3KKSA

Crystal structure of catalytic core domain of biv integrase in crystal form ii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
GSHLWQMDNTHWNKTIIWVAVETNSGLVEAQVIPEETALQVALCILQLIQRYTVLHLHSDNGPCFTAHRIENLCKYLGITKTTGIPYNPQSQGVVERAHRDLKDRLAAYQGDCETVEAALSLALVSLNKKRGGIGGHTPYEIYLESEHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of catalytic core domain of BIV integrase: implications for the interaction between integrase and target DNA
pubmed doi rcsb
source organism Bovine immunodeficiency virus
molecule tags Dna binding protein
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kksA00
4LY7A 1YTAA 3DOLA 3SUPA 2G8HA 4CIFA 1T8EA 1LWCA 3KK3A 2YNGA 4DQIA 4FM2A 3IAYA 1A5XA 3QIOA 2BGGA 3V1OA 5HRNA 3M8PA 1VSEA 2KTQA 4I2PA 3LANA 2G8WA 3L2WA 1S1VA 2I5JA 4B9UA 1JLGA 2F8TA 4KTWA 1RBUA 2FBTA 3VQ7A 4FLXA 5SWMA 4DS5A 1GOAA 4CEFA 3ZT1A 2OPQA 4LD0A 1UAXA 1FXXA 4KFBA 1A5VA 1JL2A 3QO9A 1EETA 1GOBA 2KFZA 1NK6A 3AVKA 5FDLA 3MXMA 3CFRA 1RBVA 3KLIA 3ZSZA 3V9XA 1D5AA 2Z1HA 3ZSVA 3QNOA 1X9SA 4OKJA 3SQ4A 1L3TA 4AHSA 4HUEA 3HYFA 2HHSA 3OYKA 3MAQA 1RDBA 2XY5A 1R0AA 3M8QA 4O5BA 4Y1CA 4FJHA 2HMIA 2Y1JA 4YNQA 4RW6A 4KTQA 4HHTA 4GMJB 3TI0A 3FFIA 1RDDA 4DU4A 2FBXA 3TR8A 3L3UA 1S1WA 3S3NA 4I2QA 1D8YA 1FK9A 1EKEA 1HPZA 1ZBLA 3IS9A 2IS3A 3NGYA 1L3SA 4FZYA 4Z0UA 3ZSXA 5DMRA 4IKFA 2RKIA 2HW3A 1C0UA 2VWJA 4CJTA 3HT3A 5K14A 4B9SA 4DQSA 4EP4A 3AO2A 4J2AA 5FRMA 4F3OA 3V9UA 1ZBHA 4CHPA 3UIQA 2P1JA 3SI6A 1XC9A 3LALA 3CYMA 3L3VA 2PY5A 3RMCA 2AJQA 1ZBIA 4LSNA 2KW4A 3A2FA 3OS2A 3VQ8A 2F8SA 1RILA 3OYLA 3LDSA 4AHVA 1HMVA 3KLGA 4Y1DA 2EX3A 2YKMA 3V1RA 1VSFA 3WNFA 1RDCA 4JS5A 1KFSA 3ZT0A 1U04A 3VQ6A 3OYAA 4DQQA 4CIGA 1TK8A 3H08A 4CEBA 4DS4A 4DF4A 3TANA 2ZQBA 1RCHA 3OYDA 4B9VA 3ZT2A 1RTIA 2HNDA 2Z1GA 3QLHA 4O44A 3KK2A 4H4OA 1VRUA 5DK5A 3OYMA 1KVAA 4FM1A 5EU7A 1Y97A 2X78A 3HPGA 4FVMA 3JYTA 4DTSA 1J5OA 3M8RA 3RR7A 1GOCA 4F8RA 2O4IA 2G8UA 4K8ZA 5FROA 4KTZA 1S9GA 4FK0A 2Z1IA 1RNHA 1K6YA 3VQ5A 3HP9A 4JLHA 3DLKA 3L2RA 2HHXA 1NOZA 1WSFA 2HHTA 3V9SA 3ZT4A 2HNZA 1HYVA 3LWLA 4DTOA 1IKXA 4I7FA 4OVLA 5J2PA 3CM6A 1BCOA 3AVIA 1WSHA 3NF6A 1BIZA 4CJRA 1BIUA 4KI6A 3MECA 1U4BA 3PX4A 3NF7A 4DLGA 1SL0A 4FJJA 1S5JA 1Z25A 1RTJA 4FM0A 4DQRA 4CJWA 1RT3A 1JLFA 4HVJA 2P5OA 3KKRA 4E7JA 4CIEA 1Q9YA 3QNNA 1HJRA 1S1TA 1IKYA 3OYNA 3K57A 4BE1A 2VG6A 4DSLA 4LH4A 5CZ1A 3QESA 3CM5A 3L2UA 2OPSA 3NAEA 3VQDA 1NOYA 4B8CA 3KLHA 4CGDA 1SV5A 4DSFA 4CGFA 2BANA 1BQNA 3VA3A 4B9LA 4IG0A 2HHUA 2B4JA 3KLFA 1ZYQA 3O3HA 4FLYA 4C8LA 3S3MA 3WNGA 3DRPA 3AA3A 4B9MA 1IO2A 3I0RA 3AO4A 4FK4A 5CYQA 3LP0A 3QEPA 3HP6A 5CYMA 2KQ2A 3RMBA 1ASUA 3CFPA 3AA4A 3ITHA 3SNNA 3SYZA 4ELTA 4M3ZA 3AA5X 4FW2A 3NDKA 1SL1A 3KIOA 2JLEA 4W5RA 4KHSA 3VA0A 5HP1A 4KB1A 1TGOA 3LZIA 1XHXA 4CEDA 4CJLA 4KHWA 3VQEA 4E89A 5J2NA 4F2SA 4CHZA 4BE2A 4KHUA 3ZSQA 4PY5A 2YNHA 2D0CA 3I8DA 4AHTA 1XI1A 2FC0A 1WAJA 1X9WA 4Z4CA 1KVBA 1RBSA 4F4KA 2ZE2A 1CXQA 1CZBA 1WN7A 3B6PA 1HRHA 1TL1A 4CJ4A 2HHWA 3NF8A 3D45A 4E1NA 4QOZB 5KI6A 2RF2A 4Z4FA 5HROA 2B6AA 3WNEA 3T3FA 3NFAA 4FLUA 2KZMA 1SL2A 4DTJA 3V81A 1QTMA 3QIPA 1LAVA 1LW0A 2EHGA 1VK0A 3RRGA 2P5GA 3TAPA 1S6PA 3C6UA 1Z26A 4CECA 4DTNA 4B3OA 3HO1A 4W5NA 2XHBA 4CE9A 3SQ2A 1WAFA 1RBRA 4CGIA 3OYHA 2HHVA 4N47A 4OPJA 3OS1A 3TWHA 4W5TA 5KRTA 3RMDA 4CF2A 3HVRA 4ELUA 4M3XA 4KHQA 1BCMA 3OYGA 4HTUA 1T03A 3AO3A 3HSTB 4FJ7A 1JXBA 2IAJA 3CFOA 4CJSA 3TAEA 4KHYA 3AO5A 3NH1A 4NCBA 2X6NA 4E19A 2IGIA 2G8VA 4RW8A 3U3YA 1DTTA 4K8XA 1HYZA 5KGXA 1SKWA 1XHZA 4Z4HA 4QAGA 4FJGA 4M3RA 3EZ5A 4DF8A 1KSPA 4QCLA 4HCBA 2YNIA 4DSKA 1TKZA 3SUQA 3HM9A 