3KKRA

Crystal structure of catalytic core domain of biv integrase in crystal form i
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
GSHLWQMDNTHWNKTIIWVAVETNSGLVEAQVIPEETALQVALCILQLIQRYTVLHLHSDNGPCFTAHRIENLCKYLGITKTTGIPYNPQSQGVVERAHRDLKDRLAAYQGDCETVEAALSLALVSLNKKRGGIGGHTPYEIYLESEHTKYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of catalytic core domain of BIV integrase: implications for the interaction between integrase and target DNA
pubmed doi rcsb
source organism Bovine immunodeficiency virus
molecule tags Dna binding protein
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kkrA00
1C1BA 4BE2A 1NKEA 4O55A 1HJRA 3AVHA 2IS3A 1VK0A 3QESA 4FJLA 2GUIA 3O4QA 4CJPA 4FM0A 4BDZA 4M42A 2YNGA 3AO1A 4OGEA 3AVIA 1TKDA 1J54A 3QEPA 1D8YA 1KSPA 1L5UA 3OS2A 2HHUA 2NUBA 3OY9A 1L3SA 1LW0A 3DRPA 1RILA 4EZ9A 4ICLA 1C1AA 4FJJA 3K58A 4OLBA 3VQPA 3UIQA 1SKSA 1Q9YA 1CXUA 4B9SA 5KGWA 5E41A 4FJMA 3OYNA 1RBTA 2XRIA 2Z1JA 3LALA 3V6DA 1XC9A 4TSXA 4DG1A 3VQ8A 1KRPA 1FK9A 3U3YA 1RCHA 3AA2A 3TAGA 4FJ8A 1BCOA 2XY8A 3LP0A 4CJ4A 3F73A 4HUFA 3MEGA 4H4OA 2A1RA 1RT3A 4ELVA 1IKVA 4FJHA 1ZYQA 3HT3A 4IG0A 1Q8IA 5I42A 1KVBA 3QETA 4DLGA 3L2UA 1HNIA 1SL2A 3CFRA 1IH7A 2RPIA 1BI4A 3M8QA 3A2FA 1NK9A 1ZBHA 4CIGA 2P5GA 1NK0A 4DQRA 1U47A 1D9FA 3CM5A 3OYCA 3OYIA 4O0IA 4F8RA 1HYSA 1B9FA 1ASUA 2I5JA 1YTUA 3OYMA 4I7FA 3VQDA 1VSJA 5C42A 3NHGA 3PV8A 5CYQA 3AO3A 1VSKA 5EU7A 1RDBA 1S1XA 3TABA 3SUQA 4CEFA 4CEOA 1UWBA 1JL2A 5FRNA 1ZBLA 2BGGA 1RT4A 1S1WA 5JS2A 4JS5A 1B92A 4CK3A 4ELUA 1U4BA 1BIUA 1WSIA 2O4GA 1TL3A 3ZSZA 4FJIA 4FJXA 1KFDA 3I8DA 2YHAA 2YKNA 4GW6A 1X9WA 2OPQA 4CIEA 1S1TA 2RF2A 3CYMA 1RDDA 1TKXA 4HTUA 3K5OA 3BGRA 4KHUA 4AHUA 4M3WA 4DQPA 1TKTA 2XO7A 4KKOA 4O44A 4CJTA 3CQ8A 4FVMA 3KLEA 3MXMA 3I0RA 2ATQA 4RW8A 4KHQA 2ZE2A 3LPTA 1HMVA 2YV0X 3HYFA 3JYTA 3L8BA 1NJYA 4HVJA 4CHYA 1DLOA 3SJJA 4DF8A 1JXEA 4CEDA 3BDPA 2GV9A 1VRTA 4OKKA 5HRPA 3NBPA 3SCXA 2HNDA 1SUQA 2JGUA 5SZTA 4CIFA 2IAJA 2IOCA 5HRRA 1EKEA 3OYHA 1KLMA 4DTNA 4N41A 2D0BA 1Z25A 2QXFA 4CJWA 3MECA 2FBYA 2F8TA 1KCFA 2OPSA 1TAQA 5CYMA 3S9HA 3SUOA 4FK0A 2OPPA 2LSNA 4DSKA 2VWKA 3F9KA 5J2PA 3TI0A 4LD0A 4KV8A 1C0MA 1WSFA 3K5NA 3M8RA 1LAWA 3THVA 1WNSA 1S1UA 3ZSOA 5HRNA 1O1WA 3DLEA 1WSHA 4CF8A 3TAPA 4N76A 1UA0A 4DS4A 3CG7A 1QSYA 1LW2A 2RN2A 4CJVA 1K6YA 2Y1JA 1SKRA 1RT2A 4F2RA 2G8KA 4LH4A 1X9SA 3ZSYA 4B9NA 4J2AA 1LAVA 4CGFA 2FC0A 2OPRA 3HJFA 3PO5A 1HYVA 5J2MA 4AH9A 2HMIA 1XHZA 3B6PA 3NF9A 1X1PA 3HP6A 3NGIA 5J1EA 4E7KA 1QSSA 3LZIA 4DSIA 3NF6A 1T05A 5DMRA 3AVLA 4I2PA 1ZBUA 2WONA 3AVNA 3ISNC 1U48A 2Z1HA 3QLHA 5J2QA 1NK5A 3MXJA 4PUOA 4DQSA 1CLQA 3AA4A 2B6AA 4O4GA 2KFZA 1VSIA 1CZBA 4NCGA 3QEXA 2DY4A 3ZSRA 1T8EA 4CFDA 3KK3A 1QSLA 1BISA 5KGXA 2OYQA 4CHNA 1WSEA 1EXQA 3TAQA 3QNNA 3SQ2A 4FJNA 3NAEA 1FXXA 3PX4A 3G10A 3HP9A 2Z1GA 4AHTA 3AA3A 4CE9A 4FLZA 1DTTA 4CJEA 3S3NA 1JLBA 3LAKA 1YTAA 3T1AA 3WNHA 4FLUA 4F3OA 2OZSA 1Y97A 1BHLA 3LDSA 1TK0A 1BCMA 3KD1E 3AVGA 1VSFA 2YNFA 3K57A 4B9VA 1RBVA 1HNVA 3K2PA 1TGOA 3P5JA 4WE1A 3V9ZA 4DFJA 4Z4EA 3KLIA 4BWMA 4DS5A 4M3XA 3NGZA 3ZCMA 2HNYA 3LZJA 3V9WA 4HHTA 3QIPA 1RBUA 3ZSVA 2KTQA 4B08A 2R7YA 2G8VA 3AO5A 3DLHA 4KB1A 5CZ2A 2YNHA 4BE0A 3KKRA 3OYLA 3EYZA 2HNZA 1D5AA 1JLQA 3AVCA 3DRRA 3V9UA 4CECA 3OYFA 4ZTJA 1T03A 4J2DA 1B9DA 4JLHA 3ZT2A 4CK2A 2HHVA 4IFYA 4F3TA 4F2SA 3MEDA 2Q3SA 4QAGA 5FRMA 1KLNA 2FBTA 4ID5A 4Z4FA 4FZXC 1IO2A 1RDAA 1HQUA 3C95A 4CEBA 3AO4A 1I39A 4CGDA 4YFUA 3OYBA 4JRQA 3TANA 2HHXA 4K8XA 2HVHA 1HRHA 4HCBA 2P5OA 4HUGA 4OLAA 4ELTA 1VSLA 4CESA 2F96A 3ZT3A 1RNHA 1SV5A 3K59A 3V9XA 4KB0A 4PY5A 1Q9XA 3TAMA 4CJUA 4FXDA 2HB5A 3DMJA 5T7BA 1RT6A 4O0JA 4FJ5A 2HHSA 4DTXA 4IKFA 1VSDA 3MXIA 5FDLA 3C6TA 3O4NA 4AHCA 4BACA 3NCIA 1Z26A 4RW4A 4AHVA 1N6QA 3DLBA 3VQ6A 1BI4B 4IBNA 3KD5E 3HPHA 3QERA 3HVTA 5HLFA 1KTQA 4UQGA 2XY7A 1VSHA 3D0PA 3NF8A 1A5WA 2X78A 4CHQA 1C0UA 4FJ7A 2Z1IA 3ZT0A 2YHBA 4NYFA 4FM2A 4FJGA 3NF7A 3E01A 3IS9A 3ALYA 3SV3A 1KFSA 3OJUA 4CHOA 4N56A 4IFVA 1RBSA 1D9DA 3L3UA 4KPYA 3KLGA 1TVRA 1S9EA 5KRSA 2O4IA 3VQCA 1QQCA 1HQEA 3M8SA 4KREA 4DFMA 3SV4A 1CXQA 4CHZA 1R0AA 1RBRA 3RR8A 1IKWA 4E7HA 4PQUA 5J2NA 2E6MA 4KHNA 3AVFA 4DSFA 4L8RB 2P51A 1EP4A 4CF1A 1JKHA 4Y1CA 3MEEA 1TK5A 1L3UA 4KAZA 3AVJA 4N47A 2F8SA 4PWDA 3LP1A 1XWLA 5D3GA 5JS1A 4E7LA 3VQEA 1RTIA 4LY7A 2VG5A 4G1QA 1NOZA 3CFOA 4KO0A 1N5YA 3B6OA 3QINA 3VQ4A 2PZSA 4E3SA 1WSGA 4AHSA 4E1MA 1JLCA 4CFBA 1DTQA 3KLHA 4HCCA 4DTRA 3EZ5A 1NKBA 4DQIA 1TK8A 3AVMA 3IRXA 3AVBA 1GOBA 4B9LA 4BDYA 4E7JA 4DQQA 2Y1IA 2KZMA 4MQ3A 1SL1A 4FM1A 1BL3A 4QCLA 1NK4A 1S1VA 4B9UA 3PX0A 1RTJA 4E7IA 4FW1A 4JRPA 2BANA 4DMNA 3QEVA 4B9MA 1BQNA 3HVRA 4FLWA 3IG1A 4DTOA 3QEWA 4LSLA 3VQ7A 3OYDA 4CK1A 2AJQA 2IGIA 1U45A 1JLFA 4B8AB 4CGJA 3TAFA 1G15A 4M41A 2JLEA 4FLXA 2QK9A 4CGHA 2DFFA 4CJSA 4KTQA 3V81A 5C24A 4CGIA 3AVAA 3NH1A 4RW7A 4CFCA 3H08A 1SL0A 4FJ9A 4FK2A 2YNIA 5DK5A 4HUEA 2XY6A 1RTDA 4FK4A 4C8OA 1A5VA 4ZHRA 2D5RA 3NDKA 3ZT1A 4KTZA 4EP4A 3RMBA 3NE6A 4CJQA 4Z0UA 4MFBA 4OGCA 1TAUA 3VQ5A 2DFEA 1GOCA 1FKOA 2B5JA 1I3AA 3LAMA 4CJ3A 1JLGA 3L3VA 3HPOA 4C8LA 2KQ2A 4RW6A 3O3GA 3G0ZA 3OYJA 3LWMA 5HRSA 4OPJA 4DTMA 2VG6A 4Q5VA 3OYGA 1LV5A 1L3VA 1ASWA 4M3UA 1TKZA 1W0HA 4B9TA 2YKMA 3DLRA 2KW4A 4PA1A 4C8MA 5FROA 3V1RA 5KRTA 3MAQA 4DSEA 3SQ1A 2HHTA 4I2QA 4W5OA 4CEAA 3VQBA 4ZTFA 3KK1A 1QS4A 4B3OA 3HL8A 4OPKA 3HM9A 4W5QA 4FCYA 2P1JA 2KZZA 1UOCA 1C6VA 2QKBA 4BE1A 1SKWA 4FYDA 2E4LA 5CZ1A 4EZ6A 3OS0A 2BDPA 2HW3A 4FZYA 4DFKA 5K14A 3LP2A 2ZD1A 1KVCA 3O3FA 2X74A 1IG9A 3JSMA 3NFAA 4CHPA 4C8KA 4NCAA 3VA0A 1U04A 1T7PA 3HK2A 4GMJB 2KFNA 1BIZA 3HSTB 4GVMA 4CJFA 4JS4A 4F4KA 3SZ2A 1HYZA 3V9SA 4Z4IA 4M3ZA 4CEZA 4XIUA 3FFIA 3M8PA 4CF2A 4FLVA 1TL1A 4RW9A 4E89A 1ASVA 4Z4HA 3SPZA 4NCBA 3SUPA 5HP1A 1U49A 3PY8A 3NH2A 4KTWA 5KTQA 4DFPA 3TARA 1WAJA 2FBXA 4DLEA 3SUNA 1J9AA 3DLKA 1C0TA 3TWHA 4CGGA 3KKSA 4DTJA 3WNEA 4CEQA 2RKIA 4M3RA 1YVUA 2XHBA 1JLEA 3ZSWA 4E19A 3OJSA 3VQ9A 3SQ4A 1RT1A 1W9HA 1YT3A 2HHWA 5CY4A 4CJRA 1UAXA 4OJRA 3ZSQA 4RG8A 3ZSXA 4KHWA 2HHQA 4KI4A 3DM2A 4DTPA 3DLGA 3VQQA 1LWEA 4I9LA 4J2BA 3V1QA 3PO4A 3ULDA 2PYLA 3K5LA 3SI6A 1NOYA 3HO1A 2W42A 3KTQA 1XI1A 1ITGA 2OA8A 4Z4GA 4AILC 2G8WA 1XHXA 2B4JA 4DTSA 3T3FA 3AA5X 3TR8A 3HXMA 3RMCA 1ZBFA 2EHGA 1L3TA 4DSJA 4M3YA 3QO9A 4O5BA 5HBMA 1RDCA 3L2VA 3VA3A 3EY1A 1JL1A 2G8FA 4CJKA 1F21A 4FJKA 1ZBIA 4M3TA 4W5RA 3TAEA 1KVAA 3ZT4A 3KLFA 3U3GA 4CFAA 1QE1A 1VRUA 2ZQBA 3V1OA 2IDOA 3NH0A 4OKEA 3QIOA 3K5MA 3RMDA 4DSLA 1S9GA 4AHRA 3L2RA 3AV9A 4M45A 4E0DA 4KHYA 4CJ5A 4DU1A 2DFHA 4DU3A 1EETA 3S3OA 2HVIA 4KFBA 1NK6A 2D0CA 2DTUA 3PUFA 2VG7A 3PX6A 1A5XA 4CCHA 1QTMA 4KRFA 4K8ZA 2A1SA 3ITHA 1TV6A 2G8HA 4C8NA 4DTUA 3HPGA 3P83D 4YNQA 3L2WA 1IKYA 4FW2A 3OYKA 1JLAA 1UA1A 2G8UA 2PYJA 1NJXA 4Q0BA 4N5SA 1LWCA 3KIOA 3WNGA 4W5NA 3CM6A 2BE2A 2XY5A 1BQMA 3D45A 4LSNA 4DF4A 1WSJA 2IC3A 3I0SA 3LANA 1EX4A 4W5TA 1MU2A 5C25A 4DWIA 3RTVA 3RR7A 2GBZA 5KI6A 2QKKA 1S6QA 3IAYA 1J53A 3SQ0A 4EP5A 4OKJA 3VQAA 3OYEA 4R5PA 2G8IA 1CZ9A 1QHTA 2X6SA 4CJLA 2X6NA 3RRGA 4FLYA 2PY5A 4BDPA 1WLJA 3DRSA 1RTHA 3OVNA 2ETJA 1VSMA 3AO2A 3LWLA 4B8CA 1WN7A 3QNOA 4LH5A 3RRHA 3SPYA 1RT7A 1WAFA 2ITGA 3DYAA 4ID1A 3OS1A 3WNFA 2VWJA 5HROA 3S3MA 4J2EA 4IG3A 1FKPA 3QEIA 4KI6A 1LWFA 4BWJA 1J5OA 4CEEA 1VSEA 3VN5A 4E1NA 3O3HA 1IKXA 1NK7A 3OYAA 1NJWA 5SWMA 1NJZA 4QOZB 1S5JA 3T19A 1BGXT 2EX3A 4KHSA 3U6FA 2D0AA 3SNNA 2E6LA 4FLTA 4CF9A 4Z4CA 3V4IA 3CFPA 4Y1DA 3C94A 4CERA 3DOLA 1NKCA 3DOKA 3SYZA 4I9QA 4OVLA 3LPUA 1C1CA 3LP3A 4H4MA 3KJVA 1JXBA 2FBVA 3ASMA 4DU4A 1RT5A 3RMAA 3AVKA 3NGYA 1NK8A 1X9MA 3C6UA 3L2QA 1HPZA 3DI6A 4NYNA 3P1GA 1S6PA 4H8KA 2WOMA 5I3UA 3RWUA 1GOAA 1REVA 4FZZA 2OZMA 3KK2A 4CF0A 4IDKA
chains in the Genus database with same CATH superfamily
