3KKRA

Crystal structure of catalytic core domain of biv integrase in crystal form i
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
b'GSHLWQMDNTHWNKTIIWVAVETNSGLVEAQVIPEETALQVALCILQLIQRYTVLHLHSDNGPCFTAHRIENLCKYLGITKTTGIPYNPQSQGVVERAHRDLKDRLAAYQGDCETVEAALSLALVSLNKKRGGIGGHTPYEIYLESEHTKYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of catalytic core domain of BIV integrase: implications for the interaction between integrase and target DNA
pubmed doi rcsb
source organism Bovine immunodeficiency virus
molecule tags Dna binding protein
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kkrA00
1S1XA 3RMDA 3OY9A 4DTMA 3RMCA 1VRUA 1BQNA 4E19A 1WSGA 4GMJB 1RBVA 4E1NA 4FLXA 4FZXC 4ZHRA 4KHQA 2KFZA 4BACA 3HVTA 4OLAA 4HTUA 2IOCA 1FXXA 4C8NA 3ZCMA 5HBMA 2ETJA 3P5JA 1RDAA 2B6AA 3DOKA 3SQ0A 2RN2A 3DRSA 3HYFA 3M8PA 3NGZA 4KB1A 2HB5A 3VQBA 3SPZA 3VQCA 2VG7A 3VA3A 1RT4A 4IFYA 1ZBLA 5KTQA 4W5RA 4B3OA 2DY4A 2HNDA 3BGRA 4FJ7A 1O1WA 4KAZA 1J53A 3BDPA 1CZBA 2Q3SA 1RTIA 3DM2A 1RDCA 3AVKA 3LALA 4OJRA 4M41A 3QNNA 1TK5A 3RRGA 4KREA 4CECA 1SKSA 1WSJA 3V9UA 1QSSA 4FVMA 1G15A 2PYLA 1ZBFA 3LWMA 3RMBA 1A5XA 1KVBA 1C0MA 3OVNA 2FC0A 3LP1A 1BI4A 3TAPA 4B9TA 3QINA 4W5QA 3VQAA 2X74A 3SQ1A 2HW3A 3HVRA 4G1QA 3SPYA 2VWJA 3V4IA 3TWHA 1JLFA 4Y1DA 1HPZA 1J54A 4B9LA 1D9FA 1SKWA 1K6YA 4CJFA 4DU4A 3TAFA 4DSEA 1F21A 4YFUA 3RWUA 1VSFA 4F3TA 1ASUA 1RT6A 4IDKA 4CEDA 5JS1A 1JXEA 3K5LA 4AHSA 3OYBA 4CESA 3DLBA 4CJVA 3NH1A 3EYZA 3O3HA 2OPPA 5HRRA 4Z4CA 1KRPA 1SV5A 4DSIA 3OJSA 1A5VA 2G8IA 4FJ8A 4GVMA 1ZBIA 1LW2A 3IAYA 4RG8A 3SUOA 4LY7A 3SQ2A 2G8UA 3PX6A 4CEBA 3DYAA 2O4GA 4WE1A 1SKRA 4CJUA 3NFAA 3ASMA 3AVNA 1IKYA 4LSLA 2ZD1A 3NBPA 4CFCA 4OVLA 3VQ6A 3KK1A 3SQ4A 1Y97A 1RTJA 1T7PA 4PUOA 5CY4A 3PX0A 5J2PA 5HROA 4I2PA 4B9UA 4FJNA 3V9WA 1VSLA 3TR8A 4FJ9A 3MAQA 3TAQA 1U48A 2G8VA 2HHQA 3MEEA 1S1WA 3LP0A 4K8XA 1Z25A 1HYVA 1YTAA 2HHXA 2E6MA 4B9NA 1U47A 5FROA 3K5OA 3VQ4A 3LAMA 4IKFA 1EXQA 4CJEA 4NYFA 3L2WA 4BE1A 4PY5A 4O55A 1ASVA 1LV5A 2KZZA 2BANA 1S6PA 4Z4IA 5I42A 1U49A 3TI0A 4DTXA 3VQ5A 4CHPA 4DTOA 4F8RA 1BISA 1JKHA 4I2QA 4B08A 3QETA 2P5GA 3H08A 4HUEA 5D3GA 4FM1A 4CGGA 4E7LA 3OYMA 3SYZA 4DF4A 3NGYA 4BE2A 4DF8A 1W9HA 1S1VA 3VQEA 4B8CA 4DQPA 3E01A 3DOLA 3NF8A 5T7BA 1VSKA 1TKXA 4JS5A 2KQ2A 3MXIA 4AHTA 1NK5A 3HM9A 2F8SA 1C1AA 3V9ZA 2E6LA 1RNHA 2QXFA 3KTQA 2KW4A 1C0TA 4HVJA 2G8WA 2P5OA 1FKPA 1IKVA 1BQMA 4B9VA 3P83D 1EETA 4M3XA 4YNQA 2VWKA 1KVCA 1Q9YA 1TAUA 2XY7A 3AVCA 4KRFA 1BGXT 2RF2A 3T3FA 4E7IA 1TV6A 3ZSWA 4QOZB 1NK8A 3M8SA 4DQRA 4O5BA 4Q0BA 4DS5A 4FJIA 1TL1A 4CJKA 3V6DA 1JL2A 4M3YA 3WNHA 3ITHA 1U4BA 3TARA 1BL3A 1RDDA 3O4NA 4BDYA 4FLWA 3DLHA 3C95A 4FLVA 1WSFA 5FDLA 1L5UA 1W0HA 3VN5A 1ZBHA 3OYEA 1BHLA 3V81A 3AVIA 3L2QA 4E89A 2OPRA 4Q5VA 1DTTA 1VSJA 4C8LA 3U3YA 3RR8A 1Q8IA 1CXUA 4J2EA 1JXBA 4CEFA 2JGUA 5HRNA 1HYZA 3MXJA 3O4QA 4M42A 1LAVA 4KHWA 3VQ8A 5C25A 3NAEA 4DFJA 3U6FA 4CEOA 3AVGA 1YTUA 3EZ5A 4KHNA 1RBTA 3PUFA 3HT3A 2VG6A 4F2RA 3TANA 3PY8A 1S9GA 1T05A 2HHTA 3O3FA 1U04A 4C8OA 1XI1A 1NJYA 1X9MA 1VK0A 3C94A 2XO7A 2B5JA 1JLGA 1SL1A 4FK4A 2DFHA 1KCFA 2HNZA 2YNHA 4FW1A 3B6OA 2FBTA 1HNVA 4XIUA 3AO5A 3O3GA 1I39A 4CJ3A 4DFKA 1C1CA 2I5JA 4M3ZA 4J2AA 4FJLA 2FBXA 4M3WA 4KHYA 4N47A 2IAJA 4FZZA 4DQIA 3IS9A 5SWMA 4CGDA 1EP4A 4DG1A 4DTPA 4ELTA 4I9QA 2PY5A 4W5TA 4CFDA 3K5MA 4AHCA 4KHUA 3OYAA 3PO4A 1LW0A 4KHSA 2X6NA 3G0ZA 2GV9A 3RRHA 4LH5A 3I0SA 4RW9A 1I3AA 5HRPA 4DTNA 3IG1A 1NKBA 3QEVA 1T8EA 3LP3A 1JLAA 3KKSA 1NKCA 2PYJA 4DLGA 4DS4A 4RW6A 4IFVA 5I3UA 2OZMA 3AVMA 3ZSOA 2X78A 3KD1E 3QNOA 4MFBA 1S1UA 3IRXA 4NYNA 3PV8A 4Y1CA 1ZBUA 4NCGA 4RW8A 4N41A 4DFMA 2G8KA 3VQ7A 4OPKA 3G10A 1UA1A 2XY5A 3SV4A 3B6PA 5EU7A 1REVA 1NJXA 2AJQA 4CF9A 4JLHA 3S9HA 4B9SA 1KFSA 1RBRA 3MEGA 3NF9A 4EZ9A 4CHYA 4QAGA 1IKWA 5DK5A 4IG0A 5HLFA 4KTZA 3NGIA 4M3TA 3OYNA 1RDBA 3DLGA 3VA0A 1L3VA 4PA1A 3AO4A 4CHZA 1J9AA 4HHTA 4LD0A 3TABA 3VQQA 3SUNA 4FK0A 1TKZA 4CFBA 3I0RA 1TVRA 1RT5A 4CEAA 4OKKA 3ZT1A 4DWIA 1XWLA 4DFPA 3HPHA 4FM0A 1D9DA 2KTQA 3OYKA 3ZT2A 3VQDA 2YV0X 5CYQA 3S3NA 3NH0A 3LWLA 4FJXA 2D0AA 3QEIA 3QLHA 4CF1A 1HQUA 1B9FA 2FBYA 2YHBA 2R7YA 4CJWA 3QEXA 4FJHA 4JS4A 1J5OA 5FRNA 2EX3A 3CFPA 1ASWA 2FBVA 5JS2A 3SJJA 3KD5E 4FJJA 1L3UA 4LSNA 4OPJA 4HUGA 4Z4FA 3ZSQA 3THVA 4EP4A 1KLNA 1CXQA 3OS1A 4FCYA 1CZ9A 4CJTA 4H4MA 2YKMA 4I9LA 3ZT3A 3ZSYA 3OYGA 1ITGA 4ID1A 4Z4HA 3MECA 3CQ8A 3SNNA 3SUQA 3LZIA 4DTSA 3V1RA 1D8YA 1B9DA 2XY8A 1JLBA 4BDZA 2HMIA 5FRMA 2BGGA 1NK7A 1LAWA 3SUPA 2G8HA 1S9EA 2A1RA 4AILC 4J2BA 1KSPA 1SL0A 2QKKA 1TKTA 5J1EA 1R0AA 2OPSA 3OJUA 3KK2A 3V1QA 4M3UA 2IGIA 4R5PA 4FLYA 4NCAA 4MQ3A 1QHTA 3EY1A 1KVAA 1XHXA 4C8MA 2A1SA 3CYMA 3WNFA 4PWDA 4CIGA 1GOAA 1SUQA 2RKIA 4FJMA 3AVLA 3LPTA 3M8RA 1B92A 4DTJA 4FLTA 4CJLA 4CGFA 4KO0A 3AA3A 4F2SA 1BIUA 1JLEA 2JLEA 2ZQBA 2XY6A 3LP2A 3TAEA 1U45A 4CCHA 3ZT0A 2HHUA 1LWFA 2YNGA 3QEPA 1IKXA 3P1GA 2F8TA 1Z26A 2DFEA 4CJSA 2YHAA 4CK2A 4GW6A 1TAQA 3NHGA 5J2NA 4CIFA 3KLHA 3MEDA 3AO3A 4L8RB 4ELVA 4Z4GA 4DSJA 2OZSA 1GOBA 3DRRA 4N56A 1C0UA 1C1BA 4E0DA 2OPQA 4ZTFA 3DLRA 1VRTA 2IC3A 4PQUA 3AV9A 4CJ4A 1NKEA 1DTQA 4FK2A 4F3OA 1RT2A 1KLMA 1WNSA 2YNFA 5E41A 4FLUA 3ZSXA 3JSMA 3HPGA 3HP6A 4ICLA 4B8AB 4DQQA 1N6QA 4Z0UA 5SZTA 1NK9A 4OKEA 3OYHA 2HHWA 1HYSA 3OYDA 4CIEA 1UWBA 4H4OA 2Z1GA 3AVBA 3ZSRA 3A2FA 4DQSA 4EZ6A 2O4IA 2ATQA 4KKOA 4FYDA 1TK8A 2XHBA 4O0JA 1NK4A 3U3GA 1IH7A 3NH2A 3ALYA 3OS0A 3QERA 4QCLA 4O0IA 4OGEA 2IDOA 1X9SA 2D0BA 3SZ2A 1L3SA 3LANA 4UQGA 2HVIA 3HJFA 1RBUA 4O44A 5DMRA 4FZYA 2G8FA 2D0CA 3AA5X 1WN7A 1FK9A 2Z1HA 4KI4A 1QS4A 3VQ9A 4AHVA 4ZTJA 2P51A 4CJ5A 4CEZA 4W5OA 1Q9XA 3S3MA 2HHVA 1TK0A 2YKNA 3HXMA 2VG5A 4FJGA 1CLQA 3DRPA 1TGOA 3ZSVA 4NCBA 5C42A 3K57A 2DTUA 1BCOA 5J2QA 1RT1A 5HRSA 1QSLA 1RT3A 4TSXA 1UA0A 2DFFA 2GBZA 1BI4B 1MU2A 3PX4A 2KZMA 3CFOA 4CK3A 4KPYA 4CJQA 4AH9A 4DMNA 1FKOA 4CERA 1NOZA 4KTQA 3V9XA 3AVHA 3QIOA 5K14A 4FJ5A 1TKDA 4J2DA 4HUFA 4CHQA 3OYIA 1S6QA 3L2VA 3HPOA 1RT7A 4CEEA 4ELUA 1QTMA 1KFDA 1JLCA 3CG7A 3S3OA 1NK0A 3CM5A 3NF7A 1IO2A 2D5RA 2P1JA 5C24A 4CFAA 3ISNC 1QQCA 4B9MA 4BDPA 3UIQA 2E4LA 3LPUA 4AHRA 1WSHA 3L2UA 4JRQA 4CEQA 4E7KA 5HP1A 1NJZA 3M8QA 1RCHA 1D5AA 4E7JA 5J2MA 2F96A 1NOYA 1RTDA 1BIZA 1QE1A 4N5SA 3OYCA 2Y1JA 1QSYA 1GOCA 4KFBA 4FXDA 3KLEA 3KLFA 2ITGA 4ID5A 4O4GA 4CHNA 3KKRA 4H8KA 1XC9A 3RTVA 4BWJA 4C8KA 2B4JA 3DMJA 3DI6A 4FW2A 4CGIA 2WONA 1UOCA 4CF0A 3HL8A 4KV8A 4EP5A 3NCIA 4W5NA 1WLJA 4FJKA 2QKBA 5KGWA 3V1OA 3D0PA 4OKJA 3OYLA 1HRHA 3OYJA 3F73A 4CJRA 1WAJA 2HNYA 4IBNA 3AO1A 3MXMA 2ZE2A 3OS2A 4BWMA 4DSKA 3ZT4A 5CZ1A 4IG3A 2Z1JA 2YNIA 1LWEA 4LH4A 4KTWA 1IG9A 1UAXA 3HP9A 4CK1A 3K5NA 4JRPA 1C6VA 3CM6A 5KRSA 3LDSA 3L8BA 1DLOA 3ZSZA 2PZSA 1S1TA 1TL3A 3T1AA 4CGJA 4DTRA 3SCXA 1YVUA 2X6SA 3V9SA 1VSMA 3FFIA 4DTUA 3NDKA 2BDPA 4E3SA 4Z4EA 3HK2A 4AHUA 4FM2A 4E7HA 3LAKA 1S5JA 4CHOA 3AVJA 3TAGA 2OYQA 3L3VA 1HNIA 1N5YA 1X1PA 4DU3A 4KB0A 3KIOA 3L3UA 2EHGA 4BE0A 3I8DA 1EKEA 5KRTA 3K59A 1JLQA 4I7FA 1EX4A 4CE9A 1X9WA 1KTQA 2BE2A 2HHSA 1VSEA 3K2PA 3OYFA 3PO5A 4N76A 3T19A 3KLGA 3L2RA 1L3TA 3ULDA 3CFRA 4RW4A 3QESA 1RILA 1YT3A 3DLEA 3TAMA 5KI6A 1VSDA 4RW7A 4DU1A 3RMAA 1WSEA 4M45A 4CF2A 4HCCA 4HCBA 4CF8A 4FLZA 1ZYQA 5CZ2A 4DSLA 4F4KA 3QEWA 2WOMA 3AVAA 4M3RA 2LSNA 1HJRA 2HVHA 3AA4A 3QO9A 1WSIA 4DLEA 3HSTB 3NE6A 4DSFA 2W42A 1T03A 1NK6A 3RR7A 3SI6A 2KFNA 3F9KA 3WNGA 1WAFA 3NF6A 4OGCA 1RBSA 3C6UA 3WNEA 3HO1A 3QIPA 2OA8A 3AVFA 3KLIA 1LWCA 2RPIA 1VSHA 1RTHA 3JYTA 2Y1IA 1HQEA 4E1MA 1XHZA 4CJPA 3K58A 1NJWA 2GUIA 2Z1IA 5KGXA 3SV3A 1BCMA 4KI6A 1VSIA 3AO2A 3VQPA 3C6TA 3KK3A 2QK9A 5CYMA 2XRIA 2NUBA 1JL1A 1HMVA 4CGHA 3D45A 3KJVA 1A5WA 2IS3A 1SL2A 4K8ZA 4OLBA 3AA2A 3DLKA 3LZJA
chains in the Genus database with same CATH superfamily
