA A;  4KHQ A;  2E4L A;  3HK2 A;  3NGY A;  2KFN A; 
#chains in the Genus database with same CATH topology
 4RW6 A;  2HND A;  4Q5V A;  2CGJ A;  5I42 A;  3SUN A;  3A5O C;  3OJU A;  5CR4 A;  1NK9 A;  1E4F T;  1BA0 A;  2IGI A;  3ENH A;  4E1M A;  3T19 A;  3THY B;  1KFS A;  4B3T K;  4FJN A;  4GW6 A;  3PX0 A;  1UWB A;  3ZX0 A;  3PX6 A;  3SQ0 A;  4DTU A;  3GE1 A;  1JXB A;  1GOC A;  4O55 A;  5SWM A;  4CF9 A;  1D8Y A;  4Z4E A;  2GTD A;  1S22 A;  3OYD A;  5C10 A;  5KQD A;  3A8Y A;  2VWJ A;  3HPO A;  4LFA K;  5C12 A;  4DR5 K;  1JLF A;  4Z4I A;  4O5B A;  3VES A;  4CFB A;  4EAH D;  1ITG A;  4WCE L;  3RTV A;  4CZM A;  4CBU A;  3OYH A;  5I3U A;  4H0T B;  4KB1 A;  3P1G A;  1KRP A;  2FC0 A;  4H0Y B;  4B9Q A;  5BPM A;  3DOL A;  3R1X A;  4BRC A;  4JKF A;  3WT0 A;  2BGG A;  1QVF M;  1GOA A;  3AAP A;  1X9M A;  1IJJ A;  1QZ6 A;  4JK9 A;  3J80 O;  1YI2 N;  4K0K K;  4CJV A;  4KFB A;  4FZX C;  2O4G A;  4CK1 A;  2D0B A;  1WLJ A;  2P1J A;  4FK2 A;  5C2F A;  3O08 A;  2ZJR L;  4H5N A;  1ATN A;  4CHY A;  3WQU A;  5AQU A;  2E6L A;  5DK5 A;  3HM8 A;  4BR0 A;  1HPM A;  3S3N A;  1XHX A;  1RNH A;  5FPD A;  3R6M A;  4DSF A;  4FM1 A;  2PYL A;  3MN5 A;  4GVE A;  3ZX3 A;  1J5O A;  4RW7 A;  3HJF A;  3VQC A;  1Y64 A;  4FL9 A;  3ZT3 A;  3FZM A;  1B9F A;  2HVI A;  2HHQ A;  3QNN A;  2ZQB A;  3T69 A;  4EIA A;  1TKD A;  2BAN A;  3AVN A;  2ZM6 K;  4OKE A;  3CQY A;  3QIC A;  4FJL A;  1NGJ A;  4HTU A;  5AQG A;  2PY5 A;  1IBL K;  5CYQ A;  5LMU K;  3H46 O;  2P9K B;  4BDZ A;  2VYP A;  2GWK A;  2B4J A;  3SCX A;  5I9E B;  1ZBI A;  3I33 A;  4CES A;  5JS2 A;  4DFJ A;  2O8F B;  1LWC A;  3ZEU B;  4DR4 K;  4R5P A;  4JI3 K;  1BCO A;  1QSS A;  3AA5 X;  5E26 A;  4BY9 C;  1KTQ A;  3V81 A;  2YHX A;  4A5B A;  3L2U A;  3EKS A;  4A61 A;  2UUC K;  3OYG A;  2QWQ A;  1KC8 O;  4CIF A;  4BDP A;  1HQE A;  3BEX A;  3CCR N;  2IVP A;  1A5X A;  2UXB K;  3RMB A;  4L3Q A;  2VWB A;  3CF5 L;  5LMN K;  1NK6 A;  2Z1I A;  5GIO A;  4YDU C;  2FXU A;  2P9U B;  3BGR A;  3EEQ A;  5AQM A;  3VA0 A;  3SMP A;  4JI8 K;  2FBY A;  1X3N A;  3VPZ A;  1NMN A;  5M1F A;  1M90 O;  2Q97 A;  1ZXO A;  3AGK A;  4FWL A;  5KQ8 A;  1VQK N;  3EKU A;  3HST B;  2G8W A;  3AO2 A;  1HRH A;  3DJC A;  5AZI A;  5BN9 A;  4NYN A;  3BF3 A;  1BU6 O;  2Z1H A;  4DV3 K;  4OGC A;  5EVZ A;  4B9V A;  4IO8 A;  2GUI A;  3SK3 A;  3D0P A;  4QS7 A;  4CBX A;  2F8S A;  1FKO A;  4DG1 A;  3MXJ A;  1RTH A;  2NRW A;  2YJF A;  3AY9 A;  3KK1 A;  1J53 A;  2G8V A;  4DQP A;  4O4G A;  4J8F A;  3AVC A;  2YI1 A;  2OCE A;  4FJ8 A;  1RT5 A;  3OS1 A;  4YOW A;  1U47 A;  3PV8 A;  2VG6 A;  4LF7 K;  3MWT A;  4CJP A;  1N5Y A;  4BAC A;  1JLE A;  2O8C A;  2DFH A;  3K0S A;  1NJZ A;  3E01 A;  3TAP A;  1T05 A;  3TAM A;  4CJF A;  3EZ5 A;  3ZSV A;  1IV0 A;  2UU9 K;  5HBM A;  2QWR A;  4HVJ A;  5HOO A;  2QKB A;  4CZH A;  4HCC A;  1D9D A;  2W42 A;  2G8H A;  5AQP A;  1RTJ A;  3VF2 A;  4RWT A;  3CXC M;  4CGF A;  3QIO A;  4PL7 A;  2YNF A;  4G1Q A;  4CHP A;  1C1C A;  4B1Y B;  4DWI A;  4IEE A;  4H0V B;  1SS6 A;  1S1W A;  4JLH A;  1NJI O;  3L6Q A;  3SLC A;  1RTI A;  1VK0 A;  3LDP A;  3NF9 A;  3DXK B;  4FPB A;  3QEW A;  1JCF A;  1RT3 A;  1MWM A;  4OJR A;  4DMN A;  3O3G A;  4U7B A;  1SAZ A;  1REV A;  1JKH A;  2QW9 A;  5KGW A;  4LSL A;  4JI5 K;  4B9U A;  2XY5 A;  3AA3 A;  2W6L A;  3UKU B;  3VQQ A;  3PO5 A;  2FF3 B;  4CJ3 A;  3ZSQ A;  3SAG A;  3ENB A;  1J9A A;  3MAQ A;  1N34 K;  4W5R A;  4MDB A;  4B9L A;  4N56 A;  1OH7 A;  3HPH A;  4LSN A;  5FRM A;  5GAG P;  3ZT4 A;  4JKG A;  4DTN A;  1UOC A;  3I0R A;  4XH4 A;  4BC3 A;  5J2Q A;  1ZBL A;  1YIT N;  4W5N A;  3C6T A;  1P8Z A;  3IDH A;  4HTL A;  3QO9 A;  1IKV A;  1HX1 A;  1MU2 A;  1LAV A;  4BC4 A;  4CF2 A;  5AQW A;  3S9H A;  3EZW A;  3CJ1 A;  4X65 K;  4M3R A;  4JI7 K;  4ELT A;  1Q7Y O;  4A62 A;  4GVM A;  1WAF A;  3K5M A;  5ELZ A;  3MXM A;  1RDU A;  4JI4 K;  3FZK A;  1UAX A;  3LZJ A;  3JAM O;  4DS5 A;  3PSF A;  4BR4 A;  3H6E A;  