4CZKA 4BE2A 4IO8A 4FJLA 2IS3A 3CCRN 2GUIA 2CGLA 2ZWHA 3AVIA 3A8YA 4A57A 2HHUA 2NUBA 1L3SA 1LW0A 3M1FA 2QXLA 4A2BA 2KLAA 4ICLA 5AQVA 4WFAL 4DB3A 3TSUA 3UIQA 1QQMA 4OLBA 1OH7A 3K9JA 1CXUA 4FJMA 2O8EA 2XRIA 3V6DA 3THWA 4DG1A 3TAGA 1RCHA 4CJ4A 4H4OA 3TTCA 2A1RA 4NXNK 4K0KK 1IKVA 1ZYQA 3HT3A 5I42A 1DT9A 4MLHA 5JICA 1YIJN 5F0XA 4CIGA 4JAXA 3CM5A 1HYSA 4O0IA 1B9FA 3OYMA 1VQ7N 3VQDA 1VSJA 3PV8A 2WBNA 1Z6RA 1RDBA 4FPBA 5FRNA 1RT4A 4JS5A 1B92A 4YDUC 4JI4K 2E8AA 1I94K 2P9SB 5TKYA 1RDDA 3BGRA 1Q7YO 1JJ2M 4IDHA 1SQKA 2XO7A 4CJTA 3CQ8A 3KLEA 3I0RA 2ATQA 3LPTA 4J8FA 4K43A 4CIFA 4GV6A 1KLMA 3TU5A 3MECA 1KCFA 2A40A 5CYMA 3S9HA 4DSKA 3H46O 3ZX0A 1E4GT 4AF1A 4KV8A 1C0MA 1LAWA 3CETA 3THVA 5HRNA 1O1WA 1YJWN 3HBTA 4FWSA 5IT9O 3NMUA 1QSYA 4CJVA 3P39A 2Y1JA 1K73O 4KHPK 4J2AA 4B9NA 4MO5A 4IEEA 2OPRA 3PO5A 1HYVA 4WF9L 5J2MA 1X1PA 3NGIA 5J1EA 1GLAG 3I8BA 4C1NI 3UKRB 3K0SA 3ENOA 3NF6A 1T05A 4I2PA 1ZBUA 2A6AA 3DXMB 3NVKA 1NK5A 1HNZK 3QBXA 4KBOA 4PUOA 3F9MA 2KFZA 2E2OA 2UXDK 1GLLO 4HTLA 4NCGA 3QFPA 3KK3A 3ATUA 1EWRA 4CHNA 1EXQA 4DKWA 4FJNA 3PX4A 2P9IB 2IIRA 2Z1GA 3HP9A 4M63C 4AHTA 2GWKA 3AA3A 4FLZA 3BF1A 4MLEA 1JLBA 2OZSA 3H1VX 3TTDA 1TK0A 3LDSA 1BCMA 2YNFA 3K57A 1R59O 3SBGA 5M1QA 4WE1A 3SLCA 4Z4EA 4BWMA 4DS5A 4M3XA 3ZCMA 3LZJA 3ZSVA 4B08A 1VHXA 2R7YA 5CZ2A 4QS8A 1ATNA 5AQHA 4J2DA 4LF5K 2HHVA 4F2SA 2Q3SA 4OPHA 4QAGA 4ID5A 5M1OA 1RDAA 4JRQA 1IG8A 4NLBA 2HHXA 2QWLA 4BR0A 5BPNA 2W6LA 4EIAA 1Q9XA 4CJUA 5ADXH 4FXDA 2HB5A 2O8DA 3BUZB 1OH6A 3ZLJA 5KPZA 3CJ1A 3MX2A 4IOAL 4FWPA 5FDLA 3UKUA 3BZKA 1T44A 1Z26A 4RW4A 4BREA 3VQ6A 4IBNA 4BRNA 4CZEA 2XY7A 1VSHA 2A41A 1C0UA 4PKGA 2Z1IA 3ZT0A 4FM2A 4FJGA 2O8FA 3HRGA 4N56A 1D9DA 1GLFO 4JD2B 3DLLL 1YHQN 3MCAB 2UYTA 1E4FT 1QQCA 4ISEA 3M8SA 4KREA 4DFMA 2E1ZA 1WOQA 4PQUA 3MWPA 2P51A 4CF1A 1YXQA 2F8SA 3MEEA 5JS1A 2OANA 3LP1A 4E7LA 2VG5A 4G1QA 1NU0A 2YJFA 4AHSA 1JLCA 3KLHA 3EZ5A 4AQYK 1NKBA 2QM1A 4DQIA 3AVMA 3IRXA 1GOBA 2Y1IA 4FM1A 1VQMN 4QCLA 1S1VA 3A5MC 3C7NB 3VTHA 4E7IA 2BANA 3HVRA 5ADXA 1HKBA 3IG1A 4DTOA 4LSLA 4CZIA 2AJQA 1C0FA 4PL7A 2FSNA 4CGJA 2P9UB 2WFBA 2HOEA 4B1VA 4M41A 4LF8K 2GWJA 2F4VK 3AVAA 3NH1A 3THXB 2UUAK 4FJ9A 4LF6K 4HUEA 4FK4A 3ENBA 4JEPA 5AQRA 3CERA 5EY4A 2YJEA 3VEOA 4MFBA 2HMPA 2DFEA 3HPOA 2KQ2A 3G0ZA 4BR2A 1ASWA 2QW9A 1VQ6N 1TKZA 2YKMA 1YI2N 2UUCK 4C8MA 4DR6K 4MO4A 3SQ1A 2QWNA 4ZTFA 1HNXK 4OPKA 4FCYA 1UOCA 3MN9A 4JI3K 3HOTA 2JWKA 2BDPA 5AQFA 4DFKA 4FZYA 5K14A 3LP2A 3ULEB 3IFRA 3VA0A 4GVMA 3LDNA 3V9SA 3SMSA 4M3ZA 3IUCA 1XMQK 3M8PA 4CF2A 1ASVA 4Z4HA 3SPZA 4KTWA 3TARA 4DLEA 1C0TA 3Q7BA 3VF2A 1KAXA 2RKIA 5AQZA 2XHBA 1K9MO 4E19A 3O9QA 1RT1A 5CY4A 4KHWA 2KKZA 3ULDA 2PYLA 3SI6A 2OA8A 3CXCM 4BRKA 4CJ7A 5BRHA 1NGGA 3S41A 3RMCA 3FR0A 3FZLA 3HXMA 1L3TA 4RWTA 3ZX3A 1YF5L 5JLFA 1JL1A 4DUYK 1QZ5A 4M3TA 4W5RA 3VEWA 3ZT4A 1KAZA 3EEQA 1BO5O 4A61A 1QE1A 5A2QO 3V1OA 4OKEA 3QIOA 1NGEA 4DSLA 5F2RA 5AZJA 3ZEUB 4YHHK 4FPAA 2VGMA 2W41A 3LDQA 4DU1A 4HWIA 4CZFA 4JHDA 1NK6A 2D0CA 3R6MA 2VG7A 4BRPA 1A5XA 4FOEA 1VQNN 5CE3A 3L4IA 1NGCA 5JLHA 4Q0BA 4B1WB 3M3ZA 3CPWM 3KIOA 2P9NB 3HM8A 2XY5A 1WSJA 1G99A 4BR9A 4W5TA 1EX4A 4H0TB 5FLXO 3EO3A 2QWMA 1S6QA 3IAYA 4OO1J 3VQAA 3OYEA 4R5PA 4NLCA 2X6SA 4DV1K 1ATRA 2PY5A 1WLJA 1QHAA 3DRSA 3OVNA 2YI1A 1VSMA 3O4WA 4LH5A 3RRHA 1S22A 3H45C 1J6ZA 1WAFA 4ID1A 2ITGA 2VWJA 3S3MA 1P8ZA 4IG3A 1O13A 2W40A 3KHYA 4CEEA 3VESA 1NK7A 4FSVA 3OYAA 2VGNA 4QOZB 2O8BA 1BGXT 2EX3A 1VQ4N 3EL2A 4DHYA 2E6LA 4CF9A 3V4IA 3DOLA 1NKCA 5FPMA 4OVLA 3KJVA 3F5TA 2FBVA 4DU4A 4AM7A 2P9PB 1NK8A 4ILHA 3P1GA 4H8KA 3RWUA 4FZZA 1C1BA 4O55A 3AVHA 3QESA 1HKGA 4CJPA 5GAHP 5FPDA 1J54A 1D8YA 1L5UA 3OBWA 3AAPA 3DRPA 4XH1A 1RILA 4EZ9A 1C1AA 1T3VA 3K58A 4H5WA 3VQPA 1NMDA 1SKSA 4YOWA 1RBTA 1IBKK 4EHUA 3VQ8A 1KRPA 5M1NA 5GIOA 3EE9A 1XQSC 4CBXA 2XY8A 4FJHA 3MEGA 2HHHK 4ELVA 3FZHA 3N4QA 4H5VA 1QQOA 1Q8IA 5I9EB 1KVBA 2P9KB 1HNIA 1HPMA 3M8QA 2P5GA 4EAHD 2FF3B 1VQON 1M1KO 3THWB 2YX6A 1ASUA 2I5JA 4JKDA 4LC9B 1S1XA 2HBJA 2A3ZA 4CEFA 1JL2A 5BREA 5AQGA 1S1WA 1RDWX 3PIOL 4ELUA 4BRLA 4B1UB 4NB4A 2V52B 3I8DA 1C0GA 2AP1A 4GW6A 2OPQA 4CIEA 1S1TA 1TKXA 4BRMA 1U2VA 4O44A 3MXMA 3SAGA 2ZE2A 1N33K 3HYFA 3JYTA 4WFNL 3L8BA 4HVJA 1DLOA 3OBYA 2QI2A 4OKKA 1SUQA 5SZTA 3TTFA 2IAJA 4XH5A 4H0YB 3T69A 1D4XA 3OYHA 4N41A 1N32K 2WTUA 1Z25A 4CJWA 1Q82O 3JS6A 4FK0A 3SUOA 4JKGB 2VWKA 1Q86O 1WSFA 3D2EB 3OHRA 4DR4K 1S1UA 3ZSOA 3TAPA 4N76A 1UA0A 2RN2A 4DV7K 2G8KA 2A5XA 1X9SA 2FC0A 4DV2K 3HJFA 3WXKA 1NGFA 2HMIA 5LY3A 3B6PA 1WUAA 3PSIA 1BDGA 4O5FA 5KQ8A 4DSIA 3ID8A 1NGAA 5DMRA 5EOYA 3AVNA 1ZBSA 3ISNC 2Q97A 1WBDA 3QLHA 3E9LA 3J8AA 3CCQN 3BF3A 3MXJA 3WUHA 3AA4A 4O4GA 4IJNA 4DV4K 1CZBA 4WQ4A 2DY4A 3ZSRA 4CFDA 1QSLA 1VQKN 5CR4A 4B3RK 3DJCA 2CH5A 1NGJA 1YTAA 4I6MB 3WNHA 5H1SQ 1NLVA 1BHLA 3KD1E 4FO0A 2FXUA 3AVGA 4B9VA 3K2PA 4BR5A 3J80O 3NGZA 1YUWA 3V9WA 4GKJK 3AO5A 3KWGA 4JK8A 3OYLA 3EYZA 2HNZA 3AVCA 3QICA 1ZXOA 1T03A 3HOSA 1B9DA 3ZT2A 4BC5A 2RHKA 4IFYA 4F3TA 3MEDA 3VMFB 2NZTA 1NBWA 3C95A 4CEBA 3GOIA 3TANA 4ISGA 2HVHA 1HRHA 4H03B 2P5OA 4HCBA 2F7TA 3O9SA 3K59A 3V9XA 1SV5A 2V7ZA 5GAEP 5AQSA 1W97L 4FJ5A 4IZ9A 1VSDA 4YOTA 4DR7K 3C6TA 2IVNA 3NCIA 2W6KA 3KD5E 5C2DA 1BI4B 4DV6K 3QERA 3HVTA 4JKFA 5HLFA 5BRFA 3D0PA 3NF8A 1A5WA 2X78A 4CHQA 2YHBA 3E01A 3OA9A 5C15A 4DV0K 1KFSA 3OJUA 1RBSA 3MN7A 4BRCA 4LF4K 2HBLA 3LDOA 3AARA 1YJ9N 3KLGA 5E84A 2O4IA 1HQEA 1CXQA 1XNRK 1RBRA 5AQPA 4DSFA 1EP4A 2WUSA 4ISFA 3U8XA 1RTIA 4BR7A 4E3SA 1DTQA 4HCCA 4FWKA 1TK8A 3ZETA 2EWSA 3AVBA 4DQQA 3A5OC 1BL3A 4GV9A 1RTJA 3QEVA 4DMNA 3QEWA 4H0VB 3VQ7A 3AGRA 1JLFA 3P38A 1KAYA 3THYB 4FLXA 2P9LB 1K8AO 5AZIB 2QWPA 4CJSA 5IWAK 3FZFA 3IMXA 2GUPA 3FZMA 4JKCA 5DK5A 2XY6A 1RTDA 1K8KB 5DM6L 2D5RA 3RSEA 4EP4A 4KTZA 3A5LC 1TAUA 1GOCA 1I3AA 5BR9A 3L3VA 4C8LA 4RW6A 5MLCQ 3OYJA 1L3VA 3CIPA 5AQYA 4B1YB 3U9DA 4B9TA 2YHWA 3GG4A 3CCUN 5FROA 3V1RA 2HHTA 3L6QA 1VQLN 1MWMA 3BZCA 3VQBA 1X9JA 4W5QA 1KC8O 2QKBA 2E4LA 5CZ1A 3VGKA 1IJJA 2HW3A 1KVCA 2ZD1A 3O3FA 2X74A 3NFAA 4CHPA 5B8HA 4NO7A 1U04A 5GAGP 2KFNA 3ID6A 3VEXA 4F4KA 4L3QA 2NRXA 4CEZA 3H3OB 4BGBA 1VAZA 3PY8A 4WCEL 5KTQA 2V7YA 2ZGZA 3TWHA 4CGGA 3KKSA 2CH6A 4CEQA 3ZSWA 4U7BA 3VQ9A 1W9HA 4JKAA 3D2FB 4OJRA 2HHQA 4DTPA 2FSJA 3DLGA 3VQQA 1LOTB 2E5LK 3PO4A 4J2BA 2P9SA 3KTQA 4M7XA 4AILC 4EFHA 1XHXA 4DTSA 3LM2A 3TR8A 3CD6N 2BH1A 4M3YA 3QO9A 1RDCA 2Q31A 4CJKA 1T6CA 1NJIO 4FJKA 1ZBIA 1TYQA 3J7ZO 1BOTO 3TAEA 1KVAA 3KLFA 5BPLA 4QS9A 4CFAA 4YOXA 3CPEA 2VQEK 1KD1O 3K5MA 3AAQA 1S9GA 3S3OA 3BEXA 4BGAA 3G6EN 2DTUA 3PUFA 3IKMA 3VEYA 1SS6A 3PX6A 3I56N 4CCHA 4JI1K 4K8ZA 4C8NA 4DTUA 3HPGA 3P83D 2G8UA 2UU9K 4FW2A 3OYKA 3SK3A 4DCHA 4N5SA 3FE1A 3Q7CA 3CM6A 1YJNN 1BQMA 1TUYA 5HOOA 3O1BA 1MU2A 4DWIA 2D4WA 3RTVA 3RR7A 5KI6A 3W3DA 3SQ0A 3GBTA 3CF5L 2G8IA 3WEEB 1CZ9A 1QHTA 2X6NA 3UKRA 1NNEA 4BDPA 3KZBA 4EHTA 3QNOA 2ETJA 2I7NA 3VGMA 4PL8A 4YOYA 3QEIA 2J4RA 4KI6A 2Q36A 1LWFA 4DR2K 4BWJA 4E1NA 1VQ8N 2Q0RA 4CZHA 2RE2A 3U6FA 3EZWA 1H1VA 2P9IA 2F9TA 3CQXA 5C10A 3VEZA 3CFPA 4Y1DA 4CERA 1T6DA 3DOKA 1C1CA 5BRDA 2OTJN 2VYPA 3NGYA 5DM7L 1HPZA 4NYNA 3ATVA 5BR8K 1GOAA 3U4LA 1NM1A 2OZMA 4CF0A 2F9WA 3MDQA 4M42A 1VK0A 3O4QA 4FM0A 3D7EO 2YNGA 4YY3K 4LFBK 3AO1A 3AGKA 1TKDA 4A5AA 3QEPA 1HKCA 1KSPA 4NXMK 5EXWA 4FJJA 5AQXA 4FL9A 5KGWA 1W7AA 3OYNA 2Z1JA 3LALA 1XC9A 5KQDA 4FJ8A 3WXIA 3U9ZA 5BPMA 4HUFA 1ZC6A 1RT3A 3GDQA 3HTVA 4IG0A 4GKKK 3L2UA 1SL2A 1NK9A 1OH8A 3A2FA 2YCHA 3ENHA 4F8RA 3OYIA 5M1KA 1XUPO 5AJ3K 4I7FA 3NHGA 5CYQA 3AO3A 1VSKA 4WYBA 5EU7A 2O8CB 3TABA 3SUQA 2D0PA 5JVGL 2BTFA 2BGGA 5JS2A 2HF4A 4JD2A 1U4BA 2GX9A 2O4GA 3ZSZA 2YKNA 1X9WA 3CYMA 4HTUA 5LJVA 3FLCO 4JK7A 4KHUA 4BY9C 4AHUA 4DR3K 2NRZA 4B3TK 4JKBA 4KHQA 1HMVA 2YV0X 2ZJRL 1NJYA 4CHYA 1KXPA 1JXEA 3VENA 4CEDA 3BDPA 2GV9A 3LDLA 3R8EA 1VRTA 5HRPA 4JNEA 3NBPA 5ELZA 2HNDA 3SCXA 2IOCA 2Q0UA 5HRRA 1U2VB 1DEJA 4OX9K 2D0BA 4E1JA 2FBYA 3EKUA 2OPSA 3C7NA 1TAQA 2QWQA 3F9KA 3TI0A 4LD0A 3M8RA 1WNSA 3TSPA 2ZJPL 3DLEA 1WSHA 1KQSM 3CG7A 3PLAA 1LW2A 1K6YA 1SKRA 5C0YA 4GV3A 4LH4A 3ZSYA 3THXA 4AH9A 3WXLA 4AM6A 3HP6A 3CJAA 4YDUA 3LZIA 4E7KA 1YVNA 1QSSA 4H5TA 3OW2M 1HR0K 4QS7A 4DUZK 1U48A 2Z1HA 5J2QA 4O8KA 5EVZA 3T1HK 1CLQA 4JKEA 1MA9B 1VSIA 3VF4A 3QEXA 1NWKA 3JAMO 1T8EA 5KGXA 3O80A 3CC7N 3SAFA 1WSEA 3TAQA 3QNNA 4JI5K 3SQ2A 5EX5A 2NRHA 4CZLA 2UXCK 4CJEA 3T1AA 4FLUA 3T7ZA 1YAGA 4F3OA 3CCLN 1HX1A 3V9ZA 3P5JA 2HNYA 3R1XA 5GINA 4CBUA 2IVPA 1RBUA 2KTQA 2YNHA 5AQQA 3KKRA 4BC3A 4BE0A 1D5AA 1Y64A 4CECA 4ZTJA 4JLHA 2DPNA 4KH4A 4U67L 4CVNE 5FRMA 1KLNA 2FBTA 4CGDA 4BRDA 1I39A 4YFUA 3OYBA 1Q81O 4FWOA 5AQMA 4HUGA 1Q18A 1VSLA 3HI0A 3ZT3A 4JI2K 4CD3A 4KB0A 1QVFM 1FW6A 3TAMA 2O8EB 3DMJA 3VTIA 1RT6A 4O0JA 4BRIA 3DWLA 4IEIA 2OCEA 4IJAA 1ATSA 3O9RA 3OTOK 2FF6A 1HJOA 3DLBA 3O4NA 4BACA 1NG9A 3DXKA 3HPHA 4K42A 1KTQA 4XH4A 2BUPA 4FJ7A 4H0OA 2JWLA 3NF7A 3IS9A 3ALYA 3ZEUA 5KRSA 3VQCA 3SV4A 4BQLA 4CHZA 1R0AA 3NVMA 3RR8A 4E7HA 4GY2B 3AVFA 4L8RB 5HL7L 4KAZA 4Y1CA 3AVJA 5D3GA 1XWLA 2UXBK 3VQEA 1NOZA 2P9NA 3CFOA 3B6OA 4BVPA 3N4PA 3VQ4A 2PZSA 1WSGA 4CFBA 3CCMN 5GADP 1GLDG 5LMUK 4IOXA 3JXUA 5KPTA 4BDYA 4E7JA 3FFKB 2KZMA 4DV3K 4B9UA 1QVGM 4FW1A 3I55N 1BQNA 4BG9A 3AY9A 2E2QA 4FLWA 3OYDA 4LFCK 3O1WA 1U45A 5BN9A 3TAFA 1G15A 2NRTA 4OPAA 2JLEA 3O9UA 1OKJA 4LF9K 4CGHA 2DFFA 3O5BA 1P90A 3V81A 1IV0A 5FPNA 4RW7A 3H08A 4FK2A 2YNIA 3KVGA 1EWQA 2E2NA 1A5VA 4ZHRA 1BA1A 3TPQA 2E1YA 3NE6A 4BRAA 4JYAK 2ZF5O 4CJ3A 2P9PA 1JLGA 4PHTX 3FGUA 4C1NK 3O3GA 3LWMA 2PFUA 4OPJA 1LV5A 4Q5VA 3RVCA 4M3UA 4CW7B 4CZMA 1RGIA 1W0HA 3PSFA 2KW4A 4K25A 1JCFA 3MAQA 4DSEA 1Z05A 4I2QA 4V19S 4W5OA 4B3SK 4CEAA 4YORA 3HM9A 2KZZA 1C6VA 4EZ6A 1WBBA 3OS0A 2NRRA 3ZX2A 4C8KA 4NCAA 1T7PA 3E66A 3WT0A 3HSTB 4JS4A 1HYZA 2P9KA 4Z4IA 3C65A 3FFIA 4FLVA 4RW9A 4E89A 5HP1A 1SZ2A 3O8MA 1N8RO 4IFEA 4JI7K 4BC2A 1JLEA 1UAXA 3ZSXA 2O8DB 3C6AA 4I9LA 3HO1A 3V1QA 1IBLK 3K5LA 1NOYA 1XNQK 1XI1A 1ITGA 4JK9A 4Z4GA 2G8WA 3A0IX 3QBWA 3UKUB 3VOVA 3AA5X 2EHGA 5HBMA 3G4SN 3VA3A 3EY1A 3QB0A 4CZGA 2O8FB 1M90O 3O6WA 3VF6A 1VRUA 2ZQBA 3J7YP 5AFUA 3NH0A 3QFUA 3AV9A 5C2FA 4E0DA 4KHYA 2HVIA 2E2PA 2DFHA 4UY8O 3EKSA 4KFBA 1TYQB 4JKGA 2A1SA 1TV6A 2G8HA 3L2WA 1UA1A 2PYJA 3D2EA 1LCUA 2I7PA 