1S1XA 3RMDA 4DTMA 1NGAA 4NB4A 4CD1A 4FZXC 2NRTA 4BACA 3O80A 2ETJA 1RDAA 4CZFA 3DOKA 5BN9A 2RN2A 3M8PA 2Q0RA 4CW7B 5AQNA 3VQCA 3R9PA 4B3OA 4FWQA 3LL3A 4YDUC 3BDPA 1RDCA 1QZ6A 1GLLO 1TK5A 3RRGA 3MK6A 4KREA 3GE1A 4CECA 4IOXA 1SKSA 3GDQA 1QSSA 2PYLA 1ZBFA 4AM6A 3CCLN 3QBXA 1C0MA 3TTFA 3TAPA 1KXPA 2HW3A 1VQMN 3VPZA 4G1QA 3V4IA 2WBNA 3SBTA 1Z05A 1D9FA 1EO1A 1U6ZA 4F3TA 1XNRK 4IDKA 4CEDA 5TKYA 3K5LA 4AHSA 3DLBA 4L3QA 1ZXOA 1KRPA 4JHDB 4GVMA 3WXMB 4RG8A 3SUOA 3PX6A 2FF3B 1IKYA 1C0FA 4OVLA 3VQ6A 5CY4A 4B9UA 4FJNA 3VOVA 3MDQA 3MAQA 1OKJA 2V52B 2HHQA 3MEEA 3O1WA 4K8XA 1YTAA 1U47A 3M3ZA 3LAMA 4JI0K 4CJEA 5AZIA 5KPZA 1ASVA 3CIPA 5FPEA 5AFUA 3TI0A 4DTXA 4DTOA 3QFPA 3EN9A 4B08A 3H08A 3JXUA 4FM1A 1MDUB 4MDAA 3L6QA 4DF8A 3VQEA 4FPBA 1M1KO 4JKEA 1VQ8N 4LF9K 2P9KB 3BF1A 2PFUA 1YJWN 1C0TA 5LY3A 2P5OA 4M3XA 4YNQA 1Q81O 1TAUA 3UKUB 3FZKA 4KRFA 2RF2A 3T3FA 1BA0A 3ZSWA 5LJWA 1NK8A 4Q0BA 1K8KA 3WQUA 4FJIA 4CJKA 3WNHA 4I6MB 3TTCA 3TARA 3C95A 3GOIA 3VN5A 2NLXA 1BHLA 3VEXA 2E2OA 3I55N 3L2QA 1VQ4N 3J8AA 3E9OA 4C8LA 1VSJA 4LC9B 3U3YA 2IVPA 1CXUA 1NGBA 3ID8A 4CEFA 2JGUA 3Q7BA 4DFJA 3HT3A 2D1KA 3TANA 4BR9A 1T05A 3O3FA 1U04A 4K41A 1NJYA 4H5NA 1VK0A 3TTDA 3CQYA 2ZJPL 4FW1A 4YOVA 3B6OA 4CJ3A 5C2DA 4M3ZA 4J2AA 1JCFA 4KHYA 4M7YA 3LM2A 4DTPA 2E5LK 3OYAA 3AY9A 1LW0A 4KHSA 2X6NA 2GV9A 1BO5O 3A5MC 3VF4A 1YXQA 4YHHK 3SBGA 1T8EA 4Y0WA 3KWIA 2PYJA 4BY9C 2GWJA 5I3UA 4XH5A 4KHPK 3QNOA 2E8AA 5ADXA 3IRXA 4NCGA 1XNQK 4CZJA 4DFMA 1W2BM 3E1YA 3VQ7A 5EU7A 4A57A 4DHYA 4JI7K 4B9SA 4FWSA 2GTDA 4EZ9A 4EIAA 5DK5A 5EX5A 1RDBA 2QWOA 4PA1A 3SUNA 2UXBK 4LD0A 3CJAA 4CEAA 3ZT1A 3HPHA 5AQJA 3OYKA 3ZT2A 3J81O 5LJVA 2WC9A 4CF1A 2YHBA 4YDUA 2HBJA 3ENOA 4G9ZA 4Z4FA 3ZLJA 4BRQA 3ZSQA 3THVA 1CXQA 4XH1A 2QWQA 2J4RA 4I9LA 3ZT3A 1N8RO 4CZGA 3CQ8A 3SUQA 3V1RA 2XY8A 1JLBA 3O8MA 5GINA 2G8HA 1KAZA 2QKKA 4LF8K 5J1EA 2OPSA 3V1QA 4M3UA 2YI1A 4H5TA 4R5PA 4NCAA 5E84A 3FZMA 2A1SA 3CYMA 4C8MA 2P9KA 4WYBA 1GOAA 2O8CB 3AVLA 1S22A 4DTJA 1BIUA 1JLEA 1LWFA 3UKUA 4CJSA 2UUAK 4CK2A 1D4XA 4GW6A 3JS6A 3NHGA 3VETA 3CCRN 4ILHA 4IEIA 4PKIA 4N56A 4YOTA 4LFCK 2OPQA 5AZJB 3DLRA 1VRTA 1HKGA 4F3OA 4FWKA 2YNFA 2I7NA 3TSPA 4FLUA 1RDWX 4B8AB 4DQQA 1XC3A 4B1YB 1HYSA 4CIEA 4H4OA 3PLAA 4JKAA 4DQSA 2PAVA 3N4PA 4EZ6A 3J80O 3C6HA 3U8XA 4KKOA 4DB3A 3CF5L 3A5OC 4JI2K 2IVOA 4BC5A 3O9SA 3VEWA 2GEMA 3ALYA 3NH2A 3QERA 2YJEA 3CPEA 4UQGA 3HJFA 4ISGA 5DMRA 1ZC6A 4KI4A 3VQ9A 2FXUA 4ZTJA 2HHVA 4CEZA 1EWRA 1NGDA 4H5WA 1OH8A 5HRSA 2GBZA 4V19S 3PX4A 3CCJN 4CJQA 4AH9A 3VF6A 1NOZA 5K14A 3PIOL 3JAMO 1TKDA 3BY5A 1S6QA 3HPOA 5AQLA 1W97L 1KFDA 1JLCA 3CG7A 5F0XA 3S3OA 3OBYA 3WXJA 1IO2A 2D5RA 5HOOA 2OCEA 4EAHD 2VGNA 2E4LA 3L2UA 4AHRA 4E7KA 4CEQA 3MWPA 3M8QA 5J2MA 1NJZA 4N5SA 3ZETB 2I7PA 3OYCA 1NLVA 3HM8A 1QSYA 1WB9A 4OX9K 3EEQA 2UXCK 1XUPO 4H8KA 5B8HA 1XC9A 3RTVA 2B4JA 3DMJA 4DV2K 1Q7YO 2WFBA 2WUSA 3HL8A 5BRHA 5KGWA 3D0PA 4DV0K 5FPNA 3AO1A 1T44A 3MXMA 3UE5A 2OTJN 2CGKA 4K0KK 5FPDA 2Z1JA 1LWEA 4KTWA 4BR4A 4CK1A 3K5NA 1C6VA 5KRSA 5C12A 4M63C 1TL3A 1YVUA 3V9SA 1VQLN 3FFIA 3LM9A 4DTUA 2BDPA 5AQFA 3TAGA 2OYQA 2YHWA 1Y64A 3KIOA 3L3UA 4O5FA 3M5RA 4BE0A 5KRTA 4K42A 4H0OA 3L4IA 1YVNA 1KTQA 4B3RK 4KH6A 3OYFA 5AQPA 3T19A 1L3TA 3ULDA 3CFRA 1N33K 4RW4A 1RILA 1YT3A 4DU1A 3RMAA 1VSDA 1WSEA 4CF2A 4HCCA 3ULEB 4H0XB 5HL7L 4CF8A 4DSLA 1WOQA 4BR7A 1NG9A 1SS6A 1HR0K 1NK6A 3NE6A 2W42A 3RR7A 1IJJA 1TUYA 3WNGA 5LMUK 1WAFA 3DXMA 3THYA 2OA8A 3AVFA 2RPIA 1VSHA 1RTHA 5A2QO 2QI2A 1XHZA 3DXKB 5ELZA 3S41A 1NJWA 2GUIA 5KGXA 3AO2A 3C6TA 4CGHA 2NUBA 3N4QA 1I94K 3AA2A 2UUCK 3DLKA 4E19A 1E3MA 4E1NA 4ZHRA 4KHQA 4HTUA 4C8NA 3ZCMA 5HBMA 3CCSN 2B6AA 3SQ0A 3DRSA 3HYFA 3MWTA 1U2VB 4KB1A 3U4LA 2HB5A 1R59O 1BUPA 1ZBLA 4C23A 5KTQA 3BGRA 1J53A 1RTIA 3LALA 4OJRA 2O8DA 3F2KA 2D4WA 3MN5A 1E4GT 4OO1J 2FC0A 4B9QA 5KQDA 3QINA 3HVRA 2VWJA 1J54A 4JI4K 1K6YA 1RFQA 1VSFA 3I33A 1RT6A 3OYBA 5M1OA 4CJVA 1IBMK 5AQVA 1NWKA 1XMOK 4WCEL 2OPPA 4IWVA 5HRRA 3DWLA 4FWPA 1SV5A 3OJSA 4FJ8A 3VGLA 4A2BA 2G8UA 2P9LB 4CEBA 1VQ5N 4BRLA 3DYAA 2O8EB 3ASMA 5EY4A 3R8EA 1Y97A 1RTJA 1IG8A 4PUOA 3PX0A 2O8FB 5JVGL 2G8VA 1U48A 1WBBA 3P39A 4DV6K 5M1QA 1S1WA 1HYVA 2NRRA 2UYTA 4RCHA 1GLFO 4IKFA 1EXQA 3CQXA 3L2WA 3TPQA 2NRWA 4BRNA 2BTFA 4NO7A 1ATSA 4F8RA 1BISA 5JLHA 3QETA 4U7BA 2E2NA 4ISFA 1QVFM 3CPWM 4K43A 4CGGA 3CCUN 4E7LA 3OYMA 3NVKA 3NGYA 4BE2A 4B1WB 1W9HA 4B8CA 4UY8O 4JS5A 1VSKA 1TKXA 5H1SQ 2KQ2A 3MXIA 3HM9A 5JLFA 1C1AA 3V9ZA 2E6LA 5AR0A 3KTQA 4HVJA 1FKPA 5FPMA 1EETA 3HBTA 2VWKA 4JK9A 3A5NC 1BGXT 2PBDA 4E7IA 1TV6A 3H3NO 4QOZB 4EFHA 4DQRA 4O5BA 4DS5A 1HUXA 4YOXA 1M90O 1JL2A 1BL3A 1RDDA 2VCPA 3MN6A 1WSFA 1ZBHA 4E89A 2OPRA 1DTTA 4MDBA 1Q8IA 3TSUA 1HYZA 3MXJA 3O4QA 3VEZA 4M42A 1LAVA 1GLDG 3AVGA 4PKHA 3EZ5A 2GWKA 1Q82O 4O8UA 4F2RA 1JJ2M 3C0BA 5AFUH 3C94A 2B5JA 4AF1A 4MO5A 2YNHA 2AP1A 4KH4A 3SAHA 3AO5A 2KLAA 4DR1K 1YIJN 2IAJA 4GV3A 4FZZA 5SWMA 1EP4A 2P9IB 3CCMN 3D2EB 4CFDA 3MN7A 2QWLA 2A3ZA 4KHUA 1I3AA 4DTNA 4JN4A 3IG1A 1NKBA 1JLAA 4JKHA 4RW6A 3CD6N 3VMFB 5FLXO 3O9TA 1ZBUA 3THWB 2G8KA 4DCHA 2JWKA 1UA1A 4NLBA 2XY5A 1REVA 2NNWA 5GIOA 4JLHA 1KFSA 3C7NB 2KHOA 4KTZA 4M3TA 3DLGA 4FK0A 1J9AA 4CFBA 3BEXA 1RT5A 1N36K 4OKKA 4DWIA 2KTQA 5KQ8A 1D9DA 1C0GA 3VQDA 2O8FA 5CYQA 4FJXA 4B1XB 3VESA 4IFEA 1B9FA 2FBYA 2P9PA 4CJWA 5FRNA 1Q86O 4FJJA 5JS2A 3SJJA 4H0TB 1L3UA 4LSNA 4HWIA 4HUGA 3FE1A 3OS1A 1HX1A 3H1QA 4CJTA 3FFKB 4H4MA 3OYGA 1ITGA 3LZIA 4DTSA 1D8YA 4C1NK 2HMIA 4BDZA 1NK7A 3EO3A 1LAWA 1S9EA 1KSPA 1SL0A 4B3MK 1TKTA 3SK3A 2YHXA 1TUUA 4H0PA 1KVAA 5ADXH 1XHXA 2GX9A 3M8RA 1B92A 4CJLA 4CGFA 2XY6A 1U45A 1H1VA 3ZT0A 2HHUA 3WXIA 3CC7N 1IKXA 5CHIA 2DFEA 5AQTA 2QWPA 3ZEUB 1TAQA 5J2NA 3VGKA 3KLHA 4Z4GA 4DSJA 1YTUA 2IC3A 1OVQA 3PIPL 5AQHA 3AGKA 1DTQA 1RT2A 3DLLL 3K9JA 3JSMA 1N6QA 4Z0UA 5SZTA 1NK9A 4CZMA 3ZX0A 3VF2A 4A59A 1UWBA 4GKJK 3QDKA 4FO0A 3AVBA 3EKSA 3ZSRA 3CC4N 2ATQA 2RHKA 4FYDA 1TK8A 2XHBA 1IH7A 4BGAA 2IDOA 1NGJA 5LMNK 2CH6A 1L3SA 2HVIA 4EHUA 3VEVA 1YUWA 1HLUA 1WN7A 4E1JA 4AHVA 1Q9XA 2P51A 1OH6A 2P9NB 2F4VK 2YKNA 3HXMA 4FJGA 3K9KA 3LDNA 4JKDA 3K57A 2P9IA 3D2EA 3WXLA 3J7AP 4DR7K 1MU2A 3OHRA 4IO8A 3G4SN 3CFOA 1FKOA 2VYPA 4CERA 3V9XA 3AVHA 3QIOA 5BRFA 1SQKA 1T3VA 4FJ5A 4J2DA 3BZKA 3OYIA 3L2VA 4CEEA 4M7XA 1NK0A 3NMUA 3T69A 2NRZA 3AGRA 2P1JA 5C24A 4CFAA 4JHDA 4B9MA 1VAZA 4BDPA 3LPUA 4JRQA 4FVUA 4CJ7A 1QE1A 3T1YK 5GADP 1OH5A 4FXDA 3KLEA 2HF4A 1WUAA 2P9SB 3KLFA 3EE8A 1HPMA 4C8KA 4CGIA 2WONA 4EP5A 1WLJA 4IDHA 4FJKA 4DR4K 3ENBA 2QKBA 4GV6A 4HTLA 3F73A 5DM7L 2UU9K 4JKGB 3OS2A 1OVYA 3E66A 4IG3A 3IUCA 1IG9A 1UAXA 3HP9A 3CM6A 3L8BA 4E0DA 4B3TK 1DLOA 4OPHA 3HTVA 5AQIA 1VSMA 3FZLA 3SJHA 2QWRA 3HK2A 4E7HA 1N34K 3VEOA 5BPNA 2Q97A 4DV1K 1QVGM 3R1XA 3K59A 4I7FA 4CE9A 4H0VB 2BE2A 5M1PA 1JCGA 4N76A 3KLGA 3L2RA 5IWAK 2QM1A 3TAMA 5KI6A 2WTUA 4RW7A 3VERA 2AA4A 4LF4K 3QEWA 3WEEB 2IVNA 4M3RA 2LSNA 1HJRA 3QO9A 4I6MA 4CI6A 1NGIA 2KFNA 3SI6A 3CCQN 2Q31A 2BUPA 3IFRA 1P90A 3JYTA 4E1MA 1BU6O 2Z1IA 1W7AA 1RGIA 1BCMA 2QK9A 4BRDA 3HOSA 2XRIA 4OLBA 2IS3A 2E20A 1BG3A 1VQKN 5BR8K 5GAHP 3RMCA 1HNWK 5JICA 1WSGA 5IT9O 2UXDK 4GMJB 4FLXA 1VHXA 3VGMA 3ID6A 1J5EK 1DT9A 3W3DA 1FXXA 3P5JA 1MWMA 3T1HK 3NGZA 3SPZA 3Q7CA 2A42A 2HNDA 4FJ7A 1QQNA 4IJNA 2Q3SA 4M41A 3AVKA 2W6LA 1NMDA 1WSJA 4NLCA 5AQQA 1G15A 4BRAA 1YJNN 1KVBA 3OVNA 1DEJA 3LP1A 2V51B 3WUHA 4B9TA 3VQAA 4FWLA 3K0SA 2VGMA 3SPYA 3TWHA 1JLFA 4H5RA 4Y1DA 2HSTA 4GVEA 1SKWA 4CJFA 3TAFA 3RWUA 4YFUA 3CJ7A 1ASUA 1JXEA 4CESA 3OTOK 2A6AA 4MO4A 3NH1A 1VQ7N 3CJ1A 3EYZA 1GLAG 4DSIA 1ZBIA 1LW2A 5BREA 3IAYA 4LY7A 3SQ2A 2O4GA 4WE1A 4JI1K 1SKRA 3NFAA 3AVNA 1HJOA 2ZD1A 4LSLA 5DM6L 3O9RA 4CFCA 4WFNL 3O08A 3A5LC 4QS9A 2HBKA 4JKGA 5J2PA 3V9WA 4O8KA 5C0YA 1VSLA 3TAQA 1GLBG 1JCEA 3LP0A 1Z25A 5GIPA 5FROA 1TYQB 2DPNA 1E4FT 4O55A 3O5BA 5AQOA 1S6PA 4Z4IA 5I42A 1U49A 1J6ZA 3VEYA 4BC2A 2ZM6K 5D3GA 2O8CA 4H0YB 3SYZA 4DF4A 3E01A 1KAXA 2A40A 3NF8A 3KK7A 2F8SA 1QHAA 3A0IX 1RNHA 2QXFA 2KW4A 5I9EB 2G8WA 1IKVA 1BQMA 2ZWHA 2CGLA 3WEEA 1KVCA 1X9JA 3AVCA 5AZJA 1YITN 1G99A 1X3MA 4DR2K 2ITMA 2FF6A 3M8SA 3BF3A 2V7ZA 4WQ5C 1TL1A 5KPTA 4AQYK 3MCPA 2NRHA 1U4BA 3DLHA 3D2FB 4FLWA 3IDHA 1W0HA 3QBWA 1RDUA 3P4IA 1DKGD 3UB5A 4Q5VA 3GL1A 4YOYA 4MLEA 4BRKA 1S72N 4J2EA 3HI0A 5HRNA 2QW9A 3CC2N 1X3NA 4JI3K 3VQ8A 3NAEA 3U6FA 1NJIO 3FZHA 4CEOA 4KHNA 3PUFA 3PY8A 2HMPA 2V7YA 4C8OA 1XI1A 1X9MA 3SAFA 5AQZA 1IV0A 1SL1A 4GKKK 3F9MA 2DFHA 2FBTA 3HOTA 1C1CA 3R3LA 4M3WA 3C6AA 1NGCA 4DQIA 4CGDA 4DG1A 4A61A 3K5MA 2ASOA 1V4TA 3PO4A 3G0ZA 5C2FA 4LFAK 4RW9A 3LP3A 3KKSA 4DLGA 1BOTO 2QXLA 4BQLA 2OZMA 4BC4A 3AVMA 3ZSOA 4B3SK 3KD1E 3PV8A 3ZETA 4RW8A 4CBXA 4N41A 4OPKA 3G10A 3KVGA 3H6EA 3SV4A 3B6PA 3T7ZA 3EL2A 1NJXA 4CF9A 3S9HA 2JWLA 4JEPA 4QAGA 1IKWA 4IG0A 5HLFA 4BR0A 1T6DA 3P31A 3NGIA 3VA0A 1L3VA 3PSFA 3KWGA 3VQQA 1TVRA 4JKBA 1XWLA 4FM0A 3OW2M 2FSNA 4DR5K 3QEIA 3QLHA 1IBLK 2R7YA 4DUYK 5CE3A 4JS4A 1J5OA 2E1ZA 2EX3A 3BP8A 4IXCA 3CFPA 4JV5K 1ASWA 3CJBA 1ZBSA 4JKFA 3A8YA 1VQ6N 1TYQA 4BRGA 3AARA 4EP4A 3RSEB 1KLNA 3AAQA 4FCYA 1K8AO 3EE9A 2YKMA 4DKWA 4NXMK 4Z4HA 3G6EN 3MECA 2OTLN 1IBKK 1B9DA 1NM1A 1NNEA 1N32K 3SUPA 3ZYYX 2A1RA 4AILC 5AZIB 1QZ5A 5AQMA 3I56N 3OJUA 4R79A 3KK2A 4XEIA 3AAPA 2IGIA 3MN9A 4FLYA 4MQ3A 3EY1A 3ULEA 2BH1A 4PWDA 4CIGA 3KHYA 4BG9A 3H3OB 4KO0A 4Z94A 2JLEA 4CCHA 3LP2A 5EXWA 3QEPA 3P1GA 2F8TA 3DXKA 3L4QA 2NZTA 3ZX2A 4L8RB 2OZSA 3DRRA 5BPLA 3O9UA 4PQUA 2W40A 4CJ4A 4YOUA 3CMEN 4FK2A 1WNSA 5E41A 1KAYA 3ZSXA 4ICLA 4A62A 4OKEA 3SMSA 3OYHA 2HHWA 3MCAB 2Q1NA 3OYDA 3BUZB 1U2VA 2Z1GA 1LOTB 3A2FA 4JAXA 1NK4A 2HF3A 3U3GA 4QCLA 4O0IA 1HKCA 3SZ2A 1RBUA 4FZYA 2D0CA 1GLEG 3AA5X 4BRHA 4W5OA 4BROA 3S3MA 3IMXA 3CJ9A 3CCEN 1CLQA 5M1FA 1BDGA 3DRPA 4BRIA 5J2QA 1RT1A 4TSXA 1UA0A 2CH5A 1BI4B 2KZMA 4IJAA 4JI5K 1V4SA 4CZHA 4HUFA 4CHQA 5KPRA 1RT7A 1QTMA 3NF7A 4WQ5A 1QQCA 1WSHA 2E2QA 5HP1A 1RCHA 1BA1A 1D5AA 3SLCA 2F96A 5LL6Z 1SAZA 4BQZA 4F9OA 1RTDA 1FJGK 3NVMA 2P9LA 4RTFD 2O8EA 1GOCA 4ID5A 4O4GA 3KKRA 3EKUA 4X66K 3DI6A 4CF0A 4FWRA 4KV8A 4W5NA 3V1OA 4OKJA 1HRHA 1DGKN 3OYJA 4YY3K 1Z6RA 4BWMA 4DSKA 3ZT4A 1ATRA 1MWKA 4LH4A 4JRPA 1SZ2A 4JI6K 3LDSA 2PZSA 4CGJA 3SCXA 4DR6K 5MLCQ 3RSEA 3I8BA 2ZJRL 4FM2A 