3G10 A;  3J8A A;  1S9E A;  3BZK A;  4B8C A;  4NYF A;  2YHY A;  3QBW A;  4CW7 B;  4DTM A;  2GWJ A;  1QQN A;  3MEE A;  3M8P A;  4O44 A;  1BUP A;  4FJM A;  2IC3 A;  4H5W A;  1L3U A;  4FWK A;  1NMD A;  1U04 A;  5BR9 A;  1ESV A;  3OS2 A;  3VF6 A;  1HLU A;  2NRV A;  2HW3 A;  5AQV A;  3LAM A;  3QEI A;  1CZA N;  1XQS C;  4FLT A;  3ZLJ A;  1G99 A;  1KSP A;  3IRX A;  2VCP A;  4CJT A;  3D2E B;  4IOX A;  4MQ3 A;  1S1U A;  3VMF B;  3G6E N;  1Y97 A;  1S72 N;  3MCA B;  4DUY K;  2Z1G A;  4BRO A;  4H03 B;  4FJ7 A;  4CIG A;  4J2E A;  4IG0 A;  2HMP A;  3NF6 A;  1NK7 A;  1W7A A;  1IG8 A;  3AVG A;  1GLC G;  2QWL A;  4M3X A;  1NGI A;  4QAG A;  1C1B A;  3QB0 A;  4JNE A;  4YOY A;  2P5O A;  3OYI A;  3VQA A;  4C8M A;  3HRG A;  4DR1 K;  5JIC A;  1HKB A;  3NMU A;  3O5B A;  2HST A;  4IEI A;  4GV9 A;  1IG9 A;  1LWF A;  1T3V A;  2HB5 A;  1FJG K;  1BWF O;  1VQL N;  1QVG M;  3DRP A;  1QE1 A;  2WTU A;  2KKZ A;  1XC9 A;  4HUG A;  1YJW N;  3RMC A;  4H8K A;  4L8R B;  4OVL A;  3CIP A;  3IS9 A;  4FSV A;  1IO2 A;  4CEE A;  3EL2 A;  3E1Y A;  1NWK A;  5M1N A;  3SQ4 A;  2A1R A;  1NKE A;  4BVP A;  2A42 A;  1EWR A;  5FDL A;  4IG3 A;  3DLR A;  1CXU A;  2P9K A;  3ZSR A;  3D6R A;  5HRS A;  5HRO A;  3R9P A;  1Q81 O;  1NNE A;  3QEV A;  4I9Q A;  1NOZ A;  1WBD A;  5AQT A;  2O8F A;  3WEE B;  4OO1 J;  3SYZ A;  4IFE A;  1Q18 A;  3W3D A;  4NXN K;  3WUH A;  1IKY A;  4DSJ A;  1IBM K;  4KHQ A;  1NGG A;  3GOI A;  3CCM N;  5BRH A;  5M1K A;  1TK8 A;  1BL3 A;  4HCB A;  1GLB G;  3L8B A;  2YHA A;  4DV6 K;  3TAQ A;  2O8D B;  3U9Z A;  3DM2 A;  3ZX2 A;  2P5G A;  3NCI A;  3VF4 A;  4BC2 A;  3E66 A;  2YKM A;  5D3G A;  3C94 A;  1I3A A;  2P9U A;  1S5J A;  4CK2 A;  3NH2 A;  2Q3S A;  2E2O A;  3M5R A;  2R7Y A;  2Q1N A;  4JI2 K;  2QWO A;  3AO4 A;  1HNX K;  4B08 A;  3QLH A;  1VHX A;  3PX4 A;  4FW1 A;  5EY4 A;  4WF9 L;  4JKC A;  4LF9 K;  4PUO A;  1QQC A;  4E7K A;  1TV6 A;  1BO5 O;  3AVI A;  1W2B M;  1RTD A;  4CZJ A;  3CM5 A;  1HJO A;  1HJR A;  3HOS A;  1WBB A;  1CXQ A;  1N6Q A;  1I94 K;  5KI6 A;  2P9P B;  4OLB A;  4CJU A;  3O9S A;  3L2Q A;  3LZI A;  4FJX A;  4CGI A;  4CCH A;  4GV6 A;  1VAZ A;  1VQP N;  4CFA A;  4YFU A;  4Z4C A;  3QES A;  2YJE A;  1KQS M;  2J4R A;  1NGC A;  4E1N A;  1VRU A;  1RBU A;  3EYZ A;  4O5F A;  2W41 A;  4DQS A;  3MEC A;  1GOB A;  4XIU A;  2IVO A;  1WSH A;  1S6Q A;  3DWL A;  5FPM A;  2HBJ A;  4F3T A;  1N32 K;  4YOU A;  3PUF A;  3OA9 A;  2FSJ A;  4MLE A;  1SQK A;  4KTQ A;  3KLG A;  1TKZ A;  3ID8 A;  4CZF A;  3AVA A;  5CHI A;  3TI0 A;  5E84 A;  1KXP A;  1NLV A;  4CD1 A;  4AHU A;  4YDU A;  3ATU A;  5J1E A;  2NLX A;  1N36 K;  3P83 D;  4CZL A;  4FVU A;  1LV5 A;  2GEL A;  2XHB A;  1Z26 A;  2I7P A;  1LW0 A;  4JD2 B;  3CCU N;  4IOA L;  3GDQ A;  2BUP A;  3C65 A;  5FPN A;  4H4O A;  4K41 A;  4BQL A;  1VQ5 N;  2DY4 A;  2HHX A;  5GAH P;  1X9W A;  4FZY A;  3F2K A;  4KO0 A;  5IWA K;  3CFR A;  4ID5 A;  4G9Z A;  4NCB A;  3G0Z A;  4Z4G A;  4K43 A;  3OYJ A;  3TAB A;  2PBD A;  4FM0 A;  3DXM B;  2PZS A;  2O8E B;  5JVH L;  3UKU A;  1V4T A;  3N4P A;  3H1Q A;  5LY3 A;  2QK9 A;  1RBT A;  2JGU A;  5BRF A;  1HKG A;  3G71 N;  3E9P A;  4BR2 A;  4YY3 K;  4AIL C;  2E5L K;  1EQY A;  4PA1 A;  3OYN A;  2UUB K;  1TYQ B;  3IUC A;  1NOY A;  3ALY A;  4CF8 A;  3OYE A;  4KTW A;  3M8Q A;  4KKO A;  3FZF A;  3NFA A;  4EHU A;  2ATQ A;  4BE0 A;  4O0I A;  1ZBU A;  2XY8 A;  1JLQ A;  1L3S A;  1C0M A;  3VTH A;  4HWI A;  1J6Z A;  4DQ8 A;  3LDQ A;  3P39 A;  1WOQ A;  3K9K A;  4DV5 K;  3SQ1 A;  3DLB A;  4LC9 B;  4M7Y A;  2ZE2 A;  4M7X A;  3LDN A;  3HP9 A;  4AHS A;  1KVB A;  4M42 A;  3HVR A;  3P5J A;  1GLA G;  3AVJ A;  5AQL A;  4FZZ A;  4FXD A;  1VSM A;  1HYV A;  3KLF A;  3RWU A;  4CBW A;  1BA1 A;  4XEI A;  5M1O A;  2A40 A;  4CEZ A;  4ICL A;  3KLE A;  3P31 A;  3VQ6 A;  4KHY A;  4KI4 A;  3VEZ A;  3L2V A;  4WFB L;  1XNR K;  3MWP A;  4Z4F A;  3MCP A;  4FCY A;  3O4Q A;  4C1N K;  4DUZ K;  3VQ8 A;  1Z05 A;  4LF8 K;  