1NK8A 2Q3SA 4FJXA 3JSMA 1VSDA 5CZ2A 3O3GA 4DU1A 4C8KA 3V4IA 4IFVA 4CK3A 3EYZA 4ZTFA 4E7IA 3AVGA 4F3TA 4CFBA 5KGWA 4E0DA 4GW6A 3DYAA 3TAGA 1RT7A 4DTRA 1HNVA 4DSEA 4NCGA 2IOCA 3AVHA 4IBNA 1NJXA 1HYSA 3TAQA 3D0PA 4CFAA 2DTUA 4DSJA 2IC3A 2PYJA 1VSJA 2NUBA 2QXFA 3O3FA 3G0ZA 1QSSA 4L8RB 4CGHA 4IDKA 4M3WA 4DFPA 3U6FA 2R7YA 2OYQA 4R5PA 2YHBA 3OJUA 3QETA 3QEXA 3DLHA 3C94A 1D9FA 4OLBA 3HPHA 4M3TA 3PO4A 3NE6A 1JL1A 1TV6A 4CF8A 3SV3A 2D0BA 5HRRA 1KRPA 2WONA 3DM2A 3MEEA 3KK1A 2X74A 4GVMA 4CHYA 3NH2A 3F73A 3AVAA 3RR8A 4WE1A 3ISNC 3VQAA 4CGGA 4KHNA 3KKSA 4FYDA 2RN2A 3V9WA 4FZZA 1J53A 3NBPA 2VG5A 1TKTA 1SKSA 4AHCA 5T7BA 4J2DA 3HJFA 1LAWA 1BI4A 3K2PA 3MEGA 3PUFA 3TAMA 3PY8A 2ITGA 2Y1IA 4W5OA 3THVA 2DFEA 1KCFA 1S6QA 4ID5A 3ZCMA 4AHUA 3NH0A 4OKKA 1NK7A 1KTQA 3NCIA 3NHGA 4FJ5A 4M3UA 3CQ8A 1WNSA 1WSIA 4B9TA 3OVNA 2W42A 1B9FA 1O1WA 3LZJA 1LW2A 1BGXT 5C24A 1JLQA 3MXIA 3BDPA 1ASWA 4B9NA 4O4GA 1QSYA 4J2BA 4CHOA 5I3UA 1C6VA 2PYLA 3VQCA 4J2EA 4FJKA 2ETJA 3LP1A 3AVLA 2G8FA 1B92A 3DLEA 4UQGA 1BHLA 1WSGA 1UA1A 1Q8IA 2BE2A 4CEAA 4CJVA 4DFMA 4ID1A 4ZTJA 1N5YA 5D3GA 1JLAA 5FRNA 3VQBA 4DG1A 5HLFA 2DY4A 2DFHA 3ZSYA 1VSKA 4CHNA 3G10A 3ZSRA 4PUOA 5JS1A 3ULDA 2JGUA 1X9MA 2GV9A 3PO5A 1NK5A 3T19A 3DLBA 2QKBA 1C1AA 1IKWA 2OPRA 4O0JA 4PA1A 1JLBA 3VQ9A 1U49A 3HPOA 3ZT3A 2HVHA 1NK4A 4FJ9A 4FJLA 1U47A 4JS4A 4DSIA 4JRPA 3SUNA 4PWDA 1LWEA 2G8IA 3AVCA 5J1EA 4OGCA 4G1QA 4DLEA 3V9ZA 1G15A 2ZD1A 4CF1A 1NK9A 3DRSA 3RWUA 4CJUA 1CLQA 1FKOA 3KD5E 3SZ2A 2DFFA 3QEWA 4FJMA 1WSEA 2E6LA 3LAKA 4CERA 3TABA 3DOKA 1WSJA 2LSNA 3O4QA 4JRQA 2VWKA 4CESA 3VQ4A 1RT1A 1IKVA 1HNIA 3DLRA 1I3AA 4NYFA 1LWFA 4N76A 1MU2A 3HVTA 1NKEA 4LSLA 5HRSA 4N41A 1XWLA 3LAMA 3RMAA 2QKKA 1JXEA 4CJ3A 4RW4A 4B8AB 1NKBA 1EXQA 3EY1A 5C25A 1RBTA 1L5UA 4DQPA 2D0AA 2KZZA 4MFBA 4AHRA 3E01A 4B08A 4FLZA 1TK5A 2YV0X 1ASVA 1VSHA 1EX4A 1UA0A 3HXMA 4BDPA 2E6MA 4CF9A 4PQUA 3ZSWA 1IH7A 4RW9A 1ITGA 3OJSA 2GUIA 3T1AA 2HVIA 2WOMA 1QSLA 4CEZA 3NGZA 4BACA 1C0TA 4E7HA 3VN5A 4C8MA 2XO7A 4DMNA 1X1PA 1BL3A 5KRSA 3S9HA 2HNYA 3AO1A 4OJRA 3SPZA 1C1BA 3AV9A 3DLGA 3MEDA 4LH5A 4CGJA 2B5JA 1NJZA 4NCAA 3OS0A 1TVRA 3DMJA 4H8KA 4DTMA 4BWMA 3PV8A 4KREA 1CZ9A 1RTHA 1LV5A 4E7LA 1L3VA 1VSMA 2OZSA 1ZBUA 1KVCA 3AVNA 1TAQA 1U48A 3F9KA 1S1XA 1QS4A 1J54A 3V6DA 3BGRA 3TARA 1DTQA 4CFDA 4FLTA 4BDZA 1ZBFA 1TL3A 1I39A 3L2VA 1Q9XA 3IRXA 1BQMA 1C1CA 4OGEA 3V1QA 1FKPA 2VG7A 5E41A 3QEIA 3ASMA 3C95A 4FZXC 2A1SA 4FW1A 4M41A 3NGIA 4BWJA 3SJJA 4Q0BA 3DRRA 4FJIA 1NJWA 4IG3A 3NF9A 2FBYA 5CY4A 1W0HA 3OYBA 1SKRA 1D9DA 4KPYA 2QK9A 1VRTA 4Q5VA 1C0MA 1VSIA 2OA8A 2RPIA 1HQUA 4DWIA 1QE1A 3LP3A 4CEQA 1CXUA 2ATQA 3LWMA 3MXJA 3OYIA 2E4LA 3U3GA 3SV4A 3SPYA 2HHQA 3OYFA 1NKCA 1REVA 4RG8A 4CK2A 1W9HA 3C6TA 4OKEA 4O0IA 1JLEA 4CJ5A 4YFUA 2D5RA 5JS2A 2PZSA 1JLCA 1RT5A 1YT3A 3S3OA 1TKXA 2OPPA 3L8BA 1RT6A 4BDYA 1KFDA 4XIUA 5SZTA 3AA2A 2A1RA 1TK0A 4CK1A 2F96A 1UOCA 3DI6A 5HRPA 4CEOA 3RRHA 4I9LA 2KFNA 3PX0A 1DLOA 3I0SA 4I9QA 3HK2A 3P1GA 4CHQA 4FK2A 3AVFA 3SQ1A 4TSXA 4HUGA 5HBMA 1KLMA 4CFCA 5KTQA 4DFJA 1VSLA 4CJFA 4DFKA 4KAZA 1RT4A 3OYEA 4FLVA 1RTDA 4E1MA 3K5NA 5J2MA 4EZ9A 3OYJA 3AVBA 3KLEA 3KJVA 4IFYA 4BE0A 4HUFA 1BI4B 4E7KA 1T7PA 4CJKA 4FJ8A 1KLNA 1SUQA 4EP5A 4FXDA 3OYCA 1WLJA 4CJEA 4DU3A 1TKDA 1B9DA 1EP4A 1UWBA 4CJPA 4ZHRA 4H4MA 4W5QA 4C8OA 2X6SA 3CG7A 4MQ3A 4E3SA 5J2QA 4DTXA 4N5SA 2OZMA 4AILC 1N6QA 3P83D 4KI4A 4OLAA 4FCYA 1JKHA 1F21A 4M45A 3LPUA 4KKOA 4RW7A 3KTQA 3TAFA 1S1UA 2XY7A 1QQCA 4Z4EA 4DTUA 1RDAA 3P5JA 4DTPA 1BISA 1NJYA 2XY8A 1YTUA 3ALYA 1TAUA 3K5MA 1HQEA 3RTVA 4CCHA 3QEVA 4Z4GA 4EZ6A 2XY6A 3ZSOA 2IDOA 2O4GA 4O55A 4AH9A 4HCCA 3QERA 1RT2A 5C42A 3VQQA 2YHAA 3K5LA 1NK0A 4CF0A 2YNFA 3PX6A 3AVMA 3LP2A 4KO0A 4OPKA 4NYNA 3K59A 1U45A 2BDPA 4Z4IA 2YKNA 3M8SA 3L2QA 3QINA 2P51A 3KD1E 1YVUA 1L3UA 4KRFA 4N56A 4FLWA 3B6OA 3SUOA 3IG1A 3AVJA 3K5OA 3LPTA 3VQPA 3SQ0A 2XRIA 4F2RA 4ICLA 2HB5A 1QHTA 1A5WA 4CJQA 3OY9A 1IG9A 2FBVA 4KB0A 4CEEA 4M42A 4M3YA 1T05A 4FJNA 1J9AA 2GBZA 3O4NA 4ELVA 3HL8A 4C8NA 3WNHA 4KV8A 5I42A 3SCXA 2G8KA 1S9EA 3K58A 2Z1JA