3LAKA 3VTIA 1KD1O 4DUZK 1HNIA 3P38A 3VTHA 1N5YA 4CD3A 4KB0A 3I8DA 1EKEA 1JLQA 4FPAA 1ATNA 4LF6K 2F9TA 2HHSA 1VSEA 3K2PA 1HKBA 4YORA 4A5BA 3QESA 3DLEA 4IOAL 4M45A 4JI8K 2VQEK 4HCBA 4FLZA 1NGHA 1NU0A 1ZYQA 3M1FA 4IOCL 4KBOA 5BN8A 3AA4A 4DLEA 1T03A 3F9KA 3E9PA 4OGCA 1RBSA 4FOIA 3HO1A 3QIPA 4J8FA 1LWCA 4IO9L 1HQEA 3MX2A 4GNIA 4KI6A 1VSIA 2HBMA 1SL2A 1A5WA 3O6WA 2RE2A 3OY9A 1VRUA 1BQNA 4BR5A 4JYAK 1RBVA 2KFZA 3HVTA 3KZBA 4OLAA 2IOCA 4ISEA 4FWOA 4A5AA 3GBTA 3VQBA 1KQSM 3VA3A 2VG7A 2ZGYA 1RT4A 4IFYA 4IZ9A 4C1NI 4X62K 4W5RA 2DY4A 2W41A 1O1WA 4KAZA 3FLCO 3MX5A 1CZBA 4H5VA 3DM2A 3QNNA 5F2RA 3V9UA 4FVMA 3LWMA 3RMBA 1A5XA 3UKRB 1BI4A 3C65A 4BRFA 4W5QA 2X74A 3SQ1A 1XMQK 2ZF5O 3THWA 1HPZA 4B9LA 1P8ZA 4DU4A 4DSEA 1F21A 3O4WA 3C7NA 5JS1A 4B1VA 1GLCG 5C15A 3O3HA 1ILYA 4Z4CA 4FL9A 1A5VA 2G8IA 3WXKA 1KC8O 4DR3K 4PL8A 4IEEA 1HNZK 3CJCA 4CJUA 3NBPA 1OH7A 3KK1A 3SQ4A 1T7PA 3J7YP 5HROA 4I2PA 1Q18A 3TR8A 4FJ9A 2O8BB 2IIRA 4DV5K 4B1ZA 2E6MA 4B9NA 3K5OA 3VQ4A 1GLJO 4JKCA 2E2PA 2QEXN 4NYFA 2ASPA 4BE1A 4PY5A 4XH4A 3M6GA 4BVPA 1LV5A 5JMVA 2KZZA 4QS7A 2BANA 3BZCA 5BRDA 4PL7A 4EHTA 3VQ5A 4CHPA 1BWFO 1JKHA 4I2QA 2P5GA 4HUEA 4BVOA 1S1VA 4DQPA 1K73O 3DOLA 3SAGA 5T7BA 4AHTA 1NK5A 4BRCA 3TSQA 4DV3K 5AQKA 2GELA 3ZEUA 1YJ9N 1NGGA 5AQRA 4B9VA 3R6MA 3P83D 1Q9YA 2UUBK 4JK8A 4H03B 2XY7A 4CZKA 5AJ3K 3W0LA 5EVZA 3F5TA 3V6DA 4M3YA 3ITHA 3O4NA 4BDYA 4FLVA 5FDLA 3DXMB 3THYB 1L5UA 3OYEA 3V81A 2F9WA 3AVIA 3LDOA 2QTDA 5TKWA 1EQYA 3RR8A 3E9LA 1FW6A 1JXBA 3LDPA 3PSIA 4GV9A 5AQGA 3U9ZA 1NMNA 4KHWA 5C25A 2A5XA 5M1KA 1RBTA 4JD2B 2VG6A 4LF7K 5AQXA 2FSJA 1S9GA 2HHTA 5M1NA 2P9NA 4CZLA 1WBDA 2XO7A 4U67L 1JLGA 2F7TA 4FK4A 3ZX3A 2HNZA 1KCFA 4XIUA 3O3GA 1HNVA 4DFKA 1I39A 2I5JA 4FJLA 2FBXA 3O1BA 3OBWA 4N47A 2FSKA 3IS9A 4ELTA 4I9QA 3UKRA 2PY5A 4W5TA 4AHCA 2O8DB 2ZGZA 3H46O 3RRHA 4LH5A 3I0SA 3SMPA 4LF5K 5HRPA 2W6KA 3QEVA 2H3GX 1NKCA 4DS4A 4CZEA 4IFVA 2X78A 4MFBA 1S1UA 4NYNA 4Y1CA 4ILJA 2P9SA 2AJQA 1VQ9N 4AM7A 1RBRA 4BC3A 3MEGA 2EWSA 3NF9A 4MLHA 4WQ4C 3U9DA 5F1XA 2Q0UA 4CHYA 1YI2N 2NRVA 3CETA 3OYNA 3AO4A 4CHZA 4HHTA 3TABA 3QB0A 1TKZA 3I0RA 3FR0A 4DFPA 1S3XA 2VQFK 2YV0X 3S3NA 3NH0A 3LWLA 2D0AA 2P9UB 1XQSC 1HQUA 3QEXA 4FJHA 2O8BA 2HBLA 2VWBA 3KD5E 2FBVA 4BRMA 4OPJA 3CERA 1CZ9A 3MMVA 3ZSYA 1VQNN 4ID1A 3WQTA 3SNNA 2A41A 5FRMA 2BGGA 4BGBA 4LFBK 2HHHK 4J2BA 1R0AA 3THXB 2HOEA 3FGUA 3LDLA 4JNEA 4ILGB 1QHTA 4DQ8A 1YF5L 3WNFA 3G25A 1SUQA 1CZAN 2RKIA 4FJMA 3H1VX 3LPTA 4DV4K 4RWTA 4FLTA 3AA3A 2OANA 2E88A 2ZQBA 3HZ6A 3TAEA 2FLOA 2YNGA 1Z26A 2YHAA 3EZWA 4CZIA 4PHTX 2Q36A 4CIFA 1LCUA 3MEDA 3AO3A 4ELVA 3OA9A 1GOBA 1C0UA 1C1BA 2KKZA 5EOYA 4ZTFA 3AV9A 1NKEA 2CGJA 1KLMA 2Q2RA 4KH5A 3HPGA 3HP6A 1YHQN 4NXNK 3QICA 3DJCA 4FSVA 5GAGP 2O4IA 1NBWA 4O0JA 4X64K 4JD2A 4BG8A 3OS0A 4OGEA 3CMAN 1X9SA 2D0BA 3LANA 3FZFA 4O44A 1YAGA 2G8FA 2GUPA 1FK9A 2Z1HA 2YX6A 2E1YA 1QS4A 2QWNA 4CJ5A 3CI5A 1TK0A 5CR4A 2VG5A 4FWNA 3IKMA 1TGOA 3ZSVA 4NCBA 5C42A 4WF9L 2DTUA 2ASMA 1BCOA 1QSLA 1RT3A 1VQPN 2DFFA 3D6RA 4CBWA 3D7EO 5AQUA 4CK3A 5AQSA 4KPYA 3GG4A 4DMNA 1QQOA 1ESVA 1MA9B 4KTQA 3CHWA 5BR9A 4B1UB 4X65K 1K9MO 4ELUA 3ATUA 1VQON 3CM5A 2QA4N 5C10A 3ISNC 3UIQA 5GAEP 3B8AX 4E7JA 1NOYA 5BPMA 1BIZA 4QS8A 1NGFA 2Y1JA 4KFBA 2ITGA 1NGEA 4FWMA 4CHNA 4BWJA 2ZJQL 4FW2A 3ATVA 1UOCA 4BR2A 2D0PA 3NCIA 3RVCA 4DV7K 3TU5A 3CCVN 3OYLA 4CVNE 3O9QA 4BREA 1WAJA 2HNYA 4IBNA 4CJRA 4WFBL 4BRPA 2ZE2A 2P9UA 5CZ1A 2YNIA 4A2AA 2HHXA 3ZSZA 1S1TA 3HSCA 3T1AA 4DTRA 1QQMA 2X6SA 5AQWA 2P9PB 3NDKA 4Z4EA 4E3SA 4AHUA 4WFAL 1S5JA 4CHOA 3AVJA 2YJFA 4K25A 3HRGA 4YOWA 3L3VA 1X1PA 4DU3A 3VENA 2EHGA 2YCHA 4GY2B 3THXA 1EX4A 1X9WA 2YHYA 4CBUA 1O13A 2D0OA 5AQYA 3PO5A 3DAWA 3WT0A 5JVHL 4OPAA 5CZ2A 4F4KA 3CXCM 2WOMA 3AVAA 3ENHA 4WQ4A 2QWMA 2HVHA 1EWQA 1T6CA 3QFUA 4JK7A 1WSIA 4DSFA 3HSTB 2NRXA 3D2FA 4FOEA 3WNEA 3NF6A 1HNXK 3C6UA 4F2SA 3KLIA 1K8KB 2Y1IA 3H45C 3LDQA 4CJPA 3J7ZO 3G71N 3K58A 5E26A 3SV3A 3QMLA 3VQPA 4PKGA 3KK3A 5CYMA 3L0QA 1JL1A 1HMVA 3KJVA 4K8ZA 3D45A 3LZJA
chains in the Genus database with same CATH topology
1S1XA 3RMDA 3OY9A 4DTMA 3RMCA 1VRUA 1BQNA 4E19A 1WSGA 4GMJB 1RBVA 4E1NA 4FLXA 4FZXC 4ZHRA 4KHQA 2KFZA 4BACA 3HVTA 4OLAA 4HTUA 2IOCA 1FXXA 4C8NA 3ZCMA 5HBMA 2ETJA 3P5JA 1RDAA 2B6AA 3DOKA 3SQ0A 2RN2A 3DRSA 3HYFA 3M8PA 3NGZA 4KB1A 2HB5A 3VQBA 3SPZA 3VQCA 2VG7A 3VA3A 1RT4A 4IFYA 1ZBLA 5KTQA 4W5RA 4B3OA 2DY4A 2HNDA 3BGRA 4FJ7A 1O1WA 4KAZA 1J53A 3BDPA 1CZBA 2Q3SA 1RTIA 3DM2A 1RDCA 3AVKA 3LALA 4OJRA 4M41A 3QNNA 1TK5A 3RRGA 4KREA 4CECA 1SKSA 1WSJA 3V9UA 1QSSA 4FVMA 1G15A 2PYLA 1ZBFA 3LWMA 3RMBA 1A5XA 1KVBA 1C0MA 3OVNA 2FC0A 3LP1A 1BI4A 3TAPA 4B9TA 3QINA 4W5QA 3VQAA 2X74A 3SQ1A 2HW3A 3HVRA 4G1QA 3SPYA 2VWJA 3V4IA 3TWHA 1JLFA 4Y1DA 1HPZA 1J54A 4B9LA 1D9FA 1SKWA 1K6YA 4CJFA 4DU4A 3TAFA 4DSEA 1F21A 4YFUA 3RWUA 1VSFA 4F3TA 1ASUA 1RT6A 4IDKA 4CEDA 5JS1A 1JXEA 3K5LA 4AHSA 3OYBA 4CESA 3DLBA 4CJVA 3NH1A 3EYZA 3O3HA 2OPPA 5HRRA 4Z4CA 1KRPA 1SV5A 4DSIA 3OJSA 1A5VA 2G8IA 4FJ8A 4GVMA 1ZBIA 1LW2A 3IAYA 4RG8A 3SUOA 4LY7A 3SQ2A 2G8UA 3PX6A 4CEBA 3DYAA 2O4GA 4WE1A 1SKRA 4CJUA 3NFAA 3ASMA 3AVNA 1IKYA 4LSLA 2ZD1A 3NBPA 4CFCA 4OVLA 3VQ6A 3KK1A 3SQ4A 1Y97A 1RTJA 1T7PA 4PUOA 5CY4A 3PX0A 5J2PA 5HROA 4I2PA 4B9UA 4FJNA 3V9WA 1VSLA 3TR8A 4FJ9A 3MAQA 3TAQA 1U48A 2G8VA 2HHQA 3MEEA 1S1WA 3LP0A 4K8XA 1Z25A 1HYVA 1YTAA 2HHXA 2E6MA 4B9NA 1U47A 5FROA 3K5OA 3VQ4A 3LAMA 4IKFA 1EXQA 4CJEA 4NYFA 3L2WA 4BE1A 4PY5A 4O55A 1ASVA 1LV5A 2KZZA 2BANA 1S6PA 4Z4IA 5I42A 1U49A 3TI0A 4DTXA 3VQ5A 4CHPA 4DTOA 4F8RA 1BISA 1JKHA 4I2QA 4B08A 3QETA 2P5GA 3H08A 4HUEA 5D3GA 4FM1A 4CGGA 4E7LA 3OYMA 3SYZA 4DF4A 3NGYA 4BE2A 4DF8A 1W9HA 1S1VA 3VQEA 4B8CA 4DQPA 3E01A 3DOLA 3NF8A 5T7BA 1VSKA 1TKXA 4JS5A 2KQ2A 3MXIA 4AHTA 1NK5A 3HM9A 2F8SA 1C1AA 3V9ZA 2E6LA 1RNHA 2QXFA 3KTQA 2KW4A 1C0TA 4HVJA 2G8WA 2P5OA 1FKPA 1IKVA 1BQMA 4B9VA 3P83D 1EETA 4M3XA 4YNQA 2VWKA 1KVCA 1Q9YA 1TAUA 2XY7A 3AVCA 4KRFA 1BGXT 2RF2A 3T3FA 4E7IA 1TV6A 3ZSWA 4QOZB 1NK8A 3M8SA 4DQRA 4O5BA 4Q0BA 4DS5A 4FJIA 1TL1A 4CJKA 3V6DA 1JL2A 4M3YA 3WNHA 3ITHA 1U4BA 3TARA 1BL3A 1RDDA 3O4NA 4BDYA 4FLWA 3DLHA 3C95A 4FLVA 1WSFA 5FDLA 1L5UA 1W0HA 3VN5A 1ZBHA 3OYEA 1BHLA 3V81A 3AVIA 3L2QA 4E89A 2OPRA 4Q5VA 1DTTA 1VSJA 4C8LA 3U3YA 3RR8A 1Q8IA 1CXUA 4J2EA 1JXBA 4CEFA 2JGUA 5HRNA 1HYZA 3MXJA 3O4QA 4M42A 1LAVA 4KHWA 3VQ8A 5C25A 3NAEA 4DFJA 3U6FA 4CEOA 3AVGA 1YTUA 3EZ5A 4KHNA 1RBTA 3PUFA 3HT3A 2VG6A 4F2RA 3TANA 3PY8A 1S9GA 1T05A 2HHTA 3O3FA 1U04A 4C8OA 1XI1A 1NJYA 1X9MA 1VK0A 3C94A 2XO7A 2B5JA 1JLGA 1SL1A 4FK4A 2DFHA 1KCFA 2HNZA 2YNHA 4FW1A 3B6OA 2FBTA 1HNVA 4XIUA 3AO5A 3O3GA 1I39A 4CJ3A 4DFKA 1C1CA 2I5JA 4M3ZA 4J2AA 4FJLA 2FBXA 4M3WA 4KHYA 4N47A 2IAJA 4FZZA 4DQIA 3IS9A 5SWMA 4CGDA 1EP4A 4DG1A 4DTPA 4ELTA 4I9QA 2PY5A 4W5TA 4CFDA 3K5MA 4AHCA 4KHUA 3OYAA 3PO4A 1LW0A 4KHSA 2X6NA 3G0ZA 2GV9A 3RRHA 4LH5A 3I0SA 4RW9A 1I3AA 5HRPA 4DTNA 3IG1A 1NKBA 3QEVA 1T8EA 3LP3A 1JLAA 3KKSA 1NKCA 2PYJA 4DLGA 4DS4A 4RW6A 4IFVA 5I3UA 2OZMA 3AVMA 3ZSOA 2X78A 3KD1E 3QNOA 4MFBA 1S1UA 3IRXA 4NYNA 3PV8A 4Y1CA 1ZBUA 4NCGA 4RW8A 4N41A 4DFMA 2G8KA 3VQ7A 4OPKA 3G10A 1UA1A 2XY5A 3SV4A 3B6PA 5EU7A 1REVA 1NJXA 2AJQA 4CF9A 4JLHA 3S9HA 4B9SA 1KFSA 1RBRA 3MEGA 3NF9A 4EZ9A 4CHYA 4QAGA 1IKWA 5DK5A 4IG0A 5HLFA 4KTZA 3NGIA 4M3TA 3OYNA 1RDBA 3DLGA 3VA0A 1L3VA 4PA1A 3AO4A 4CHZA 1J9AA 4HHTA 4LD0A 3TABA 3VQQA 3SUNA 4FK0A 1TKZA 4CFBA 3I0RA 1TVRA 1RT5A 4CEAA 4OKKA 3ZT1A 4DWIA 1XWLA 4DFPA 3HPHA 4FM0A 1D9DA 2KTQA 3OYKA 3ZT2A 3VQDA 2YV0X 5CYQA 3S3NA 3NH0A 3LWLA 4FJXA 2D0AA 3QEIA 3QLHA 4CF1A 1HQUA 1B9FA 2FBYA 2YHBA 2R7YA 4CJWA 3QEXA 4FJHA 4JS4A 1J5OA 5FRNA 2EX3A 3CFPA 1ASWA 2FBVA 5JS2A 3SJJA 3KD5E 4FJJA 1L3UA 4LSNA 4OPJA 4HUGA 4Z4FA 3ZSQA 3THVA 4EP4A 1KLNA 1CXQA 3OS1A 4FCYA 1CZ9A 4CJTA 4H4MA 2YKMA 4I9LA 3ZT3A 3ZSYA 3OYGA 1ITGA 4ID1A 4Z4HA 3MECA 3CQ8A 3SNNA 3SUQA 3LZIA 4DTSA 3V1RA 1D8YA 1B9DA 2XY8A 1JLBA 4BDZA 2HMIA 5FRMA 2BGGA 1NK7A 1LAWA 3SUPA 2G8HA 1S9EA 2A1RA 4AILC 4J2BA 1KSPA 1SL0A 2QKKA 1TKTA 5J1EA 1R0AA 2OPSA 3OJUA 3KK2A 3V1QA 4M3UA 2IGIA 4R5PA 4FLYA 4NCAA 4MQ3A 1QHTA 3EY1A 1KVAA 1XHXA 4C8MA 2A1SA 3CYMA 3WNFA 4PWDA 4CIGA 1GOAA 1SUQA 2RKIA 4FJMA 3AVLA 3LPTA 3M8RA 1B92A 4DTJA 4FLTA 4CJLA 4CGFA 4KO0A 3AA3A 4F2SA 1BIUA 1JLEA 2JLEA 2ZQBA 2XY6A 3LP2A 3TAEA 1U45A 4CCHA 3ZT0A 2HHUA 1LWFA 2YNGA 3QEPA 1IKXA 3P1GA 2F8TA 1Z26A 2DFEA 4CJSA 2YHAA 4CK2A 4GW6A 1TAQA 3NHGA 5J2NA 4CIFA 3KLHA 3MEDA 3AO3A 4L8RB 4ELVA 4Z4GA 4DSJA 2OZSA 1GOBA 3DRRA 4N56A 1C0UA 1C1BA 4E0DA 2OPQA 4ZTFA 3DLRA 1VRTA 2IC3A 4PQUA 3AV9A 4CJ4A 1NKEA 1DTQA 4FK2A 4F3OA 1RT2A 1KLMA 1WNSA 2YNFA 5E41A 4FLUA 3ZSXA 3JSMA 3HPGA 3HP6A 4ICLA 4B8AB 4DQQA 1N6QA 4Z0UA 5SZTA 1NK9A 4OKEA 3OYHA 2HHWA 1HYSA 3OYDA 4CIEA 1UWBA 4H4OA 2Z1GA 3AVBA 3ZSRA 3A2FA 4DQSA 4EZ6A 2O4IA 2ATQA 4KKOA 4FYDA 1TK8A 2XHBA 4O0JA 1NK4A 3U3GA 1IH7A 3NH2A 3ALYA 3OS0A 3QERA 4QCLA 4O0IA 4OGEA 2IDOA 1X9SA 2D0BA 3SZ2A 1L3SA 3LANA 4UQGA 2HVIA 3HJFA 1RBUA 4O44A 5DMRA 