3NVM A;  3JS6 A;  4E19 A;  4AM7 A;  4AHT A;  4UY8 O;  2ASP A;  3RR8 A;  3UB5 A;  3J7Z O;  3TU5 A;  3T1A A;  1VSJ A;  3VN5 A;  2D0A A;  1OKJ A;  2Q0U A;  1Q86 O;  3QIN A;  4FWQ A;  1FKP A;  4DCH A;  2FSK A;  4Z0U A;  4F3O A;  3KIO A;  4BRH A;  4C8N A;  1DKG D;  3D2E A;  4DU4 A;  2QTD A;  1T03 A;  2RKI A;  4LFC K;  1W0H A;  3NAE A;  3MXI A;  2HHS A;  1RT6 A;  3T3F A;  1U49 A;  1QHT A;  3SAH A;  5KPZ A;  3WXJ A;  1HYZ A;  2ZJP L;  3CCJ N;  2E2N A;  3D45 A;  4M45 A;  4DSI A;  3M8R A;  5AFU A;  4FJG A;  2FBX A;  2CH5 A;  4BRQ A;  1HMV A;  3VQP A;  3ZT1 A;  1ATR A;  3CCV N;  2HF4 A;  4EZ9 A;  4FWR A;  4NB4 A;  4Y0W A;  3EE9 A;  4DSK A;  5AZJ B;  3K57 A;  1W97 L;  4A57 A;  4CJR A;  5JVG L;  2HF3 A;  4DFP A;  4IJN A;  3M1F A;  3LAL A;  4DLE A;  4FJ9 A;  2A5X A;  4CEA A;  1U2V B;  3WXM B;  1WSE A;  3JYT A;  1BQM A;  3THW B;  5HRR A;  3MX5 A;  4FOE A;  5ADX H;  1TKT A;  4B1X B;  2OPS A;  2P9N B;  4AM6 A;  1VSD A;  3O1W A;  3TSP A;  2UXD K;  4C23 A;  1SV5 A;  2A6A A;  3MMV A;  3NGZ A;  3SUO A;  3F9M A;  1YUW A;  3AGR A;  4DTP A;  2G8F A;  5J2M A;  4LY7 A;  4CK3 A;  1TUU A;  4K8X A;  4A59 A;  2RPI A;  5AQQ A;  1VSK A;  2VWK A;  3ID6 A;  1C0G A;  1TK0 A;  4DR6 K;  3DYA A;  1Z25 A;  1OVY A;  2UXC K;  1HNV A;  3NBP A;  4OPH A;  4IXC A;  1J5E K;  1BI4 A;  1I39 A;  1NJY A;  3V9W A;  3HM9 A;  3HI0 A;  4Q0B A;  3H3N O;  2O8D A;  2NRT A;  4WQ5 C;  1D9F A;  4IZ9 A;  1IKW A;  4U67 L;  4CI6 A;  3VQ9 A;  3B8A X;  3CYM A;  3OYK A;  1XWL A;  2H3G X;  1RDD A;  3SNN A;  1JL1 A;  2O8B B;  1GLF O;  4I6M B;  1NK4 A;  3I56 N;  4FLW A;  1M1K O;  3UE5 A;  4RCH A;  4CHO A;  1RDW X;  2KZM A;  3TPQ A;  4BGB A;  2YX6 A;  4WE1 A;  4YOT A;  4UQG A;  5KGX A;  1OVQ A;  4DU3 A;  1K8K B;  1NKC A;  1WSJ A;  2RF2 A;  1RDA A;  2KW4 A;  1VQO N;  1YAG A;  4BE2 A;  3V9X A;  4EP4 A;  1NGE A;  1R59 O;  4MO4 A;  2UYT A;  3HYF A;  1YVU A;  1WAJ A;  2YHW A;  3F73 A;  2OTJ N;  3U3Y A;  2QWM A;  3L3U A;  3LAN A;  3I8D A;  4F2R A;  5AQN A;  3D2F A;  3GBT A;  1ASV A;  4FWO A;  3JSM A;  3VEN A;  2WON A;  4ILJ A;  1VRT A;  3OVN A;  2BDP A;  2F8T A;  4KHU A;  1KVC A;  2YV0 X;  5JS1 A;  5HLF A;  2HNY A;  4C8L A;  5KPT A;  1KAZ A;  5AQO A;  2VG7 A;  2YHB A;  4ZTF A;  5BRE A;  5GAD P;  4CE9 A;  3TAG A;  2OYQ A;  3CFP A;  3HL8 A;  4B3S K;  1XNQ K;  4CHN A;  5J2N A;  4BRK A;  3R3L A;  4H0X B;  3VQ5 A;  1TL1 A;  4JRQ A;  2ASO A;  3G25 A;  3E9O A;  3O1B A;  3QFU A;  2HHH K;  1X3M A;  3E9L A;  4W5T A;  5CZ2 A;  4CZK A;  4M3U A;  1TGO A;  2D0P A;  1IBK K;  4BWM A;  3QIP A;  3ZET B;  4BC5 A;  1Q82 O;  2UUA K;  3KKR A;  3TAN A;  2IVN A;  1E3M A;  4CGG A;  4AH9 A;  3OYL A;  3N4Q A;  2O4I A;  1VQN N;  2O8E A;  2F96 A;  3T1Y K;  4WQ4 C;  4FM2 A;  2P9I B;  2Q2R A;  2Q36 A;  3THV A;  1Q8I A;  4QCL A;  4CER A;  3FR0 A;  4B9M A;  3HK2 A;  4BRF A;  2E4L A;  2F4V K;  2P9L B;  3MK6 A;  5KPR A;  4GMJ B;  3ZCM A;  3AO3 A;  4HUF A;  1TYQ A;  4DS4 A;  1C1A A;  3H3O B;  5JMV A;  3MEG A;  1YJ9 N;  1G15 A;  1SKW A;  5EXW A;  3TTF A;  3THY A;  1YF5 L;  3V1Q A;  3VQE A;  4B1U B;  3U6F A;  4M63 C;  1CZ9 A;  1KLN A;  4HHT A;  2FBV A;  3L2R A;  1T6D A;  2Q0R A;  3SJH A;  4KPY A;  4CEQ A;  3CJ7 A;  2Q31 A;  1KAX A;  3CCS N;  5FPE A;  4CJS A;  1XI1 A;  2E8A A;  3OY9 A;  3MX2 A;  3EO3 A;  3MED A;  4B1V A;  3L0Q A;  1VSL A;  4JI1 K;  1IH7 A;  4A5A A;  1JCE A;  4KHW A;  4JEP A;  1YXQ A;  3V6D A;  4AQY K;  2A41 A;  4CJ7 A;  4ILH A;  4V19 S;  2YNG A;  4NLC A;  1DT9 A;  4PKG A;  3HSC A;  3G4S N;  2YNI A;  3DOK A;  4FOI A;  1KCF A;  3LP3 A;  3NE6 A;  4MFB A;  1XHZ A;  1NGB A;  3CJC A;  2B6A A;  1DGK N;  5H1S Q;  1JLA A;  4WFN L;  4CIE A;  4MO5 A;  5AQK A;  3PSI A;  1MA9 B;  2F9W A;  4LF5 K;  4OX9 K;  1A5W A;  1LWE A;  4LD0 A;  3VEO A;  2DFE A;  2FSN A;  3VEV A;  4B1Z A;  1VQ7 N;  3C6U A;  3TTD A;  4LH5 A;  4HUE A;  4CZE A;  2QWN A;  4FPA A;  1U6Z A;  1GLJ O;  1HR0 K;  3S3M A;  3DRR A;  4DR2 K;  4B9S A;  