chains in the Genus database with same CATH superfamily
2W6LA 3E9PA 4LY7A 4CZGA 3R8EA 3LL3A 4BR9A 4C1NK 1SAZA 2BGGA 3V1OA 5HRNA 2OTJN 2KTQA 3LANA 2G8WA 3L2WA 4JI8K 3WQUA 1JLGA 2F8TA 2FBTA 1GOAA 3ZT1A 4BRGA 2VYPA 4KFBA 5AZJB 2IIRA 3O80A 2QWNA 5FDLA 3BP8A 1D5AA 1L3TA 1HNXK 1E3MA 1U2VA 4JI0K 3OBWA 4DV3K 3EE8A 2HMIA 4JI2K 3A8YA 4GMJB 1RDDA 2ITMA 2FBXA 3L3UA 4I2QA 1EKEA 4FPBA 2P9LB 1QHAA 3H3NO 5DMRA 1YXQA 3U9DA 4J2AA 2KHOA 3P4IA 4LSNA 3OS2A 3VQ8A 1EQYA 3OYLA 5BREA 2WTUA 1HMVA 1SQKA 2YX6A 4BY9C 3V1RA 4BG8A 3CQXA 3ZYYX 3H08A 1HNWK 1GLEG 2HNDA 3QLHA 3KK2A 4H4OA 1WBDA 2FLOA 2X78A 3HPGA 3M8RA 4F8RA 2O4IA 1MWMA 4MO4A 4KTZA 4FK0A 2Z1IA 1RNHA 3VQ5A 3L2RA 4LFAK 3QBXA 3ZT4A 1Q82O 4I7FA 3CM6A 1BCOA 3SAFA 4CJRA 4KI6A 3MECA 3PX4A 1T6CA 4FJJA 1J6ZA 3R1XA 1Z25A 4DUYK 4FM0A 2P5OA 3QMLA 4O5FA 1KAXA 4E7JA 3VF4A 1S72N 4BE1A 3K57A 3L4IA 2A42A 2QW9A 2VG6A 4G9ZA 3CM5A 3L2UA 2OPSA 3NAEA 1YJNN 3VQDA 1VQPN 1K8KB 4B8CA 2NRVA 3HRGA 4WF9L 4BC4A 1BQNA 3I33A 3VPZA 2B4JA 4DR4K 1VQ7N 3S3MA 3AO4A 4H03B 3D2EA 5CYMA 3RMBA 5GINA 3AA4A 3CQYA 2P9NA 1OVYA 1XQSC 3SYZA 1VQKN 4KHSA 2W6KA 3VA0A 1NMDA 2V7YA 3ID6A 4E89A 5LJVA 1RBSA 1ATSA 1WN7A 1CZBA 1T44A 4GVEA 1HRHA 2D0PA 4CJ4A 3JAMO 2E1YA 2HHWA 2P9IA 4E1NA 5JMVA 2FXUA 3C0BA 4Z4FA 1NWKA 5EX5A 1MA9B 1LAVA 4U67L 1VK0A 3RRGA 3TAPA 3C6UA 1Z26A 4DTNA 3EO3A 2XHBA 2QWPA 3SQ2A 5M1QA 4YOYA 3EZWA 4WQ4A 3O5BA 3OS1A 4JKGA 3TWHA 5C12A 1BCMA 3UE5A 3TTFA 1T03A 4ILGB 3LDLA 3HSTB 1GLAG 3M6GA 3HZ6A 4CJSA 4KHYA 4NCBA 5BN9A 4K8XA 1HYZA 1SKWA 3VTIA 4FJGA 4QAGA 4M3RA 3EZ5A 4JHDB 4HCBA 2YNIA 1Y64A 3SUQA 1V4TA 3KWIA 4BC5A 2IVNA 4DU1A 2NRHA 4YOXA 3EYZA 4ZTFA 4IOCL 4LF5K 5BPMA 4NB4A 4DV0K 1RT7A 3QICA 2IOCA 4IBNA 4CFAA 1RFQA 2Q1NA 4WFAL 4GKKK 2GUPA 3FGUA 2QXFA 4L8RB 3U6FA 3QFPA 4R5PA 1X3NA 3MDQA 2O8EA 1HLUA 3DLHA 1D9FA 4AM7A 3NE6A 3CIPA 5BPNA 2WONA 3L6QA 4WE1A 3VQAA 4KHNA 1T3VA 3KKSA 4FYDA 2RN2A 4ISGA 4JKAA 1NGJA 5GAEP 4AM6A 1TKTA 4J2DA 5T7BA 2Y1IA 4W5OA 4ID5A 1NK7A 4CVNE 3THYB 3OVNA 2W42A 4JV5K 4ISEA 4WQ4C 1B9FA 3LZJA 5C24A 1JLQA 3BDPA 1ASWA 5M1KA 3DXKA 3VEOA 3VQCA 4J2EA 2ETJA 3LP1A 3AVLA 1NGDA 1B92A 1M90O 2BE2A 3DXKB 3HSCA 5AQZA 4ZTJA 5D3GA 2YHWA 2DFHA 3ZSRA 1VQON 3DLBA 2QKBA 1YHQN 2OPRA 4O0JA 1U49A 3ZT3A 4FJ9A 3MWTA 5FLXO 1YITN 5TKYA 4JN4A 4BC3A 3AVCA 4DQ8A 4IJAA 5HOOA 2VQEK 3DRSA 4JI3K 3RWUA 3KD5E 1MWKA 3PSIA 3QEWA 4FJMA 1WSEA 3DOKA 1WSJA 4LF9K 4CESA 1KAZA 1HNIA 3THXB 3KK7A 3HVTA 4DR5K 1NKEA 4LSLA 3VGLA 5HRSA 3EL2A 1JXEA 3GL1A 4Y0WA 4CJ3A 4I6MB 1EXQA 3ENOA 4LF7K 1L5UA 3E01A 4B08A 2YV0X 1VSHA 1EX4A 3M5RA 3ZSWA 4RW9A 1ITGA 5AZIA 2WOMA 4H0TB 1QSLA 3J7YP 3WXLA 3S9HA 4DMNA 1BL3A 4NCAA 4OJRA 1C1BA 4CGJA 3CHWA 3JS6A 3HOSA 3OS0A 3DMJA 4BWMA 2FF6A 1N8RO 1LV5A 1L3VA 2Q0UA 1VSMA 1TAQA 3PIPL 1U48A 5JLHA 1TYQA 1DTQA 3ENHA 3ZLJA 3GBTA 4BR7A 3V1QA 2VG7A 1QQMA 4FZXC 2P9SB 2A1SA 3OBYA 4FW1A 4M41A 3DXMA 3MX2A 3DRRA 4FJIA 1NJWA 4CZKA 1W97L 1K9MO 1W0HA 1GLLO 2QK9A 2ZGYA 3K9KA 2E4LA 3WXKA 5AQPA 1NKCA 1W9HA 3T1HK 1NMNA 2HBLA 4CJ5A 2D5RA 2PZSA 1RT5A 3S3OA 2ZGZA 1TKXA 1RT6A 1KFDA 1XMQK 3DI6A 2KFNA 3CCSN 1DLOA 3HK2A 5ADXH 5AQWA 4KAZA 