5AQKA 2GELA 1NJXA 3MN5A 3D45A 4LSNA 2IC3A 5C25A 2GBZA 1MWKA 4EP5A 4OKJA 3WXMB 2QTDA 4CJLA 3LDPA 3GE1A 1RTHA 2WC9A 4B8CA 3MN6A 3SPYA 1RT7A 4J2EA 3SBTA 1FKPA 1VSEA 3O3HA 1IKXA 3CJCA 1NJWA 1U6ZA 5SWMA 3BP8A 1NJZA 3T19A 4B1XB 4KHSA 1QQNA 1EQYA 2HF3A 2QA4N 2D0AA 3SNNA 2ZGYA 5LMNK 3MK6A 5FPEA 4Z4CA 4LFAK 3C94A 4JV5K 4I9QA 4I6MA 3R3LA 4H4MA 5GIPA 3ASMA 1ESVA 1X9MA 3C6UA 3L2QA 1S6PA 3C0BA 2E20A 3D6RA 4JI6K 3KK2A 4IDKA 1NKEA 3LM9A 1MDUB 1HJRA 3VGLA 1RFQA 4WQ5C 4KH5A 4BDZA 4OGEA 3OS2A 3OY9A 2Q2RA 1CZAN 2PAVA 3CHWA 4BC4A 1Q9YA 4B9SA 5E41A 5F1XA 3F2KA 4TSXA 1FK9A 3U3YA 3AA2A 3CJ7A 4H0PA 4H5RA 1BCOA 3LP0A 3F73A 1HNWK 1BA0A 3QETA 4DLGA 3CFRA 4A2AA 1IH7A 2RPIA 1BI4A 1ZBHA 1NK0A 4DQRA 1U47A 1D9FA 3VEVA 3OYCA 4IXCA 1YTUA 3I33A 5C42A 2NNWA 2HBKA 4CEOA 1UWBA 1ZBLA 1EO1A 4CK3A 4FWLA 1BIUA 1WSIA 4BRHA 1TL3A 4FJIA 4FJXA 3M5RA 1KFDA 3E9OA 2YHAA 5AR0A 2RF2A 3K5OA 4CI6A 5M1FA 4M3WA 1TKTA 4A5BA 4KKOA 4FVMA 4WQ4C 2ITMA 4RW8A 2GTDA 3H6EA 4BQZA 3SAHA 3WQUA 3CCEN 2D0OA 1X3NA 3SJJA 4JI0K 4DF8A 3G71N 2FSKA 4DR1K 4G9ZA 2JGUA 2NRWA 3MCPA 5AZJB 1EKEA 5JVHL 2E88A 4DTNA 2QXFA 2F8TA 4JHDB 3CMEN 2OPPA 2LSNA 5J2PA 3K5NA 4MDAA 4CF8A 2QWRA 4DS4A 3THYA 1RT2A 4F2RA 2P9LA 5AZIA 3DXMA 3CC4N 3IDHA 1LAVA 4CGFA 2VQFK 4JN4A 4DQ8A 2YHYA 1XHZA 3NF9A 1K8KA 1HUXA 4IWVA 1JCGA 3AVLA 2WONA 3K9KA 1N36K 4DQSA 2B6AA 5AQIA 2QWOA 1DGKN 1BISA 2HBMA 2OYQA 2O8BB 3NAEA 1FXXA 3G10A 3E9PA 4CE9A 4RTFD 1DTTA 2GEMA 3S3NA 3LAKA 3MX5A 2A42A 3P31A 4WFBL 1Y97A 1VSFA 1SAZA 1RBVA 1HNVA 4CBWA 1TGOA 4DFJA 3QDKA 3KLIA 4XEIA 1OVQA 4PKHA 4HHTA 4PKIA 3QIPA 5C12A 2G8VA 3DLHA 4KB1A 1XC3A 3RRGA 1JLQA 3DAWA 3DRRA 3UB5A 3V9UA 3CJ9A 3OYFA 2ZM6K 3MWTA 4CK2A 3TSQA 5AQOA 4Z4FA 4FZXC 1IO2A 1HQUA 4DQPA 3AO4A 4K8XA 1YITN 2FLOA 4OLAA 4B3MK 4ELTA 2HSTA 4CESA 2F96A 1RNHA 4PY5A 3D2FA 3SMPA 4A59A 5T7BA 2HHSA 4DTXA 4IKFA 4BRGA 3MXIA 4AHCA 1N6QA 3KWIA 4AHVA 1BU6O 3P4IA 4UQGA 4YOVA 1N34K 4BR4A 1TUUA 2H3GX 5BN8A 4NYFA 4FVUA 4IO9L 2NLXA 4DV5K 3SV3A 3CCVN 1GLCG 4CHOA 4IFVA 4BROA 3L3UA 2OTLN 4KPYA 1NMNA 3DXKB 4X66K 1TVRA 1S9EA 5AQJA 1OH5A 3L4QA 1IKWA 2CGJA 5J2NA 2E6MA 4IOCL 4KHNA 3H3NO 1TK5A 1JKHA 1L3UA 1J5EK 5M1PA 4N47A 4PWDA 4LY7A 4KO0A 1N5YA 4Z94A 3CI5A 3WQTA 1WB9A 3QINA 4E1MA 4DTRA 1GLEG 3FZKA 3LL3A 2P9UA 2ASMA 4B9LA 3WEEA 4B1ZA 4MQ3A 1SL1A 3M6GA 1NK4A 3PX0A 4A62A 4K41A 4JRPA 1DKGD 1JCEA 4B9MA 4CK1A 2IGIA 4B8AB 2ASOA 2PBDA 1HLUA 4Y0WA 2QK9A 3ZYYX 3CCJN 4KTQA 5C24A 4CGIA 3L0QA 2Q1NA 4JKHA 4CFCA 1SL0A 4C8OA 3O08A 3NDKA 1QZ6A 5AQTA 3ZT1A 3RMBA 4CJQA 4Z0UA 4OGCA 5CHIA 5LL6Z 3VQ5A 2IVOA 1FKOA 2B5JA 3LAMA 4ILJA 4YOUA 5AQWA 4BRQA 1GLJO 5HRSA 4DTMA 3O9TA 2VG6A 3OYGA 3W0LA 2ZJQL 4RCHA 5AQUA 5AQNA 1BWFO 3DLRA 4PA1A 5KRTA 4MDBA 3KK7A 3ULEA 3T1YK 3KK1A 1QS4A 4B3OA 3HL8A 4FWMA 2P1JA 4BE1A 1SKWA 4FYDA 1BG3A 1V4SA 1IG9A 3JSMA 2V51B 3HK2A 4GMJB 1BIZA 4CJFA 4B9QA 3SZ2A 1NGBA 4XIUA 1TL1A 4NCBA 2VCPA 3CJBA 3QMLA 3SUPA 1U49A 3NH2A 1X3MA 4DFPA 3VPZA 1WAJA 2FBXA 3SUNA 1J9AA 4JI8K 3DLKA 1RDUA 4DTJA 3WNEA 4M3RA 1YVUA 1XMOK 2O8CA 3BY5A 4O8UA 3OJSA 3SQ4A 3G25A 2VWBA 1YT3A 2HHWA 2KHOA 4CJRA 5JMVA 3ZSQA 4RG8A 2UUBK 4CD1A 4GNIA 3DM2A 3E1YA 1LWEA 2QEXN 2D1KA 1GLBG 3CMAN 2W42A 3MMVA 1E3MA 2B4JA 3H1QA 1VQPN 3T3FA 3A5NC 1ZBFA 1NGDA 4DSJA 3J7AP 4O5BA 4H0XB 5LJWA 4BG8A 3CQYA 3L2VA 4X65K 4C23A 4BRFA 2G8FA 1F21A 4X62K 1S72N 4FOIA 4FWRA 3U3GA 4ILGB 3R9PA 2IDOA 5KPRA 3CC2N 3RMDA 4AHRA 3L2RA 4M45A 3WXJA 1BUPA 4CJ5A 4WQ5A 4DU3A 1EETA 5TKWA 1QTMA 4KRFA 3ITHA 1VQ5N 4YNQA 4KI4A 1IKYA 1JLAA 1IBMK 1LWCA 3UE5A 3WNGA 4W5NA 4DR5K 3EN9A 2BE2A 3J81O 4DF4A 3I0SA 3LANA 5E26A 5AQLA 2QKKA 1V4TA 1J53A 3ZETB 1NGIA 1S3XA 1W2BM 3HZ6A 2AA4A 4F9OA 3VETA 4FLYA 4R79A 4FWQA 3LWLA 3AO2A 3SJHA 2ASPA 1WN7A 3EE8A 4H5NA 3OS1A 3DYAA 3HSCA 3WNFA 5HROA 4FWNA 1J5OA 3PIPL 1OVYA 3VN5A 3B8AX 1NGHA 1S5JA 3C6HA 3CCSN 4FLTA 3RSEB 3SYZA 3LPUA 4GVEA 3LP3A 1FJGK 1JXBA 4LF7K 4CZJA 3RMAA 1RT5A 5AFUH 3AVKA 1VQ9N 4BVOA 3GL1A 4M7YA 2CGKA 3DI6A 3VERA 4X64K 2YHXA 2NRVA 1ILYA 2WOMA 4KH6A 5I3UA 1REVA
chains in the Genus database with same CATH topology
1C1BA 4BE2A 1NKEA 4O55A 1HJRA 3AVHA 2IS3A 1VK0A 3QESA 4FJLA 2GUIA 3O4QA 4CJPA 4FM0A 4BDZA 4M42A 2YNGA 3AO1A 4OGEA 3AVIA 1TKDA 1J54A 3QEPA 1D8YA 1KSPA 1L5UA 3OS2A 2HHUA 2NUBA 3OY9A 1L3SA 1LW0A 3DRPA 1RILA 4EZ9A 4ICLA 1C1AA 4FJJA 3K58A 4OLBA 3VQPA 3UIQA 1SKSA 1Q9YA 1CXUA 4B9SA 5KGWA 5E41A 4FJMA 3OYNA 1RBTA 2XRIA 2Z1JA 3LALA 3V6DA 1XC9A 4TSXA 4DG1A 3VQ8A 1KRPA 1FK9A 3U3YA 1RCHA 3AA2A 3TAGA 4FJ8A 1BCOA 2XY8A 3LP0A 4CJ4A 3F73A 4HUFA 3MEGA 4H4OA 2A1RA 1RT3A 4ELVA 1IKVA 4FJHA 1ZYQA 3HT3A 4IG0A 1Q8IA 5I42A 1KVBA 3QETA 4DLGA 3L2UA 1HNIA 1SL2A 3CFRA 1IH7A 2RPIA 1BI4A 3M8QA 3A2FA 1NK9A 1ZBHA 4CIGA 2P5GA 1NK0A 4DQRA 1U47A 1D9FA 3CM5A 3OYCA 3OYIA 4O0IA 4F8RA 1HYSA 1B9FA 1ASUA 2I5JA 1YTUA 3OYMA 4I7FA 3VQDA 1VSJA 5C42A 3NHGA 3PV8A 5CYQA 3AO3A 1VSKA 5EU7A 1RDBA 1S1XA 3TABA 3SUQA 4CEFA 4CEOA 1UWBA 1JL2A 5FRNA 1ZBLA 2BGGA 1RT4A 1S1WA 5JS2A 4JS5A 1B92A 4CK3A 4ELUA 1U4BA 1BIUA 1WSIA 2O4GA 1TL3A 3ZSZA 4FJIA 4FJXA 1KFDA 3I8DA 2YHAA 2YKNA 4GW6A 1X9WA 2OPQA 4CIEA 1S1TA 2RF2A 3CYMA 1RDDA 1TKXA 4HTUA 3K5OA 3BGRA 4KHUA 4AHUA 4M3WA 4DQPA 1TKTA 2XO7A 4KKOA 4O44A 4CJTA 3CQ8A 4FVMA 3KLEA 3MXMA 3I0RA 2ATQA 4RW8A 4KHQA 2ZE2A 3LPTA 1HMVA 2YV0X 3HYFA 3JYTA 3L8BA 1NJYA 4HVJA 4CHYA 1DLOA 3SJJA 4DF8A 1JXEA 4CEDA 3BDPA 2GV9A 1VRTA 4OKKA 5HRPA 3NBPA 3SCXA 2HNDA 1SUQA 2JGUA 5SZTA 4CIFA 2IAJA 2IOCA 5HRRA 1EKEA 3OYHA 1KLMA 4DTNA 4N41A 2D0BA 1Z25A 2QXFA 4CJWA 3MECA 2FBYA 2F8TA 1KCFA 2OPSA 1TAQA 5CYMA 3S9HA 3SUOA 4FK0A 2OPPA 2LSNA 4DSKA 2VWKA 3F9KA 5J2PA 3TI0A 4LD0A 4KV8A 1C0MA 1WSFA 3K5NA 3M8RA 1LAWA 3THVA 1WNSA 1S1UA 3ZSOA 5HRNA 1O1WA 3DLEA 1WSHA 4CF8A 3TAPA 4N76A 1UA0A 4DS4A 3CG7A 1QSYA 1LW2A 2RN2A 4CJVA 1K6YA 2Y1JA 1SKRA 1RT2A 4F2RA 2G8KA 4LH4A 1X9SA 3ZSYA 4B9NA 4J2AA 1LAVA 4CGFA 2FC0A 2OPRA 3HJFA 3PO5A 1HYVA 5J2MA 4AH9A 2HMIA 1XHZA 3B6PA 3NF9A 1X1PA 3HP6A 3NGIA 5J1EA 4E7KA 1QSSA 3LZIA 4DSIA 3NF6A 1T05A 5DMRA 3AVLA 4I2PA 1ZBUA 2WONA 3AVNA 3ISNC 1U48A 2Z1HA 3QLHA 5J2QA 1NK5A 3MXJA 4PUOA 4DQSA 1CLQA 3AA4A 2B6AA 4O4GA 2KFZA 1VSIA 1CZBA 4NCGA 3QEXA 2DY4A 3ZSRA 1T8EA 4CFDA 3KK3A 1QSLA 1BISA 5KGXA 2OYQA 4CHNA 1WSEA 1EXQA 3TAQA 3QNNA 3SQ2A 4FJNA 3NAEA 1FXXA 3PX4A 3G10A 3HP9A 2Z1GA 4AHTA 3AA3A 4CE9A 4FLZA 1DTTA 4CJEA 3S3NA 1JLBA 3LAKA 1YTAA 3T1AA 3WNHA 4FLUA 4F3OA 2OZSA 1Y97A 1BHLA 3LDSA 1TK0A 1BCMA 3KD1E 3AVGA 1VSFA 2YNFA 3K57A 4B9VA 1RBVA 1HNVA 3K2PA 1TGOA 3P5JA 4WE1A 3V9ZA 4DFJA 4Z4EA 3KLIA 4BWMA 4DS5A 4M3XA 3NGZA 3ZCMA 2HNYA 3LZJA 3V9WA 4HHTA 3QIPA 1RBUA 3ZSVA 2KTQA 4B08A 2R7YA 2G8VA 3AO5A 3DLHA 4KB1A 5CZ2A 2YNHA 4BE0A 3KKRA 3OYLA 3EYZA 2HNZA 1D5AA 1JLQA 3AVCA 3DRRA 3V9UA 4CECA 3OYFA 4ZTJA 1T03A 4J2DA 1B9DA 4JLHA 3ZT2A 4CK2A 2HHVA 4IFYA 4F3TA 4F2SA 3MEDA 2Q3SA 4QAGA 5FRMA 1KLNA 2FBTA 4ID5A 4Z4FA 4FZXC 1IO2A 1RDAA 1HQUA 3C95A 4CEBA 3AO4A 1I39A 4CGDA 4YFUA 3OYBA 4JRQA 3TANA 2HHXA 4K8XA 2HVHA 1HRHA 4HCBA 2P5OA 4HUGA 4OLAA 4ELTA 1VSLA 4CESA 2F96A 3ZT3A 1RNHA 1SV5A 3K59A 3V9XA 4KB0A 4PY5A 1Q9XA 3TAMA 4CJUA 4FXDA 2HB5A 3DMJA 5T7BA 1RT6A 4O0JA 4FJ5A 2HHSA 4DTXA 4IKFA 1VSDA 3MXIA 5FDLA 3C6TA 3O4NA 4AHCA 4BACA 3NCIA 1Z26A 4RW4A 4AHVA 1N6QA 3DLBA 3VQ6A 1BI4B 4IBNA 3KD5E 3HPHA 3QERA 3HVTA 5HLFA 1KTQA 4UQGA 2XY7A 1VSHA 3D0PA 3NF8A 1A5WA 2X78A 4CHQA 1C0UA 4FJ7A 2Z1IA 3ZT0A 2YHBA 4NYFA 4FM2A 4FJGA 3NF7A 3E01A 3IS9A 3ALYA 3SV3A 1KFSA 3OJUA 4CHOA 4N56A 4IFVA 1RBSA 1D9DA 3L3UA 4KPYA 3KLGA 1TVRA 1S9EA 5KRSA 2O4IA 3VQCA 1QQCA 1HQEA 3M8SA 4KREA 4DFMA 3SV4A 1CXQA 4CHZA 1R0AA 1RBRA 3RR8A 1IKWA 4E7HA 4PQUA 5J2NA 2E6MA 4KHNA 3AVFA 4DSFA 4L8RB 2P51A 1EP4A 4CF1A 1JKHA 4Y1CA 3MEEA 1TK5A 1L3UA 4KAZA 3AVJA 4N47A 2F8SA 4PWDA 3LP1A 1XWLA 5D3GA 5JS1A 4E7LA 3VQEA 1RTIA 4LY7A 2VG5A 4G1QA 1NOZA 3CFOA 4KO0A 1N5YA 3B6OA 3QINA 3VQ4A 2PZSA 4E3SA 1WSGA 4AHSA 4E1MA 1JLCA 4CFBA 1DTQA 3KLHA 4HCCA 4DTRA 3EZ5A 1NKBA 4DQIA 1TK8A 3AVMA 3IRXA 3AVBA 1GOBA 4B9LA 4BDYA 4E7JA 4DQQA 2Y1IA 2KZMA 4MQ3A 1SL1A 4FM1A 1BL3A 4QCLA 1NK4A 1S1VA 4B9UA 3PX0A 1RTJA 4E7IA 4FW1A 4JRPA 2BANA 4DMNA 3QEVA 4B9MA 1BQNA 3HVRA 4FLWA 3IG1A 4DTOA 3QEWA 4LSLA 3VQ7A 3OYDA 4CK1A 2AJQA 2IGIA 1U45A 1JLFA 4B8AB 4CGJA 3TAFA 1G15A 4M41A 2JLEA 4FLXA 2QK9A 4CGHA 2DFFA 4CJSA 4KTQA 3V81A 5C24A 4CGIA 3AVAA 3NH1A 4RW7A 4CFCA 3H08A 1SL0A 4FJ9A 4FK2A 2YNIA 5DK5A 4HUEA 2XY6A 1RTDA 4FK4A 4C8OA 1A5VA 4ZHRA 2D5RA 3NDKA 3ZT1A 4KTZA 4EP4A 3RMBA 3NE6A 4CJQA 4Z0UA 4MFBA 4OGCA 1TAUA 3VQ5A 2DFEA 1GOCA 1FKOA 2B5JA 1I3AA 3LAMA 4CJ3A 1JLGA 3L3VA 3HPOA 4C8LA 2KQ2A 4RW6A 3O3GA 3G0ZA 3OYJA 3LWMA 5HRSA 4OPJA 4DTMA 2VG6A 4Q5VA 3OYGA 1LV5A 1L3VA 1ASWA 4M3UA 1TKZA 1W0HA 4B9TA 2YKMA 3DLRA 2KW4A 4PA1A 4C8MA 5FROA 3V1RA 5KRTA 3MAQA 4DSEA 3SQ1A 2HHTA 4I2QA 4W5OA 4CEAA 3VQBA 4ZTFA 3KK1A 1QS4A 4B3OA 3HL8A 4OPKA 3HM9A 4W5QA 4FCYA 2P1JA 2KZZA 1UOCA 1C6VA 2QKBA 4BE1A 1SKWA 4FYDA 2E4LA 5CZ1A 4EZ6A 3OS0A 2BDPA 2HW3A 4FZYA 4DFKA 5K14A 3LP2A 2ZD1A 1KVCA 3O3FA 2X74A 1IG9A 