4OLA A;  2ITM A;  3KWG A;  1NK5 A;  3K2P A;  1XC3 A;  4ZHR A;  3S3O A;  1YIJ N;  2GUP A;  4JI6 K;  4KHS A;  3VEW A;  1S1T A;  3SAF A;  3QDK A;  3DLK A;  4PWD A;  1NGF A;  3OYA A;  4CEB A;  4DQQ A;  3KD1 E;  4PKI A;  2G8U A;  1BCM A;  1RIL A;  2CGK A;  5AZJ A;  3O4W A;  4NCG A;  3ZSZ A;  1OH8 A;  4PHT X;  3V9U A;  5J2P A;  5HRN A;  3MN6 A;  3FZH A;  1U2V A;  3KHY A;  4YOR A;  3EE8 A;  5BPN A;  1HNZ K;  4JYA K;  3KVG A;  1KFD A;  4CD3 A;  4C8O A;  3QML A;  4N41 A;  3ZEU A;  3DLL L;  3KZB A;  3O9Q A;  5AQH A;  3RSE B;  5CYM A;  4ELV A;  4LF6 K;  4IDK A;  4JV5 K;  3SI6 A;  3SUQ A;  3CET A;  4CJ5 A;  4DV0 K;  1HNI A;  3SZ2 A;  1T7P A;  3NF8 A;  4B3O A;  5C2D A;  2V51 B;  4BR5 A;  1NU0 A;  5AQX A;  4W5Q A;  4DTR A;  1ZBH A;  3OYC A;  4JK7 A;  3LDL A;  4DB3 A;  5AQS A;  1S1X A;  5CY4 A;  4NO7 A;  5TKY A;  1YTU A;  1MWK A;  3LPT A;  2JWL A;  2FBT A;  3LWL A;  3VGM A;  1WUA A;  4H0O A;  2IAJ A;  1YTA A;  3O9U A;  4KAZ A;  3AVM A;  3TTC A;  2ETJ A;  3ZSO A;  1SL1 A;  3BUZ B;  3WNG A;  1W9H A;  4JS4 A;  1K6Y A;  4M3T A;  4XH5 A;  3VET A;  3LAK A;  2O8B A;  3AVK A;  4I6M A;  3HP6 A;  3K59 A;  1TVR A;  1JJ2 M;  4JN4 A;  3DLE A;  4FWN A;  3FZL A;  3AAQ A;  1WSF A;  3AVF A;  3OHR A;  4M3W A;  3LP0 A;  3KKS A;  3KLH A;  3I55 N;  4JKB A;  3CCL N;  4KHP K;  1QTM A;  1BIU A;  4C8K A;  4N76 A;  3I0S A;  4JKE A;  4CEC A;  1JL2 A;  3ULD A;  2XY7 A;  3O3H A;  3ZT2 A;  1RT2 A;  4QS9 A;  3VA3 A;  4FK4 A;  1KAY A;  3HVT A;  3AO5 A;  4JKA A;  1RDB A;  4KRF A;  2D5R A;  3IKM A;  4CVN E;  4OKJ A;  1S6P A;  3RMA A;  2BTF A;  3IFR A;  1ZYQ A;  4J2A A;  4A2B A;  3J81 O;  3U8X A;  4KBO A;  3BY5 A;  4DV2 K;  5C0Y A;  4CGD A;  2E88 A;  3T7Z A;  3K58 A;  3T1H K;  1UA0 A;  3CME N;  3LWM A;  1NM1 A;  5CZ1 A;  4B9T A;  3DLH A;  3P38 A;  5A2Q O;  3NHG A;  3DXK A;  4B3R K;  3ULE B;  3RRG A;  1NK8 A;  3RVC A;  3VER A;  4H0P A;  4WQ5 A;  2E20 A;  4DQI A;  4KI6 A;  4ISE A;  4K25 A;  5KRS A;  3CC4 N;  3CJA A;  3V9Z A;  5BRD A;  1U4B A;  1RGI A;  4JI0 K;  3HO1 A;  4EP5 A;  4FLV A;  2JLE A;  4O0J A;  3O6W A;  5GIN A;  4H5R A;  4OKK A;  4FWM A;  1WN7 A;  3S41 A;  2Z1J A;  1TL3 A;  1VQ9 N;  1D4X A;  1DTT A;  2LSN A;  3NGI A;  4BRA A;  3F5T A;  1TAQ A;  3AAR A;  2YNH A;  1T44 A;  1RT7 A;  2NNW A;  5EU7 A;  3SJJ A;  3QER A;  3CER A;  3FFI A;  3V4I A;  1VQM N;  2KFZ A;  2P9I A;  1B92 A;  3L2W A;  5AQJ A;  1LAW A;  5EOY A;  3F9K A;  3CHW A;  2P9L A;  1NJW A;  3AA4 A;  3CJB A;  4I2P A;  1J54 A;  4O8K A;  4M41 A;  4BVO A;  5DM7 L;  3OYF A;  3CJ9 A;  2NUB A;  4IDH A;  1C0T A;  5F1X A;  4BG8 A;  4K8Z A;  1U48 A;  4YNQ A;  4CF0 A;  1RT1 A;  4F4K A;  2WC9 A;  5LJV A;  4DSE A;  4R79 A;  4WYB A;  1TKX A;  4FJ5 A;  4IFV A;  2HVH A;  4I2Q A;  4RG8 A;  1EP4 A;  2A3Z A;  4PQU A;  4FO0 A;  4M3Y A;  4K42 A;  1ZC6 A;  2X6N A;  3O80 A;  2IDO A;  3U4L A;  1ZBF A;  2PFU A;  4N5S A;  3C6A A;  3B6P A;  3ZSY A;  4AF1 A;  3SV4 A;  1R0A A;  3TSQ A;  1GLD G;  4B3M K;  2RHK A;  3ZT0 A;  4FLY A;  5HP1 A;  4FJI A;  2HHV A;  2D0C A;  4MLH A;  1HKC A;  1VSI A;  1NKB A;  3HTV A;  5C42 A;  1RBV A;  2HBK A;  3ITH A;  3GG4 A;  1JLB A;  1JLC A;  1L3T A;  5AQF A;  4DTS A;  2KHO A;  4IOC L;  1T8E A;  1BG3 A;  3U9D A;  3AO1 A;  4WQ4 A;  3C6H A;  5BR8 K;  3LDS A;  5M1P A;  1HNW K;  4EHT A;  1NGH A;  1TAU A;  4ISF A;  1EX4 A;  1JLG A;  1S3X A;  4QOZ B;  3C95 A;  4CF1 A;  2IS3 A;  1JXE A;  4DR7 K;  2WBN A;  5BPL A;  3RRH A;  4KB0 A;  3IG1 A;  3OS0 A;  2G8K A;  4KH4 A;  4IO9 L;  3QNO A;  2ZGY A;  3NH1 A;  4E0D A;  3CFO A;  3D7E O;  3ZSW A;  3WXK A;  3V1O A;  3H1V X;  5F0X A;  3EY1 A;  1OH6 A;  2ASM A;  5B8H A;  1ZBS A;  3THX B;  1F21 A;  4DLG A;  3W0L A;  1WB9 A;  3IMX A;  1C0F A;  4CJ4 A;  1KVA A;  4E7J A;  1P90 A;  4XH1 A;  4KV8 A;  3WNF A;  3H08 A;  3WEE A;  3TAF A;  2NRR A;  3H45 C;  1GLL O;  3RSE A;  3UKR B;  1S1V A;  3AVL A;  3TR8 A;  1YJN N;  4NCA A;  3NGY A;  2KFN A;  5HRP A;  2D0O A;  