1O13A 4DKWA 4FPAA 4BE0A 3MX5A 1BI4B 1SUQA 4H0OA 3CETA 2A41A 3EN9A 3FZFA 1EP4A 4CJPA 3TSUA 4W5QA 4C8OA 3BF1A 5J2QA 3UKUB 4DTXA 3O9SA 1JKHA 4KKOA 4BR2A 4RW7A 3KTQA 4Z4EA 3AGRA 2XY8A 5AQYA 3CJCA 4NO7A 1BA1A 3QEVA 1ILYA 4O55A 3QBWA 2E88A 2E20A 2NRWA 4PKIA 4DV5K 4YORA 5AFUH 3ENBA 3K59A 4C23A 2YKNA 4PHTX 1YVUA 4KRFA 4BREA 5LMUK 3VQPA 3THWA 4M7XA 1M1KO 4ICLA 4L3QA 3OY9A 4CEEA 5FPEA 4FJNA 1QZ6A 1NGGA 3O4NA 5AQMA 4CZEA 1NGIA 2NNWA 5GIPA 1K73O 2V52B 5AQGA 3DOLA 3SUPA 2G8HA 4MO5A 4JKDA 3RSEA 2YNGA 3IAYA 4DB3A 5E26A 2O8FA 3BUZB 1VQ8N 1S22A 4B9UA 3DLLL 1NM1A 3SBGA 4FLXA 5SWMA 4LD0A 1UAXA 4KH5A 3QO9A 2KFZA 3CFRA 3KLIA 3V9XA 3QNOA 2Z1HA 3VEYA 3CXCM 4HUEA 1YI2N 3E9LA 3OYKA 4BVPA 2XY5A 4BQZA 4FJHA 1E4GT 3KZBA 4YNQA 3P31A 4HHTA 3TI0A 2VGMA 3Q7BA 4WYBA 4CD3A 1ZBLA 3IS9A 3NGYA 2F9TA 4Z0UA 1N33K 2RKIA 4BRAA 1C0UA 4ILJA 3ZETA 5K14A 2GX9A 4DQSA 5FRMA 4A2AA 3SI6A 3QDKA 3LDNA 3LALA 3L3VA 3RMCA 2VGNA 1RILA 5BR8K 3SK3A 3SLCA 4Y1DA 2YKMA 3EEQA 1RDCA 1KFSA 2HBJA 1U04A 4DF4A 3TANA 3OYDA 4B9VA 4FWSA 1NGBA 3ZX3A 2O8CA 4FM1A 4FOEA 1Q81O 5EU7A 1Y97A 4FVMA 2E1ZA 3JYTA 4H0XB 1J5OA 3ZX2A 5FROA 1K6YA 3SMPA 2O8CB 3HP9A 4RWTA 2HHXA 1NOZA 5AQNA 1OH6A 3AVIA 2QWRA 3O1WA 3CCQN 1U4BA 3CPEA 3LDQA 3VEWA 1SL0A 3CJ9A 1KD1O 4CJWA 3DWLA 3KKRA 1Q7YO 4CD1A 4IEIA 4EHUA 4U7BA 1NGCA 3QESA 4JI1K 3KLHA 5EVZA 2IVPA 3CCMN 2UXCK 4CGDA 4DSFA 2NRTA 4CGFA 4FWMA 4BRPA 2HHUA 1ZYQA 3O3HA 4C8LA 3DRPA 3I0RA 4FK4A 3WXMB 2YI1A 3QEPA 1VQ9N 2KQ2A 2O8DA 5CHIA 3CFPA 3SNNA 5DM7L 4A57A 1SL1A 4W5RA 5HP1A 4KB1A 2OTLN 3LZIA 4H5VA 4CEDA 4PKGA 5J2NA 4KHUA 2P9PA 1XI1A 4Z4CA 2ZJQL 3AARA 2UU9K 1TL1A 5HROA 3O9TA 3FZLA 3IFRA 4K42A 3WNEA 3T3FA 4DTJA 4JKEA 3V81A 2GELA 2HBKA 2EHGA 4CZJA 1ATNA 2P5GA 3CJ7A 5JVGL 1FW6A 4B3OA 3HO1A 4MLEA 3HI0A 3TSQA 4BRQA 1D4XA 2HHVA 2HBMA 4OPJA 5KRTA 3D2FA 4CF2A 4ELUA 2DPNA 4KHQA 4M3XA 3OYGA 4R79A 1YJ9N 3CFOA 1OH7A 2G8VA 1DTTA 4A59A 5KGXA 1XHZA 1U2VB 3CCRN 4DF8A 1DT9A 1KSPA 1RDWX 1TKZA 1NK8A 3O3GA 3V4IA 5AR0A 3O9RA 1VQ4N 5KGWA 4DV6K 3CC7N 4DTRA 3VEVA 4DSEA 2ASMA 2W40A 3G0ZA 1BO5O 4IDKA 3H6EA 2R7YA 2OYQA 3QETA 4OLBA 1TV6A 3MEEA 3KK1A 2X74A 4GVMA 4BRCA 3F73A 2YJEA 3ISNC 4CGGA 4RCHA 2BUPA 4ILHA 3J8AA 2PFUA 3VOVA 4AHCA 2GTDA 3K2PA 3PY8A 5BN8A 1N34K 2DFEA 5FPNA 3TU5A 3NH0A 5E84A 4FJ5A 3CQ8A 3CC2N 4B9TA 1P90A 4BGBA 1GLCG 3O6WA 1BGXT 4J2BA 4CHOA 3EKUA 3WUHA 2HOEA 3QFUA 2NRRA 4UQGA 1UA1A 1Q8IA 4CEAA 4DFMA 2PBDA 3MCAB 4ID1A 3LM9A 2QM1A 2DY4A 4CJ7A 4PUOA 4CHNA 3G10A 3ULDA 3PO5A 5AQRA 2A40A 3T19A 3CMEN 4JKFA 4PA1A 3VQ9A 3L4QA 3CD6N 2HVHA 4DSIA 5JICA 3SUNA 4IEEA 4PWDA 3D2EB 4OGCA 3V9ZA 2P9NB 2ZD1A 4ISFA 4M63C 4WQ5C 2OANA 3VGKA 4CJUA 4B1WB 3F2KA 4GV6A 1CLQA 4DR3K 3TABA 4JKCA 3O4QA 2UXBK 4JRQA 2VWKA 3WQTA 2VWBA 1RT1A 1IKVA 3C7NA 3DLRA 3L0QA 2P9IB 2EWSA 3TTDA 3RMAA 3A5NC 4RW4A 4BR0A 2KZZA 3IDHA 4BDPA 4H5WA 2E6MA 1BOTO 4CW7B 3WEEA 4H5NA 5AQKA 3OJSA 4X62K 3T1AA 2HVIA 4JKGB 3NGZA 1C0TA 2F9WA 5AQVA 1NK4A 1KLNA 3SPZA 1NJZA 5MLCQ 4DTMA 1KQSM 5AQTA 1CZ9A 1RTHA 3VF2A 4A61A 1WOQA 5LY3A 3VERA 4CBUA 2OZSA 3ID8A 3BF3A 3D7EO 2I7PA 4GV9A 3GOIA 4CFDA 4FLTA 3OA9A 1I39A 3O4WA 3L2VA 2GWJA 3C6AA 5E41A 3QEIA 3ASMA 4BWJA 4B1UB 2FBYA 4DUZK 5CY4A 3OYBA 4CZMA 4DV1K 1D9DA 1VRTA 1HQUA 3LWMA 1CXUA 3MXJA 4IXCA 3SPYA 3U3GA 5GIOA 4RG8A 4IO9L 5H1SQ 2O8EB 1JLCA 4FOIA 2GWKA 4BDYA 4XIUA 5KQ8A 1TK0A 4CK1A 3RRHA 4I9LA 1GLDG 4FK2A 3AVFA 1YAGA 1R59O 5KTQA 4DFJA 1VSLA 4FLVA 4E1MA 4KBOA 1MDUB 3UB5A 3KJVA 4FJ8A 4IFYA 4HUFA 4CJKA 3AAQA 4EFHA 4B1YB 2HHHK 3H45C 5BPLA 4CJEA 1TKDA 1UWBA 4ZHRA 3MCPA 1K8AO 3SMSA 2I7NA 4AILC 4BR5A 4OLAA 3LPUA 3TAFA 