3JSMA 3NFAA 4CHPA 4C8KA 4NCAA 3VA0A 1U04A 1T7PA 3HK2A 4GMJB 2KFNA 1BIZA 3HSTB 4GVMA 4CJFA 4JS4A 4F4KA 3SZ2A 1HYZA 3V9SA 4Z4IA 4M3ZA 4CEZA 4XIUA 3FFIA 3M8PA 4CF2A 4FLVA 1TL1A 4RW9A 4E89A 1ASVA 4Z4HA 3SPZA 4NCBA 3SUPA 5HP1A 1U49A 3PY8A 3NH2A 4KTWA 5KTQA 4DFPA 3TARA 1WAJA 2FBXA 4DLEA 3SUNA 1J9AA 3DLKA 1C0TA 3TWHA 4CGGA 3KKSA 4DTJA 3WNEA 4CEQA 2RKIA 4M3RA 1YVUA 2XHBA 1JLEA 3ZSWA 4E19A 3OJSA 3VQ9A 3SQ4A 1RT1A 1W9HA 1YT3A 2HHWA 5CY4A 4CJRA 1UAXA 4OJRA 3ZSQA 4RG8A 3ZSXA 4KHWA 2HHQA 4KI4A 3DM2A 4DTPA 3DLGA 3VQQA 1LWEA 4I9LA 4J2BA 3V1QA 3PO4A 3ULDA 2PYLA 3K5LA 3SI6A 1NOYA 3HO1A 2W42A 3KTQA 1XI1A 1ITGA 2OA8A 4Z4GA 4AILC 2G8WA 1XHXA 2B4JA 4DTSA 3T3FA 3AA5X 3TR8A 3HXMA 3RMCA 1ZBFA 2EHGA 1L3TA 4DSJA 4M3YA 3QO9A 4O5BA 5HBMA 1RDCA 3L2VA 3VA3A 3EY1A 1JL1A 2G8FA 4CJKA 1F21A 4FJKA 1ZBIA 4M3TA 4W5RA 3TAEA 1KVAA 3ZT4A 3KLFA 3U3GA 4CFAA 1QE1A 1VRUA 2ZQBA 3V1OA 2IDOA 3NH0A 4OKEA 3QIOA 3K5MA 3RMDA 4DSLA 1S9GA 4AHRA 3L2RA 3AV9A 4M45A 4E0DA 4KHYA 4CJ5A 4DU1A 2DFHA 4DU3A 1EETA 3S3OA 2HVIA 4KFBA 1NK6A 2D0CA 2DTUA 3PUFA 2VG7A 3PX6A 1A5XA 4CCHA 1QTMA 4KRFA 4K8ZA 2A1SA 3ITHA 1TV6A 2G8HA 4C8NA 4DTUA 3HPGA 3P83D 4YNQA 3L2WA 1IKYA 4FW2A 3OYKA 1JLAA 1UA1A 2G8UA 2PYJA 1NJXA 4Q0BA 4N5SA 1LWCA 3KIOA 3WNGA 4W5NA 3CM6A 2BE2A 2XY5A 1BQMA 3D45A 4LSNA 4DF4A 1WSJA 2IC3A 3I0SA 3LANA 1EX4A 4W5TA 1MU2A 5C25A 4DWIA 3RTVA 3RR7A 2GBZA 5KI6A 2QKKA 1S6QA 3IAYA 1J53A 3SQ0A 4EP5A 4OKJA 3VQAA 3OYEA 4R5PA 2G8IA 1CZ9A 1QHTA 2X6SA 4CJLA 2X6NA 3RRGA 4FLYA 2PY5A 4BDPA 1WLJA 3DRSA 1RTHA 3OVNA 2ETJA 1VSMA 3AO2A 3LWLA 4B8CA 1WN7A 3QNOA 4LH5A 3RRHA 3SPYA 1RT7A 1WAFA 2ITGA 3DYAA 4ID1A 3OS1A 3WNFA 2VWJA 5HROA 3S3MA 4J2EA 4IG3A 1FKPA 3QEIA 4KI6A 1LWFA 4BWJA 1J5OA 4CEEA 1VSEA 3VN5A 4E1NA 3O3HA 1IKXA 1NK7A 3OYAA 1NJWA 5SWMA 1NJZA 4QOZB 1S5JA 3T19A 1BGXT 2EX3A 4KHSA 3U6FA 2D0AA 3SNNA 2E6LA 4FLTA 4CF9A 4Z4CA 3V4IA 3CFPA 4Y1DA 3C94A 4CERA 3DOLA 1NKCA 3DOKA 3SYZA 4I9QA 4OVLA 3LPUA 1C1CA 3LP3A 4H4MA 3KJVA 1JXBA 2FBVA 3ASMA 4DU4A 1RT5A 3RMAA 3AVKA 3NGYA 1NK8A 1X9MA 3C6UA 3L2QA 1HPZA 3DI6A 4NYNA 3P1GA 1S6PA 4H8KA 2WOMA 5I3UA 3RWUA 1GOAA 1REVA 4FZZA 2OZMA 3KK2A 4CF0A 4IDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1B A;  4BE2 A;  1NKE A;  4O55 A;  1HJR A;  3AVH A;  2IS3 A;  1VK0 A;  3QES A;  4FJL A;  2GUI A;  3O4Q A;  4CJP A;  4FM0 A;  4BDZ A;  4M42 A;  2YNG A;  3AO1 A;  4OGE A;  3AVI A;  1TKD A;  1J54 A;  3QEP A;  1D8Y A;  1KSP A;  1L5U A;  3OS2 A;  2HHU A;  2NUB A;  3OY9 A;  1L3S A;  1LW0 A;  3DRP A;  1RIL A;  4EZ9 A;  4ICL A;  1C1A A;  4FJJ A;  3K58 A;  4OLB A;  3VQP A;  3UIQ A;  1SKS A;  1Q9Y A;  1CXU A;  4B9S A;  5KGW A;  5E41 A;  4FJM A;  3OYN A;  1RBT A;  2XRI A;  2Z1J A;  3LAL A;  3V6D A;  1XC9 A;  4TSX A;  4DG1 A;  3VQ8 A;  1KRP A;  1FK9 A;  3U3Y A;  1RCH A;  3AA2 A;  3TAG A;  4FJ8 A;  1BCO A;  2XY8 A;  3LP0 A;  4CJ4 A;  3F73 A;  4HUF A;  3MEG A;  4H4O A;  2A1R A;  1RT3 A;  4ELV A;  1IKV A;  4FJH A;  1ZYQ A;  3HT3 A;  4IG0 A;  1Q8I A;  5I42 A;  1KVB A;  3QET A;  4DLG A;  3L2U A;  1HNI A;  1SL2 A;  3CFR A;  1IH7 A;  2RPI A;  1BI4 A;  3M8Q A;  3A2F A;  1NK9 A;  1ZBH A;  4CIG A;  2P5G A;  1NK0 A;  4DQR A;  1U47 A;  1D9F A;  3CM5 A;  3OYC A;  3OYI A;  4O0I A;  4F8R A;  1HYS A;  1B9F A;  1ASU A;  2I5J A;  1YTU A;  3OYM A;  4I7F A;  3VQD A;  1VSJ A;  5C42 A;  3NHG A;  3PV8 A;  5CYQ A;  3AO3 A;  1VSK A;  5EU7 A;  1RDB A;  1S1X A;  3TAB A;  3SUQ A;  4CEF A;  4CEO A;  1UWB A;  1JL2 A;  5FRN A;  1ZBL A;  2BGG A;  1RT4 A;  1S1W A;  5JS2 A;  4JS5 A;  1B92 A;  4CK3 A;  4ELU A;  1U4B A;  1BIU A;  1WSI A;  2O4G A;  1TL3 A;  3ZSZ A;  4FJI A;  4FJX A;  1KFD A;  3I8D A;  2YHA A;  2YKN A;  4GW6 A;  1X9W A;  2OPQ A;  4CIE A;  1S1T A;  2RF2 A;  3CYM A;  1RDD A;  1TKX A;  4HTU A;  3K5O A;  3BGR A;  4KHU A;  4AHU A;  4M3W A;  4DQP A;  1TKT A;  2XO7 A;  4KKO A;  4O44 A;  4CJT A;  3CQ8 A;  4FVM A;  3KLE A;  3MXM A;  3I0R A;  2ATQ A;  4RW8 A;  4KHQ A;  2ZE2 A;  3LPT A;  1HMV A;  2YV0 X;  3HYF A;  3JYT A;  3L8B A;  1NJY A;  4HVJ A;  4CHY A;  1DLO A;  3SJJ A;  4DF8 A;  1JXE A;  4CED A;  3BDP A;  2GV9 A;  1VRT A;  4OKK A;  5HRP A;  3NBP A;  3SCX A;  2HND A;  1SUQ A;  2JGU A;  5SZT A;  4CIF A;  2IAJ A;  2IOC A;  5HRR A;  1EKE A;  3OYH A;  1KLM A;  4DTN A;  4N41 A;  2D0B A;  1Z25 A;  2QXF A;  4CJW A;  3MEC A;  2FBY A;  2F8T A;  1KCF A;  2OPS A;  1TAQ A;  5CYM A;  3S9H A;  3SUO A;  4FK0 A;  2OPP A;  2LSN A;  4DSK A;  2VWK A;  3F9K A;  5J2P A;  3TI0 A;  4LD0 A;  4KV8 A;  1C0M A;  1WSF A;  3K5N A;  3M8R A;  1LAW A;  3THV A;  1WNS A;  1S1U A;  3ZSO A;  5HRN A;  1O1W A;  3DLE A;  1WSH A;  4CF8 A;  3TAP A;  4N76 A;  1UA0 A;  4DS4 A;  3CG7 A;  1QSY A;  1LW2 A;  2RN2 A;  4CJV A;  1K6Y A;  2Y1J A;  1SKR A;  1RT2 A;  4F2R A;  2G8K A;  4LH4 A;  1X9S A;  3ZSY A;  4B9N A;  4J2A A;  1LAV A;  4CGF A;  2FC0 A;  2OPR A;  3HJF A;  3PO5 A;  1HYV A;  5J2M A;  4AH9 A;  2HMI A;  1XHZ A;  3B6P A;  3NF9 A;  1X1P A;  3HP6 A;  3NGI A;  5J1E A;  4E7K A;  1QSS A;  3LZI A;  4DSI A;  3NF6 A;  1T05 A;  5DMR A;  3AVL A;  4I2P A;  1ZBU A;  2WON A;  3AVN A;  3ISN C;  1U48 A;  2Z1H A;  3QLH A;  5J2Q A;  1NK5 A;  3MXJ A;  4PUO A;  4DQS A;  1CLQ A;  3AA4 A;  2B6A A;  4O4G A;  2KFZ A;  1VSI A;  1CZB A;  4NCG A;  3QEX A;  2DY4 A;  3ZSR A;  1T8E A;  4CFD A;  3KK3 A;  1QSL A;  1BIS A;  5KGX A;  2OYQ A;  4CHN A;  1WSE A;  1EXQ A;  3TAQ A;  3QNN A;  3SQ2 A;  4FJN A;  3NAE A;  1FXX A;  3PX4 A;  3G10 A;  3HP9 A;  2Z1G A;  4AHT A;  3AA3 A;  4CE9 A;  4FLZ A;  1DTT A;  4CJE A;  3S3N A;  1JLB A;  3LAK A;  1YTA A;  3T1A A;  3WNH A;  4FLU A;  4F3O A;  2OZS A;  1Y97 A;  1BHL A;  3LDS A;  1TK0 A;  1BCM A;  3KD1 E;  3AVG A;  1VSF A;  2YNF A;  3K57 A;  4B9V A;  1RBV A;  1HNV A;  3K2P A;  1TGO A;  3P5J A;  4WE1 A;  3V9Z A;  4DFJ A;  4Z4E A;  3KLI A;  4BWM A;  4DS5 A;  4M3X A;  3NGZ A;  3ZCM A;  2HNY A;  3LZJ A;  3V9W A;  4HHT A;  3QIP A;  1RBU A;  3ZSV A;  2KTQ A;  4B08 A;  2R7Y A;  2G8V A;  3AO5 A;  3DLH A;  4KB1 A;  5CZ2 A;  2YNH A;  4BE0 A;  3KKR A;  3OYL A;  3EYZ A;  2HNZ A;  1D5A A;  1JLQ A;  3AVC A;  3DRR A;  3V9U A;  4CEC A;  3OYF A;  4ZTJ A;  1T03 A;  4J2D A;  1B9D A;  4JLH A;  3ZT2 A;  4CK2 A;  2HHV A;  4IFY A;  4F3T A;  4F2S A;  3MED A;  2Q3S A;  4QAG A;  5FRM A;  1KLN A;  2FBT A;  4ID5 A;  4Z4F A;  4FZX C;  1IO2 A;  1RDA A;  1HQU A;  3C95 A;  4CEB A;  3AO4 A;  1I39 A;  4CGD A;  4YFU A;  3OYB A;  4JRQ A;  3TAN A;  2HHX A;  4K8X A;  2HVH A;  1HRH A;  4HCB A;  2P5O A;  4HUG A;  4OLA A;  4ELT A;  1VSL A;  4CES A;  2F96 A;  3ZT3 A;  1RNH A;  1SV5 A;  3K59 A;  3V9X A;  4KB0 A;  4PY5 A;  1Q9X A;  3TAM A;  4CJU A;  4FXD A;  2HB5 A;  3DMJ A;  5T7B A;  1RT6 A;  4O0J A;  4FJ5 A;  2HHS A;  4DTX A;  4IKF A;  1VSD A;  3MXI A;  5FDL A;  3C6T A;  3O4N A;  4AHC A;  4BAC A;  3NCI A;  1Z26 A;  4RW4 A;  4AHV A;  1N6Q A;  3DLB A;  3VQ6 A;  1BI4 B;  4IBN A;  3KD5 E;  3HPH A;  3QER A;  3HVT A;  5HLF A;  1KTQ A;  4UQG A;  2XY7 A;  1VSH A;  3D0P A;  3NF8 A;  1A5W A;  2X78 A;  4CHQ A;  1C0U A;  4FJ7 A;  2Z1I A;  3ZT0 A;  2YHB A;  4NYF A;  4FM2 A;  4FJG A;  3NF7 A;  3E01 A;  3IS9 A;  3ALY A;  3SV3 A;  1KFS A;  3OJU A;  4CHO A;  4N56 A;  4IFV A;  1RBS A;  1D9D A;  3L3U A;  4KPY A;  3KLG A;  1TVR A;  1S9E A;  5KRS A;  2O4I A;  3VQC A;  1QQC A;  1HQE A;  3M8S A;  4KRE A;  4DFM A;  3SV4 A;  1CXQ A;  4CHZ A;  1R0A A;  1RBR A;  3RR8 A;  1IKW A;  4E7H A;  4PQU A;  5J2N A;  2E6M A;  4KHN A;  3AVF A;  4DSF A;  4L8R B;  2P51 A;  1EP4 A;  4CF1 A;  1JKH A;  4Y1C A;  3MEE A;  1TK5 A;  1L3U A;  4KAZ A;  3AVJ A;  4N47 A;  2F8S A;  4PWD A;  3LP1 A;  1XWL A;  5D3G A;  5JS1 A;  4E7L A;  3VQE A;  1RTI A;  4LY7 A;  2VG5 A;  4G1Q A;  1NOZ A;  3CFO A;  4KO0 A;  1N5Y A;  3B6O A;  3QIN A;  3VQ4 A;  2PZS A;  4E3S A;  1WSG A;  4AHS A;  4E1M A;  1JLC A;  4CFB A;  1DTQ A;  3KLH A;  4HCC A;  4DTR A;  3EZ5 A;  1NKB A;  4DQI A;  1TK8 A;  3AVM A;  3IRX A;  3AVB A;  1GOB A;  4B9L A;  4BDY A;  4E7J A;  4DQQ A;  2Y1I A;  2KZM A;  4MQ3 A;  1SL1 A;  4FM1 A;  1BL3 A;  4QCL A;  1NK4 A;  1S1V A;  4B9U A;  3PX0 A;  1RTJ A;  4E7I A;  4FW1 A;  4JRP A;  2BAN A;  4DMN A;  3QEV A;  4B9M A;  1BQN A;  3HVR A;  4FLW A;  3IG1 A;  4DTO A;  3QEW A;  4LSL A;  3VQ7 A;  3OYD A;  4CK1 A;  2AJQ A;  2IGI A;  1U45 A;  1JLF A;  4B8A B;  4CGJ A;  3TAF A;  1G15 A;  4M41 A;  2JLE A;  4FLX A;  2QK9 A;  4CGH A;  2DFF A;  4CJS A;  4KTQ A;  3V81 A;  5C24 A;  4CGI A;  3AVA A;  3NH1 A;  4RW7 A;  4CFC A;  3H08 A;  1SL0 A;  4FJ9 A;  4FK2 A;  2YNI A;  5DK5 A;  4HUE A;  2XY6 A;  1RTD A;  4FK4 A;  4C8O A;  1A5V A;  4ZHR A;  2D5R A;  3NDK A;  3ZT1 A;  4KTZ A;  4EP4 A;  3RMB A;  3NE6 A;  4CJQ A;  4Z0U A;  4MFB A;  4OGC A;  1TAU A;  3VQ5 A;  2DFE A;  1GOC A;  1FKO A;  2B5J A;  1I3A A;  3LAM A;  4CJ3 A;  1JLG A;  3L3V A;  3HPO A;  4C8L A;  2KQ2 A;  4RW6 A;  3O3G A;  3G0Z A;  3OYJ A;  3LWM A;  5HRS A;  