4FZYA 2G8FA 2D0CA 3AA5X 1WN7A 1FK9A 2Z1HA 4KI4A 1QS4A 3VQ9A 4AHVA 4ZTJA 2P51A 4CJ5A 4CEZA 4W5OA 1Q9XA 3S3MA 2HHVA 1TK0A 2YKNA 3HXMA 2VG5A 4FJGA 1CLQA 3DRPA 1TGOA 3ZSVA 4NCBA 5C42A 3K57A 2DTUA 1BCOA 5J2QA 1RT1A 5HRSA 1QSLA 1RT3A 4TSXA 1UA0A 2DFFA 2GBZA 1BI4B 1MU2A 3PX4A 2KZMA 3CFOA 4CK3A 4KPYA 4CJQA 4AH9A 4DMNA 1FKOA 4CERA 1NOZA 4KTQA 3V9XA 3AVHA 3QIOA 5K14A 4FJ5A 1TKDA 4J2DA 4HUFA 4CHQA 3OYIA 1S6QA 3L2VA 3HPOA 1RT7A 4CEEA 4ELUA 1QTMA 1KFDA 1JLCA 3CG7A 3S3OA 1NK0A 3CM5A 3NF7A 1IO2A 2D5RA 2P1JA 5C24A 4CFAA 3ISNC 1QQCA 4B9MA 4BDPA 3UIQA 2E4LA 3LPUA 4AHRA 1WSHA 3L2UA 4JRQA 4CEQA 4E7KA 5HP1A 1NJZA 3M8QA 1RCHA 1D5AA 4E7JA 5J2MA 2F96A 1NOYA 1RTDA 1BIZA 1QE1A 4N5SA 3OYCA 2Y1JA 1QSYA 1GOCA 4KFBA 4FXDA 3KLEA 3KLFA 2ITGA 4ID5A 4O4GA 4CHNA 3KKRA 4H8KA 1XC9A 3RTVA 4BWJA 4C8KA 2B4JA 3DMJA 3DI6A 4FW2A 4CGIA 2WONA 1UOCA 4CF0A 3HL8A 4KV8A 4EP5A 3NCIA 4W5NA 1WLJA 4FJKA 2QKBA 5KGWA 3V1OA 3D0PA 4OKJA 3OYLA 1HRHA 3OYJA 3F73A 4CJRA 1WAJA 2HNYA 4IBNA 3AO1A 3MXMA 2ZE2A 3OS2A 4BWMA 4DSKA 3ZT4A 5CZ1A 4IG3A 2Z1JA 2YNIA 1LWEA 4LH4A 4KTWA 1IG9A 1UAXA 3HP9A 4CK1A 3K5NA 4JRPA 1C6VA 3CM6A 5KRSA 3LDSA 3L8BA 1DLOA 3ZSZA 2PZSA 1S1TA 1TL3A 3T1AA 4CGJA 4DTRA 3SCXA 1YVUA 2X6SA 3V9SA 1VSMA 3FFIA 4DTUA 3NDKA 2BDPA 4E3SA 4Z4EA 3HK2A 4AHUA 4FM2A 4E7HA 3LAKA 1S5JA 4CHOA 3AVJA 3TAGA 2OYQA 3L3VA 1HNIA 1N5YA 1X1PA 4DU3A 4KB0A 3KIOA 3L3UA 2EHGA 4BE0A 3I8DA 1EKEA 5KRTA 3K59A 1JLQA 4I7FA 1EX4A 4CE9A 1X9WA 1KTQA 2BE2A 2HHSA 1VSEA 3K2PA 3OYFA 3PO5A 4N76A 3T19A 3KLGA 3L2RA 1L3TA 3ULDA 3CFRA 4RW4A 3QESA 1RILA 1YT3A 3DLEA 3TAMA 5KI6A 1VSDA 4RW7A 4DU1A 3RMAA 1WSEA 4M45A 4CF2A 4HCCA 4HCBA 4CF8A 4FLZA 1ZYQA 5CZ2A 4DSLA 4F4KA 3QEWA 2WOMA 3AVAA 4M3RA 2LSNA 1HJRA 2HVHA 3AA4A 3QO9A 1WSIA 4DLEA 3HSTB 3NE6A 4DSFA 2W42A 1T03A 1NK6A 3RR7A 3SI6A 2KFNA 3F9KA 3WNGA 1WAFA 3NF6A 4OGCA 1RBSA 3C6UA 3WNEA 3HO1A 3QIPA 2OA8A 3AVFA 3KLIA 1LWCA 2RPIA 1VSHA 1RTHA 3JYTA 2Y1IA 1HQEA 4E1MA 1XHZA 4CJPA 3K58A 1NJWA 2GUIA 2Z1IA 5KGXA 3SV3A 1BCMA 4KI6A 1VSIA 3AO2A 3VQPA 3C6TA 3KK3A 2QK9A 5CYMA 2XRIA 2NUBA 1JL1A 1HMVA 4CGHA 3D45A 3KJVA 1A5WA 2IS3A 1SL2A 4K8ZA 4OLBA 3AA2A 3DLKA 3LZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1X A;  3RMD A;  3OY9 A;  4DTM A;  3RMC A;  1VRU A;  1BQN A;  4E19 A;  1WSG A;  4GMJ B;  1RBV A;  4E1N A;  4FLX A;  4FZX C;  4ZHR A;  4KHQ A;  2KFZ A;  4BAC A;  3HVT A;  4OLA A;  4HTU A;  2IOC A;  1FXX A;  4C8N A;  3ZCM A;  5HBM A;  2ETJ A;  3P5J A;  1RDA A;  2B6A A;  3DOK A;  3SQ0 A;  2RN2 A;  3DRS A;  3HYF A;  3M8P A;  3NGZ A;  4KB1 A;  2HB5 A;  3VQB A;  3SPZ A;  3VQC A;  2VG7 A;  3VA3 A;  1RT4 A;  4IFY A;  1ZBL A;  5KTQ A;  4W5R A;  4B3O A;  2DY4 A;  2HND A;  3BGR A;  4FJ7 A;  1O1W A;  4KAZ A;  1J53 A;  3BDP A;  1CZB A;  2Q3S A;  1RTI A;  3DM2 A;  1RDC A;  3AVK A;  3LAL A;  4OJR A;  4M41 A;  3QNN A;  1TK5 A;  3RRG A;  4KRE A;  4CEC A;  1SKS A;  1WSJ A;  3V9U A;  1QSS A;  4FVM A;  1G15 A;  2PYL A;  1ZBF A;  3LWM A;  3RMB A;  1A5X A;  1KVB A;  1C0M A;  3OVN A;  2FC0 A;  3LP1 A;  1BI4 A;  3TAP A;  4B9T A;  3QIN A;  4W5Q A;  3VQA A;  2X74 A;  3SQ1 A;  2HW3 A;  3HVR A;  4G1Q A;  3SPY A;  2VWJ A;  3V4I A;  3TWH A;  1JLF A;  4Y1D A;  1HPZ A;  1J54 A;  4B9L A;  1D9F A;  1SKW A;  1K6Y A;  4CJF A;  4DU4 A;  3TAF A;  4DSE A;  1F21 A;  4YFU A;  3RWU A;  1VSF A;  4F3T A;  1ASU A;  1RT6 A;  4IDK A;  4CED A;  5JS1 A;  1JXE A;  3K5L A;  4AHS A;  3OYB A;  4CES A;  3DLB A;  4CJV A;  3NH1 A;  3EYZ A;  3O3H A;  2OPP A;  5HRR A;  4Z4C A;  1KRP A;  1SV5 A;  4DSI A;  3OJS A;  1A5V A;  2G8I A;  4FJ8 A;  4GVM A;  1ZBI A;  1LW2 A;  3IAY A;  4RG8 A;  3SUO A;  4LY7 A;  3SQ2 A;  2G8U A;  3PX6 A;  4CEB A;  3DYA A;  2O4G A;  4WE1 A;  1SKR A;  4CJU A;  3NFA A;  3ASM A;  3AVN A;  1IKY A;  4LSL A;  2ZD1 A;  3NBP A;  4CFC A;  4OVL A;  3VQ6 A;  3KK1 A;  3SQ4 A;  1Y97 A;  1RTJ A;  1T7P A;  4PUO A;  5CY4 A;  3PX0 A;  5J2P A;  5HRO A;  4I2P A;  4B9U A;  4FJN A;  3V9W A;  1VSL A;  3TR8 A;  4FJ9 A;  3MAQ A;  3TAQ A;  1U48 A;  2G8V A;  2HHQ A;  3MEE A;  1S1W A;  3LP0 A;  4K8X A;  1Z25 A;  1HYV A;  1YTA A;  2HHX A;  2E6M A;  4B9N A;  1U47 A;  5FRO A;  3K5O A;  3VQ4 A;  3LAM A;  4IKF A;  1EXQ A;  4CJE A;  4NYF A;  3L2W A;  4BE1 A;  4PY5 A;  4O55 A;  1ASV A;  1LV5 A;  2KZZ A;  2BAN A;  1S6P A;  4Z4I A;  5I42 A;  1U49 A;  3TI0 A;  4DTX A;  3VQ5 A;  4CHP A;  4DTO A;  4F8R A;  1BIS A;  1JKH A;  4I2Q A;  4B08 A;  3QET A;  2P5G A;  3H08 A;  4HUE A;  5D3G A;  4FM1 A;  4CGG A;  4E7L A;  3OYM A;  3SYZ A;  4DF4 A;  3NGY A;  4BE2 A;  4DF8 A;  1W9H A;  1S1V A;  3VQE A;  4B8C A;  4DQP A;  3E01 A;  3DOL A;  3NF8 A;  5T7B A;  1VSK A;  1TKX A;  4JS5 A;  2KQ2 A;  3MXI A;  4AHT A;  1NK5 A;  3HM9 A;  2F8S A;  1C1A A;  3V9Z A;  2E6L A;  1RNH A;  2QXF A;  3KTQ A;  2KW4 A;  1C0T A;  4HVJ A;  2G8W A;  2P5O A;  1FKP A;  1IKV A;  1BQM A;  4B9V A;  3P83 D;  1EET A;  4M3X A;  4YNQ A;  2VWK A;  1KVC A;  1Q9Y A;  1TAU A;  2XY7 A;  3AVC A;  4KRF A;  1BGX T;  2RF2 A;  3T3F A;  4E7I A;  1TV6 A;  3ZSW A;  4QOZ B;  1NK8 A;  3M8S A;  4DQR A;  4O5B A;  4Q0B A;  4DS5 A;  4FJI A;  1TL1 A;  4CJK A;  3V6D A;  1JL2 A;  4M3Y A;  3WNH A;  3ITH A;  1U4B A;  3TAR A;  1BL3 A;  1RDD A;  3O4N A;  4BDY A;  4FLW A;  3DLH A;  3C95 A;  4FLV A;  1WSF A;  5FDL A;  1L5U A;  1W0H A;  3VN5 A;  1ZBH A;  3OYE A;  1BHL A;  3V81 A;  3AVI A;  3L2Q A;  4E89 A;  2OPR A;  4Q5V A;  1DTT A;  1VSJ A;  4C8L A;  3U3Y A;  3RR8 A;  1Q8I A;  1CXU A;  4J2E A;  1JXB A;  4CEF A;  2JGU A;  5HRN A;  1HYZ A;  3MXJ A;  3O4Q A;  4M42 A;  1LAV A;  4KHW A;  3VQ8 A;  5C25 A;  3NAE A;  4DFJ A;  3U6F A;  4CEO A;  3AVG A;  1YTU A;  3EZ5 A;  4KHN A;  1RBT A;  3PUF A;  3HT3 A;  2VG6 A;  4F2R A;  3TAN A;  3PY8 A;  1S9G A;  1T05 A;  2HHT A;  3O3F A;  1U04 A;  4C8O A;  1XI1 A;  1NJY A;  1X9M A;  1VK0 A;  3C94 A;  2XO7 A;  2B5J A;  1JLG A;  1SL1 A;  4FK4 A;  2DFH A;  1KCF A;  2HNZ A;  2YNH A;  4FW1 A;  3B6O A;  2FBT A;  1HNV A;  4XIU A;  3AO5 A;  3O3G A;  1I39 A;  4CJ3 A;  4DFK A;  1C1C A;  2I5J A;  4M3Z A;  4J2A A;  4FJL A;  2FBX A;  4M3W A;  4KHY A;  4N47 A;  2IAJ A;  4FZZ A;  4DQI A;  3IS9 A;  5SWM A;  4CGD A;  1EP4 A;  4DG1 A;  4DTP A;  4ELT A;  4I9Q A;  2PY5 A;  4W5T A;  4CFD A;  3K5M A;  4AHC A;  4KHU A;  3OYA A;  3PO4 A;  1LW0 A;  4KHS A;  2X6N A;  3G0Z A;  2GV9 A;  3RRH A;  4LH5 A;  3I0S A;  4RW9 A;  1I3A A;  5HRP A;  4DTN A;  3IG1 A;  1NKB A;  3QEV A;  1T8E A;  3LP3 A;  1JLA A;  3KKS A;  1NKC A;  2PYJ A;  4DLG A;  4DS4 A;  4RW6 A;  4IFV A;  5I3U A;  2OZM A;  3AVM A;  3ZSO A;  2X78 A;  3KD1 E;  3QNO A;  4MFB A;  1S1U A;  3IRX A;  4NYN A;  3PV8 A;  4Y1C A;  1ZBU A;  4NCG A;  4RW8 A;  4N41 A;  4DFM A;  2G8K A;  3VQ7 A;  4OPK A;  3G10 A;  1UA1 A;  2XY5 A;  3SV4 A;  3B6P A;  5EU7 A;  1REV A;  1NJX A;  2AJQ A;  4CF9 A;  4JLH A;  3S9H A;  4B9S A;  1KFS A;  1RBR A;  3MEG A;  3NF9 A;  4EZ9 A;  4CHY A;  4QAG A;  1IKW A;  5DK5 A;  4IG0 A;  5HLF A;  4KTZ A;  3NGI A;  4M3T A;  3OYN A;  1RDB A;  3DLG A;  3VA0 A;  1L3V A;  4PA1 A;  3AO4 A;  4CHZ A;  1J9A A;  4HHT A;  4LD0 A;  3TAB A;  3VQQ A;  3SUN A;  4FK0 A;  1TKZ A;  4CFB A;  3I0R A;  1TVR A;  1RT5 A;  4CEA A;  4OKK A;  3ZT1 A;  4DWI A;  1XWL A;  4DFP A;  3HPH A;  4FM0 A;  1D9D A;  2KTQ A;  3OYK A;  3ZT2 A;  3VQD A;  2YV0 X;  5CYQ A;  3S3N A;  3NH0 A;  3LWL A;  4FJX A;  2D0A A;  3QEI A;  3QLH A;  4CF1 A;  1HQU A;  1B9F A;  2FBY A;  2YHB A;  2R7Y A;  4CJW A;  3QEX A;  4FJH A;  4JS4 A;  1J5O A;  5FRN A;  2EX3 A;  3CFP A;  1ASW A;  2FBV A;  5JS2 A;  3SJJ A;  3KD5 E;  4FJJ A;  1L3U A;  4LSN A;  4OPJ A;  4HUG A;  4Z4F A;  3ZSQ A;  3THV A;  4EP4 A;  1KLN A;  1CXQ A;  3OS1 A;  4FCY A;  1CZ9 A;  4CJT A;  4H4M A;  2YKM A;  4I9L A;  3ZT3 A;  3ZSY A;  3OYG A;  1ITG A;  4ID1 A;  4Z4H A;  3MEC A;  3CQ8 A;  3SNN A;  3SUQ A;  3LZI A;  4DTS A;  3V1R A;  1D8Y A;  1B9D A;  2XY8 A;  1JLB A;  4BDZ A;  2HMI A;  5FRM A;  2BGG A;  1NK7 A;  1LAW A;  3SUP A;  2G8H A;  1S9E A;  2A1R A;  4AIL C;  4J2B A;  1KSP A;  1SL0 A;  2QKK A;  1TKT A;  5J1E A;  1R0A A;  2OPS A;  3OJU A;  3KK2 A;  3V1Q A;  4M3U A;  2IGI A;  4R5P A;  4FLY A;  4NCA A;  4MQ3 A;  1QHT A;  3EY1 A;  1KVA A;  1XHX A;  4C8M A;  2A1S A;  3CYM A;  3WNF A;  4PWD A;  4CIG A;  1GOA A;  1SUQ A;  2RKI A;  4FJM A;  3AVL A;  3LPT A;  3M8R A;  1B92 A;  4DTJ A;  4FLT A;  4CJL A;  4CGF A;  4KO0 A;  3AA3 A;  4F2S A;  1BIU A;  1JLE A;  2JLE A;  2ZQB A;  2XY6 A;  3LP2 A;  3TAE A;  1U45 A;  4CCH A;  3ZT0 A;  2HHU A;  1LWF A;  2YNG A;  3QEP A;  1IKX A;  3P1G A;  2F8T A;  1Z26 A;  2DFE A;  4CJS A;  2YHA A;  4CK2 A;  4GW6 A;  1TAQ A;  3NHG A;  5J2N A;  4CIF A;  3KLH A;  3MED A;  3AO3 A;  4L8R B;  4ELV A;  4Z4G A;  4DSJ A;  2OZS A;  1GOB A;  3DRR A;  4N56 A;  1C0U A;  1C1B A;  4E0D A;  2OPQ A;  4ZTF A;  3DLR A;  1VRT A;  2IC3 A;  4PQU A;  3AV9 A;  4CJ4 A;  1NKE A;  1DTQ A;  4FK2 A;  4F3O A;  