1QQCA 3N4PA 4B9QA 4PL8A 1TAUA 3HM8A 5ELZA 3K5MA 3RTVA 4CCHA 4Z4GA 4JAXA 3BY5A 5DM6L 3SAGA 4H5TA 3QERA 1QVGM 5C42A 3K5LA 5F1XA 4JK7A 4BRKA 2ASPA 1TUYA 5KQDA 5AQUA 2D0OA 4FSVA 3IG1A 3K5OA 3PLAA 4F2RA 3VEXA 3H3OB 4NXNK 3UKRA 1Z05A 3G71N 4ELVA 3HL8A 4C8NA 4BRHA 2NRXA 3SCXA 4O44A 1S9EA 4OO1J 4CK3A 4B1VA 1YTAA 4GKJK 3KK3A 3T7ZA 3MN6A 1A5XA 3Q7CA 1XNRK 5EXWA 3M8PA 4DR1K 5EY4A 4KH4A 1P8ZA 1VAZA 5F0XA 1RBUA 5AZIB 3VQ7A 4OPHA 4CEFA 2OPQA 2H3GX 1A5VA 1JL2A 1EETA 1NK6A 2RE2A 2QWQA 5KPZA 1RBVA 1X9SA 1Q86O 3SQ4A 2QTDA 1X9JA 4B3RK 1XMOK 3HYFA 3AAPA 4CZIA 3M8QA 4O5BA 1TYQB 4RW6A 3GG4A 3G25A 4Z94A 3TSPA 2UUBK 4DU4A 3TR8A 1S1WA 1D8YA 3GE1A 1HPZA 2IS3A 4FZYA 3ZSXA 3DXMB 2HW3A 4JK9A 2VWJA 2E2OA 4GNIA 4XH1A 3HT3A 4B9SA 4EP4A 4F3OA 5AQHA 2P1JA 3LDPA 4YOWA 2E2NA 4JI7K 2KW4A 3IMXA 3A5LC 3LDSA 3KLGA 4A5BA 1H1VA 3WNFA 4JS5A 3ZT0A 1V4SA 3VQ6A 3OYAA 4DQQA 1TK8A 4CEBA 5B8HA 3GDQA 3ULEA 1QZ5A 4CBXA 2V51B 1VRUA 3OYMA 1KXPA 2W41A 4DTSA 3ULEB 3RR7A 1GOCA 5C2DA 1ESVA 5AQXA 2GEMA 4KH6A 3DLKA 1WSFA 2HHTA 3LWLA 4DTOA 1HYVA 5J2PA 3O1BA 4IO8A 3OTOK 3NF7A 4DLGA 3W3DA 4FWLA 1HPMA 1JLFA 1RT3A 2A3ZA 3CCLN 4PKHA 1GLFO 2KLAA 4CIEA 1SS6A 3QNNA 1HJRA 3WXIA 5HL7L 5M1FA 1HX1A 1J5EK 2JWLA 4LH4A 2FF3B 1OH5A 1IBMK 4BGAA 3O9UA 4H0VB 1IG8A 3U8XA 3VA3A 4NXMK 4IG0A 4K0KK 4FLYA 4B9MA 3AA3A 1IO2A 1Z6RA 3KVGA 1N36K 4M3ZA 3AA5X 4BR4A 4HWIA 5EOYA 1XHXA 4CJLA 3THWB 4CHZA 4BE2A 4PY5A 2D0CA 2Q0RA 3I8DA 1X9WA 2FC0A 2E5LK 5LL6Z 1KVBA 4F4KA 4MLHA 3JXUA 1CXQA 3NF8A 4IOAL 2RF2A 3NFAA 3RSEB 1LW0A 4YDUC 4BRMA 3CERA 4CECA 2O8FB 4W5NA 3VENA 4CE9A 5ADXA 2VQFK 1WAFA 2D4WA 1RBRA 2J4RA 3PSFA 4CGIA 4DHYA 1QQOA 3OYHA 3A5MC 1NBWA 3KWGA 2IAJA 2QWLA 3TAEA 5FPDA 3AO5A 1VQ6N 2X6NA 4RW8A 2BH1A 1OVQA 4JEPA 3W0LA 1JJ2M 3FLCO 2IVOA 4B1ZA 4FJXA 2Q3SA 3H1QA 3JSMA 1VSDA 1LOTB 1VHXA 1RGIA 4CFBA 3AY9A 3ZETB 4E0DA 2RHKA 4GW6A 3TAGA 1HNZK 1HNVA 3PIOL 1HYSA 3TAQA 3D0PA 5AFUA 2DTUA 4B1XB 2IC3A 3C65A 2PYJA 2NUBA 3O3FA 1QSSA 1YVNA 4DFPA 2YCHA 2YHBA 3OJUA 3C94A 4M3TA 3PO4A 4CF8A 3SV3A 1GLJO 5HRRA 1VQMN 3AVAA 2CGLA 5AQSA 3AGKA 1QVFM 1LCUA 3TPQA 3V9WA 2QWOA 3NBPA 3S41A 2VG5A 2ZF5O 3FZKA 3RVCA 3KHYA 1SKSA 1LAWA 3TAMA 3F5TA 4JD2A 3PUFA 2ITGA 3CJ1A 3THVA 4OX9K 1S6QA 3ZEUA 1JCFA 3NCIA 3NHGA 4UY8O 4M3UA 4BQLA 1O1WA 5AQLA 2CGKA 3MXIA 2P9UA 4O4GA 5JLFA 1QSYA 1DKGD 5AQIA 2PYLA 3OHRA 4FJKA 2QEXN 4A2BA 2G8FA 3DLEA 5AJ3K 3DAWA 4CJVA 3VESA 1N5YA 3EE9A 5FRNA 1JLAA 4DG1A 5HLFA 1NU0A 3EKSA 2FSNA 2QA4N 2GV9A 2P9KA 4CZHA 1NK5A 4FL9A 3CMAN 1IKWA 1JLBA 2KKZA 4JS4A 1EWQA 4JRPA 1LWEA 1GLBG 2O8DB 1G15A 1C0GA 4CF1A 4MDBA 4CERA 3LAKA 4DR2K 3O8MA 2P9PB 4AQYK 5GAGP 3VQ4A 3P39A 1LWFA 3MN9A 4N76A 1SZ2A 1MU2A 3ATVA 4EIAA 1W2BM 1HUXA 2F7TA 1XWLA 2QKKA 3SBTA 3CCUN 4B8AB 1NKBA 3EY1A 1RBTA 1FJGK 2D0AA 3ZX0A 4FLZA 1TK5A 1ASVA 1ZC6A 1UA0A 3HXMA 3VETA 3D6RA 1BA0A 4E1JA 4YOUA 4X66K 2GUIA 3CCVN 3FE1A 3D2FB 4BACA 4E7HA 5C0YA 1NGHA 4H0YB 1X1PA 5KRSA 2HNYA 3AO1A 5AZJA 1XUPO 3AV9A 3MEDA 4LH5A 2Q36A 4JI6K 2B5JA 2ASOA 3PV8A 4KREA 2Q2RA 1BDGA 1X3MA 3MK6A 4BROA 4JKHA 1ZBUA 1KVCA 3AVNA 5AQQA 4CZLA 1QS4A 1J54A 3V6DA 3TARA 1VQ5N 4BDZA 1ZBFA 1TL3A 4J8FA 3IRXA 2NZTA 1BQMA 1FKPA 2P9LA 3C95A 3CJAA 4WQ5A 3SJJA 4Q0BA 5JVHL 1ATRA 3NF9A 5M1NA 1RDUA 4IJNA 1SKRA 5IT9O 4Q5VA 1C0MA 1VSIA 4DWIA 4CEQA 2UUCK 3OYIA 4CK2A 3C6TA 4XH4A 4OKEA 4YFUA 3NMUA 4OPAA 5JS2A 3CPWM 5A2QO 3O9QA 1YT3A 5TKWA 2V7ZA 1EWRA 3MN7A 5HRPA 1UOCA 4JI4K 4CEOA 4LFCK 4I9QA 3I0SA 4QS7A 5AQOA 3P1GA 3SQ1A 1KLMA 4CFCA 4DFKA 4CJFA 3FZMA 5J2MA 3CCJN 4EZ9A 3AVBA 1T7PA 4CBWA 4O8UA 1WLJA 4DU3A 1WUAA 4DV4K 1B9DA 4H4MA 4K25A 2X6SA 