4OPJ A;  4DTM A;  2VG6 A;  4Q5V A;  3OYG A;  1LV5 A;  1L3V A;  1ASW A;  4M3U A;  1TKZ A;  1W0H A;  4B9T A;  2YKM A;  3DLR A;  2KW4 A;  4PA1 A;  4C8M A;  5FRO A;  3V1R A;  5KRT A;  3MAQ A;  4DSE A;  3SQ1 A;  2HHT A;  4I2Q A;  4W5O A;  4CEA A;  3VQB A;  4ZTF A;  3KK1 A;  1QS4 A;  4B3O A;  3HL8 A;  4OPK A;  3HM9 A;  4W5Q A;  4FCY A;  2P1J A;  2KZZ A;  1UOC A;  1C6V A;  2QKB A;  4BE1 A;  1SKW A;  4FYD A;  2E4L A;  5CZ1 A;  4EZ6 A;  3OS0 A;  2BDP A;  2HW3 A;  4FZY A;  4DFK A;  5K14 A;  3LP2 A;  2ZD1 A;  1KVC A;  3O3F A;  2X74 A;  1IG9 A;  3JSM A;  3NFA A;  4CHP A;  4C8K A;  4NCA A;  3VA0 A;  1U04 A;  1T7P A;  3HK2 A;  4GMJ B;  2KFN A;  1BIZ A;  3HST B;  4GVM A;  4CJF A;  4JS4 A;  4F4K A;  3SZ2 A;  1HYZ A;  3V9S A;  4Z4I A;  4M3Z A;  4CEZ A;  4XIU A;  3FFI A;  3M8P A;  4CF2 A;  4FLV A;  1TL1 A;  4RW9 A;  4E89 A;  1ASV A;  4Z4H A;  3SPZ A;  4NCB A;  3SUP A;  5HP1 A;  1U49 A;  3PY8 A;  3NH2 A;  4KTW A;  5KTQ A;  4DFP A;  3TAR A;  1WAJ A;  2FBX A;  4DLE A;  3SUN A;  1J9A A;  3DLK A;  1C0T A;  3TWH A;  4CGG A;  3KKS A;  4DTJ A;  3WNE A;  4CEQ A;  2RKI A;  4M3R A;  1YVU A;  2XHB A;  1JLE A;  3ZSW A;  4E19 A;  3OJS A;  3VQ9 A;  3SQ4 A;  1RT1 A;  1W9H A;  1YT3 A;  2HHW A;  5CY4 A;  4CJR A;  1UAX A;  4OJR A;  3ZSQ A;  4RG8 A;  3ZSX A;  4KHW A;  2HHQ A;  4KI4 A;  3DM2 A;  4DTP A;  3DLG A;  3VQQ A;  1LWE A;  4I9L A;  4J2B A;  3V1Q A;  3PO4 A;  3ULD A;  2PYL A;  3K5L A;  3SI6 A;  1NOY A;  3HO1 A;  2W42 A;  3KTQ A;  1XI1 A;  1ITG A;  2OA8 A;  4Z4G A;  4AIL C;  2G8W A;  1XHX A;  2B4J A;  4DTS A;  3T3F A;  3AA5 X;  3TR8 A;  3HXM A;  3RMC A;  1ZBF A;  2EHG A;  1L3T A;  4DSJ A;  4M3Y A;  3QO9 A;  4O5B A;  5HBM A;  1RDC A;  3L2V A;  3VA3 A;  3EY1 A;  1JL1 A;  2G8F A;  4CJK A;  1F21 A;  4FJK A;  1ZBI A;  4M3T A;  4W5R A;  3TAE A;  1KVA A;  3ZT4 A;  3KLF A;  3U3G A;  4CFA A;  1QE1 A;  1VRU A;  2ZQB A;  3V1O A;  2IDO A;  3NH0 A;  4OKE A;  3QIO A;  3K5M A;  3RMD A;  4DSL A;  1S9G A;  4AHR A;  3L2R A;  3AV9 A;  4M45 A;  4E0D A;  4KHY A;  4CJ5 A;  4DU1 A;  2DFH A;  4DU3 A;  1EET A;  3S3O A;  2HVI A;  4KFB A;  1NK6 A;  2D0C A;  2DTU A;  3PUF A;  2VG7 A;  3PX6 A;  1A5X A;  4CCH A;  1QTM A;  4KRF A;  4K8Z A;  2A1S A;  3ITH A;  1TV6 A;  2G8H A;  4C8N A;  4DTU A;  3HPG A;  3P83 D;  4YNQ A;  3L2W A;  1IKY A;  4FW2 A;  3OYK A;  1JLA A;  1UA1 A;  2G8U A;  2PYJ A;  1NJX A;  4Q0B A;  4N5S A;  1LWC A;  3KIO A;  3WNG A;  4W5N A;  3CM6 A;  2BE2 A;  2XY5 A;  1BQM A;  3D45 A;  4LSN A;  4DF4 A;  1WSJ A;  2IC3 A;  3I0S A;  3LAN A;  1EX4 A;  4W5T A;  1MU2 A;  5C25 A;  4DWI A;  3RTV A;  3RR7 A;  2GBZ A;  5KI6 A;  2QKK A;  1S6Q A;  3IAY A;  1J53 A;  3SQ0 A;  4EP5 A;  4OKJ A;  3VQA A;  3OYE A;  4R5P A;  2G8I A;  1CZ9 A;  1QHT A;  2X6S A;  4CJL A;  2X6N A;  3RRG A;  4FLY A;  2PY5 A;  4BDP A;  1WLJ A;  3DRS A;  1RTH A;  3OVN A;  2ETJ A;  1VSM A;  3AO2 A;  3LWL A;  4B8C A;  1WN7 A;  3QNO A;  4LH5 A;  3RRH A;  3SPY A;  1RT7 A;  1WAF A;  2ITG A;  3DYA A;  4ID1 A;  3OS1 A;  3WNF A;  2VWJ A;  5HRO A;  3S3M A;  4J2E A;  4IG3 A;  1FKP A;  3QEI A;  4KI6 A;  1LWF A;  4BWJ A;  1J5O A;  4CEE A;  1VSE A;  3VN5 A;  4E1N A;  3O3H A;  1IKX A;  1NK7 A;  3OYA A;  1NJW A;  5SWM A;  1NJZ A;  4QOZ B;  1S5J A;  3T19 A;  1BGX T;  2EX3 A;  4KHS A;  3U6F A;  2D0A A;  3SNN A;  2E6L A;  4FLT A;  4CF9 A;  4Z4C A;  3V4I A;  3CFP A;  4Y1D A;  3C94 A;  4CER A;  3DOL A;  1NKC A;  3DOK A;  3SYZ A;  4I9Q A;  4OVL A;  3LPU A;  1C1C A;  3LP3 A;  4H4M A;  3KJV A;  1JXB A;  2FBV A;  3ASM A;  4DU4 A;  1RT5 A;  3RMA A;  3AVK A;  3NGY A;  1NK8 A;  1X9M A;  3C6U A;  3L2Q A;  1HPZ A;  3DI6 A;  4NYN A;  3P1G A;  1S6P A;  4H8K A;  2WOM A;  5I3U A;  3RWU A;  1GOA A;  1REV A;  4FZZ A;  2OZM A;  3KK2 A;  4CF0 A;  4IDK A; 
#chains in the Genus database with same CATH topology
 4CZK A;  4BE2 A;  4IO8 A;  4FJL A;  2IS3 A;  3CCR N;  2GUI A;  2CGL A;  2ZWH A;  3AVI A;  3A8Y A;  4A57 A;  2HHU A;  2NUB A;  1L3S A;  1LW0 A;  3M1F A;  2QXL A;  4A2B A;  2KLA A;  4ICL A;  5AQV A;  4WFA L;  4DB3 A;  3TSU A;  3UIQ A;  1QQM A;  4OLB A;  1OH7 A;  3K9J A;  1CXU A;  4FJM A;  2O8E A;  2XRI A;  3V6D A;  3THW A;  4DG1 A;  3TAG A;  1RCH A;  4CJ4 A;  4H4O A;  3TTC A;  2A1R A;  4NXN K;  4K0K K;  1IKV A;  1ZYQ A;  3HT3 A;  5I42 A;  1DT9 A;  4MLH A;  5JIC A;  1YIJ N;  5F0X A;  4CIG A;  4JAX A;  3CM5 A;  1HYS A;  4O0I A;  1B9F A;  3OYM A;  1VQ7 N;  3VQD A;  1VSJ A;  3PV8 A;  2WBN A;  1Z6R A;  1RDB A;  4FPB A;  5FRN A;  1RT4 A;  4JS5 A;  1B92 A;  4YDU C;  4JI4 K;  2E8A A;  1I94 K;  2P9S B;  5TKY A;  1RDD A;  3BGR A;  1Q7Y O;  1JJ2 M;  4IDH A;  1SQK A;  2XO7 A;  4CJT A;  3CQ8 A;  3KLE A;  3I0R A;  2ATQ A;  3LPT A;  4J8F A;  4K43 A;  4CIF A;  4GV6 A;  1KLM A;  3TU5 A;  3MEC A;  1KCF A;  2A40 A;  5CYM A;  3S9H A;  4DSK A;  3H46 O;  3ZX0 A;  1E4G T;  4AF1 A;  4KV8 A;  1C0M A;  1LAW A;  3CET A;  3THV A;  5HRN A;  1O1W A;  1YJW N;  3HBT A;  4FWS A;  5IT9 O;  3NMU A;  1QSY A;  4CJV A;  3P39 A;  2Y1J A;  1K73 O;  4KHP K;  4J2A A;  4B9N A;  4MO5 A;  4IEE A;  2OPR A;  3PO5 A;  1HYV A;  4WF9 L;  5J2M A;  1X1P A;  3NGI A;  5J1E A;  1GLA G;  3I8B A;  4C1N I;  3UKR B;  3K0S A;  3ENO A;  3NF6 A;  1T05 A;  4I2P A;  1ZBU A;  2A6A A;  3DXM B;  3NVK A;  1NK5 A;  1HNZ K;  3QBX A;  4KBO A;  4PUO A;  3F9M A;  2KFZ A;  2E2O A;  2UXD K;  1GLL O;  4HTL A;  4NCG A;  3QFP A;  3KK3 A;  3ATU A;  1EWR A;  4CHN A;  1EXQ A;  4DKW A;  4FJN A;  3PX4 A;  2P9I B;  2IIR A;  2Z1G A;  3HP9 A;  4M63 C;  4AHT A;  2GWK A;  3AA3 A;  4FLZ A;  3BF1 A;  4MLE A;  1JLB A;  2OZS A;  3H1V X;  3TTD A;  1TK0 A;  3LDS A;  1BCM A;  2YNF A;  3K57 A;  1R59 O;  3SBG A;  5M1Q A;  4WE1 A;  3SLC A;  4Z4E A;  4BWM A;  4DS5 A;  4M3X A;  3ZCM A;  3LZJ A;  3ZSV A;  4B08 A;  1VHX A;  2R7Y A;  5CZ2 A;  4QS8 A;  1ATN A;  5AQH A;  4J2D A;  4LF5 K;  2HHV A;  4F2S A;  2Q3S A;  4OPH A;  4QAG A;  4ID5 A;  5M1O A;  1RDA A;  4JRQ A;  1IG8 A;  4NLB A;  2HHX A;  2QWL A;  4BR0 A;  5BPN A;  2W6L A;  4EIA A;  1Q9X A;  4CJU A;  5ADX H;  4FXD A;  2HB5 A;  2O8D A;  3BUZ B;  1OH6 A;  3ZLJ A;  5KPZ A;  3CJ1 A;  3MX2 A;  4IOA L;  4FWP A;  5FDL A;  3UKU A;  3BZK A;  1T44 A;  1Z26 A;  4RW4 A;  4BRE A;  3VQ6 A;  4IBN A;  4BRN A;  4CZE A;  2XY7 A;  1VSH A;  2A41 A;  1C0U A;  4PKG A;  2Z1I A;  3ZT0 A;  4FM2 A;  4FJG A;  2O8F A;  3HRG A;  4N56 A;  1D9D A;  1GLF O;  4JD2 B;  3DLL L;  1YHQ N;  3MCA B;  2UYT A;  1E4F T;  1QQC A;  4ISE A;  3M8S A;  4KRE A;  4DFM A;  2E1Z A;  1WOQ A;  4PQU A;  3MWP A;  2P51 A;  4CF1 A;  1YXQ A;  2F8S A;  3MEE A;  5JS1 A;  2OAN A;  3LP1 A;  4E7L A;  2VG5 A;  4G1Q A;  1NU0 A;  2YJF A;  4AHS A;  1JLC A;  3KLH A;  3EZ5 A;  4AQY K;  1NKB A;  2QM1 A;  4DQI A;  3AVM A;  3IRX A;  1GOB A;  2Y1I A;  4FM1 A;  1VQM N;  4QCL A;  1S1V A;  3A5M C;  3C7N B;  3VTH A;  4E7I A;  2BAN A;  3HVR A;  5ADX A;  1HKB A;  3IG1 A;  4DTO A;  4LSL A;  4CZI A;  2AJQ A;  1C0F A;  4PL7 A;  2FSN A;  4CGJ A;  2P9U B;  2WFB A;  2HOE A;  4B1V A;  4M41 A;  4LF8 K;  2GWJ A;  2F4V K;  3AVA A;  3NH1 A;  3THX B;  2UUA K;  4FJ9 A;  4LF6 K;  4HUE A;  4FK4 A;  3ENB A;  4JEP A;  5AQR A;  3CER A;  5EY4 A;  2YJE A;  3VEO A;  4MFB A;  2HMP A;  2DFE A;  3HPO A;  2KQ2 A;  3G0Z A;  4BR2 A;  1ASW A;  2QW9 A;  1VQ6 N;  1TKZ A;  2YKM A;  1YI2 N;  2UUC K;  4C8M A;  4DR6 K;  4MO4 A;  3SQ1 A;  2QWN A;  4ZTF A;  1HNX K;  4OPK A;  4FCY A;  1UOC A;  3MN9 A;  4JI3 K;  3HOT A;  2JWK A;  2BDP A;  5AQF A;  4DFK A;  4FZY A;  5K14 A;  3LP2 A;  3ULE B;  3IFR A;  3VA0 A;  4GVM A;  3LDN A;  3V9S A;  3SMS A;  4M3Z A;  3IUC A;  1XMQ K;  3M8P A;  4CF2 A;  1ASV A;  4Z4H A;  3SPZ A;  4KTW A;  3TAR A;  4DLE A;  1C0T A;  3Q7B A;  3VF2 A;  1KAX A;  2RKI A;  5AQZ A;  2XHB A;  1K9M O;  4E19 A;  3O9Q A;  1RT1 A;  5CY4 A;  4KHW A;  2KKZ A;  3ULD A;  2PYL A;  3SI6 A;  2OA8 A;  3CXC M;  4BRK A;  4CJ7 A;  5BRH A;  1NGG A;  3S41 A;  3RMC A;  3FR0 A;  3FZL A;  3HXM A;  1L3T A;  4RWT A;  3ZX3 A;  1YF5 L;  5JLF A;  1JL1 A;  4DUY K;  1QZ5 A;  4M3T A;  4W5R A;  3VEW A;  3ZT4 A;  1KAZ A;  3EEQ A;  1BO5 O;  4A61 A;  1QE1 A;  5A2Q O;  3V1O A;  4OKE A;  3QIO A;  1NGE A;  4DSL A;  5F2R A;  5AZJ A;  3ZEU B;  4YHH K;  4FPA A;  2VGM A;  2W41 A;  3LDQ A;  4DU1 A;  4HWI A;  4CZF A;  4JHD A;  1NK6 A;  2D0C A;  3R6M A;  2VG7 A;  4BRP A;  1A5X A;  4FOE A;  1VQN N;  5CE3 A;  3L4I A;  1NGC A;  5JLH A;  4Q0B A;  4B1W B;  3M3Z A;  3CPW M;  3KIO A;  2P9N B;  3HM8 A;  2XY5 A;  1WSJ A;  1G99 A;  4BR9 A;  4W5T A;  1EX4 A;  4H0T B;  5FLX O;  3EO3 A;  2QWM A;  1S6Q A;  3IAY A;  4OO1 J;  3VQA A;  3OYE A;  4R5P A;  4NLC A;  2X6S A;  4DV1 K;  1ATR A;  2PY5 A;  1WLJ A;  1QHA A;  3DRS A;  3OVN A;  2YI1 A;  1VSM A;  3O4W A;  4LH5 A;  3RRH A;  1S22 A;  3H45 C;  1J6Z A;  1WAF A;  4ID1 A;  2ITG A;  2VWJ A;  3S3M A;  1P8Z A;  4IG3 A;  1O13 A;  2W40 A;  3KHY A;  4CEE A;  