4I9L A;  2P9S B;  2IOC A;  4JKH A;  2QXF A;  3VQ7 A;  4ISG A;  3WQT A;  4OPJ A;  3QEX A;  3OW2 M;  3K5L A;  4ID1 A;  2V52 B;  4CJQ A;  2YCH A;  3MN7 A;  4BRE A;  5T7B A;  3C0B A;  1X9J A;  2KTQ A;  4BRI A;  3AA2 A;  3TAE A;  2QXL A;  3A0I X;  3DRS A;  3M8S A;  2GX9 A;  3M6G A;  4FJJ A;  4CJE A;  3ENO A;  3EN9 A;  3CC7 N;  4NLB A;  4KH6 A;  3UIQ A;  4JRP A;  4GV3 A;  3SMS A;  2I5J A;  3HOT A;  4FJK A;  2VG5 A;  3C7N B;  5AR0 A;  3A5M C;  1N33 K;  4CZI A;  2IIR A;  1O13 A;  2WFB A;  5FRO A;  2HNZ A;  1NK0 A;  2QM1 A;  1SKS A;  2P9P A;  2DTU A;  1MDU B;  3OBY A;  4OGE A;  1N8R O;  4ZTJ A;  2OPR A;  2WOM A;  4CEO A;  4FWP A;  2X78 A;  4B9N A;  5GIP A;  1XMQ K;  4LF4 K;  5K14 A;  1ILY A;  3DAW A;  4JS5 A;  3L3V A;  4CHQ A;  2F7T A;  1JCG A;  1ASU A;  4CED A;  3CQX A;  5AJ3 K;  1EKE A;  1SL0 A;  4KRE A;  4CGJ A;  4DSL A;  3AVB A;  2ZD1 A;  1RCH A;  3TAR A;  1SZ2 A;  3LM9 A;  4A2A A;  5M1Q A;  3OJS A;  1FXX A;  3LP1 A;  4KH5 A;  2HBM A;  1XUP O;  1LOT B;  3L4I A;  5AQY A;  3CM6 A;  3O9R A;  3SBT A;  4JHD B;  2DFF A;  3R8E A;  4FJH A;  2OA8 A;  1S9G A;  1D5A A;  3AV9 A;  4X62 K;  5MLC Q;  4DF4 A;  1T6C A;  1K73 O;  3TSU A;  5DM6 L;  3A2F A;  1RBR A;  4F8R A;  1WSG A;  3BZC A;  2QI2 A;  1Q9Y A;  5AQR A;  2E6M A;  1VSF A;  1L3V A;  4Z4H A;  5F2R A;  2GBZ A;  1GLE G;  3ISN C;  4JD2 A;  2HHW A;  5C15 A;  1OH5 A;  1QSY A;  2PAV A;  4Z94 A;  3ULE A;  4N47 A;  2AP1 A;  4DU1 A;  2PYJ A;  4CEF A;  3WXI A;  2Y1I A;  4BRL A;  1KD1 O;  2GEM A;  2NRH A;  2W40 A;  3O4N A;  3VQD A;  2KLA A;  5FRN A;  4YOX A;  1HPZ A;  4ILG B;  3DXM A;  3NDK A;  5E41 A;  4Y1D A;  2V7Y A;  2VQE K;  1LW2 A;  1EXQ A;  3CQ8 A;  4BR7 A;  2V7Z A;  3J7Y P;  5KTQ A;  1BGX T;  1VSE A;  1B9D A;  4H5T A;  4OPA A;  2QWP A;  2WUS A;  4JKD A;  4BG9 A;  1C0U A;  1X9S A;  4FLZ A;  2E2P A;  2AJQ A;  1WSI A;  4E3S A;  4RW9 A;  3QBX A;  3A5N C;  1SKR A;  1RBS A;  2ZJQ L;  4F9O A;  1X1P A;  3K9J A;  3VQ4 A;  4BRN A;  4DR3 K;  2D1K A;  3CD6 N;  3HZ6 A;  5C25 A;  3DI6 A;  3LDO A;  3O8M A;  1SL2 A;  3KLI A;  2E1Z A;  1NGD A;  4J2D A;  4FLX A;  3I8B A;  4LFB K;  5ADX A;  3L4Q A;  5FLX O;  4RW4 A;  1BDG A;  3SBG A;  1U45 A;  1K8A O;  1V4S A;  1QZ5 A;  4BRG A;  4BE1 A;  1RFQ A;  3FLC O;  2OZS A;  1VQ6 N;  3OYB A;  4H4M A;  3M3Z A;  4DF8 A;  2NRZ A;  5DMR A;  3KTQ A;  1IKX A;  1BIS A;  1TUY A;  4CJK A;  3KJV A;  2HMI A;  1HUX A;  4E7I A;  2RN2 A;  3PY8 A;  5EX5 A;  4CGH A;  3HT3 A;  5SZT A;  2HHT A;  3VEY A;  2D4W A;  2XRI A;  3CMA N;  4I7F A;  2ZF5 O;  3OBW A;  1LCU A;  3WNH A;  2AA4 A;  4PL8 A;  2EX3 A;  2OPQ A;  3LP2 A;  4F2S A;  2XY6 A;  3LL3 A;  4RW8 A;  4DV4 K;  4IBN A;  3DMJ A;  4ELU A;  1EET A;  4J2B A;  4AHV A;  3HXM A;  1EO1 A;  4CZG A;  3NVK A;  1BOT O;  1K9M O;  4B1W B;  4WFA L;  3RR7 A;  4IFY A;  4O8U A;  3ZSX A;  4GKJ K;  2P51 A;  3PO4 A;  4IWV A;  2YKN A;  3LPU A;  4PKH A;  1SUQ A;  5LL6 Z;  3CI5 A;  3LM2 A;  1VSH A;  4DV1 K;  4BRM A;  2RE2 A;  2XO7 A;  4CJL A;  2G8I A;  1E4G T;  3SUP A;  2EWS A;  2NZT A;  3Q7B A;  4IJA A;  4FK0 A;  1VQ8 N;  1NBW A;  3CPE A;  3BF1 A;  1C6V A;  3VQB A;  3VEX A;  4CFC A;  3QFP A;  1TK5 A;  4FVM A;  4C1N I;  5AQZ A;  3KK7 A;  3K5N A;  3FE1 A;  4BRD A;  3P4I A;  3THW A;  4CHZ A;  2E2Q A;  3V9S A;  1NJX A;  2QKK A;  2KQ2 A;  4MDA A;  1FW6 A;  2P9N A;  1ATS A;  2DPN A;  1QQO A;  4AHC A;  1XMO K;  1CLQ A;  2GV9 A;  3VTI A;  4LH4 A;  4CJW A;  2KZZ A;  3THX A;  4JK8 A;  3FFK B;  4BGA A;  4CFD A;  2A1S A;  4YOV A;  5AQI A;  3K5O A;  4FYD A;  5JLF A;  1DLO A;  5HL7 L;  5LJW A;  3VOV A;  3Q7C A;  1O1W A;  3UKR A;  4E1J A;  3PLA A;  3MDQ A;  2HHU A;  4BR9 A;  4W5O A;  1BI4 B;  3QET A;  1DTQ A;  3AVH A;  3J7A P;  2P9S A;  4PY5 A;  4E7H A;  3NF7 A;  5AZI B;  3IAY A;  1CZB A;  4YHH K;  3A5L C;  3KK3 A;  4OPK A;  1VQ4 N;  4AHR A;  3TWH A;  3BP8 A;  2Y1J A;  4EFH A;  3SV3 A;  3GL1 A;  4B8A B;  2CH6 A;  1DEJ A;  2HOE A;  3VGL A;  1EWQ A;  