3CG7A 4E3SA 4B3TK 4N5SA 3WXJA 5M1OA 1KC8O 1N6QA 5I9EB 4KI4A 4FCYA 1F21A 1TUUA 2F4VK 1S1UA 3U4LA 2XY7A 3NVMA 1RDAA 3M3ZA 1NJYA 3MWPA 4BRDA 2PAVA 4YOTA 1W7AA 1HQEA 4EZ6A 2XY6A 4K41A 3ZSOA 3J80O 3FFKB 2IDOA 1K8KA 4AH9A 3CCEN 4HCCA 4F9OA 3VQQA 1NNEA 2NRZA 2OCEA 1HKCA 2YHAA 4DV7K 1NK0A 4CF0A 1YJWN 3HTVA 3A5OC 3AVMA 4KO0A 2BDPA 2O8BA 3T1YK 3M8SA 3QINA 2P51A 2O8BB 2D1KA 3AVJA 4EAHD 1VQLN 1A5WA 5AQFA 4CJQA 1IG9A 2FBVA 4KB0A 4M3YA 3VMFB 3C7NB 1OKJA 1YUWA 2GBZA 4H5RA 3WNHA 4KV8A 2A6AA 3CI5A 4CIFA 1T8EA 1LWCA 3BZCA 4DQIA 3VGMA 4FM2A 3QIOA 1VSEA 4I2PA 1IJJA 1S1VA 2I5JA 3HBTA 3WEEB 4KTWA 1WB9A 4DR6K 4JK8A 4DS5A 3H46O 1FXXA 3E9OA 1GOBA 1Q18A 3AVKA 3MXMA 3ZSZA 3ZSVA 4JYAK 4OKJA 4AHSA 1VQNN 2HHSA 3MAQA 4A5AA 1RDBA 1R0AA 4Y1CA 2AA4A 4JHDA 2Y1JA 4KTQA 3FFIA 3S3NA 2NLXA 1XC3A 1FK9A 4V19S 1L3SA 2JWKA 4IKFA 4MDAA 4CJTA 1NLVA 1QQNA 5BRHA 3AO2A 2YJFA 3V9UA 1ZBHA 4CHPA 3UIQA 1XC9A 3CYMA 2PY5A 2AJQA 2HSTA 1NGAA 1ZBIA 3A2FA 2F8SA 1BUPA 4AHVA 2EX3A 1VSFA 4WCEL 4JI5K 5C2FA 4CIGA 1HR0K 4DS4A 2ZQBA 1RCHA 2Q97A 3ZT2A 1RTIA 2Z1GA 4QS8A 5DK5A 1KVAA 2FSKA 4H0PA 2G8UA 4K8ZA 3R9PA 1S9GA 5C15A 1I94K 4JLHA 3K0SA 3V9SA 4DR7K 2HNZA 3IKMA 1IKXA 4OVLA 4BRIA 3THYA 2ZJRL 1WSHA 3NF6A 4IDHA 1BIZA 1BIUA 1E4FT 1T6DA 3E1YA 1S5JA 4A62A 1RTJA 1IBLK 4DQRA 4HVJA 4FWNA 1Q9YA 4X65K 1S1TA 3OYNA 1IKYA 3I55N 5IWAK 4DSLA 5CZ1A 4FO0A 4FWKA 1NOYA 3J81O 2HF4A 1SV5A 2BANA 1HKBA 3G4SN 1HKGA 4WFBL 4B9LA 4HTLA 3KLFA 4BRLA 1XNQK 3WNGA 2CGJA 4M7YA 5CYQA 1NGFA 3LP0A 3HP6A 3BEXA 1ASUA 4ELTA 3ITHA 3NDKA 4FW2A 3KIOA 2JLEA 1S3XA 5AQJA 2Q31A 1TGOA 5KPTA 4KHWA 3VQEA 4F2SA 2UYTA 3ZSQA 2YNHA 2UXDK 2CH6A 4AHTA 1WAJA 3N4QA 3UKRB 2ZE2A 4KHPK 3B6PA 2AP1A 3D45A 3O08A 4QOZB 3THXA 5KI6A 1HJOA 2B6AA 4IWVA 4LC9B 2UUAK 4FLUA 2KZMA 1SL2A 1QTMA 2HF3A 4I6MA 3QIPA 3SAHA 2FSJA 1S6PA 3NVKA 4BRFA 4DV2K 3CF5L 4N47A 4W5TA 3RMDA 3HVRA 4IFEA 1NJIO 4BG9A 4HTUA 3AO3A 4FJ7A 5LMNK 1JXBA 3NH1A 4E19A 2IGIA 3U3YA 4Z4HA 4QCLA 3R6MA 3E66A 4DSKA 3HM9A 2E8AA 3K9JA 5CZ2A 4C8KA 4IFVA 5LJWA 2P9SA 4E7IA 3AVGA 4F3TA 5CR4A 4FWRA 1YIJN 3DYAA 1NG9A 4IOXA 1N32K 5C10A 4NCGA 3AVHA 1NJXA 4DSJA 1VSJA 4CGHA 4M3WA 1IBKK 1DEJA 2WC9A 1NGEA 3ATUA 3F9MA 4YDUA 3QEXA 2ZJPL 3HPHA 1JL1A 2D0BA 4WFNL 3MMVA 1KRPA 3DM2A 4FWPA 4CHYA 3NH2A 3RR8A 1WBBA 4FWOA 4FZZA 4LF6K 4X64K 1J53A 3HOTA 4YOVA 3HJFA 1BI4A 3MEGA 4EHTA 4AHUA 1KCFA 3ZCMA 4GY2B 4OKKA 1KTQA 1WNSA 1WSIA 4DCHA 1JCGA 2YHXA 3UKUA 1LW2A 4B9NA 5I3UA 1C6VA 3G6EN 4B3MK 1BHLA 1G99A 1WSGA 2E2QA 1BWFO 4IZ9A 5GAHP 4CZFA 3H1VX 3VQBA 3ZSYA 1VSKA 5JS1A 4AF1A 2JGUA 1X9MA 1U6ZA 4K43A 4XH5A 1C1AA 3HPOA 4FJLA 1U47A 2G8IA 5J1EA 4DLEA 4G1QA 1NK9A 4NLCA 1FKOA 3SZ2A 2DFFA 2E6LA 1JCEA 4LF8K 2LSNA 4BVOA 3J7AP 3LDOA 1I3AA 4NYFA 3U9ZA 4N41A 4BRNA 3LAMA 5C25A 4DQPA 2CH5A 4MFBA 4AHRA 4YHHK 4CF9A 3FR0A 5BR9A 2WFBA 1IH7A 4LF4K 2HMPA 4BC2A 3VEZA 4CEZA 3T69A 3VN5A 4C8MA 4CI6A 4FWQA 2XO7A 3MN5A 3DLGA 2YHYA 4PQUA 3LM2A 1TVRA 4H8KA 4E7LA 3BZKA 4O8KA 3F9KA 1S1XA 2QWMA 3DJCA 3BGRA 4XEIA 4FVUA 3CC4N 2A5XA 1Q9XA 1C1CA 4OGEA 2E2PA 2ZWHA 3NGIA 4LFBK 5FPMA 2ZM6K 4IG3A 3P38A 1CZAN 5CE3A 4KPYA 1EO1A 1ZBSA 3CJBA 2OA8A 2RPIA 1QE1A 3FZHA 3LP3A 2ATQA 1L3UA 2HHQA 3SV4A 3OYFA 1REVA 5BRFA 4O0IA 1JLEA 5M1PA 2QXLA 5GADP 2OPPA 4JNEA 3L8BA 5SZTA 3AA2A 2A1RA 4B3SK 2F96A 1YF5L 3PX0A 2WBNA 4CHQA 4YY3K 3B8AX 4QS9A 4TSXA 4HUGA 5HBMA 4GV3A 3I56N 5BRDA 1RT4A 3OYEA 1RTDA 3K5NA 3OYJA 3KLEA 4E7KA 4JD2B 2BTFA 1KAYA 4EP5A 4FXDA 1BU6O 3OYCA 3ZEUB 1ZXOA 2VCPA 3J7ZO 2QI2A 4MQ3A 3OW2M 2OZMA 1DGKN 2P9UB 3A0IX 5KPRA 3P83D 4M45A 5F2RA 4DTUA 4DTPA 3P5JA 1BISA 1YTUA 3ALYA 2O4GA 3R3LA 3SJHA 1IV0A 3TTCA 2P9KB 1RT2A 1C0FA 3M1FA 2YNFA 3PX6A 3LP2A 1U45A 4OPKA 4NYNA 4Z4IA 4C1NI 3L2QA 3VTHA 3KD1E 4N56A 3C6HA 4FLWA 3B6OA 3IUCA 1BG3A 3SUOA 4NLBA 4JKBA 3LPTA 3VF6A 3SQ0A 2XRIA 4RTFD 2HB5A 1QHTA 1OH8A 4PL7A 2WUSA 4M42A 1T05A 1J9AA 3WT0A 5I42A 2G8KA 3QB0A 3I8BA 3K58A 2Z1JA