3VES A;  1NK7 A;  4FSV A;  3OYA A;  2VGN A;  4QOZ B;  2O8B A;  1BGX T;  2EX3 A;  1VQ4 N;  3EL2 A;  4DHY A;  2E6L A;  4CF9 A;  3V4I A;  3DOL A;  1NKC A;  5FPM A;  4OVL A;  3KJV A;  3F5T A;  2FBV A;  4DU4 A;  4AM7 A;  2P9P B;  1NK8 A;  4ILH A;  3P1G A;  4H8K A;  3RWU A;  4FZZ A;  1C1B A;  4O55 A;  3AVH A;  3QES A;  1HKG A;  4CJP A;  5GAH P;  5FPD A;  1J54 A;  1D8Y A;  1L5U A;  3OBW A;  3AAP A;  3DRP A;  4XH1 A;  1RIL A;  4EZ9 A;  1C1A A;  1T3V A;  3K58 A;  4H5W A;  3VQP A;  1NMD A;  1SKS A;  4YOW A;  1RBT A;  1IBK K;  4EHU A;  3VQ8 A;  1KRP A;  5M1N A;  5GIO A;  3EE9 A;  1XQS C;  4CBX A;  2XY8 A;  4FJH A;  3MEG A;  2HHH K;  4ELV A;  3FZH A;  3N4Q A;  4H5V A;  1QQO A;  1Q8I A;  5I9E B;  1KVB A;  2P9K B;  1HNI A;  1HPM A;  3M8Q A;  2P5G A;  4EAH D;  2FF3 B;  1VQO N;  1M1K O;  3THW B;  2YX6 A;  1ASU A;  2I5J A;  4JKD A;  4LC9 B;  1S1X A;  2HBJ A;  2A3Z A;  4CEF A;  1JL2 A;  5BRE A;  5AQG A;  1S1W A;  1RDW X;  3PIO L;  4ELU A;  4BRL A;  4B1U B;  4NB4 A;  2V52 B;  3I8D A;  1C0G A;  2AP1 A;  4GW6 A;  2OPQ A;  4CIE A;  1S1T A;  1TKX A;  4BRM A;  1U2V A;  4O44 A;  3MXM A;  3SAG A;  2ZE2 A;  1N33 K;  3HYF A;  3JYT A;  4WFN L;  3L8B A;  4HVJ A;  1DLO A;  3OBY A;  2QI2 A;  4OKK A;  1SUQ A;  5SZT A;  3TTF A;  2IAJ A;  4XH5 A;  4H0Y B;  3T69 A;  1D4X A;  3OYH A;  4N41 A;  1N32 K;  2WTU A;  1Z25 A;  4CJW A;  1Q82 O;  3JS6 A;  4FK0 A;  3SUO A;  4JKG B;  2VWK A;  1Q86 O;  1WSF A;  3D2E B;  3OHR A;  4DR4 K;  1S1U A;  3ZSO A;  3TAP A;  4N76 A;  1UA0 A;  2RN2 A;  4DV7 K;  2G8K A;  2A5X A;  1X9S A;  2FC0 A;  4DV2 K;  3HJF A;  3WXK A;  1NGF A;  2HMI A;  5LY3 A;  3B6P A;  1WUA A;  3PSI A;  1BDG A;  4O5F A;  5KQ8 A;  4DSI A;  3ID8 A;  1NGA A;  5DMR A;  5EOY A;  3AVN A;  1ZBS A;  3ISN C;  2Q97 A;  1WBD A;  3QLH A;  3E9L A;  3J8A A;  3CCQ N;  3BF3 A;  3MXJ A;  3WUH A;  3AA4 A;  4O4G A;  4IJN A;  4DV4 K;  1CZB A;  4WQ4 A;  2DY4 A;  3ZSR A;  4CFD A;  1QSL A;  1VQK N;  5CR4 A;  4B3R K;  3DJC A;  2CH5 A;  1NGJ A;  1YTA A;  4I6M B;  3WNH A;  5H1S Q;  1NLV A;  1BHL A;  3KD1 E;  4FO0 A;  2FXU A;  3AVG A;  4B9V A;  3K2P A;  4BR5 A;  3J80 O;  3NGZ A;  1YUW A;  3V9W A;  4GKJ K;  3AO5 A;  3KWG A;  4JK8 A;  3OYL A;  3EYZ A;  2HNZ A;  3AVC A;  3QIC A;  1ZXO A;  1T03 A;  3HOS A;  1B9D A;  3ZT2 A;  4BC5 A;  2RHK A;  4IFY A;  4F3T A;  3MED A;  3VMF B;  2NZT A;  1NBW A;  3C95 A;  4CEB A;  3GOI A;  3TAN A;  4ISG A;  2HVH A;  1HRH A;  4H03 B;  2P5O A;  4HCB A;  2F7T A;  3O9S A;  3K59 A;  3V9X A;  1SV5 A;  2V7Z A;  5GAE P;  5AQS A;  1W97 L;  4FJ5 A;  4IZ9 A;  1VSD A;  4YOT A;  4DR7 K;  3C6T A;  2IVN A;  3NCI A;  2W6K A;  3KD5 E;  5C2D A;  1BI4 B;  4DV6 K;  3QER A;  3HVT A;  4JKF A;  5HLF A;  5BRF A;  3D0P A;  3NF8 A;  1A5W A;  2X78 A;  4CHQ A;  2YHB A;  3E01 A;  3OA9 A;  5C15 A;  4DV0 K;  1KFS A;  3OJU A;  1RBS A;  3MN7 A;  4BRC A;  4LF4 K;  2HBL A;  3LDO A;  3AAR A;  1YJ9 N;  3KLG A;  5E84 A;  2O4I A;  1HQE A;  1CXQ A;  1XNR K;  1RBR A;  5AQP A;  4DSF A;  1EP4 A;  2WUS A;  4ISF A;  3U8X A;  1RTI A;  4BR7 A;  4E3S A;  1DTQ A;  4HCC A;  4FWK A;  1TK8 A;  3ZET A;  2EWS A;  3AVB A;  4DQQ A;  3A5O C;  1BL3 A;  4GV9 A;  1RTJ A;  3QEV A;  4DMN A;  3QEW A;  4H0V B;  3VQ7 A;  3AGR A;  1JLF A;  3P38 A;  1KAY A;  3THY B;  4FLX A;  2P9L B;  1K8A O;  5AZI B;  2QWP A;  4CJS A;  5IWA K;  3FZF A;  3IMX A;  2GUP A;  3FZM A;  4JKC A;  5DK5 A;  2XY6 A;  1RTD A;  1K8K B;  5DM6 L;  2D5R A;  3RSE A;  4EP4 A;  4KTZ A;  3A5L C;  1TAU A;  1GOC A;  1I3A A;  5BR9 A;  3L3V A;  4C8L A;  4RW6 A;  5MLC Q;  3OYJ A;  1L3V A;  3CIP A;  5AQY A;  4B1Y B;  3U9D A;  4B9T A;  2YHW A;  3GG4 A;  3CCU N;  5FRO A;  3V1R A;  2HHT A;  3L6Q A;  1VQL N;  1MWM A;  3BZC A;  3VQB A;  1X9J A;  4W5Q A;  1KC8 O;  2QKB A;  2E4L A;  5CZ1 A;  3VGK A;  1IJJ A;  2HW3 A;  1KVC A;  2ZD1 A;  3O3F A;  2X74 A;  3NFA A;  4CHP A;  5B8H A;  4NO7 A;  1U04 A;  5GAG P;  2KFN A;  3ID6 A;  3VEX A;  4F4K A;  4L3Q A;  2NRX A;  4CEZ A;  3H3O B;  4BGB A;  1VAZ A;  3PY8 A;  4WCE L;  5KTQ A;  2V7Y A;  2ZGZ A;  3TWH A;  4CGG A;  3KKS A;  2CH6 A;  4CEQ A;  3ZSW A;  4U7B A;  3VQ9 A;  1W9H A;  4JKA A;  3D2F B;  4OJR A;  2HHQ A;  4DTP A;  2FSJ A;  3DLG A;  3VQQ A;  1LOT B;  2E5L K;  3PO4 A;  4J2B A;  2P9S A;  3KTQ A;  4M7X A;  4AIL C;  4EFH A;  1XHX A;  4DTS A;  3LM2 A;  3TR8 A;  3CD6 N;  2BH1 A;  4M3Y A;  3QO9 A;  1RDC A;  2Q31 A;  4CJK A;  1T6C A;  1NJI O;  4FJK A;  1ZBI A;  1TYQ A;  3J7Z O;  1BOT O;  3TAE A;  1KVA A;  3KLF A;  5BPL A;  4QS9 A;  4CFA A;  4YOX A;  3CPE A;  2VQE K;  1KD1 O;  3K5M A;  3AAQ A;  1S9G A;  3S3O A;  3BEX A;  4BGA A;  3G6E N;  2DTU A;  3PUF A;  3IKM A;  3VEY A;  1SS6 A;  3PX6 A;  3I56 N;  4CCH A;  4JI1 K;  4K8Z A;  4C8N A;  4DTU A;  3HPG A;  3P83 D;  2G8U A;  2UU9 K;  4FW2 A;  3OYK A;  3SK3 A;  4DCH A;  4N5S A;  3FE1 A;  3Q7C A;  3CM6 A;  1YJN N;  1BQM A;  1TUY A;  5HOO A;  3O1B A;  1MU2 A;  4DWI A;  2D4W A;  3RTV A;  3RR7 A;  5KI6 A;  3W3D A;  3SQ0 A;  3GBT A;  3CF5 L;  2G8I A;  3WEE B;  1CZ9 A;  1QHT A;  2X6N A;  3UKR A;  1NNE A;  4BDP A;  3KZB A;  4EHT A;  3QNO A;  2ETJ A;  2I7N A;  3VGM A;  4PL8 A;  4YOY A;  3QEI A;  2J4R A;  4KI6 A;  2Q36 A;  1LWF A;  4DR2 K;  4BWJ A;  4E1N A;  1VQ8 N;  2Q0R A;  4CZH A;  2RE2 A;  3U6F A;  3EZW A;  1H1V A;  2P9I A;  2F9T A;  3CQX A;  5C10 A;  3VEZ A;  3CFP A;  4Y1D A;  4CER A;  1T6D A;  3DOK A;  1C1C A;  5BRD A;  2OTJ N;  2VYP A;  3NGY A;  5DM7 L;  1HPZ A;  4NYN A;  3ATV A;  5BR8 K;  1GOA A;  3U4L A;  1NM1 A;  2OZM A;  4CF0 A;  2F9W A;  3MDQ A;  4M42 A;  1VK0 A;  3O4Q A;  4FM0 A;  3D7E O;  2YNG A;  4YY3 K;  4LFB K;  3AO1 A;  3AGK A;  1TKD A;  4A5A A;  3QEP A;  1HKC A;  1KSP A;  4NXM K;  5EXW A;  4FJJ A;  5AQX A;  4FL9 A;  5KGW A;  1W7A A;  3OYN A;  2Z1J A;  3LAL A;  1XC9 A;  5KQD A;  4FJ8 A;  3WXI A;  3U9Z A;  5BPM A;  4HUF A;  1ZC6 A;  1RT3 A;  3GDQ A;  3HTV A;  4IG0 A;  4GKK K;  3L2U A;  1SL2 A;  1NK9 A;  1OH8 A;  3A2F A;  2YCH A;  3ENH A;  4F8R A;  3OYI A;  5M1K A;  1XUP O;  5AJ3 K;  4I7F A;  3NHG A;  5CYQ A;  3AO3 A;  1VSK A;  4WYB A;  5EU7 A;  2O8C B;  3TAB A;  3SUQ A;  2D0P A;  5JVG L;  2BTF A;  2BGG A;  5JS2 A;  2HF4 A;  4JD2 A;  1U4B A;  2GX9 A;  2O4G A;  3ZSZ A;  2YKN A;  1X9W A;  3CYM A;  4HTU A;  5LJV A;  3FLC O;  4JK7 A;  4KHU A;  4BY9 C;  4AHU A;  4DR3 K;  2NRZ A;  4B3T K;  4JKB A;  4KHQ A;  1HMV A;  2YV0 X;  2ZJR L;  1NJY A;  4CHY A;  1KXP A;  1JXE A;  3VEN A;  4CED A;  3BDP A;  2GV9 A;  3LDL A;  3R8E A;  1VRT A;  5HRP A;  4JNE A;  3NBP A;  5ELZ A;  2HND A;  3SCX A;  2IOC A;  2Q0U A;  5HRR A;  1U2V B;  1DEJ A;  4OX9 K;  2D0B A;  4E1J A;  2FBY A;  3EKU A;  2OPS A;  3C7N A;  1TAQ A;  2QWQ A;  3F9K A;  3TI0 A;  4LD0 A;  3M8R A;  1WNS A;  3TSP A;  2ZJP L;  3DLE A;  1WSH A;  1KQS M;  3CG7 A;  3PLA A;  1LW2 A;  1K6Y A;  1SKR A;  5C0Y A;  4GV3 A;  4LH4 A;  3ZSY A;  3THX A;  4AH9 A;  3WXL A;  4AM6 A;  3HP6 A;  3CJA A;  4YDU A;  3LZI A;  4E7K A;  1YVN A;  1QSS A;  4H5T A;  3OW2 M;  1HR0 K;  4QS7 A;  4DUZ K;  1U48 A;  2Z1H A;  5J2Q A;  4O8K A;  5EVZ A;  3T1H K;  1CLQ A;  4JKE A;  1MA9 B;  1VSI A;  3VF4 A;  3QEX A;  1NWK A;  3JAM O;  1T8E A;  5KGX A;  3O80 A;  3CC7 N;  3SAF A;  1WSE A;  3TAQ A;  3QNN A;  4JI5 K;  3SQ2 A;  5EX5 A;  2NRH A;  4CZL A;  2UXC K;  4CJE A;  3T1A A;  4FLU A;  3T7Z A;  1YAG A;  4F3O A;  3CCL N;  1HX1 A;  3V9Z A;  3P5J A;  2HNY A;  3R1X A;  5GIN A;  4CBU A;  2IVP A;  1RBU A;  2KTQ A;  2YNH A;  5AQQ A;  3KKR A;  4BC3 A;  4BE0 A;  1D5A A;  1Y64 A;  4CEC A;  4ZTJ A;  4JLH A;  2DPN A;  4KH4 A;  4U67 L;  4CVN E;  5FRM A;  1KLN A;  2FBT A;  4CGD A;  4BRD A;  1I39 A;  4YFU A;  3OYB A;  1Q81 O;  4FWO A;  5AQM A;  4HUG A;  1Q18 A;  1VSL A;  3HI0 A;  3ZT3 A;  4JI2 K;  4CD3 A;  4KB0 A;  1QVF M;  1FW6 A;  3TAM A;  2O8E B;  3DMJ A;  3VTI A;  1RT6 A;  4O0J A;  4BRI A;  3DWL A;  4IEI A;  2OCE A;  4IJA A;  1ATS A;  3O9R A;  3OTO K;  2FF6 A;  1HJO A;  3DLB A;  3O4N A;  4BAC A;  1NG9 A;  3DXK A;  3HPH A;  4K42 A;  1KTQ A;  4XH4 A;  2BUP A;  4FJ7 A;  4H0O A;  2JWL A;  3NF7 A;  3IS9 A;  3ALY A;  3ZEU A;  5KRS A;  3VQC A;  3SV4 A;  4BQL A;  4CHZ A;  1R0A A;  3NVM A;  3RR8 A;  4E7H A;  4GY2 B;  3AVF A;  4L8R B;  5HL7 L;  4KAZ A;  4Y1C A;  3AVJ A;  5D3G A;  1XWL A;  2UXB K;  3VQE A;  1NOZ A;  2P9N A;  3CFO A;  3B6O A;  4BVP A;  3N4P A;  3VQ4 A;  2PZS A;  1WSG A;  4CFB A;  3CCM N;  5GAD P;  1GLD G;  5LMU K;  4IOX A;  3JXU A;  5KPT A;  4BDY A;  4E7J A;  3FFK B;  2KZM A;  4DV3 K;  4B9U A;  1QVG M;  4FW1 A;  3I55 N;  1BQN A;  4BG9 A;  3AY9 A;  2E2Q A;  4FLW A;  3OYD A;  4LFC K;  3O1W A;  1U45 A;  5BN9 A;  3TAF A;  1G15 A;  2NRT A;  4OPA A;  2JLE A;  3O9U A;  1OKJ A;  4LF9 K;  4CGH A;  2DFF A;  3O5B A;  1P90 A;  3V81 A;  1IV0 A;  5FPN A;  4RW7 A;  3H08 A;  4FK2 A;  2YNI A;  3KVG A;  1EWQ A;  2E2N A;  1A5V A;  4ZHR A;  1BA1 A;  3TPQ A;  2E1Y A;  3NE6 A;  4BRA A;  4JYA K;  2ZF5 O;  4CJ3 A;  2P9P A;  1JLG A;  4PHT X;  3FGU A;  4C1N K;  3O3G A;  3LWM A;  2PFU A;  4OPJ A;  1LV5 A;  4Q5V A;  3RVC A;  4M3U A;  4CW7 B;  4CZM A;  1RGI A;  1W0H A;  3PSF A;  2KW4 A;  4K25 A;  1JCF A;  3MAQ A;  4DSE A;  1Z05 A;  4I2Q A;  4V19 S;  4W5O A;  4B3S K;  4CEA A;  4YOR A;  3HM9 A;  2KZZ A;  1C6V A;  4EZ6 A;  1WBB A;  3OS0 A;  2NRR A;  3ZX2 A;  4C8K A;  4NCA A;  1T7P A;  3E66 A;  3WT0 A;  3HST B;  4JS4 A;  1HYZ A;  2P9K A;  4Z4I A;  3C65 A;  3FFI A;  4FLV A;  4RW9 A;  4E89 A;  5HP1 A;  1SZ2 A;  3O8M A;  1N8R O;  4IFE A;  4JI7 K;  4BC2 A;  1JLE A;  1UAX A;  3ZSX A;  2O8D B;  3C6A A;  4I9L A;  3HO1 A;  3V1Q A;  1IBL K;  3K5L A;  1NOY A;  1XNQ K;  1XI1 A;  1ITG A;  4JK9 A;  4Z4G A;  2G8W A;  3A0I X;  3QBW A;  3UKU B;  3VOV A;  3AA5 X;  2EHG A;  5HBM A;  3G4S N;  3VA3 A;  3EY1 A;  3QB0 A;  4CZG A;  2O8F B;  1M90 O;  3O6W A;  3VF6 A;  1VRU A;  2ZQB A;  3J7Y P;  5AFU A;  3NH0 A;  3QFU A;  3AV9 A;  5C2F A;  4E0D A;  4KHY A;  2HVI A;  2E2P A;  2DFH A;  4UY8 O;  3EKS A;  4KFB A;  1TYQ B;  4JKG A;  2A1S A;  1TV6 A;  2G8H A;  3L2W A;  1UA1 A;  2PYJ A;  3D2E A;  1LCU A;  2I7P A;  5AQK A;  2GEL A;  1NJX A;  3MN5 A;  3D45 A;  4LSN A;  2IC3 A;  5C25 A;  2GBZ A;  1MWK A;  4EP5 A;  4OKJ A;  3WXM B;  2QTD A;  4CJL A;  3LDP A;  3GE1 A;  1RTH A;  2WC9 A;  4B8C A;  3MN6 A;  3SPY A;  1RT7 A;  4J2E A;  3SBT A;  1FKP A;  1VSE A;  3O3H A;  1IKX A;  3CJC A;  1NJW A;  1U6Z A;  5SWM A;  3BP8 A;  1NJZ A;  3T19 A;  4B1X B;  4KHS A;  1QQN A;  1EQY A;  2HF3 A;  2QA4 N;  2D0A A;  3SNN A;  2ZGY A;  5LMN K;  3MK6 A;  5FPE A;  4Z4C A;  4LFA K;  3C94 A;  4JV5 K;  4I9Q A;  4I6M A;  3R3L A;  4H4M A;  5GIP A;  3ASM A;  1ESV A;  1X9M A;  3C6U A;  3L2Q A;  1S6P A;  3C0B A;  2E20 A;  3D6R A;  4JI6 K;  3KK2 A;  4IDK A;  1NKE A;  3LM9 A;  1MDU B;  1HJR A;  3VGL A;  1RFQ A;  4WQ5 C;  4KH5 A;  4BDZ A;  4OGE A;  3OS2 A;  3OY9 A;  2Q2R A;  1CZA N;  2PAV A;  3CHW A;  4BC4 A;  1Q9Y A;  4B9S A;  5E41 A;  5F1X A;  3F2K A;  4TSX A;  1FK9 A;  3U3Y A;  3AA2 A;  3CJ7 A;  4H0P A;  4H5R A;  1BCO A;  3LP0 A;  3F73 A;  1HNW K;  1BA0 A;  3QET A;  4DLG A;  3CFR A;  4A2A A;  1IH7 A;  2RPI A;  1BI4 A;  1ZBH A;  1NK0 A;  4DQR A;  1U47 A;  1D9F A;  3VEV A;  3OYC A;  4IXC A;  1YTU A;  3I33 A;  5C42 A;  2NNW A;  2HBK A;  4CEO A;  1UWB A;  1ZBL A;  1EO1 A;  4CK3 A;  4FWL A;  1BIU A;  1WSI A;  4BRH A;  1TL3 A;  4FJI A;  4FJX A;  3M5R A;  1KFD A;  3E9O A;  2YHA A;  5AR0 A;  2RF2 A;  3K5O A;  4CI6 A;  5M1F A;  4M3W A;  1TKT A;  4A5B A;  4KKO A;  4FVM A;  4WQ4 C;  2ITM A;  4RW8 A;  2GTD A;  3H6E A;  4BQZ A;  3SAH A;  3WQU A;  3CCE N;  2D0O A;  1X3N A;  3SJJ A;  4JI0 K;  4DF8 A;  3G71 N;  2FSK A;  4DR1 K;  4G9Z A;  2JGU A;  2NRW A;  3MCP A;  5AZJ B;  1EKE A;  5JVH L;  2E88 A;  4DTN A;  2QXF A;  2F8T A;  4JHD B;  3CME N;  2OPP A;  2LSN A;  5J2P A;  3K5N A;  4MDA A;  4CF8 A;  2QWR A;  4DS4 A;  3THY A;  1RT2 A;  4F2R A;  2P9L A;  5AZI A;  3DXM A;  3CC4 N;  3IDH A;  1LAV A;  4CGF A;  2VQF K;  4JN4 A;  4DQ8 A;  2YHY A;  1XHZ A;  3NF9 A;  1K8K A;  1HUX A;  4IWV A;  1JCG A;  3AVL A;  2WON A;  3K9K A;  1N36 K;  4DQS A;  2B6A A;  5AQI A;  2QWO A;  1DGK N;  1BIS A;  2HBM A;  2OYQ A;  2O8B B;  3NAE A;  1FXX A;  3G10 A;  3E9P A;  4CE9 A;  4RTF D;  1DTT A;  2GEM A;  3S3N A;  3LAK A;  3MX5 A;  2A42 A;  3P31 A;  4WFB L;  1Y97 A;  1VSF A;  1SAZ A;  1RBV A;  1HNV A;  4CBW A;  1TGO A;  4DFJ A;  3QDK A;  3KLI A;  4XEI A;  1OVQ A;  4PKH A;  4HHT A;  4PKI A;  3QIP A;  5C12 A;  2G8V A;  3DLH A;  4KB1 A;  1XC3 A;  3RRG A;  1JLQ A;  3DAW A;  3DRR A;  3UB5 A;  3V9U A;  3CJ9 A;  3OYF A;  2ZM6 K;  3MWT A;  4CK2 A;  3TSQ A;  5AQO A;  4Z4F A;  4FZX C;  1IO2 A;  1HQU A;  4DQP A;  3AO4 A;  4K8X A;  1YIT N;  2FLO A;  4OLA A;  4B3M K;  4ELT A;  2HST A;  4CES A;  2F96 A;  1RNH A;  4PY5 A;  3D2F A;  3SMP A;  4A59 A;  5T7B A;  2HHS A;  4DTX A;  4IKF A;  4BRG A;  3MXI A;  4AHC A;  1N6Q A;  3KWI A;  4AHV A;  1BU6 O;  3P4I A;  4UQG A;  4YOV A;  1N34 K;  4BR4 A;  1TUU A;  2H3G X;  5BN8 A;  4NYF A;  4FVU A;  4IO9 L;  2NLX A;  4DV5 K;  3SV3 A;  3CCV N;  1GLC G;  4CHO A;  4IFV A;  4BRO A;  3L3U A;  2OTL N;  4KPY A;  1NMN A;  3DXK B;  4X66 K;  1TVR A;  1S9E A;  5AQJ A;  1OH5 A;  3L4Q A;  1IKW A;  2CGJ A;  5J2N A;  2E6M A;  4IOC L;  4KHN A;  3H3N O;  1TK5 A;  1JKH A;  1L3U A;  1J5E K;  5M1P A;  4N47 A;  4PWD A;  4LY7 A;  4KO0 A;  1N5Y A;  4Z94 A;  3CI5 A;  3WQT A;  1WB9 A;  3QIN A;  4E1M A;  4DTR A;  1GLE G;  3FZK A;  3LL3 A;  2P9U A;  2ASM A;  4B9L A;  3WEE A;  4B1Z A;  4MQ3 A;  1SL1 A;  3M6G A;  1NK4 A;  3PX0 A;  4A62 A;  4K41 A;  4JRP A;  1DKG D;  1JCE A;  4B9M A;  4CK1 A;  2IGI A;  4B8A B;  2ASO A;  2PBD A;  1HLU A;  4Y0W A;  2QK9 A;  3ZYY X;  3CCJ N;  4KTQ A;  5C24 A;  4CGI A;  3L0Q A;  2Q1N A;  4JKH A;  4CFC A;  1SL0 A;  4C8O A;  3O08 A;  3NDK A;  1QZ6 A;  5AQT A;  3ZT1 A;  3RMB A;  4CJQ A;  4Z0U A;  4OGC A;  5CHI A;  5LL6 Z;  3VQ5 A;  2IVO A;  1FKO A;  2B5J A;  3LAM A;  4ILJ A;  4YOU A;  5AQW A;  4BRQ A;  1GLJ O;  5HRS A;  4DTM A;  3O9T A;  2VG6 A;  3OYG A;  3W0L A;  2ZJQ L;  4RCH A;  5AQU A;  5AQN A;  1BWF O;  3DLR A;  4PA1 A;  5KRT A;  4MDB A;  3KK7 A;  3ULE A;  3T1Y K;  3KK1 A;  1QS4 A;  4B3O A;  3HL8 A;  4FWM A;  2P1J A;  4BE1 A;  1SKW A;  4FYD A;  1BG3 A;  1V4S A;  1IG9 A;  3JSM A;  2V51 B;  3HK2 A;  4GMJ B;  1BIZ A;  4CJF A;  4B9Q A;  3SZ2 A;  1NGB A;  4XIU A;  1TL1 A;  4NCB A;  2VCP A;  3CJB A;  3QML A;  3SUP A;  1U49 A;  3NH2 A;  1X3M A;  4DFP A;  3VPZ A;  1WAJ A;  2FBX A;  3SUN A;  1J9A A;  4JI8 K;  3DLK A;  1RDU A;  4DTJ A;  3WNE A;  4M3R A;  1YVU A;  1XMO K;  2O8C A;  3BY5 A;  4O8U A;  3OJS A;  3SQ4 A;  3G25 A;  2VWB A;  1YT3 A;  2HHW A;  2KHO A;  4CJR A;  5JMV A;  3ZSQ A;  4RG8 A;  2UUB K;  4CD1 A;  4GNI A;  3DM2 A;  3E1Y A;  1LWE A;  2QEX N;  2D1K A;  1GLB G;  3CMA N;  2W42 A;  3MMV A;  1E3M A;  2B4J A;  3H1Q A;  1VQP N;  3T3F A;  3A5N C;  1ZBF A;  1NGD A;  4DSJ A;  3J7A P;  4O5B A;  4H0X B;  5LJW A;  4BG8 A;  3CQY A;  3L2V A;  4X65 K;  4C23 A;  4BRF A;  2G8F A;  1F21 A;  4X62 K;  1S72 N;  4FOI A;  4FWR A;  3U3G A;  4ILG B;  3R9P A;  2IDO A;  5KPR A;  3CC2 N;  3RMD A;  4AHR A;  3L2R A;  4M45 A;  3WXJ A;  1BUP A;  4CJ5 A;  4WQ5 A;  4DU3 A;  1EET A;  5TKW A;  1QTM A;  4KRF A;  3ITH A;  1VQ5 N;  4YNQ A;  4KI4 A;  1IKY A;  1JLA A;  1IBM K;  1LWC A;  3UE5 A;  3WNG A;  4W5N A;  4DR5 K;  3EN9 A;  2BE2 A;  3J81 O;  4DF4 A;  3I0S A;  3LAN A;  5E26 A;  5AQL A;  2QKK A;  1V4T A;  1J53 A;  3ZET B;  1NGI A;  1S3X A;  1W2B M;  3HZ6 A;  2AA4 A;  4F9O A;  3VET A;  4FLY A;  4R79 A;  4FWQ A;  3LWL A;  3AO2 A;  3SJH A;  2ASP A;  1WN7 A;  3EE8 A;  4H5N A;  3OS1 A;  3DYA A;  3HSC A;  3WNF A;  5HRO A;  4FWN A;  1J5O A;  3PIP L;  1OVY A;  3VN5 A;  3B8A X;  1NGH A;  1S5J A;  3C6H A;  3CCS N;  4FLT A;  3RSE B;  3SYZ A;  3LPU A;  4GVE A;  3LP3 A;  1FJG K;  1JXB A;  4LF7 K;  4CZJ A;  3RMA A;  1RT5 A;  5AFU H;  3AVK A;  1VQ9 N;  4BVO A;  3GL1 A;  4M7Y A;  2CGK A;  3DI6 A;  3VER A;  4X64 K;  2YHX A;  2NRV A;  1ILY A;  2WOM A;  4KH6 A;  5I3U A;  1REV A; 
#chains in the Genus database with same CATH homology
 1C1B A;  4BE2 A;  1NKE A;  4O55 A;  1HJR A;  3AVH A;  2IS3 A;  1VK0 A;  3QES A;  4FJL A;  2GUI A;  3O4Q A;  4CJP A;  4FM0 A;  4BDZ A;  4M42 A;  2YNG A;  3AO1 A;  4OGE A;  3AVI A;  1TKD A;  1J54 A;  3QEP A;  1D8Y A;  1KSP A;  1L5U A;  3OS2 A;  2HHU A;  2NUB A;  3OY9 A;  1L3S A;  1LW0 A;  3DRP A;  1RIL A;  4EZ9 A;  4ICL A;  1C1A A;  4FJJ A;  3K58 A;  4OLB A;  3VQP A;  3UIQ A;  1SKS A;  1Q9Y A;  1CXU A;  4B9S A;  5KGW A;  5E41 A;  4FJM A;  3OYN A;  1RBT A;  2XRI A;  2Z1J A;  3LAL A;  3V6D A;  1XC9 A;  4TSX A;  4DG1 A;  3VQ8 A;  1KRP A;  1FK9 A;  3U3Y A;  1RCH A;  3AA2 A;  3TAG A;  4FJ8 A;  1BCO A;  2XY8 A;  3LP0 A;  4CJ4 A;  3F73 A;  4HUF A;  3MEG A;  4H4O A;  2A1R A;  1RT3 A;  4ELV A;  1IKV A;  4FJH A;  1ZYQ A;  3HT3 A;  4IG0 A;  1Q8I A;  5I42 A;  1KVB A;  3QET A;  4DLG A;  3L2U A;  1HNI A;  1SL2 A;  3CFR A;  1IH7 A;  2RPI A;  1BI4 A;  3M8Q A;  3A2F A;  1NK9 A;  1ZBH A;  4CIG A;  2P5G A;  1NK0 A;  4DQR A;  1U47 A;  1D9F A;  3CM5 A;  3OYC A;  3OYI A;  4O0I A;  4F8R A;  1HYS A;  1B9F A;  1ASU A;  2I5J A;  1YTU A;  3OYM A;  4I7F A;  3VQD A;  1VSJ A;  5C42 A;  3NHG A;  3PV8 A;  5CYQ A;  3AO3 A;  1VSK A;  5EU7 A;  1RDB A;  1S1X A;  3TAB A;  3SUQ A;  4CEF A;  4CEO A;  1UWB A;  1JL2 A;  5FRN A;  1ZBL A;  2BGG A;  1RT4 A;  1S1W A;  5JS2 A;  4JS5 A;  1B92 A;  4CK3 A;  4ELU A;  1U4B A;  1BIU A;  1WSI A;  2O4G A;  1TL3 A;  3ZSZ A;  4FJI A;  4FJX A;  1KFD A;  3I8D A;  2YHA A;  2YKN A;  4GW6 A;  1X9W A;  2OPQ A;  4CIE A;  1S1T A;  2RF2 A;  3CYM A;  1RDD A;  1TKX A;  4HTU A;  3K5O A;  3BGR A;  4KHU A;  4AHU A;  4M3W A;  4DQP A;  1TKT A;  2XO7 A;  4KKO