1RT2 A;  1KLM A;  1WNS A;  2YNF A;  5E41 A;  4FLU A;  3ZSX A;  3JSM A;  3HPG A;  3HP6 A;  4ICL A;  4B8A B;  4DQQ A;  1N6Q A;  4Z0U A;  5SZT A;  1NK9 A;  4OKE A;  3OYH A;  2HHW A;  1HYS A;  3OYD A;  4CIE A;  1UWB A;  4H4O A;  2Z1G A;  3AVB A;  3ZSR A;  3A2F A;  4DQS A;  4EZ6 A;  2O4I A;  2ATQ A;  4KKO A;  4FYD A;  1TK8 A;  2XHB A;  4O0J A;  1NK4 A;  3U3G A;  1IH7 A;  3NH2 A;  3ALY A;  3OS0 A;  3QER A;  4QCL A;  4O0I A;  4OGE A;  2IDO A;  1X9S A;  2D0B A;  3SZ2 A;  1L3S A;  3LAN A;  4UQG A;  2HVI A;  3HJF A;  1RBU A;  4O44 A;  5DMR A;  4FZY A;  2G8F A;  2D0C A;  3AA5 X;  1WN7 A;  1FK9 A;  2Z1H A;  4KI4 A;  1QS4 A;  3VQ9 A;  4AHV A;  4ZTJ A;  2P51 A;  4CJ5 A;  4CEZ A;  4W5O A;  1Q9X A;  3S3M A;  2HHV A;  1TK0 A;  2YKN A;  3HXM A;  2VG5 A;  4FJG A;  1CLQ A;  3DRP A;  1TGO A;  3ZSV A;  4NCB A;  5C42 A;  3K57 A;  2DTU A;  1BCO A;  5J2Q A;  1RT1 A;  5HRS A;  1QSL A;  1RT3 A;  4TSX A;  1UA0 A;  2DFF A;  2GBZ A;  1BI4 B;  1MU2 A;  3PX4 A;  2KZM A;  3CFO A;  4CK3 A;  4KPY A;  4CJQ A;  4AH9 A;  4DMN A;  1FKO A;  4CER A;  1NOZ A;  4KTQ A;  3V9X A;  3AVH A;  3QIO A;  5K14 A;  4FJ5 A;  1TKD A;  4J2D A;  4HUF A;  4CHQ A;  3OYI A;  1S6Q A;  3L2V A;  3HPO A;  1RT7 A;  4CEE A;  4ELU A;  1QTM A;  1KFD A;  1JLC A;  3CG7 A;  3S3O A;  1NK0 A;  3CM5 A;  3NF7 A;  1IO2 A;  2D5R A;  2P1J A;  5C24 A;  4CFA A;  3ISN C;  1QQC A;  4B9M A;  4BDP A;  3UIQ A;  2E4L A;  3LPU A;  4AHR A;  1WSH A;  3L2U A;  4JRQ A;  4CEQ A;  4E7K A;  5HP1 A;  1NJZ A;  3M8Q A;  1RCH A;  1D5A A;  4E7J A;  5J2M A;  2F96 A;  1NOY A;  1RTD A;  1BIZ A;  1QE1 A;  4N5S A;  3OYC A;  2Y1J A;  1QSY A;  1GOC A;  4KFB A;  4FXD A;  3KLE A;  3KLF A;  2ITG A;  4ID5 A;  4O4G A;  4CHN A;  3KKR A;  4H8K A;  1XC9 A;  3RTV A;  4BWJ A;  4C8K A;  2B4J A;  3DMJ A;  3DI6 A;  4FW2 A;  4CGI A;  2WON A;  1UOC A;  4CF0 A;  3HL8 A;  4KV8 A;  4EP5 A;  3NCI A;  4W5N A;  1WLJ A;  4FJK A;  2QKB A;  5KGW A;  3V1O A;  3D0P A;  4OKJ A;  3OYL A;  1HRH A;  3OYJ A;  3F73 A;  4CJR A;  1WAJ A;  2HNY A;  4IBN A;  3AO1 A;  3MXM A;  2ZE2 A;  3OS2 A;  4BWM A;  4DSK A;  3ZT4 A;  5CZ1 A;  4IG3 A;  2Z1J A;  2YNI A;  1LWE A;  4LH4 A;  4KTW A;  1IG9 A;  1UAX A;  3HP9 A;  4CK1 A;  3K5N A;  4JRP A;  1C6V A;  3CM6 A;  5KRS A;  3LDS A;  3L8B A;  1DLO A;  3ZSZ A;  2PZS A;  1S1T A;  1TL3 A;  3T1A A;  4CGJ A;  4DTR A;  3SCX A;  1YVU A;  2X6S A;  3V9S A;  1VSM A;  3FFI A;  4DTU A;  3NDK A;  2BDP A;  4E3S A;  4Z4E A;  3HK2 A;  4AHU A;  4FM2 A;  4E7H A;  3LAK A;  1S5J A;  4CHO A;  3AVJ A;  3TAG A;  2OYQ A;  3L3V A;  1HNI A;  1N5Y A;  1X1P A;  4DU3 A;  4KB0 A;  3KIO A;  3L3U A;  2EHG A;  4BE0 A;  3I8D A;  1EKE A;  5KRT A;  3K59 A;  1JLQ A;  4I7F A;  1EX4 A;  4CE9 A;  1X9W A;  1KTQ A;  2BE2 A;  2HHS A;  1VSE A;  3K2P A;  3OYF A;  3PO5 A;  4N76 A;  3T19 A;  3KLG A;  3L2R A;  1L3T A;  3ULD A;  3CFR A;  4RW4 A;  3QES A;  1RIL A;  1YT3 A;  3DLE A;  3TAM A;  5KI6 A;  1VSD A;  4RW7 A;  4DU1 A;  3RMA A;  1WSE A;  4M45 A;  4CF2 A;  4HCC A;  4HCB A;  4CF8 A;  4FLZ A;  1ZYQ A;  5CZ2 A;  4DSL A;  4F4K A;  3QEW A;  2WOM A;  3AVA A;  4M3R A;  2LSN A;  1HJR A;  2HVH A;  3AA4 A;  3QO9 A;  1WSI A;  4DLE A;  3HST B;  3NE6 A;  4DSF A;  2W42 A;  1T03 A;  1NK6 A;  3RR7 A;  3SI6 A;  2KFN A;  3F9K A;  3WNG A;  1WAF A;  3NF6 A;  4OGC A;  1RBS A;  3C6U A;  3WNE A;  3HO1 A;  3QIP A;  2OA8 A;  3AVF A;  3KLI A;  1LWC A;  2RPI A;  1VSH A;  1RTH A;  3JYT A;  2Y1I A;  1HQE A;  4E1M A;  1XHZ A;  4CJP A;  3K58 A;  1NJW A;  2GUI A;  2Z1I A;  5KGX A;  3SV3 A;  1BCM A;  4KI6 A;  1VSI A;  3AO2 A;  3VQP A;  3C6T A;  3KK3 A;  2QK9 A;  5CYM A;  2XRI A;  2NUB A;  1JL1 A;  1HMV A;  4CGH A;  3D45 A;  3KJV A;  1A5W A;  2IS3 A;  1SL2 A;  4K8Z A;  4OLB A;  3AA2 A;  3DLK A;  3LZJ A; 
#chains in the Genus database with same CATH topology
 1S1X A;  3RMD A;  4DTM A;  1NGA A;  4NB4 A;  4CD1 A;  4FZX C;  2NRT A;  4BAC A;  3O80 A;  2ETJ A;  1RDA A;  4CZF A;  3DOK A;  5BN9 A;  2RN2 A;  3M8P A;  2Q0R A;  4CW7 B;  5AQN A;  3VQC A;  3R9P A;  4B3O A;  4FWQ A;  3LL3 A;  4YDU C;  3BDP A;  1RDC A;  1QZ6 A;  1GLL O;  1TK5 A;  3RRG A;  3MK6 A;  4KRE A;  3GE1 A;  4CEC A;  4IOX A;  1SKS A;  3GDQ A;  1QSS A;  2PYL A;  1ZBF A;  4AM6 A;  3CCL N;  3QBX A;  1C0M A;  3TTF A;  3TAP A;  1KXP A;  2HW3 A;  1VQM N;  3VPZ A;  4G1Q A;  3V4I A;  2WBN A;  3SBT A;  1Z05 A;  1D9F A;  1EO1 A;  1U6Z A;  4F3T A;  1XNR K;  4IDK A;  4CED A;  5TKY A;  3K5L A;  4AHS A;  3DLB A;  4L3Q A;  1ZXO A;  1KRP A;  4JHD B;  4GVM A;  3WXM B;  4RG8 A;  3SUO A;  3PX6 A;  2FF3 B;  1IKY A;  1C0F A;  4OVL A;  3VQ6 A;  5CY4 A;  4B9U A;  4FJN A;  3VOV A;  3MDQ A;  3MAQ A;  1OKJ A;  2V52 B;  2HHQ A;  3MEE A;  3O1W A;  4K8X A;  1YTA A;  1U47 A;  3M3Z A;  3LAM A;  4JI0 K;  4CJE A;  5AZI A;  5KPZ A;  1ASV A;  3CIP A;  5FPE A;  5AFU A;  3TI0 A;  4DTX A;  4DTO A;  3QFP A;  3EN9 A;  4B08 A;  3H08 A;  3JXU A;  4FM1 A;  1MDU B;  4MDA A;  3L6Q A;  4DF8 A;  3VQE A;  4FPB A;  1M1K O;  4JKE A;  1VQ8 N;  4LF9 K;  2P9K B;  3BF1 A;  2PFU A;  1YJW N;  1C0T A;  5LY3 A;  2P5O A;  4M3X A;  4YNQ A;  1Q81 O;  1TAU A;  3UKU B;  3FZK A;  4KRF A;  2RF2 A;  3T3F A;  1BA0 A;  3ZSW A;  5LJW A;  1NK8 A;  4Q0B A;  1K8K A;  3WQU A;  4FJI A;  4CJK A;  3WNH A;  4I6M B;  3TTC A;  3TAR A;  3C95 A;  3GOI A;  3VN5 A;  2NLX A;  1BHL A;  3VEX A;  2E2O A;  3I55 N;  3L2Q A;  1VQ4 N;  3J8A A;  3E9O A;  4C8L A;  1VSJ A;  4LC9 B;  3U3Y A;  2IVP A;  1CXU A;  1NGB A;  3ID8 A;  4CEF A;  2JGU A;  3Q7B A;  4DFJ A;  3HT3 A;  2D1K A;  3TAN A;  4BR9 A;  1T05 A;  3O3F A;  1U04 A;  4K41 A;  1NJY A;  4H5N A;  1VK0 A;  3TTD A;  3CQY A;  2ZJP L;  4FW1 A;  4YOV A;  3B6O A;  4CJ3 A;  5C2D A;  4M3Z A;  4J2A A;  1JCF A;  4KHY A;  4M7Y A;  3LM2 A;  4DTP A;  2E5L K;  3OYA A;  3AY9 A;  1LW0 A;  4KHS A;  2X6N A;  2GV9 A;  1BO5 O;  3A5M C;  3VF4 A;  1YXQ A;  4YHH K;  3SBG A;  1T8E A;  4Y0W A;  3KWI A;  2PYJ A;  4BY9 C;  2GWJ A;  5I3U A;  4XH5 A;  4KHP K;  3QNO A;  2E8A A;  5ADX A;  3IRX A;  4NCG A;  1XNQ K;  4CZJ A;  4DFM A;  1W2B M;  3E1Y A;  3VQ7 A;  5EU7 A;  4A57 A;  4DHY A;  4JI7 K;  4B9S A;  4FWS A;  2GTD A;  4EZ9 A;  4EIA A;  5DK5 A;  5EX5 A;  1RDB A;  2QWO A;  4PA1 A;  3SUN A;  2UXB K;  4LD0 A;  3CJA A;  4CEA A;  3ZT1 A;  3HPH A;  5AQJ A;  3OYK A;  3ZT2 A;  3J81 O;  5LJV A;  2WC9 A;  4CF1 A;  2YHB A;  4YDU A;  2HBJ A;  3ENO A;  4G9Z A;  4Z4F A;  3ZLJ A;  4BRQ A;  3ZSQ A;  3THV A;  1CXQ A;  4XH1 A;  2QWQ A;  2J4R A;  4I9L A;  3ZT3 A;  1N8R O;  4CZG A;  3CQ8 A;  3SUQ A;  3V1R A;  2XY8 A;  1JLB A;  3O8M A;  5GIN A;  2G8H A;  1KAZ A;  2QKK A;  4LF8 K;  5J1E A;  2OPS A;  3V1Q A;  4M3U A;  2YI1 A;  4H5T A;  4R5P A;  4NCA A;  5E84 A;  3FZM A;  2A1S A;  3CYM A;  4C8M A;  2P9K A;  4WYB A;  1GOA A;  2O8C B;  3AVL A;  1S22 A;  4DTJ A;  1BIU A;  1JLE A;  1LWF A;  3UKU A;  4CJS A;  2UUA K;  4CK2 A;  1D4X A;  4GW6 A;  3JS6 A;  3NHG A;  3VET A;  3CCR N;  4ILH A;  4IEI A;  4PKI A;  4N56 A;  4YOT A;  4LFC K;  2OPQ A;  5AZJ B;  3DLR A;  1VRT A;  1HKG A;  4F3O A;  4FWK A;  2YNF A;  2I7N A;  3TSP A;  4FLU A;  1RDW X;  4B8A B;  4DQQ A;  1XC3 A;  4B1Y B;  1HYS A;  4CIE A;  4H4O A;  3PLA A;  4JKA A;  4DQS A;  2PAV A;  3N4P A;  4EZ6 A;  3J80 O;  3C6H A;  3U8X A;  4KKO A;  4DB3 A;  3CF5 L;  3A5O C;  4JI2 K;  2IVO A;  4BC5 A;  3O9S A;  3VEW A;  2GEM A;  3ALY A;  3NH2 A;  3QER A;  2YJE A;  3CPE A;  4UQG A;  3HJF A;  4ISG A;  5DMR A;  1ZC6 A;  4KI4 A;  3VQ9 A;  2FXU A;  4ZTJ A;  2HHV A;  4CEZ A;  1EWR A;  1NGD A;  4H5W A;  1OH8 A;  5HRS A;  2GBZ A;  4V19 S;  3PX4 A;  3CCJ N;  4CJQ A;  4AH9 A;  3VF6 A;  1NOZ A;  5K14 A;  3PIO L;  3JAM O;  1TKD A;  3BY5 A;  1S6Q A;  3HPO A;  5AQL A;  1W97 L;  1KFD A;  1JLC A;  3CG7 A;  5F0X A;  3S3O A;  3OBY A;  3WXJ A;  1IO2 A;  2D5R A;  5HOO A;  2OCE A;  4EAH D;  2VGN A;  2E4L A;  3L2U A;  4AHR A;  4E7K A;  4CEQ A;  3MWP A;  3M8Q A;  5J2M A;  1NJZ A;  4N5S A;  3ZET B;  2I7P A;  3OYC A;  1NLV A;  3HM8 A;  1QSY A;  1WB9 A;  4OX9 K;  3EEQ A;  2UXC K;  1XUP O;  4H8K A;  5B8H A;  1XC9 A;  3RTV A;  2B4J A;  3DMJ A;  4DV2 K;  1Q7Y O;  2WFB A;  2WUS A;  3HL8 A;  5BRH A;  5KGW A;  3D0P A;  4DV0 K;  5FPN A;  3AO1 A;  1T44 A;  3MXM A;  3UE5 A;  2OTJ N;  2CGK A;  4K0K K;  5FPD A;  2Z1J A;  1LWE A;  4KTW A;  4BR4 A;  4CK1 A;  3K5N A;  1C6V A;  5KRS A;  5C12 A;  4M63 C;  1TL3 A;  1YVU A;  3V9S A;  1VQL N;  3FFI A;  3LM9 A;  4DTU A;  2BDP A;  5AQF A;  3TAG A;  2OYQ A;  2YHW A;  1Y64 A;  3KIO A;  3L3U A;  4O5F A;  3M5R A;  4BE0 A;  5KRT A;  4K42 A;  4H0O A;  3L4I A;  1YVN A;  1KTQ A;  4B3R K;  4KH6 A;  3OYF A;  5AQP A;  3T19 A;  1L3T A;  3ULD A;  3CFR A;  1N33 K;  4RW4 A;  1RIL A;  1YT3 A;  4DU1 A;  3RMA A;  1VSD A;  1WSE A;  4CF2 A;  4HCC A;  3ULE B;  4H0X B;  5HL7 L;  4CF8 A;  4DSL A;  1WOQ A;  4BR7 A;  1NG9 A;  1SS6 A;  1HR0 K;  1NK6 A;  3NE6 A;  2W42 A;  3RR7 A;  1IJJ A;  1TUY A;  3WNG A;  5LMU K;  1WAF A;  3DXM A;  3THY A;  2OA8 A;  3AVF A;  2RPI A;  1VSH A;  1RTH A;  5A2Q O;  2QI2 A;  1XHZ A;  3DXK B;  5ELZ A;  3S41 A;  1NJW A;  2GUI A;  5KGX A;  3AO2 A;  3C6T A;  4CGH A;  2NUB A;  3N4Q A;  1I94 K;  3AA2 A;  2UUC K;  3DLK A;  4E19 A;  1E3M A;  4E1N A;  4ZHR A;  4KHQ A;  4HTU A;  4C8N A;  3ZCM A;  5HBM A;  3CCS N;  2B6A A;  3SQ0 A;  3DRS A;  3HYF A;  3MWT A;  1U2V B;  4KB1 A;  3U4L A;  2HB5 A;  1R59 O;  1BUP A;  1ZBL A;  4C23 A;  5KTQ A;  3BGR A;  1J53 A;  1RTI A;  3LAL A;  4OJR A;  2O8D A;  3F2K A;  2D4W A;  3MN5 A;  1E4G T;  4OO1 J;  2FC0 A;  4B9Q A;  5KQD A;  3QIN A;  3HVR A;  2VWJ A;  1J54 A;  4JI4 K;  1K6Y A;  1RFQ A;  1VSF A;  3I33 A;  1RT6 A;  3OYB A;  5M1O A;  4CJV A;  1IBM K;  5AQV A;  1NWK A;  1XMO K;  4WCE L;  2OPP A;  4IWV A;  5HRR A;  3DWL A;  4FWP A;  1SV5 A;  3OJS A;  4FJ8 A;  3VGL A;  4A2B A;  2G8U A;  2P9L B;  4CEB A;  1VQ5 N;  4BRL A;  3DYA A;  2O8E B;  3ASM A;  5EY4 A;  3R8E A;  1Y97 A;  1RTJ A;  1IG8 A;  4PUO A;  3PX0 A;  2O8F B;  5JVG L;  2G8V A;  1U48 A;  1WBB A;  3P39 A;  4DV6 K;  5M1Q A;  1S1W A;  1HYV A;  2NRR A;  2UYT A;  4RCH A;  1GLF O;  4IKF A;  1EXQ A;  3CQX A;  3L2W A;  3TPQ A;  2NRW A;  4BRN A;  2BTF A;  4NO7 A;  1ATS A;  4F8R A;  1BIS A;  5JLH A;  3QET A;  4U7B A;  2E2N A;  4ISF A;  1QVF M;  3CPW M;  4K43 A;  4CGG A;  3CCU N;  4E7L A;  3OYM A;  3NVK A;  3NGY A;  4BE2 A;  4B1W B;  1W9H A;  4B8C A;  4UY8 O;  4JS5 A;  1VSK A;  1TKX A;  5H1S Q;  2KQ2 A;  3MXI A;  3HM9 A;  5JLF A;  1C1A A;  3V9Z A;  2E6L A;  5AR0 A;  3KTQ A;  4HVJ A;  1FKP A;  5FPM A;  1EET A;  3HBT A;  2VWK A;  4JK9 A;  3A5N C;  1BGX T;  2PBD A;  4E7I A;  1TV6 A;  3H3N O;  4QOZ B;  4EFH A;  4DQR A;  4O5B A;  4DS5 A;  1HUX A;  4YOX A;  1M90 O;  1JL2 A;  1BL3 A;  1RDD A;  2VCP A;  3MN6 A;  1WSF A;  1ZBH A;  4E89 A;  2OPR A;  1DTT A;  4MDB A;  1Q8I A;  3TSU A;  1HYZ A;  3MXJ A;  3O4Q A;  3VEZ A;  4M42 A;  1LAV A;  1GLD G;  3AVG A;  4PKH A;  3EZ5 A;  2GWK A;  1Q82 O;  4O8U A;  4F2R A;  1JJ2 M;  3C0B A;  5AFU H;  3C94 A;  2B5J A;  4AF1 A;  4MO5 A;  2YNH A;  2AP1 A;  4KH4 A;  3SAH A;  3AO5 A;  2KLA A;  4DR1 K;  1YIJ N;  2IAJ A;  4GV3 A;  4FZZ A;  5SWM A;  1EP4 A;  2P9I B;  3CCM N;  3D2E B;  4CFD A;  3MN7 A;  2QWL A;  2A3Z A;  4KHU A;  1I3A A;  4DTN A;  4JN4 A;  3IG1 A;  1NKB A;  1JLA A;  4JKH A;  4RW6 A;  3CD6 N;  3VMF B;  5FLX O;  3O9T A;  1ZBU A;  3THW B;  2G8K A;  4DCH A;  2JWK A;  1UA1 A;  4NLB A;  2XY5 A;  1REV A;  2NNW A;  5GIO A;  4JLH A;  1KFS A;  3C7N B;  2KHO A;  4KTZ A;  4M3T A;  3DLG A;  4FK0 A;  1J9A A;  4CFB A;  3BEX A;  1RT5 A;  1N36 K;  4OKK A;  4DWI A;  2KTQ A;  5KQ8 A;  1D9D A;  1C0G A;  3VQD A;  2O8F A;  5CYQ A;  4FJX A;  4B1X B;  3VES A;  4IFE A;  1B9F A;  2FBY A;  2P9P A;  4CJW A;  5FRN A;  1Q86 O;  4FJJ A;  5JS2 A;  3SJJ A;  4H0T B;  1L3U A;  4LSN A;  4HWI A;  4HUG A;  3FE1 A;  3OS1 A;  1HX1 A;  3H1Q A;  4CJT A;  3FFK B;  4H4M A;  3OYG A;  1ITG A;  3LZI A;  4DTS A;  1D8Y A;  4C1N K;  2HMI A;  4BDZ A;  1NK7 A;  3EO3 A;  1LAW A;  1S9E A;  1KSP A;  1SL0 A;  4B3M K;  1TKT A;  3SK3 A;  2YHX A;  1TUU A;  4H0P A;  1KVA A;  5ADX H;  1XHX A;  2GX9 A;  3M8R A;  1B92 A;  4CJL A;  4CGF A;  2XY6 A;  1U45 A;  1H1V A;  3ZT0 A;  2HHU A;  3WXI A;  3CC7 N;  1IKX A;  5CHI A;  2DFE A;  5AQT A;  2QWP A;  3ZEU B;  1TAQ A;  5J2N A;  3VGK A;  3KLH A;  4Z4G A;  4DSJ A;  1YTU A;  2IC3 A;  1OVQ A;  3PIP L;  5AQH A;  3AGK A;  1DTQ A;  1RT2 A;  3DLL L;  3K9J A;  3JSM A;  1N6Q A;  4Z0U A;  5SZT A;  1NK9 A;  4CZM A;  3ZX0 A;  3VF2 A;  4A59 A;  1UWB A;  4GKJ K;  3QDK A;  4FO0 A;  3AVB A;  3EKS A;  3ZSR A;  3CC4 N;  2ATQ A;  2RHK A;  4FYD A;  1TK8 A;  2XHB A;  1IH7 A;  4BGA A;  2IDO A;  1NGJ A;  5LMN K;  2CH6 A;  1L3S A;  2HVI A;  4EHU A;  3VEV A;  1YUW A;  1HLU A;  1WN7 A;  4E1J A;  4AHV A;  1Q9X A;  2P51 A;  1OH6 A;  2P9N B;  2F4V K;  2YKN A;  3HXM A;  4FJG A;  3K9K A;  3LDN A;  4JKD A;  3K57 A;  2P9I A;  3D2E A;  3WXL A;  3J7A P;  4DR7 K;  1MU2 A;  3OHR A;  4IO8 A;  3G4S N;  3CFO A;  1FKO A;  2VYP A;  4CER A;  3V9X A;  3AVH A;  3QIO A;  5BRF A;  1SQK A;  1T3V A;  4FJ5 A;  4J2D A;  3BZK A;  3OYI A;  3L2V A;  4CEE A;  4M7X A;  1NK0 A;  3NMU A;  3T69 A;  2NRZ A;  3AGR A;  2P1J A;  5C24 A;  4CFA A;  4JHD A;  4B9M A;  1VAZ A;  4BDP A;  3LPU A;  4JRQ A;  4FVU A;  4CJ7 A;  1QE1 A;  3T1Y K;  5GAD P;  1OH5 A;  4FXD A;  3KLE A;  2HF4 A;  1WUA A;  2P9S B;  3KLF A;  3EE8 A;  1HPM A;  4C8K A;  4CGI A;  2WON A;  4EP5 A;  1WLJ A;  4IDH A;  4FJK A;  4DR4 K;  3ENB A;  2QKB A;  4GV6 A;  4HTL A;  3F73 A;  5DM7 L;  2UU9 K;  4JKG B;  3OS2 A;  1OVY A;  3E66 A;  4IG3 A;  3IUC A;  1IG9 A;  1UAX A;  3HP9 A;  3CM6 A;  3L8B A;  4E0D A;  4B3T K;  1DLO A;  4OPH A;  3HTV A;  5AQI A;  1VSM A;  3FZL A;  3SJH A;  2QWR A;  3HK2 A;  4E7H A;  1N34 K;  3VEO A;  5BPN A;  2Q97 A;  4DV1 K;  1QVG M;  3R1X A;  3K59 A;  4I7F A;  4CE9 A;  4H0V B;  2BE2 A;  5M1P A;  1JCG A;  4N76 A;  3KLG A;  3L2R A;  5IWA K;  2QM1 A;  3TAM A;  5KI6 A;  2WTU A;  4RW7 A;  3VER A;  2AA4 A;  4LF4 K;  3QEW A;  3WEE B;  2IVN A;  4M3R A;  2LSN A;  1HJR A;  3QO9 A;  4I6M A;  4CI6 A;  1NGI A;  2KFN A;  3SI6 A;  3CCQ N;  2Q31 A;  2BUP A;  3IFR A;  1P90 A;  3JYT A;  4E1M A;  1BU6 O;  2Z1I A;  1W7A A;  1RGI A;  1BCM A;  2QK9 A;  4BRD A;  3HOS A;  2XRI A;  4OLB A;  2IS3 A;  2E20 A;  1BG3 A;  1VQK N;  5BR8 K;  5GAH P;  3RMC A;  1HNW K;  5JIC A;  1WSG A;  5IT9 O;  2UXD K;  4GMJ B;  4FLX A;  1VHX A;  3VGM A;  3ID6 A;  1J5E K;  1DT9 A;  3W3D A;  1FXX A;  3P5J A;  1MWM A;  3T1H K;  3NGZ A;  3SPZ A;  3Q7C A;  2A42 A;  2HND A;  4FJ7 A;  1QQN A;  4IJN A;  2Q3S A;  4M41 A;  3AVK A;  2W6L A;  1NMD A;  1WSJ A;  4NLC A;  5AQQ A;  1G15 A;  4BRA A;  1YJN N;  1KVB A;  3OVN A;  1DEJ A;  3LP1 A;  2V51 B;  3WUH A;  4B9T A;  3VQA A;  4FWL A;  3K0S A;  2VGM A;  3SPY A;  3TWH A;  1JLF A;  4H5R A;  4Y1D A;  2HST A;  4GVE A;  1SKW A;  4CJF A;  3TAF A;  3RWU A;  4YFU A;  3CJ7 A;  1ASU A;  1JXE A;  4CES A;  3OTO K;  2A6A A;  4MO4 A;  3NH1 A;  1VQ7 N;  3CJ1 A;  3EYZ A;  1GLA G;  4DSI A;  1ZBI A;  1LW2 A;  5BRE A;  3IAY A;  4LY7 A;  3SQ2 A;  2O4G A;  4WE1 A;  4JI1 K;  1SKR A;  3NFA A;  3AVN A;  1HJO A;  2ZD1 A;  4LSL A;  5DM6 L;  3O9R A;  4CFC A;  4WFN L;  3O08 A;  3A5L C;  4QS9 A;  2HBK A;  4JKG A;  5J2P A;  3V9W A;  4O8K A;  5C0Y A;  1VSL A;  3TAQ A;  1GLB G;  1JCE A;  3LP0 A;  1Z25 A;  5GIP A;  5FRO A;  1TYQ B;  2DPN A;  1E4F T;  4O55 A;  3O5B A;  5AQO A;  1S6P A;  4Z4I A;  5I42 A;  1U49 A;  1J6Z A;  3VEY A;  4BC2 A;  2ZM6 K;  5D3G A;  2O8C A;  4H0Y B;  3SYZ A;  4DF4 A;  3E01 A;  1KAX A;  2A40 A;  3NF8 A;  3KK7 A;  2F8S A;  1QHA A;  3A0I X;  1RNH A;  2QXF A;  2KW4 A;  5I9E B;  2G8W A;  1IKV A;  1BQM A;  2ZWH A;  2CGL A;  3WEE A;  1KVC A;  1X9J A;  3AVC A;  5AZJ A;  1YIT N;  1G99 A;  1X3M A;  4DR2 K;  2ITM A;  2FF6 A;  3M8S A;  3BF3 A;  2V7Z A;  4WQ5 C;  1TL1 A;  5KPT A;  4AQY K;  3MCP A;  2NRH A;  1U4B A;  3DLH A;  3D2F B;  4FLW A;  3IDH A;  1W0H A;  3QBW A;  1RDU A;  3P4I A;  1DKG D;  3UB5 A;  4Q5V A;  3GL1 A;  4YOY A;  4MLE A;  4BRK A;  1S72 N;  4J2E A;  3HI0 A;  5HRN A;  2QW9 A;  3CC2 N;  1X3N A;  4JI3 K;  3VQ8 A;  3NAE A;  3U6F A;  1NJI O;  3FZH A;  4CEO A;  4KHN A;  3PUF A;  3PY8 A;  2HMP A;  2V7Y A;  4C8O A;  1XI1 A;  1X9M A;  3SAF A;  5AQZ A;  1IV0 A;  1SL1 A;  4GKK K;  3F9M A;  2DFH A;  2FBT A;  3HOT A;  1C1C A;  3R3L A;  4M3W A;  3C6A A;  1NGC A;  4DQI A;  4CGD A;  4DG1 A;  4A61 A;  3K5M A;  2ASO A;  1V4T A;  3PO4 A;  3G0Z A;  5C2F A;  4LFA K;  4RW9 A;  3LP3 A;  3KKS A;  4DLG A;  1BOT O;  2QXL A;  4BQL A;  2OZM A;  4BC4 A;  3AVM A;  3ZSO A;  4B3S K;  3KD1 E;  3PV8 A;  3ZET A;  4RW8 A;  4CBX A;  4N41 A;  4OPK A;  3G10 A;  3KVG A;  3H6E A;  3SV4 A;  3B6P A;  3T7Z A;  3EL2 A;  1NJX A;  4CF9 A;  3S9H A;  2JWL A;  4JEP A;  4QAG A;  1IKW A;  4IG0 A;  5HLF A;  4BR0 A;  1T6D A;  3P31 A;  3NGI A;  3VA0 A;  1L3V A;  3PSF A;  3KWG A;  3VQQ A;  1TVR A;  4JKB A;  1XWL A;  4FM0 A;  3OW2 M;  2FSN A;  4DR5 K;  3QEI A;  3QLH A;  1IBL K;  2R7Y A;  4DUY K;  5CE3 A;  4JS4 A;  1J5O A;  2E1Z A;  2EX3 A;  3BP8 A;  4IXC A;  3CFP A;  4JV5 K;  1ASW A;  3CJB A;  1ZBS A;  4JKF A;  3A8Y A;  1VQ6 N;  1TYQ A;  4BRG A;  3AAR A;  4EP4 A;  3RSE B;  1KLN A;  3AAQ A;  4FCY A;  1K8A O;  3EE9 A;  2YKM A;  4DKW A;  4NXM K;  4Z4H A;  3G6E N;  3MEC A;  2OTL N;  1IBK K;  1B9D A;  1NM1 A;  1NNE A;  1N32 K;  3SUP A;  3ZYY X;  2A1R A;  4AIL C;  5AZI B;  1QZ5 A;  5AQM A;  3I56 N;  3OJU A;  4R79 A;  3KK2 A;  4XEI A;  3AAP A;  2IGI A;  3MN9 A;  4FLY A;  4MQ3 A;  3EY1 A;  3ULE A;  2BH1 A;  4PWD A;  4CIG A;  3KHY A;  4BG9 A;  3H3O B;  4KO0 A;  4Z94 A;  2JLE A;  4CCH A;  3LP2 A;  5EXW A;  3QEP A;  3P1G A;  2F8T A;  3DXK A;  3L4Q A;  2NZT A;  3ZX2 A;  4L8R B;  