5AFU H;  4NXM K;  4BRP A;  3V1R A;  2F9T A;  3SQ2 A;  1QQM A;  4M3Z A;  3HPG A;  1RDC A;  1BQN A;  3CPW M;  3DLG A;  1QS4 A;  2X6S A;  1HYS A;  4KTZ A;  3C7N A;  3MN9 A;  4DTX A;  1K8K A;  2O8C B;  2FF6 A;  1YHQ N;  2E1Y A;  5TKW A;  1ASW A;  4BQZ A;  1BHL A;  2QA4 N;  4FLU A;  2VQF K;  4DFK A;  2ZWH A;  4BDY A;  2ITG A;  3O3F A;  4X64 K;  4E7L A;  1YVN A;  1YT3 A;  1A5V A;  3HBT A;  1L5U A;  2FLO A;  1NGA A;  3WXL A;  3BDP A;  1H1V A;  1QHA A;  2I7N A;  4DQR A;  2OTL N;  3O9T A;  3D2F B;  4RTF D;  1HQU A;  4EZ6 A;  2B5J A;  3SPZ A;  1KLM A;  3KK2 A;  3VGK A;  4FW2 A;  4JAX A;  3KD5 E;  4E89 A;  3SPY A;  4QS8 A;  4JHD A;  3U3G A;  4BWJ A;  4DHY A;  3OTO K;  4DV7 K;  2BH1 A;  3CC2 N;  3PIO L;  3ASM A;  3FGU A;  2BE2 A;  3NH0 A;  4Y1C A;  4GNI A;  3B6O A;  4FWS A;  4KHN A;  5JLH A;  4GKK K;  5BN8 A;  1NG9 A;  1FK9 A;  2ZGZ A;  3PIP L;  4DTJ A;  2VGM A;  3WNE A;  2W6K A;  1WNS A;  1RT4 A;  5IT9 O;  2OZM A;  2HBL A;  3KWI A;  3ZET A;  3ZYY X;  1Q9X A;  3ATV A;  4JKG B;  3CCQ N;  1Z6R A;  4H5V A;  5C24 A;  2NRX A;  2OPP A;  2VGN A;  2OAN A;  3JXU A;  4DTO A;  5CE3 A;  1QSL A;  4DKW A;  5GAE P;  3OYM A;  4X66 K;  3QEP A;  3CCE N;  3CG7 A;  4DFM A;  2QEX N;  4GY2 B;  2JWK A;  2EHG A;  2X74 A;  5KRT A;  1BIZ A;  4IKF A;  4TSX A;  1UA1 A;  3RMD A;  2CGL A; 
#chains in the Genus database with same CATH homology
 4RW6 A;  2HND A;  5HRP A;  4I9L A;  4Q5V A;  5I42 A;  2IOC A;  4GMJ B;  3SUN A;  1TK8 A;  1BL3 A;  3ZCM A;  2QXF A;  3VQ7 A;  3OJU A;  3AO3 A;  4HCB A;  3L8B A;  4HUF A;  1NK9 A;  2YHA A;  4OPJ A;  4DS4 A;  1C1A A;  3QEX A;  3TAQ A;  3K5L A;  2IGI A;  4ID1 A;  3DM2 A;  3MEG A;  4CJQ A;  4E1M A;  1G15 A;  1SKW A;  3T19 A;  1KFS A;  2P5G A;  3NCI A;  3V1Q A;  3VQE A;  5T7B A;  2YKM A;  4FJN A;  5D3G A;  3C94 A;  3U6F A;  1CZ9 A;  1I3A A;  4GW6 A;  3PX0 A;  1KLN A;  4HHT A;  2KTQ A;  1UWB A;  2FBV A;  3AA2 A;  3L2R A;  3PX6 A;  1S5J A;  3TAE A;  3SQ0 A;  4CK2 A;  4DTU A;  3NH2 A;  1JXB A;  4KPY A;  4CEQ A;  2Q3S A;  1GOC A;  4O55 A;  5SWM A;  2R7Y A;  3DRS A;  4CF9 A;  3AO4 A;  3M8S A;  4B08 A;  1D8Y A;  3QLH A;  4Z4E A;  4FJJ A;  4CJE A;  3OYD A;  3PX4 A;  4FW1 A;  3UIQ A;  4PUO A;  2VWJ A;  1QQC A;  4CJS A;  4E7K A;  1XI1 A;  3HPO A;  4JRP A;  1TV6 A;  3AVI A;  1JLF A;  1RTD A;  4Z4I A;  3OY9 A;  2I5J A;  3CM5 A;  4O5B A;  3MED A;  4CFB A;  1ITG A;  1HJR A;  1VSL A;  3RTV A;  1IH7 A;  4FJK A;  3OYH A;  4KHW A;  2VG5 A;  5I3U A;  4KB1 A;  3V6D A;  1CXQ A;  3P1G A;  1N6Q A;  2FC0 A;  1KRP A;  3DOL A;  5FRO A;  2HNZ A;  1NK0 A;  2YNG A;  5KI6 A;  1SKS A;  4OLB A;  2DTU A;  2BGG A;  4OGE A;  4CJU A;  1GOA A;  1X9M A;  4ZTJ A;  3L2Q A;  3LZI A;  2YNI A;  2OPR A;  2WOM A;  4CEO A;  4CGI A;  3DOK A;  4FJX A;  1KCF A;  3LP3 A;  4KFB A;  2X78 A;  4CJV A;  4MFB A;  2O4G A;  3NE6 A;  1XHZ A;  4B9N A;  4CCH A;  4CK1 A;  2D0B A;  5K14 A;  1WLJ A;  2B6A A;  4JS5 A;  2P1J A;  1JLA A;  3L3V A;  4CFA A;  4YFU A;  4CHQ A;  4FK2 A;  4Z4C A;  3QES A;  1ASU A;  4CIE A;  4CED A;  1EKE A;  1SL0 A;  4E1N A;  1VRU A;  1RBU A;  3EYZ A;  4KRE A;  4DQS A;  3MEC A;  1A5W A;  1GOB A;  4CGJ A;  4CHY A;  1LWE A;  4LD0 A;  4XIU A;  4DSL A;  3AVB A;  2ZD1 A;  1RCH A;  2DFE A;  3TAR A;  2E6L A;  5DK5 A;  1WSH A;  1S6Q A;  3OJS A;  3S3N A;  1FXX A;  1XHX A;  3C6U A;  4F3T A;  1RNH A;  3LP1 A;  3PUF A;  4LH5 A;  4HUE A;  4KTQ A;  3KLG A;  3CM6 A;  4DSF A;  4FM1 A;  1TKZ A;  2PYL A;  3AVA A;  1J5O A;  3TI0 A;  4RW7 A;  2DFF A;  3DRR A;  3S3M A;  4B9S A;  3HJF A;  4FJH A;  2OA8 A;  4OLA A;  1S9G A;  1D5A A;  3AV9 A;  3VQC A;  3ZT3 A;  4DF4 A;  2HHQ A;  1B9F A;  2HVI A;  4AHU A;  3QNN A;  1NK5 A;  2ZQB A;  3K2P A;  5J1E A;  4ZHR A;  3S3O A;  3A2F A;  1RBR A;  4F8R A;  1TKD A;  1WSG A;  2BAN A;  3AVN A;  3P83 D;  1Q9Y A;  4KHS A;  4OKE A;  1LV5 A;  2XHB A;  1S1T A;  1Z26 A;  2E6M A;  1VSF A;  3DLK A;  1L3V A;  4PWD A;  4Z4H A;  1LW0 A;  4FJL