A;  4O44 A;  4CJT A;  3CQ8 A;  4FVM A;  3KLE A;  3MXM A;  3I0R A;  2ATQ A;  4RW8 A;  4KHQ A;  2ZE2 A;  3LPT A;  1HMV A;  2YV0 X;  3HYF A;  3JYT A;  3L8B A;  1NJY A;  4HVJ A;  4CHY A;  1DLO A;  3SJJ A;  4DF8 A;  1JXE A;  4CED A;  3BDP A;  2GV9 A;  1VRT A;  4OKK A;  5HRP A;  3NBP A;  3SCX A;  2HND A;  1SUQ A;  2JGU A;  5SZT A;  4CIF A;  2IAJ A;  2IOC A;  5HRR A;  1EKE A;  3OYH A;  1KLM A;  4DTN A;  4N41 A;  2D0B A;  1Z25 A;  2QXF A;  4CJW A;  3MEC A;  2FBY A;  2F8T A;  1KCF A;  2OPS A;  1TAQ A;  5CYM A;  3S9H A;  3SUO A;  4FK0 A;  2OPP A;  2LSN A;  4DSK A;  2VWK A;  3F9K A;  5J2P A;  3TI0 A;  4LD0 A;  4KV8 A;  1C0M A;  1WSF A;  3K5N A;  3M8R A;  1LAW A;  3THV A;  1WNS A;  1S1U A;  3ZSO A;  5HRN A;  1O1W A;  3DLE A;  1WSH A;  4CF8 A;  3TAP A;  4N76 A;  1UA0 A;  4DS4 A;  3CG7 A;  1QSY A;  1LW2 A;  2RN2 A;  4CJV A;  1K6Y A;  2Y1J A;  1SKR A;  1RT2 A;  4F2R A;  2G8K A;  4LH4 A;  1X9S A;  3ZSY A;  4B9N A;  4J2A A;  1LAV A;  4CGF A;  2FC0 A;  2OPR A;  3HJF A;  3PO5 A;  1HYV A;  5J2M A;  4AH9 A;  2HMI A;  1XHZ A;  3B6P A;  3NF9 A;  1X1P A;  3HP6 A;  3NGI A;  5J1E A;  4E7K A;  1QSS A;  3LZI A;  4DSI A;  3NF6 A;  1T05 A;  5DMR A;  3AVL A;  4I2P A;  1ZBU A;  2WON A;  3AVN A;  3ISN C;  1U48 A;  2Z1H A;  3QLH A;  5J2Q A;  1NK5 A;  3MXJ A;  4PUO A;  4DQS A;  1CLQ A;  3AA4 A;  2B6A A;  4O4G A;  2KFZ A;  1VSI A;  1CZB A;  4NCG A;  3QEX A;  2DY4 A;  3ZSR A;  1T8E A;  4CFD A;  3KK3 A;  1QSL A;  1BIS A;  5KGX A;  2OYQ A;  4CHN A;  1WSE A;  1EXQ A;  3TAQ A;  3QNN A;  3SQ2 A;  4FJN A;  3NAE A;  1FXX A;  3PX4 A;  3G10 A;  3HP9 A;  2Z1G A;  4AHT A;  3AA3 A;  4CE9 A;  4FLZ A;  1DTT A;  4CJE A;  3S3N A;  1JLB A;  3LAK A;  1YTA A;  3T1A A;  3WNH A;  4FLU A;  4F3O A;  2OZS A;  1Y97 A;  1BHL A;  3LDS A;  1TK0 A;  1BCM A;  3KD1 E;  3AVG A;  1VSF A;  2YNF A;  3K57 A;  4B9V A;  1RBV A;  1HNV A;  3K2P A;  1TGO A;  3P5J A;  4WE1 A;  3V9Z A;  4DFJ A;  4Z4E A;  3KLI A;  4BWM A;  4DS5 A;  4M3X A;  3NGZ A;  3ZCM A;  2HNY A;  3LZJ A;  3V9W A;  4HHT A;  3QIP A;  1RBU A;  3ZSV A;  2KTQ A;  4B08 A;  2R7Y A;  2G8V A;  3AO5 A;  3DLH A;  4KB1 A;  5CZ2 A;  2YNH A;  4BE0 A;  3KKR A;  3OYL A;  3EYZ A;  2HNZ A;  1D5A A;  1JLQ A;  3AVC A;  3DRR A;  3V9U A;  4CEC A;  3OYF A;  4ZTJ A;  1T03 A;  4J2D A;  1B9D A;  4JLH A;  3ZT2 A;  4CK2 A;  2HHV A;  4IFY A;  4F3T A;  4F2S A;  3MED A;  2Q3S A;  4QAG A;  5FRM A;  1KLN A;  2FBT A;  4ID5 A;  4Z4F A;  4FZX C;  1IO2 A;  1RDA A;  1HQU A;  3C95 A;  4CEB A;  3AO4 A;  1I39 A;  4CGD A;  4YFU A;  3OYB A;  4JRQ A;  3TAN A;  2HHX A;  4K8X A;  2HVH A;  1HRH A;  4HCB A;  2P5O A;  4HUG A;  4OLA A;  4ELT A;  1VSL A;  4CES A;  2F96 A;  3ZT3 A;  1RNH A;  1SV5 A;  3K59 A;  3V9X A;  4KB0 A;  4PY5 A;  1Q9X A;  3TAM A;  4CJU A;  4FXD A;  2HB5 A;  3DMJ A;  5T7B A;  1RT6 A;  4O0J A;  4FJ5 A;  2HHS A;  4DTX A;  4IKF A;  1VSD A;  3MXI A;  5FDL A;  3C6T A;  3O4N A;  4AHC A;  4BAC A;  3NCI A;  1Z26 A;  4RW4 A;  4AHV A;  1N6Q A;  3DLB A;  3VQ6 A;  1BI4 B;  4IBN A;  3KD5 E;  3HPH A;  3QER A;  3HVT A;  5HLF A;  1KTQ A;  4UQG A;  2XY7 A;  1VSH A;  3D0P A;  3NF8 A;  1A5W A;  2X78 A;  4CHQ A;  1C0U A;  4FJ7 A;  2Z1I A;  3ZT0 A;  2YHB A;  4NYF A;  4FM2 A;  4FJG A;  3NF7 A;  3E01 A;  3IS9 A;  3ALY A;  3SV3 A;  1KFS A;  3OJU A;  4CHO A;  4N56 A;  4IFV A;  1RBS A;  1D9D A;  3L3U A;  4KPY A;  3KLG A;  1TVR A;  1S9E A;  5KRS A;  2O4I A;  3VQC A;  1QQC A;  1HQE A;  3M8S A;  4KRE A;  4DFM A;  3SV4 A;  1CXQ A;  4CHZ A;  1R0A A;  1RBR A;  3RR8 A;  1IKW A;  4E7H A;  4PQU A;  5J2N A;  2E6M A;  4KHN A;  3AVF A;  4DSF A;  4L8R B;  2P51 A;  1EP4 A;  4CF1 A;  1JKH A;  4Y1C A;  3MEE A;  1TK5 A;  1L3U A;  4KAZ A;  3AVJ A;  4N47 A;  2F8S A;  4PWD A;  3LP1 A;  1XWL A;  5D3G A;  5JS1 A;  4E7L A;  3VQE A;  1RTI A;  4LY7 A;  2VG5 A;  4G1Q A;  1NOZ A;  3CFO A;  4KO0 A;  1N5Y A;  3B6O A;  3QIN A;  3VQ4 A;  2PZS A;  4E3S A;  1WSG A;  4AHS A;  4E1M A;  1JLC A;  4CFB A;  1DTQ A;  3KLH A;  4HCC A;  4DTR A;  3EZ5 A;  1NKB A;  4DQI A;  1TK8 A;  3AVM A;  3IRX A;  3AVB A;  1GOB A;  4B9L A;  4BDY A;  4E7J A;  4DQQ A;  2Y1I A;  2KZM A;  4MQ3 A;  1SL1 A;  4FM1 A;  1BL3 A;  4QCL A;  1NK4 A;  1S1V A;  4B9U A;  3PX0 A;  1RTJ A;  4E7I A;  4FW1 A;  4JRP A;  2BAN A;  4DMN A;  3QEV A;  4B9M A;  1BQN A;  3HVR A;  4FLW A;  3IG1 A;  4DTO A;  3QEW A;  4LSL A;  3VQ7 A;  3OYD A;  4CK1 A;  2AJQ A;  2IGI A;  1U45 A;  1JLF A;  4B8A B;  4CGJ A;  3TAF A;  1G15 A;  4M41 A;  2JLE A;  4FLX A;  2QK9 A;  4CGH A;  2DFF A;  4CJS A;  4KTQ A;  3V81 A;  5C24 A;  4CGI A;  3AVA A;  3NH1 A;  4RW7 A;  4CFC A;  3H08 A;  1SL0 A;  4FJ9 A;  4FK2 A;  2YNI A;  5DK5 A;  4HUE A;  2XY6 A;  1RTD A;  4FK4 A;  4C8O A;  1A5V A;  4ZHR A;  2D5R A;  3NDK A;  3ZT1 A;  4KTZ A;  4EP4 A;  3RMB A;  3NE6 A;  4CJQ A;  4Z0U A;  4MFB A;  4OGC A;  1TAU A;  3VQ5 A;  2DFE A;  1GOC A;  1FKO A;  2B5J A;  1I3A A;  3LAM A;  4CJ3 A;  1JLG A;  3L3V A;  3HPO A;  4C8L A;  2KQ2 A;  4RW6 A;  3O3G A;  3G0Z A;  3OYJ A;  3LWM A;  5HRS A;  4OPJ A;  4DTM A;  2VG6 A;  4Q5V A;  3OYG A;  1LV5 A;  1L3V A;  1ASW A;  4M3U A;  1TKZ A;  1W0H A;  4B9T A;  2YKM A;  3DLR A;  2KW4 A;  4PA1 A;  4C8M A;  5FRO A;  3V1R A;  5KRT A;  3MAQ A;  4DSE A;  3SQ1 A;  2HHT A;  4I2Q A;  4W5O A;  4CEA A;  3VQB A;  4ZTF A;  3KK1 A;  1QS4 A;  4B3O A;  3HL8 A;  4OPK A;  3HM9 A;  4W5Q A;  4FCY A;  2P1J A;  2KZZ A;  1UOC A;  1C6V A;  2QKB A;  4BE1 A;  1SKW A;  4FYD A;  2E4L A;  5CZ1 A;  4EZ6 A;  3OS0 A;  2BDP A;  2HW3 A;  4FZY A;  4DFK A;  5K14 A;  3LP2 A;  2ZD1 A;  1KVC A;  3O3F A;  2X74 A;  1IG9 A;  3JSM A;  3NFA A;  4CHP A;  4C8K A;  4NCA A;  3VA0 A;  1U04 A;  1T7P A;  3HK2 A;  4GMJ B;  2KFN A;  1BIZ A;  3HST B;  4GVM A;  4CJF A;  4JS4 A;  4F4K A;  3SZ2 A;  1HYZ A;  3V9S A;  4Z4I A;  4M3Z A;  4CEZ A;  4XIU A;  3FFI A;  3M8P A;  4CF2 A;  4FLV A;  1TL1 A;  4RW9 A;  4E89 A;  1ASV A;  4Z4H A;  3SPZ A;  4NCB A;  3SUP A;  5HP1 A;  1U49 A;  3PY8 A;  3NH2 A;  4KTW A;  5KTQ A;  4DFP A;  3TAR A;  1WAJ A;  2FBX A;  4DLE A;  3SUN A;  1J9A A;  3DLK A;  1C0T A;  3TWH A;  4CGG A;  3KKS A;  4DTJ A;  3WNE A;  4CEQ A;  2RKI A;  4M3R A;  1YVU A;  2XHB A;  1JLE A;  3ZSW A;  4E19 A;  3OJS A;  3VQ9 A;  3SQ4 A;  1RT1 A;  1W9H A;  1YT3 A;  2HHW A;  5CY4 A;  4CJR A;  1UAX A;  4OJR A;  3ZSQ A;  4RG8 A;  3ZSX A;  4KHW A;  2HHQ A;  4KI4 A;  3DM2 A;  4DTP A;  3DLG A;  3VQQ A;  1LWE A;  4I9L A;  4J2B A;  3V1Q A;  3PO4 A;  3ULD A;  2PYL A;  3K5L A;  3SI6 A;  1NOY A;  3HO1 A;  2W42 A;  3KTQ A;  1XI1 A;  1ITG A;  2OA8 A;  4Z4G A;  4AIL C;  2G8W A;  1XHX A;  2B4J A;  4DTS A;  3T3F A;  3AA5 X;  3TR8 A;  3HXM A;  3RMC A;  1ZBF A;  2EHG A;  1L3T A;  4DSJ A;  4M3Y A;  3QO9 A;  4O5B A;  5HBM A;  1RDC A;  3L2V A;  3VA3 A;  3EY1 A;  1JL1 A;  2G8F A;  4CJK A;  1F21 A;  4FJK A;  1ZBI A;  4M3T A;  4W5R A;  3TAE A;  1KVA A;  3ZT4 A;  3KLF A;  3U3G A;  4CFA A;  1QE1 A;  1VRU A;  2ZQB A;  3V1O A;  2IDO A;  3NH0 A;  4OKE A;  3QIO A;  3K5M A;  3RMD A;  4DSL A;  1S9G A;  4AHR A;  3L2R A;  3AV9 A;  4M45 A;  4E0D A;  4KHY A;  4CJ5 A;  4DU1 A;  2DFH A;  4DU3 A;  1EET A;  3S3O A;  2HVI A;  4KFB A;  1NK6 A;  2D0C A;  2DTU A;  3PUF A;  2VG7 A;  3PX6 A;  1A5X A;  4CCH A;  1QTM A;  4KRF A;  4K8Z A;  2A1S A;  3ITH A;  1TV6 A;  2G8H A;  4C8N A;  4DTU A;  3HPG A;  3P83 D;  4YNQ A;  3L2W A;  1IKY A;  4FW2 A;  3OYK A;  1JLA A;  1UA1 A;  2G8U A;  2PYJ A;  1NJX A;  4Q0B A;  4N5S A;  1LWC A;  3KIO A;  3WNG A;  4W5N A;  3CM6 A;  2BE2 A;  2XY5 A;  1BQM A;  3D45 A;  4LSN A;  4DF4 A;  1WSJ A;  2IC3 A;  3I0S A;  3LAN A;  1EX4 A;  4W5T A;  1MU2 A;  5C25 A;  4DWI A;  3RTV A;  3RR7 A;  2GBZ A;  5KI6 A;  2QKK A;  1S6Q A;  3IAY A;  1J53 A;  3SQ0 A;  4EP5 A;  4OKJ A;  3VQA A;  3OYE A;  4R5P A;  2G8I A;  1CZ9 A;  1QHT A;  2X6S A;  4CJL A;  2X6N A;  3RRG A;  4FLY A;  2PY5 A;  4BDP A;  1WLJ A;  3DRS A;  1RTH A;  3OVN A;  2ETJ A;  1VSM A;  3AO2 A;  3LWL A;  4B8C A;  1WN7 A;  3QNO A;  4LH5 A;  3RRH A;  3SPY A;  1RT7 A;  1WAF A;  2ITG A;  3DYA A;  4ID1 A;  3OS1 A;  3WNF A;  2VWJ A;  5HRO A;  3S3M A;  4J2E A;  4IG3 A;  1FKP A;  3QEI A;  4KI6 A;  1LWF A;  4BWJ A;  1J5O A;  4CEE A;  1VSE A;  3VN5 A;  4E1N A;  3O3H A;  1IKX A;  1NK7 A;  3OYA A;  1NJW A;  5SWM A;  1NJZ A;  4QOZ B;  1S5J A;  3T19 A;  1BGX T;  2EX3 A;  4KHS A;  3U6F A;  2D0A A;  3SNN A;  2E6L A;  4FLT A;  4CF9 A;  4Z4C A;  3V4I A;  3CFP A;  4Y1D A;  3C94 A;  4CER A;  3DOL A;  1NKC A;  3DOK A;  3SYZ A;  4I9Q A;  4OVL A;  3LPU A;  1C1C A;  3LP3 A;  4H4M A;  3KJV A;  1JXB A;  2FBV A;  3ASM A;  4DU4 A;  1RT5 A;  3RMA A;  3AVK A;  3NGY A;  1NK8 A;  1X9M A;  3C6U A;  3L2Q A;  1HPZ A;  3DI6 A;  4NYN A;  3P1G A;  1S6P A;  4H8K A;  2WOM A;  5I3U A;  3RWU A;  1GOA A;  1REV A;  4FZZ A;  2OZM A;  3KK2 A;  4CF0 A;  4IDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...