chains in the Genus database with same CATH topology
4LY7A 1YTAA 3DOLA 3SUPA 2G8HA 4CIFA 1T8EA 1LWCA 3KK3A 2YNGA 4DQIA 4FM2A 3IAYA 1A5XA 3QIOA 2BGGA 3V1OA 5HRNA 3M8PA 1VSEA 2KTQA 4I2PA 3LANA 2G8WA 3L2WA 1S1VA 2I5JA 4B9UA 1JLGA 2F8TA 4KTWA 1RBUA 2FBTA 3VQ7A 4FLXA 5SWMA 4DS5A 1GOAA 4CEFA 3ZT1A 2OPQA 4LD0A 1UAXA 1FXXA 4KFBA 1A5VA 1JL2A 3QO9A 1EETA 1GOBA 2KFZA 1NK6A 3AVKA 5FDLA 3MXMA 3CFRA 1RBVA 3KLIA 3ZSZA 3V9XA 1D5AA 2Z1HA 3ZSVA 3QNOA 1X9SA 4OKJA 3SQ4A 1L3TA 4AHSA 4HUEA 3HYFA 2HHSA 3OYKA 3MAQA 1RDBA 2XY5A 1R0AA 3M8QA 4O5BA 4Y1CA 4FJHA 2HMIA 2Y1JA 4YNQA 4RW6A 4KTQA 4HHTA 4GMJB 3TI0A 3FFIA 1RDDA 4DU4A 2FBXA 3TR8A 3L3UA 1S1WA 3S3NA 4I2QA 1D8YA 1FK9A 1EKEA 1HPZA 1ZBLA 3IS9A 2IS3A 3NGYA 1L3SA 4FZYA 4Z0UA 3ZSXA 5DMRA 4IKFA 2RKIA 2HW3A 1C0UA 2VWJA 4CJTA 3HT3A 5K14A 4B9SA 4DQSA 4EP4A 3AO2A 4J2AA 5FRMA 4F3OA 3V9UA 1ZBHA 4CHPA 3UIQA 2P1JA 3SI6A 1XC9A 3LALA 3CYMA 3L3VA 2PY5A 3RMCA 2AJQA 1ZBIA 4LSNA 2KW4A 3A2FA 3OS2A 3VQ8A 2F8SA 1RILA 3OYLA 3LDSA 4AHVA 1HMVA 3KLGA 4Y1DA 2EX3A 2YKMA 3V1RA 1VSFA 3WNFA 1RDCA 4JS5A 1KFSA 3ZT0A 1U04A 3VQ6A 3OYAA 4DQQA 4CIGA 1TK8A 3H08A 4CEBA 4DS4A 4DF4A 3TANA 2ZQBA 1RCHA 3OYDA 4B9VA 3ZT2A 1RTIA 2HNDA 2Z1GA 3QLHA 4O44A 3KK2A 4H4OA 1VRUA 5DK5A 3OYMA 1KVAA 4FM1A 5EU7A 1Y97A 2X78A 3HPGA 4FVMA 3JYTA 4DTSA 1J5OA 3M8RA 3RR7A 1GOCA 4F8RA 2O4IA 2G8UA 4K8ZA 5FROA 4KTZA 1S9GA 4FK0A 2Z1IA 1RNHA 1K6YA 3VQ5A 3HP9A 4JLHA 3DLKA 3L2RA 2HHXA 1NOZA 1WSFA 2HHTA 3V9SA 3ZT4A 2HNZA 1HYVA 3LWLA 4DTOA 1IKXA 4I7FA 4OVLA 5J2PA 3CM6A 1BCOA 3AVIA 1WSHA 3NF6A 1BIZA 4CJRA 1BIUA 4KI6A 3MECA 1U4BA 3PX4A 3NF7A 4DLGA 1SL0A 4FJJA 1S5JA 1Z25A 1RTJA 4FM0A 4DQRA 4CJWA 1RT3A 1JLFA 4HVJA 2P5OA 3KKRA 4E7JA 4CIEA 1Q9YA 3QNNA 1HJRA 1S1TA 1IKYA 3OYNA 3K57A 4BE1A 2VG6A 4DSLA 4LH4A 5CZ1A 3QESA 3CM5A 3L2UA 2OPSA 3NAEA 3VQDA 1NOYA 4B8CA 3KLHA 4CGDA 1SV5A 4DSFA 4CGFA 2BANA 1BQNA 3VA3A 4B9LA 4IG0A 2HHUA 2B4JA 3KLFA 1ZYQA 3O3HA 4FLYA 4C8LA 3S3MA 3WNGA 3DRPA 3AA3A 4B9MA 1IO2A 3I0RA 3AO4A 4FK4A 5CYQA 3LP0A 3QEPA 3HP6A 5CYMA 2KQ2A 3RMBA 1ASUA 3CFPA 3AA4A 3ITHA 3SNNA 3SYZA 4ELTA 4M3ZA 3AA5X 4FW2A 3NDKA 1SL1A 3KIOA 2JLEA 4W5RA 4KHSA 3VA0A 5HP1A 4KB1A 1TGOA 3LZIA 1XHXA 4CEDA 4CJLA 4KHWA 3VQEA 4E89A 5J2NA 4F2SA 4CHZA 4BE2A 4KHUA 3ZSQA 4PY5A 2YNHA 2D0CA 3I8DA 4AHTA 1XI1A 2FC0A 1WAJA 1X9WA 4Z4CA 1KVBA 1RBSA 4F4KA 2ZE2A 1CXQA 1CZBA 1WN7A 3B6PA 1HRHA 1TL1A 4CJ4A 2HHWA 3NF8A 3D45A 4E1NA 4QOZB 5KI6A 2RF2A 4Z4FA 5HROA 2B6AA 3WNEA 3T3FA 3NFAA 4FLUA 2KZMA 1SL2A 4DTJA 3V81A 1QTMA 3QIPA 1LAVA 1LW0A 2EHGA 1VK0A 3RRGA 2P5GA 3TAPA 1S6PA 3C6UA 1Z26A 4CECA 4DTNA 4B3OA 3HO1A 4W5NA 2XHBA 4CE9A 3SQ2A 1WAFA 1RBRA 4CGIA 3OYHA 2HHVA 4N47A 4OPJA 3OS1A 3TWHA 4W5TA 5KRTA 3RMDA 4CF2A 3HVRA 4ELUA 4M3XA 4KHQA 1BCMA 3OYGA 4HTUA 1T03A 3AO3A 3HSTB 4FJ7A 1JXBA 2IAJA 3CFOA 4CJSA 3TAEA 4KHYA 3AO5A 3NH1A 4NCBA 2X6NA 4E19A 2IGIA 2G8VA 4RW8A 3U3YA 1DTTA 4K8XA 1HYZA 5KGXA 1SKWA 1XHZA 4Z4HA 4QAGA 4FJGA 4M3RA 3EZ5A 4DF8A 1KSPA 4QCLA 4HCBA 2YNIA 4DSKA 1TKZA 3SUQA 3HM9A 1NK8A 2Q3SA 4FJXA 3JSMA 1VSDA 5CZ2A 3O3GA 4DU1A 4C8KA 3V4IA 4IFVA 4CK3A 3EYZA 4ZTFA 4E7IA 3AVGA 4F3TA 4CFBA 5KGWA 4E0DA 4GW6A 3DYAA 3TAGA 1RT7A 4DTRA 1HNVA 4DSEA 4NCGA 2IOCA 3AVHA 4IBNA 1NJXA 1HYSA 3TAQA 3D0PA 4CFAA 2DTUA 4DSJA 2IC3A 2PYJA 1VSJA 2NUBA 2QXFA 3O3FA 3G0ZA 