A;  2GBZ A;  3ISN C;  3OYA A;  4HTU A;  4CEB A;  4DQQ A;  2HHW A;  3KD1 E;  2PY5 A;  1QSY A;  5CYQ A;  4H4O A;  4N47 A;  2DY4 A;  2G8U A;  2HHX A;  1BCM A;  1RIL A;  4DU1 A;  1X9W A;  2PYJ A;  4FZY A;  4KO0 A;  4NCG A;  3ZSZ A;  4BDZ A;  3CFR A;  4ID5 A;  2B4J A;  4CEF A;  2Y1I A;  3SCX A;  3V9U A;  5J2P A;  5HRN A;  3O4N A;  4NCB A;  3G0Z A;  3VQD A;  5FRN A;  4Z4G A;  3OYJ A;  3TAB A;  1ZBI A;  4CES A;  1HPZ A;  5JS2 A;  4FM0 A;  1KFD A;  2PZS A;  4DFJ A;  3NDK A;  4C8O A;  1LWC A;  5E41 A;  4N41 A;  4Y1D A;  4R5P A;  1BCO A;  1QSS A;  1LW2 A;  1EXQ A;  3AA5 X;  3CQ8 A;  5CYM A;  4ELV A;  1KTQ A;  4IDK A;  3V81 A;  5KTQ A;  3SI6 A;  3L2U A;  2QK9 A;  1RBT A;  2JGU A;  1BGX T;  1VSE A;  1T03 A;  4AIL C;  1B9D A;  3OYG A;  3SUQ A;  4CJ5 A;  4CIF A;  1HNI A;  4BDP A;  1HQE A;  3OYN A;  4PA1 A;  1A5X A;  3SZ2 A;  1T7P A;  3NF8 A;  1NOY A;  4B3O A;  3ALY A;  1C0U A;  3RMB A;  1X9S A;  4CF8 A;  4FLZ A;  3OYE A;  1NK6 A;  2AJQ A;  4KTW A;  2Z1I A;  1WSI A;  4E3S A;  3M8Q A;  4W5Q A;  4KKO A;  4DTR A;  4KB0 A;  4RW9 A;  3NFA A;  4BE0 A;  2ATQ A;  3OYC A;  1ZBH A;  4O0I A;  1ZBU A;  2XY8 A;  1SKR A;  3BGR A;  1JLQ A;  3VA0 A;  1L3S A;  1RBS A;  1C0M A;  2FBY A;  1S1X A;  1X1P A;  5CY4 A;  3VQ4 A;  3SQ1 A;  3DLB A;  1YTU A;  2ZE2 A;  3LPT A;  5C25 A;  3DI6 A;  3HP9 A;  2FBT A;  4AHS A;  3HST B;  3LWL A;  2G8W A;  1KVB A;  4M42 A;  2IAJ A;  1SL2 A;  3KLI A;  3AO2 A;  3P5J A;  3HVR A;  1YTA A;  1HRH A;  3AVJ A;  4J2D A;  4KAZ A;  3AVM A;  4FZZ A;  4FXD A;  4FLX A;  4NYN A;  1VSM A;  1HYV A;  2ETJ A;  2Z1H A;  4RW4 A;  3ZSO A;  3WNG A;  3KLF A;  1U45 A;  4OGC A;  1SL1 A;  4B9V A;  4BE1 A;  3RWU A;  2GUI A;  1W9H A;  2OZS A;  3OYB A;  4H4M A;  3D0P A;  4JS4 A;  4CEZ A;  4ICL A;  1K6Y A;  3KLE A;  3VQ6 A;  4DF8 A;  4M3T A;  4KHY A;  5DMR A;  4KI4 A;  2F8S A;  3L2V A;  1FKO A;  3KTQ A;  4DG1 A;  3LAK A;  1IKX A;  3MXJ A;  1BIS A;  1RTH A;  4Z4F A;  3AVK A;  3KK1 A;  4CJK A;  1J53 A;  3HP6 A;  3KJV A;  4FCY A;  2G8V A;  3O4Q A;  1TVR A;  4O4G A;  3K59 A;  2HMI A;  4DQP A;  3VQ8 A;  3AVC A;  4E7I A;  2RN2 A;  3DLE A;  3PY8 A;  1WSF A;  4FJ8 A;  3AVF A;  1RT5 A;  4M3W A;  3LP0 A;  4CGH A;  3OS1 A;  4E19 A;  3KKS A;  3KLH A;  1U47 A;  3HT3 A;  5SZT A;  3PV8 A;  2VG6 A;  2HHT A;  4CJP A;  1N5Y A;  4BAC A;  1JLE A;  2XRI A;  1QTM A;  1BIU A;  4I7F A;  4AHT A;  4C8K A;  4N76 A;  3I0S A;  2DFH A;  1NJZ A;  3RR8 A;  3E01 A;  3ULD A;  3WNH A;  1JL2 A;  4CEC A;  2XY7 A;  3T1A A;  1VSJ A;  2EX3 A;  3VN5 A;  2D0A A;  3O3H A;  3TAP A;  2OPQ A;  3LP2 A;  3ZT2 A;  1RT2 A;  1T05 A;  2XY6 A;  4F2S A;  3TAM A;  2HHS A;  3QIN A;  4CJF A;  1FKP A;  4RW8 A;  3EZ5 A;  3VA3 A;  4FK4 A;  3ZSV A;  4Z0U A;  4IBN A;  3DMJ A;  3KIO A;  4F3O A;  3HVT A;  3AO5 A;  5HBM A;  1RDB A;  4C8N A;  1EET A;  4HVJ A;  4DU4 A;  2D5R A;  2RKI A;  4AHV A;  4ELU A;  3HXM A;  4J2B A;  2QKB A;  4KRF A;  4OKJ A;  1S6P A;  1W0H A;  3NAE A;  3RMA A;  3MXI A;  1D9D A;  1RT6 A;  2W42 A;  2G8H A;  4HCC A;  3T3F A;  3RR7 A;  1RTJ A;  4IFY A;  1U49 A;  1ZYQ A;  4J2A A;  1QHT A;  3ZSX A;  2P51 A;  4CGF A;  3PO4 A;  2YKN A;  3LPU A;  4CGD A;  1SUQ A;  3QIO A;  2YNF A;  4G1Q A;  4CHP A;  1C1C A;  1HYZ A;  3K58 A;  4DWI A;  1UA0 A;  1VSH A;  3D45 A;  4JLH A;  1S1W A;  4M45 A;  3M8R A;  3LWM A;  4DSI A;  4FJG A;  2FBX A;  5CZ1 A;  4B9T A;  2XO7 A;  3DLH A;  1HMV A;  3VQP A;  3NHG A;  1RTI A;  3ZT1 A;  4CJL A;  1VK0 A;  2G8I A;  3NF9 A;  4EZ9 A;  3RRG A;  1NK8 A;  3SUP A;  4DSK A;  4FK0 A;  3K57 A;  3QEW A;  4CJR A;  4DFP A;  1RT3 A;  4DQI A;  4OJR A;  4KI6 A;  1C6V A;  3VQB A;  4DMN A;  3O3G A;  4CFC A;  3LAL A;  1TK5 A;  4DLE A;  4FVM A;  4FJ9 A;  1REV A;  5KRS A;  4CEA A;  1JKH A;  3K5N A;  5KGW A;  4LSL A;  1WSE A;  3JYT A;  1BQM A;  3V9Z A;  5HRR A;  2XY5 A;  3AA3 A;  4CHZ A;  4B9U A;  3V9S A;  1NJX A;  2QKK A;  3VQQ A;  1TKT A;  1U4B A;  3PO5 A;  2KQ2 A;  2OPS A;  3HO1 