2OZS A;  3DRR A;  5BPL A;  3O9U A;  4PQU A;  2W40 A;  4CJ4 A;  4YOU A;  3CME N;  4FK2 A;  1WNS A;  5E41 A;  1KAY A;  3ZSX A;  4ICL A;  4A62 A;  4OKE A;  3SMS A;  3OYH A;  2HHW A;  3MCA B;  2Q1N A;  3OYD A;  3BUZ B;  1U2V A;  2Z1G A;  1LOT B;  3A2F A;  4JAX A;  1NK4 A;  2HF3 A;  3U3G A;  4QCL A;  4O0I A;  1HKC A;  3SZ2 A;  1RBU A;  4FZY A;  2D0C A;  1GLE G;  3AA5 X;  4BRH A;  4W5O A;  4BRO A;  3S3M A;  3IMX A;  3CJ9 A;  3CCE N;  1CLQ A;  5M1F A;  1BDG A;  3DRP A;  4BRI A;  5J2Q A;  1RT1 A;  4TSX A;  1UA0 A;  2CH5 A;  1BI4 B;  2KZM A;  4IJA A;  4JI5 K;  1V4S A;  4CZH A;  4HUF A;  4CHQ A;  5KPR A;  1RT7 A;  1QTM A;  3NF7 A;  4WQ5 A;  1QQC A;  1WSH A;  2E2Q A;  5HP1 A;  1RCH A;  1BA1 A;  1D5A A;  3SLC A;  2F96 A;  5LL6 Z;  1SAZ A;  4BQZ A;  4F9O A;  1RTD A;  1FJG K;  3NVM A;  2P9L A;  4RTF D;  2O8E A;  1GOC A;  4ID5 A;  4O4G A;  3KKR A;  3EKU A;  4X66 K;  3DI6 A;  4CF0 A;  4FWR A;  4KV8 A;  4W5N A;  3V1O A;  4OKJ A;  1HRH A;  1DGK N;  3OYJ A;  4YY3 K;  1Z6R A;  4BWM A;  4DSK A;  3ZT4 A;  1ATR A;  1MWK A;  4LH4 A;  4JRP A;  1SZ2 A;  4JI6 K;  3LDS A;  2PZS A;  4CGJ A;  3SCX A;  4DR6 K;  5MLC Q;  3RSE A;  3I8B A;  2ZJR L;  4FM2 A;  3LAK A;  3VTI A;  1KD1 O;  4DUZ K;  1HNI A;  3P38 A;  3VTH A;  1N5Y A;  4CD3 A;  4KB0 A;  3I8D A;  1EKE A;  1JLQ A;  4FPA A;  1ATN A;  4LF6 K;  2F9T A;  2HHS A;  1VSE A;  3K2P A;  1HKB A;  4YOR A;  4A5B A;  3QES A;  3DLE A;  4IOA L;  4M45 A;  4JI8 K;  2VQE K;  4HCB A;  4FLZ A;  1NGH A;  1NU0 A;  1ZYQ A;  3M1F A;  4IOC L;  4KBO A;  5BN8 A;  3AA4 A;  4DLE A;  1T03 A;  3F9K A;  3E9P A;  4OGC A;  1RBS A;  4FOI A;  3HO1 A;  3QIP A;  4J8F A;  1LWC A;  4IO9 L;  1HQE A;  3MX2 A;  4GNI A;  4KI6 A;  1VSI A;  2HBM A;  1SL2 A;  1A5W A;  3O6W A;  2RE2 A;  3OY9 A;  1VRU A;  1BQN A;  4BR5 A;  4JYA K;  1RBV A;  2KFZ A;  3HVT A;  3KZB A;  4OLA A;  2IOC A;  4ISE A;  4FWO A;  4A5A A;  3GBT A;  3VQB A;  1KQS M;  3VA3 A;  2VG7 A;  2ZGY A;  1RT4 A;  4IFY A;  4IZ9 A;  4C1N I;  4X62 K;  4W5R A;  2DY4 A;  2W41 A;  1O1W A;  4KAZ A;  3FLC O;  3MX5 A;  1CZB A;  4H5V A;  3DM2 A;  3QNN A;  5F2R A;  3V9U A;  4FVM A;  3LWM A;  3RMB A;  1A5X A;  3UKR B;  1BI4 A;  3C65 A;  4BRF A;  4W5Q A;  2X74 A;  3SQ1 A;  1XMQ K;  2ZF5 O;  3THW A;  1HPZ A;  4B9L A;  1P8Z A;  4DU4 A;  4DSE A;  1F21 A;  3O4W A;  3C7N A;  5JS1 A;  4B1V A;  1GLC G;  5C15 A;  3O3H A;  1ILY A;  4Z4C A;  4FL9 A;  1A5V A;  2G8I A;  3WXK A;  1KC8 O;  4DR3 K;  4PL8 A;  4IEE A;  1HNZ K;  3CJC A;  4CJU A;  3NBP A;  1OH7 A;  3KK1 A;  3SQ4 A;  1T7P A;  3J7Y P;  5HRO A;  4I2P A;  1Q18 A;  3TR8 A;  4FJ9 A;  2O8B B;  2IIR A;  4DV5 K;  4B1Z A;  2E6M A;  4B9N A;  3K5O A;  3VQ4 A;  1GLJ O;  4JKC A;  2E2P A;  2QEX N;  4NYF A;  2ASP A;  4BE1 A;  4PY5 A;  4XH4 A;  3M6G A;  4BVP A;  1LV5 A;  5JMV A;  2KZZ A;  4QS7 A;  2BAN A;  3BZC A;  5BRD A;  4PL7 A;  4EHT A;  3VQ5 A;  4CHP A;  1BWF O;  1JKH A;  4I2Q A;  2P5G A;  4HUE A;  4BVO A;  1S1V A;  4DQP A;  1K73 O;  3DOL A;  3SAG A;  5T7B A;  4AHT A;  1NK5 A;  4BRC A;  3TSQ A;  4DV3 K;  5AQK A;  2GEL A;  3ZEU A;  1YJ9 N;  1NGG A;  5AQR A;  4B9V A;  3R6M A;  3P83 D;  1Q9Y A;  2UUB K;  4JK8 A;  4H03 B;  2XY7 A;  4CZK A;  5AJ3 K;  3W0L A;  5EVZ A;  3F5T A;  3V6D A;  4M3Y A;  3ITH A;  3O4N A;  4BDY A;  4FLV A;  5FDL A;  3DXM B;  3THY B;  1L5U A;  3OYE A;  3V81 A;  2F9W A;  3AVI A;  3LDO A;  2QTD A;  5TKW A;  1EQY A;  3RR8 A;  3E9L A;  1FW6 A;  1JXB A;  3LDP A;  3PSI A;  4GV9 A;  5AQG A;  3U9Z A;  1NMN A;  4KHW A;  5C25 A;  2A5X A;  5M1K A;  1RBT A;  4JD2 B;  2VG6 A;  4LF7 K;  5AQX A;  2FSJ A;  1S9G A;  2HHT A;  5M1N A;  2P9N A;  4CZL A;  1WBD A;  2XO7 A;  4U67 L;  1JLG A;  2F7T A;  4FK4 A;  3ZX3 A;  2HNZ A;  1KCF A;  4XIU A;  3O3G A;  1HNV A;  4DFK A;  1I39 A;  2I5J A;  4FJL A;  2FBX A;  3O1B A;  3OBW A;  4N47 A;  2FSK A;  3IS9 A;  4ELT A;  4I9Q A;  3UKR A;  2PY5 A;  4W5T A;  4AHC A;  2O8D B;  2ZGZ A;  3H46 O;  3RRH A;  4LH5 A;  3I0S A;  3SMP A;  4LF5 K;  5HRP A;  2W6K A;  3QEV A;  2H3G X;  1NKC A;  4DS4 A;  4CZE A;  4IFV A;  2X78 A;  4MFB A;  1S1U A;  4NYN A;  4Y1C A;  4ILJ A;  2P9S A;  2AJQ A;  1VQ9 N;  4AM7 A;  1RBR A;  4BC3 A;  3MEG A;  2EWS A;  3NF9 A;  4MLH A;  4WQ4 C;  3U9D A;  5F1X A;  2Q0U A;  4CHY A;  1YI2 N;  2NRV A;  3CET A;  3OYN A;  3AO4 A;  4CHZ A;  4HHT A;  3TAB A;  3QB0 A;  1TKZ A;  3I0R A;  3FR0 A;  4DFP A;  1S3X A;  2VQF K;  2YV0 X;  3S3N A;  3NH0 A;  3LWL A;  2D0A A;  2P9U B;  1XQS C;  1HQU A;  3QEX A;  4FJH A;  2O8B A;  2HBL A;  2VWB A;  3KD5 E;  2FBV A;  4BRM A;  4OPJ A;  3CER A;  1CZ9 A;  3MMV A;  3ZSY A;  1VQN N;  4ID1 A;  3WQT A;  3SNN A;  2A41 A;  5FRM A;  2BGG A;  4BGB A;  4LFB K;  2HHH K;  4J2B A;  1R0A A;  3THX B;  2HOE A;  3FGU A;  3LDL A;  4JNE A;  4ILG B;  1QHT A;  4DQ8 A;  1YF5 L;  3WNF A;  3G25 A;  1SUQ A;  1CZA N;  2RKI A;  4FJM A;  3H1V X;  3LPT A;  4DV4 K;  4RWT A;  4FLT A;  3AA3 A;  2OAN A;  2E88 A;  2ZQB A;  3HZ6 A;  3TAE A;  2FLO A;  2YNG A;  1Z26 A;  2YHA A;  3EZW A;  4CZI A;  4PHT X;  2Q36 A;  4CIF A;  1LCU A;  3MED A;  3AO3 A;  4ELV A;  3OA9 A;  1GOB A;  1C0U A;  1C1B A;  2KKZ A;  5EOY A;  4ZTF A;  3AV9 A;  1NKE A;  2CGJ A;  1KLM A;  2Q2R A;  4KH5 A;  3HPG A;  3HP6 A;  1YHQ N;  4NXN K;  3QIC A;  3DJC A;  4FSV A;  5GAG P;  2O4I A;  1NBW A;  4O0J A;  4X64 K;  4JD2 A;  4BG8 A;  3OS0 A;  4OGE A;  3CMA N;  1X9S A;  2D0B A;  3LAN A;  3FZF A;  4O44 A;  1YAG A;  2G8F A;  2GUP A;  1FK9 A;  2Z1H A;  2YX6 A;  2E1Y A;  1QS4 A;  2QWN A;  4CJ5 A;  3CI5 A;  1TK0 A;  5CR4 A;  2VG5 A;  4FWN A;  3IKM A;  1TGO A;  3ZSV A;  4NCB A;  5C42 A;  4WF9 L;  2DTU A;  2ASM A;  1BCO A;  1QSL A;  1RT3 A;  1VQP N;  2DFF A;  3D6R A;  4CBW A;  3D7E O;  5AQU A;  4CK3 A;  5AQS A;  4KPY A;  3GG4 A;  4DMN A;  1QQO A;  1ESV A;  1MA9 B;  4KTQ A;  3CHW A;  5BR9 A;  4B1U B;  4X65 K;  1K9M O;  4ELU A;  3ATU A;  1VQO N;  3CM5 A;  2QA4 N;  5C10 A;  3ISN C;  3UIQ A;  5GAE P;  3B8A X;  4E7J A;  1NOY A;  5BPM A;  1BIZ A;  4QS8 A;  1NGF A;  2Y1J A;  4KFB A;  2ITG A;  1NGE A;  4FWM A;  4CHN A;  4BWJ A;  2ZJQ L;  4FW2 A;  3ATV A;  1UOC A;  4BR2 A;  2D0P A;  3NCI A;  3RVC A;  4DV7 K;  3TU5 A;  3CCV N;  3OYL A;  4CVN E;  3O9Q A;  4BRE A;  1WAJ A;  2HNY A;  4IBN A;  4CJR A;  4WFB L;  4BRP A;  2ZE2 A;  2P9U A;  5CZ1 A;  2YNI A;  4A2A A;  2HHX A;  3ZSZ A;  1S1T A;  3HSC A;  3T1A A;  4DTR A;  1QQM A;  2X6S A;  5AQW A;  2P9P B;  3NDK A;  4Z4E A;  4E3S A;  4AHU A;  4WFA L;  1S5J A;  4CHO A;  3AVJ A;  2YJF A;  4K25 A;  3HRG A;  4YOW A;  3L3V A;  1X1P A;  4DU3 A;  3VEN A;  2EHG A;  2YCH A;  4GY2 B;  3THX A;  1EX4 A;  1X9W A;  2YHY A;  4CBU A;  1O13 A;  2D0O A;  5AQY A;  3PO5 A;  3DAW A;  3WT0 A;  5JVH L;  4OPA A;  5CZ2 A;  4F4K A;  3CXC M;  2WOM A;  3AVA A;  3ENH A;  4WQ4 A;  2QWM A;  2HVH A;  1EWQ A;  1T6C A;  3QFU A;  4JK7 A;  1WSI A;  4DSF A;  3HST B;  2NRX A;  3D2F A;  4FOE A;  3WNE A;  3NF6 A;  1HNX K;  3C6U A;  4F2S A;  3KLI A;  1K8K B;  2Y1I A;  3H45 C;  3LDQ A;  4CJP A;  3J7Z O;  3G71 N;  3K58 A;  5E26 A;  3SV3 A;  3QML A;  3VQP A;  4PKG A;  3KK3 A;  5CYM A;  3L0Q A;  1JL1 A;  1HMV A;  3KJV A;  4K8Z A;  3D45 A;  3LZJ A; 
#chains in the Genus database with same CATH homology
 1S1X A;  3RMD A;  3OY9 A;  4DTM A;  3RMC A;  1VRU A;  1BQN A;  4E19 A;  1WSG A;  4GMJ B;  1RBV A;  4E1N A;  4FLX A;  4FZX C;  4ZHR A;  4KHQ A;  2KFZ A;  4BAC A;  3HVT A;  4OLA A;  4HTU A;  2IOC A;  1FXX A;  4C8N A;  3ZCM A;  5HBM A;  2ETJ A;  3P5J A;  1RDA A;  2B6A A;  3DOK A;  3SQ0 A;  2RN2 A;  3DRS A;  3HYF A;  3M8P A;  3NGZ A;  4KB1 A;  2HB5 A;  3VQB A;  3SPZ A;  3VQC A;  2VG7 A;  3VA3 A;  1RT4 A;  4IFY A;  1ZBL A;  5KTQ A;  4W5R A;  4B3O A;  2DY4 A;  2HND A;  3BGR A;  4FJ7 A;  1O1W A;  4KAZ A;  1J53 A;  3BDP A;  1CZB A;  2Q3S A;  1RTI A;  3DM2 A;  1RDC A;  3AVK A;  3LAL A;  4OJR A;  4M41 A;  3QNN A;  1TK5 A;  3RRG A;  4KRE A;  4CEC A;  1SKS A;  1WSJ A;  3V9U A;  1QSS A;  4FVM A;  1G15 A;  2PYL A;  1ZBF A;  3LWM A;  3RMB A;  1A5X A;  1KVB A;  1C0M A;  3OVN A;  2FC0 A;  3LP1 A;  1BI4 A;  3TAP A;  4B9T A;  3QIN A;  4W5Q A;  3VQA A;  2X74 A;  3SQ1 A;  2HW3 A;  3HVR A;  4G1Q A;  3SPY A;  2VWJ A;  3V4I A;  3TWH A;  1JLF A;  4Y1D A;  1HPZ A;  1J54 A;  4B9L A;  1D9F A;  1SKW A;  1K6Y A;  4CJF A;  4DU4 A;  3TAF A;  4DSE A;  1F21 A;  4YFU A;  3RWU A;  1VSF A;  4F3T A;  1ASU A;  1RT6 A;  4IDK A;  4CED A;  5JS1 A;  1JXE A;  3K5L A;  4AHS A;  3OYB A;  4CES A;  3DLB A;  4CJV A;  3NH1 A;  3EYZ A;  3O3H A;  2OPP A;  5HRR A;  4Z4C A;  1KRP A;  1SV5 A;  4DSI A;  3OJS A;  1A5V A;  2G8I A;  4FJ8 A;  4GVM A;  1ZBI A;  1LW2 A;  3IAY A;  4RG8 A;  3SUO A;  4LY7 A;  3SQ2 A;  2G8U A;  3PX6 A;  4CEB A;  3DYA A;  2O4G A;  4WE1 A;  1SKR A;  4CJU A;  3NFA A;  3ASM A;  3AVN A;  1IKY A;  4LSL A;  2ZD1 A;  3NBP A;  4CFC A;  4OVL A;  3VQ6 A;  3KK1 A;  3SQ4 A;  1Y97 