A;  4EP5 A;  4FLV A;  4CJ3 A;  1VSD A;  3ZSQ A;  2JLE A;  4O0J A;  4AHC A;  1CLQ A;  1J9A A;  2GV9 A;  3MAQ A;  1SV5 A;  4OKK A;  4W5R A;  4LH4 A;  4B9L A;  3NGZ A;  4CJW A;  1WN7 A;  4N56 A;  2Z1J A;  3SUO A;  3HPH A;  4LSN A;  1TL3 A;  2KZZ A;  4DTP A;  5FRM A;  3ZT4 A;  1DTT A;  2LSN A;  4CFD A;  3NGI A;  2G8F A;  4DTN A;  5J2M A;  1UOC A;  2A1S A;  3I0R A;  5J2Q A;  4LY7 A;  1ZBL A;  4W5N A;  1TAQ A;  3K5O A;  3C6T A;  2YNH A;  4FYD A;  3QO9 A;  1IKV A;  1MU2 A;  4CK3 A;  1DLO A;  1RT7 A;  5EU7 A;  3SJJ A;  4K8X A;  1LAV A;  3QER A;  2RPI A;  3FFI A;  3V4I A;  1VSK A;  2VWK A;  4CF2 A;  1TK0 A;  2KFZ A;  1B92 A;  1O1W A;  3DYA A;  2HHU A;  3S9H A;  1Z25 A;  3L2W A;  1HNV A;  1LAW A;  3NBP A;  4W5O A;  1BI4 B;  3F9K A;  1BI4 A;  3QET A;  1I39 A;  1DTQ A;  4M3R A;  1NJW A;  3AVH A;  3AA4 A;  4I2P A;  4M41 A;  1J54 A;  1NJY A;  4ELT A;  4GVM A;  4PY5 A;  3V9W A;  1WAF A;  3HM9 A;  3K5M A;  3OYF A;  2NUB A;  3MXM A;  4Q0B A;  4E7H A;  1C0T A;  3NF7 A;  1D9F A;  1UAX A;  3LZJ A;  4K8Z A;  3IAY A;  1U48 A;  1CZB A;  4DS5 A;  4YNQ A;  3KK3 A;  4CF0 A;  1RT1 A;  1IKW A;  4F4K A;  3G10 A;  4OPK A;  3VQ9 A;  4AHR A;  3TWH A;  4DSE A;  3CYM A;  1S9E A;  4B8C A;  3OYK A;  1XWL A;  2Y1J A;  4NYF A;  1RDD A;  3SNN A;  3SV3 A;  1TKX A;  4DTM A;  1JL1 A;  4B8A B;  4FJ5 A;  3MEE A;  4IFV A;  2HVH A;  4I2Q A;  1NK4 A;  3M8P A;  4RG8 A;  1EP4 A;  4FLW A;  4PQU A;  4O44 A;  4M3Y A;  3V1R A;  4FJM A;  2IC3 A;  3SQ2 A;  4CHO A;  2KZM A;  2X6N A;  4M3Z A;  2IDO A;  1L3U A;  1ZBF A;  4WE1 A;  3HPG A;  4UQG A;  1RDC A;  1BQN A;  1U04 A;  3DLG A;  4N5S A;  1QS4 A;  5KGX A;  3OS2 A;  3ZSY A;  3B6P A;  2X6S A;  4DU3 A;  3SV4 A;  1R0A A;  4KTZ A;  1HYS A;  2HW3 A;  4DTX A;  1NKC A;  1WSJ A;  2RF2 A;  3LAM A;  1RDA A;  2KW4 A;  3QEI A;  1ASW A;  3ZT0 A;  4FLY A;  5HP1 A;  4BE2 A;  3V9X A;  1BHL A;  4EP4 A;  4FLT A;  4FLU A;  4FJI A;  2D0C A;  2HHV A;  1VSI A;  4DFK A;  1KSP A;  3IRX A;  3HYF A;  2ITG A;  4BDY A;  4CJT A;  3O3F A;  1NKB A;  1YVU A;  1WAJ A;  4E7L A;  1YT3 A;  4MQ3 A;  1A5V A;  1RBV A;  5C42 A;  3F73 A;  1S1U A;  3ITH A;  1Y97 A;  1JLB A;  1JLC A;  1L3T A;  3U3Y A;  4DTS A;  2Z1G A;  3L3U A;  3LAN A;  3I8D A;  4F2R A;  1L5U A;  4FJ7 A;  3BDP A;  1T8E A;  4CIG A;  4J2E A;  4IG0 A;  3NF6 A;  4DQR A;  1NK7 A;  3AO1 A;  3AVG A;  1HQU A;  2F8T A;  1ASV A;  3JSM A;  4EZ6 A;  4QAG A;  4M3X A;  2B5J A;  3LDS A;  2WON A;  3SPZ A;  1VRT A;  1C1B A;  1KLM A;  3OVN A;  2BDP A;  4FZX C;  4KHU A;  1KVC A;  2P5O A;  2YV0 X;  3OYI A;  3KK2 A;  5HLF A;  4FW2 A;  1TAU A;  2HNY A;  4C8L A;  3VQA A;  4E89 A;  3SPY A;  3KD5 E;  1EX4 A;  4C8M A;  1JLG A;  4QOZ B;  3U3G A;  3C95 A;  4BWJ A;  4CF1 A;  5JS1 A;  2IS3 A;  2VG7 A;  2YHB A;  4ZTF A;  1IG9 A;  1LWF A;  2HB5 A;  1JXE A;  4CE9 A;  3ASM A;  3TAG A;  2OYQ A;  3DRP A;  3RRH A;  1QE1 A;  2BE2 A;  3NH0 A;  4Y1C A;  3CFP A;  3IG1 A;  3OS0 A;  3HL8 A;  1XC9 A;  4HUG A;  2G8K A;  3B6O A;  4CHN A;  5J2N A;  3QNO A;  3RMC A;  4H8K A;  4KHN A;  3VQ5 A;  3NH1 A;  1TL1 A;  3CFO A;  4E0D A;  4JRQ A;  4L8R B;  4OVL A;  3IS9 A;  3ZSW A;  1FK9 A;  1IO2 A;  3V1O A;  4CEE A;  4DTJ A;  3WNE A;  4W5T A;  3SQ4 A;  5CZ2 A;  3EY1 A;  1WNS A;  2A1R A;  1NKE A;  1RT4 A;  4M3U A;  5FDL A;  1TGO A;  2OZM A;  4IG3 A;  4BWM A;  3QIP A;  3DLR A;  1CXU A;  3ZSR A;  1Q9X A;  3KKR A;  5HRS A;  3TAN A;  1F21 A;  5HRO A;  4CGG A;  4DLG A;  4AH9 A;  3OYL A;  3QEV A;  4CJ4 A;  4I9Q A;  1NOZ A;  5C24 A;  2OPP A;  1KVA A;  4E7J A;  2O4I A;  4KV8 A;  3WNF A;  4DTO A;  1QSL A;  3OYM A;  2F96 A;  3H08 A;  3TAF A;  4FM2 A;  3QEP A;  3SYZ A;  1S1V A;  3THV A;  3CG7 A;  4DFM A;  1Q8I A;  4QCL A;  2EHG A;  3AVL A;  2X74 A;  4CER A;  5KRT A;  4B9M A;  1IKY A;  1BIZ A;  3TR8 A;  4IKF A;  4TSX A;  1UA1 A;  4DSJ A;  3RMD A;  4NCA A;  4KHQ A;  2E4L A;  3HK2 A;  3NGY A;  2KFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...