A;  1RTJ A;  1T7P A;  4PUO A;  5CY4 A;  3PX0 A;  5J2P A;  5HRO A;  4I2P A;  4B9U A;  4FJN A;  3V9W A;  1VSL A;  3TR8 A;  4FJ9 A;  3MAQ A;  3TAQ A;  1U48 A;  2G8V A;  2HHQ A;  3MEE A;  1S1W A;  3LP0 A;  4K8X A;  1Z25 A;  1HYV A;  1YTA A;  2HHX A;  2E6M A;  4B9N A;  1U47 A;  5FRO A;  3K5O A;  3VQ4 A;  3LAM A;  4IKF A;  1EXQ A;  4CJE A;  4NYF A;  3L2W A;  4BE1 A;  4PY5 A;  4O55 A;  1ASV A;  1LV5 A;  2KZZ A;  2BAN A;  1S6P A;  4Z4I A;  5I42 A;  1U49 A;  3TI0 A;  4DTX A;  3VQ5 A;  4CHP A;  4DTO A;  4F8R A;  1BIS A;  1JKH A;  4I2Q A;  4B08 A;  3QET A;  2P5G A;  3H08 A;  4HUE A;  5D3G A;  4FM1 A;  4CGG A;  4E7L A;  3OYM A;  3SYZ A;  4DF4 A;  3NGY A;  4BE2 A;  4DF8 A;  1W9H A;  1S1V A;  3VQE A;  4B8C A;  4DQP A;  3E01 A;  3DOL A;  3NF8 A;  5T7B A;  1VSK A;  1TKX A;  4JS5 A;  2KQ2 A;  3MXI A;  4AHT A;  1NK5 A;  3HM9 A;  2F8S A;  1C1A A;  3V9Z A;  2E6L A;  1RNH A;  2QXF A;  3KTQ A;  2KW4 A;  1C0T A;  4HVJ A;  2G8W A;  2P5O A;  1FKP A;  1IKV A;  1BQM A;  4B9V A;  3P83 D;  1EET A;  4M3X A;  4YNQ A;  2VWK A;  1KVC A;  1Q9Y A;  1TAU A;  2XY7 A;  3AVC A;  4KRF A;  1BGX T;  2RF2 A;  3T3F A;  4E7I A;  1TV6 A;  3ZSW A;  4QOZ B;  1NK8 A;  3M8S A;  4DQR A;  4O5B A;  4Q0B A;  4DS5 A;  4FJI A;  1TL1 A;  4CJK A;  3V6D A;  1JL2 A;  4M3Y A;  3WNH A;  3ITH A;  1U4B A;  3TAR A;  1BL3 A;  1RDD A;  3O4N A;  4BDY A;  4FLW A;  3DLH A;  3C95 A;  4FLV A;  1WSF A;  5FDL A;  1L5U A;  1W0H A;  3VN5 A;  1ZBH A;  3OYE A;  1BHL A;  3V81 A;  3AVI A;  3L2Q A;  4E89 A;  2OPR A;  4Q5V A;  1DTT A;  1VSJ A;  4C8L A;  3U3Y A;  3RR8 A;  1Q8I A;  1CXU A;  4J2E A;  1JXB A;  4CEF A;  2JGU A;  5HRN A;  1HYZ A;  3MXJ A;  3O4Q A;  4M42 A;  1LAV A;  4KHW A;  3VQ8 A;  5C25 A;  3NAE A;  4DFJ A;  3U6F A;  4CEO A;  3AVG A;  1YTU A;  3EZ5 A;  4KHN A;  1RBT A;  3PUF A;  3HT3 A;  2VG6 A;  4F2R A;  3TAN A;  3PY8 A;  1S9G A;  1T05 A;  2HHT A;  3O3F A;  1U04 A;  4C8O A;  1XI1 A;  1NJY A;  1X9M A;  1VK0 A;  3C94 A;  2XO7 A;  2B5J A;  1JLG A;  1SL1 A;  4FK4 A;  2DFH A;  1KCF A;  2HNZ A;  2YNH A;  4FW1 A;  3B6O A;  2FBT A;  1HNV A;  4XIU A;  3AO5 A;  3O3G A;  1I39 A;  4CJ3 A;  4DFK A;  1C1C A;  2I5J A;  4M3Z A;  4J2A A;  4FJL A;  2FBX A;  4M3W A;  4KHY A;  4N47 A;  2IAJ A;  4FZZ A;  4DQI A;  3IS9 A;  5SWM A;  4CGD A;  1EP4 A;  4DG1 A;  4DTP A;  4ELT A;  4I9Q A;  2PY5 A;  4W5T A;  4CFD A;  3K5M A;  4AHC A;  4KHU A;  3OYA A;  3PO4 A;  1LW0 A;  4KHS A;  2X6N A;  3G0Z A;  2GV9 A;  3RRH A;  4LH5 A;  3I0S A;  4RW9 A;  1I3A A;  5HRP A;  4DTN A;  3IG1 A;  1NKB A;  3QEV A;  1T8E A;  3LP3 A;  1JLA A;  3KKS A;  1NKC A;  2PYJ A;  4DLG A;  4DS4 A;  4RW6 A;  4IFV A;  5I3U A;  2OZM A;  3AVM A;  3ZSO A;  2X78 A;  3KD1 E;  3QNO A;  4MFB A;  1S1U A;  3IRX A;  4NYN A;  3PV8 A;  4Y1C A;  1ZBU A;  4NCG A;  4RW8 A;  4N41 A;  4DFM A;  2G8K A;  3VQ7 A;  4OPK A;  3G10 A;  1UA1 A;  2XY5 A;  3SV4 A;  3B6P A;  5EU7 A;  1REV A;  1NJX A;  2AJQ A;  4CF9 A;  4JLH A;  3S9H A;  4B9S A;  1KFS A;  1RBR A;  3MEG A;  3NF9 A;  4EZ9 A;  4CHY A;  4QAG A;  1IKW A;  5DK5 A;  4IG0 A;  5HLF A;  4KTZ A;  3NGI A;  4M3T A;  3OYN A;  1RDB A;  3DLG A;  3VA0 A;  1L3V A;  4PA1 A;  3AO4 A;  4CHZ A;  1J9A A;  4HHT A;  4LD0 A;  3TAB A;  3VQQ A;  3SUN A;  4FK0 A;  1TKZ A;  4CFB A;  3I0R A;  1TVR A;  1RT5 A;  4CEA A;  4OKK A;  3ZT1 A;  4DWI A;  1XWL A;  4DFP A;  3HPH A;  4FM0 A;  1D9D A;  2KTQ A;  3OYK A;  3ZT2 A;  3VQD A;  2YV0 X;  5CYQ A;  3S3N A;  3NH0 A;  3LWL A;  4FJX A;  2D0A A;  3QEI A;  3QLH A;  4CF1 A;  1HQU A;  1B9F A;  2FBY A;  2YHB A;  2R7Y A;  4CJW A;  3QEX A;  4FJH A;  4JS4 A;  1J5O A;  5FRN A;  2EX3 A;  3CFP A;  1ASW A;  2FBV A;  5JS2 A;  3SJJ A;  3KD5 E;  4FJJ A;  1L3U A;  4LSN A;  4OPJ A;  4HUG A;  4Z4F A;  3ZSQ A;  3THV A;  4EP4 A;  1KLN A;  1CXQ A;  3OS1 A;  4FCY A;  1CZ9 A;  4CJT A;  4H4M A;  2YKM A;  4I9L A;  3ZT3 A;  3ZSY A;  3OYG A;  1ITG A;  4ID1 A;  4Z4H A;  3MEC A;  3CQ8 A;  3SNN A;  3SUQ A;  3LZI A;  4DTS A;  3V1R A;  1D8Y A;  1B9D A;  2XY8 A;  1JLB A;  4BDZ A;  2HMI A;  5FRM A;  2BGG A;  1NK7 A;  1LAW A;  3SUP A;  2G8H A;  1S9E A;  2A1R A;  4AIL C;  4J2B A;  1KSP A;  1SL0 A;  2QKK A;  1TKT A;  5J1E A;  1R0A A;  2OPS A;  3OJU A;  3KK2 A;  3V1Q A;  4M3U A;  2IGI A;  4R5P A;  4FLY A;  4NCA A;  4MQ3 A;  1QHT A;  3EY1 A;  1KVA A;  1XHX A;  4C8M A;  2A1S A;  3CYM A;  3WNF A;  4PWD A;  4CIG A;  1GOA A;  1SUQ A;  2RKI A;  4FJM A;  3AVL A;  3LPT A;  3M8R A;  1B92 A;  4DTJ A;  4FLT A;  4CJL A;  4CGF A;  4KO0 A;  3AA3 A;  4F2S A;  1BIU A;  1JLE A;  2JLE A;  2ZQB A;  2XY6 A;  3LP2 A;  3TAE A;  1U45 A;  4CCH A;  3ZT0 A;  2HHU A;  1LWF A;  2YNG A;  3QEP A;  1IKX A;  3P1G A;  2F8T A;  1Z26 A;  2DFE A;  4CJS A;  2YHA A;  4CK2 A;  4GW6 A;  1TAQ A;  3NHG A;  5J2N A;  4CIF A;  3KLH A;  3MED A;  3AO3 A;  4L8R B;  4ELV A;  4Z4G A;  4DSJ A;  2OZS A;  1GOB A;  3DRR A;  4N56 A;  1C0U A;  1C1B A;  4E0D A;  2OPQ A;  4ZTF A;  3DLR A;  1VRT A;  2IC3 A;  4PQU A;  3AV9 A;  4CJ4 A;  1NKE A;  1DTQ A;  4FK2 A;  4F3O A;  1RT2 A;  1KLM A;  1WNS A;  2YNF A;  5E41 A;  4FLU A;  3ZSX A;  3JSM A;  3HPG A;  3HP6 A;  4ICL A;  4B8A B;  4DQQ A;  1N6Q A;  4Z0U A;  5SZT A;  1NK9 A;  4OKE A;  3OYH A;  2HHW A;  1HYS A;  3OYD A;  4CIE A;  1UWB A;  4H4O A;  2Z1G A;  3AVB A;  3ZSR A;  3A2F A;  4DQS A;  4EZ6 A;  2O4I A;  2ATQ A;  4KKO A;  4FYD A;  1TK8 A;  2XHB A;  4O0J A;  1NK4 A;  3U3G A;  1IH7 A;  3NH2 A;  3ALY A;  3OS0 A;  3QER A;  4QCL A;  4O0I A;  4OGE A;  2IDO A;  1X9S A;  2D0B A;  3SZ2 A;  1L3S A;  3LAN A;  4UQG A;  2HVI A;  3HJF A;  1RBU A;  4O44 A;  5DMR A;  4FZY A;  2G8F A;  2D0C A;  3AA5 X;  1WN7 A;  1FK9 A;  2Z1H A;  4KI4 A;  1QS4 A;  3VQ9 A;  4AHV A;  4ZTJ A;  2P51 A;  4CJ5 A;  4CEZ A;  4W5O A;  1Q9X A;  3S3M A;  2HHV A;  1TK0 A;  2YKN A;  3HXM A;  2VG5 A;  4FJG A;  1CLQ A;  3DRP A;  1TGO A;  3ZSV A;  4NCB A;  5C42 A;  3K57 A;  2DTU A;  1BCO A;  5J2Q A;  1RT1 A;  5HRS A;  1QSL A;  1RT3 A;  4TSX A;  1UA0 A;  2DFF A;  2GBZ A;  1BI4 B;  1MU2 A;  3PX4 A;  2KZM A;  3CFO A;  4CK3 A;  4KPY A;  4CJQ A;  4AH9 A;  4DMN A;  1FKO A;  4CER A;  1NOZ A;  4KTQ A;  3V9X A;  3AVH A;  3QIO A;  5K14 A;  4FJ5 A;  1TKD A;  4J2D A;  4HUF A;  4CHQ A;  3OYI A;  1S6Q A;  3L2V A;  3HPO A;  1RT7 A;  4CEE A;  4ELU A;  1QTM A;  1KFD A;  1JLC A;  3CG7 A;  3S3O A;  1NK0 A;  3CM5 A;  3NF7 A;  1IO2 A;  2D5R A;  2P1J A;  5C24 A;  4CFA A;  3ISN C;  1QQC A;  4B9M A;  4BDP A;  3UIQ A;  2E4L A;  3LPU A;  4AHR A;  1WSH A;  3L2U A;  4JRQ A;  4CEQ A;  4E7K A;  5HP1 A;  1NJZ A;  3M8Q A;  1RCH A;  1D5A A;  4E7J A;  5J2M A;  2F96 A;  1NOY A;  1RTD A;  1BIZ A;  1QE1 A;  4N5S A;  3OYC A;  2Y1J A;  1QSY A;  1GOC A;  4KFB A;  4FXD A;  3KLE A;  3KLF A;  2ITG A;  4ID5 A;  4O4G A;  4CHN A;  3KKR A;  4H8K A;  1XC9 A;  3RTV A;  4BWJ A;  4C8K A;  2B4J A;  3DMJ A;  3DI6 A;  4FW2 A;  4CGI A;  2WON A;  1UOC A;  4CF0 A;  3HL8 A;  4KV8 A;  4EP5 A;  3NCI A;  4W5N A;  1WLJ A;  4FJK A;  2QKB A;  5KGW A;  3V1O A;  3D0P A;  4OKJ A;  3OYL A;  1HRH A;  3OYJ A;  3F73 A;  4CJR A;  1WAJ A;  2HNY A;  4IBN A;  3AO1 A;  3MXM A;  2ZE2 A;  3OS2 A;  4BWM A;  4DSK A;  3ZT4 A;  5CZ1 A;  4IG3 A;  2Z1J A;  2YNI A;  1LWE A;  4LH4 A;  4KTW A;  1IG9 A;  1UAX A;  3HP9 A;  4CK1 A;  3K5N A;  4JRP A;  1C6V A;  3CM6 A;  5KRS A;  3LDS A;  3L8B A;  1DLO A;  3ZSZ A;  2PZS A;  1S1T A;  1TL3 A;  3T1A A;  4CGJ A;  4DTR A;  3SCX A;  1YVU A;  2X6S A;  3V9S A;  1VSM A;  3FFI A;  4DTU A;  3NDK A;  2BDP A;  4E3S A;  4Z4E A;  3HK2 A;  4AHU A;  4FM2 A;  4E7H A;  3LAK A;  1S5J A;  4CHO A;  3AVJ A;  3TAG A;  2OYQ A;  3L3V A;  1HNI A;  1N5Y A;  1X1P A;  4DU3 A;  4KB0 A;  3KIO A;  3L3U A;  2EHG A;  4BE0 A;  3I8D A;  1EKE A;  5KRT A;  3K59 A;  1JLQ A;  4I7F A;  1EX4 A;  4CE9 A;  1X9W A;  1KTQ A;  2BE2 A;  2HHS A;  1VSE A;  3K2P A;  3OYF A;  3PO5 A;  4N76 A;  3T19 A;  3KLG A;  3L2R A;  1L3T A;  3ULD A;  3CFR A;  4RW4 A;  3QES A;  1RIL A;  1YT3 A;  3DLE A;  3TAM A;  5KI6 A;  1VSD A;  4RW7 A;  4DU1 A;  3RMA A;  1WSE A;  4M45 A;  4CF2 A;  4HCC A;  4HCB A;  4CF8 A;  4FLZ A;  1ZYQ A;  5CZ2 A;  4DSL A;  4F4K A;  3QEW A;  2WOM A;  3AVA A;  4M3R A;  2LSN A;  1HJR A;  2HVH A;  3AA4 A;  3QO9 A;  1WSI A;  4DLE A;  3HST B;  3NE6 A;  4DSF A;  2W42 A;  1T03 A;  1NK6 A;  3RR7 A;  3SI6 A;  2KFN A;  3F9K A;  3WNG A;  1WAF A;  3NF6 A;  4OGC A;  1RBS A;  3C6U A;  3WNE A;  3HO1 A;  3QIP A;  2OA8 A;  3AVF A;  3KLI A;  1LWC A;  2RPI A;  1VSH A;  1RTH A;  3JYT A;  2Y1I A;  1HQE A;  4E1M A;  1XHZ A;  4CJP A;  3K58 A;  1NJW A;  2GUI A;  2Z1I A;  5KGX A;  3SV3 A;  1BCM A;  4KI6 A;  1VSI A;  3AO2 A;  3VQP A;  3C6T A;  3KK3 A;  2QK9 A;  5CYM A;  2XRI A;  2NUB A;  1JL1 A;  1HMV A;  4CGH A;  3D45 A;  3KJV A;  1A5W A;  2IS3 A;  1SL2 A;  4K8Z A;  4OLB A;  3AA2 A;  3DLK A;  3LZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...