1QSSA 4L8RB 4CGHA 4IDKA 4M3WA 4DFPA 3U6FA 2R7YA 2OYQA 4R5PA 2YHBA 3OJUA 3QETA 3QEXA 3DLHA 3C94A 1D9FA 4OLBA 3HPHA 4M3TA 3PO4A 3NE6A 1JL1A 1TV6A 4CF8A 3SV3A 2D0BA 5HRRA 1KRPA 2WONA 3DM2A 3MEEA 3KK1A 2X74A 4GVMA 4CHYA 3NH2A 3F73A 3AVAA 3RR8A 4WE1A 3ISNC 3VQAA 4CGGA 4KHNA 3KKSA 4FYDA 2RN2A 3V9WA 4FZZA 1J53A 3NBPA 2VG5A 1TKTA 1SKSA 4AHCA 5T7BA 4J2DA 3HJFA 1LAWA 1BI4A 3K2PA 3MEGA 3PUFA 3TAMA 3PY8A 2ITGA 2Y1IA 4W5OA 3THVA 2DFEA 1KCFA 1S6QA 4ID5A 3ZCMA 4AHUA 3NH0A 4OKKA 1NK7A 1KTQA 3NCIA 3NHGA 4FJ5A 4M3UA 3CQ8A 1WNSA 1WSIA 4B9TA 3OVNA 2W42A 1B9FA 1O1WA 3LZJA 1LW2A 1BGXT 5C24A 1JLQA 3MXIA 3BDPA 1ASWA 4B9NA 4O4GA 1QSYA 4J2BA 4CHOA 5I3UA 1C6VA 2PYLA 3VQCA 4J2EA 4FJKA 2ETJA 3LP1A 3AVLA 2G8FA 1B92A 3DLEA 4UQGA 1BHLA 1WSGA 1UA1A 1Q8IA 2BE2A 4CEAA 4CJVA 4DFMA 4ID1A 4ZTJA 1N5YA 5D3GA 1JLAA 5FRNA 3VQBA 4DG1A 5HLFA 2DY4A 2DFHA 3ZSYA 1VSKA 4CHNA 3G10A 3ZSRA 4PUOA 5JS1A 3ULDA 2JGUA 1X9MA 2GV9A 3PO5A 1NK5A 3T19A 3DLBA 2QKBA 1C1AA 1IKWA 2OPRA 4O0JA 4PA1A 1JLBA 3VQ9A 1U49A 3HPOA 3ZT3A 2HVHA 1NK4A 4FJ9A 4FJLA 1U47A 4JS4A 4DSIA 4JRPA 3SUNA 4PWDA 1LWEA 2G8IA 3AVCA 5J1EA 4OGCA 4G1QA 4DLEA 3V9ZA 1G15A 2ZD1A 4CF1A 1NK9A 3DRSA 3RWUA 4CJUA 1CLQA 1FKOA 3KD5E 3SZ2A 2DFFA 3QEWA 4FJMA 1WSEA 2E6LA 3LAKA 4CERA 3TABA 3DOKA 1WSJA 2LSNA 3O4QA 4JRQA 2VWKA 4CESA 3VQ4A 1RT1A 1IKVA 1HNIA 3DLRA 1I3AA 4NYFA 1LWFA 4N76A 1MU2A 3HVTA 1NKEA 4LSLA 5HRSA 4N41A 1XWLA 3LAMA 3RMAA 2QKKA 1JXEA 4CJ3A 4RW4A 4B8AB 1NKBA 1EXQA 3EY1A 5C25A 1RBTA 1L5UA 4DQPA 2D0AA 2KZZA 4MFBA 4AHRA 3E01A 4B08A 4FLZA 1TK5A 2YV0X 1ASVA 1VSHA 1EX4A 1UA0A 3HXMA 4BDPA 2E6MA 4CF9A 4PQUA 3ZSWA 1IH7A 4RW9A 1ITGA 3OJSA 2GUIA 3T1AA 2HVIA 2WOMA 1QSLA 4CEZA 3NGZA 4BACA 1C0TA 4E7HA 3VN5A 4C8MA 2XO7A 4DMNA 1X1PA 1BL3A 5KRSA 3S9HA 2HNYA 3AO1A 4OJRA 3SPZA 1C1BA 3AV9A 3DLGA 3MEDA 4LH5A 4CGJA 2B5JA 1NJZA 4NCAA 3OS0A 1TVRA 3DMJA 4H8KA 4DTMA 4BWMA 3PV8A 4KREA 1CZ9A 1RTHA 1LV5A 4E7LA 1L3VA 1VSMA 2OZSA 1ZBUA 1KVCA 3AVNA 1TAQA 1U48A 3F9KA 1S1XA 1QS4A 1J54A 3V6DA 3BGRA 3TARA 1DTQA 4CFDA 4FLTA 4BDZA 1ZBFA 1TL3A 1I39A 3L2VA 1Q9XA 3IRXA 1BQMA 1C1CA 4OGEA 3V1QA 1FKPA 2VG7A 5E41A 3QEIA 3ASMA 3C95A 4FZXC 2A1SA 4FW1A 4M41A 3NGIA 4BWJA 3SJJA 4Q0BA 3DRRA 4FJIA 1NJWA 4IG3A 3NF9A 2FBYA 5CY4A 1W0HA 3OYBA 1SKRA 1D9DA 4KPYA 2QK9A 1VRTA 4Q5VA 1C0MA 1VSIA 2OA8A 2RPIA 1HQUA 4DWIA 1QE1A 3LP3A 4CEQA 1CXUA 2ATQA 3LWMA 3MXJA 3OYIA 2E4LA 3U3GA 3SV4A 3SPYA 2HHQA 3OYFA 1NKCA 1REVA 4RG8A 4CK2A 1W9HA 3C6TA 4OKEA 4O0IA 1JLEA 4CJ5A 4YFUA 2D5RA 5JS2A 2PZSA 1JLCA 1RT5A 1YT3A 3S3OA 1TKXA 2OPPA 3L8BA 1RT6A 4BDYA 1KFDA 4XIUA 5SZTA 3AA2A 2A1RA 1TK0A 4CK1A 2F96A 1UOCA 3DI6A 5HRPA 4CEOA 3RRHA 4I9LA 2KFNA 3PX0A 1DLOA 3I0SA 4I9QA 3HK2A 3P1GA 4CHQA 4FK2A 3AVFA 3SQ1A 4TSXA 4HUGA 5HBMA 1KLMA 4CFCA 5KTQA 4DFJA 1VSLA 4CJFA 4DFKA 4KAZA 1RT4A 3OYEA 4FLVA 1RTDA 4E1MA 3K5NA 5J2MA 4EZ9A 3OYJA 3AVBA 3KLEA 3KJVA 4IFYA 4BE0A 4HUFA 1BI4B 4E7KA 1T7PA 4CJKA 4FJ8A 1KLNA 1SUQA 4EP5A 4FXDA 3OYCA 1WLJA 4CJEA 4DU3A 1TKDA 1B9DA 1EP4A 1UWBA 4CJPA 4ZHRA 4H4MA 4W5QA 4C8OA 2X6SA 3CG7A 4MQ3A 4E3SA 5J2QA 4DTXA 4N5SA 2OZMA 4AILC 1N6QA 3P83D 4KI4A 4OLAA 4FCYA 1JKHA 1F21A 4M45A 3LPUA 4KKOA 4RW7A 3KTQA 3TAFA 1S1UA 2XY7A 1QQCA 4Z4EA 4DTUA 1RDAA 3P5JA 4DTPA 1BISA 1NJYA 2XY8A 1YTUA 3ALYA 1TAUA 3K5MA 1HQEA 3RTVA 4CCHA 3QEVA 4Z4GA 4EZ6A 2XY6A 3ZSOA 2IDOA 2O4GA 4O55A 4AH9A 4HCCA 3QERA 1RT2A 5C42A 3VQQA 2YHAA 3K5LA 1NK0A 4CF0A 2YNFA 3PX6A 3AVMA 3LP2A 4KO0A 4OPKA 4NYNA 3K59A 1U45A 2BDPA 4Z4IA 2YKNA 3M8SA 3L2QA 3QINA 2P51A 3KD1E 1YVUA 1L3UA 4KRFA 4N56A 4FLWA 3B6OA 3SUOA 3IG1A 3AVJA 3K5OA 3LPTA 3VQPA 3SQ0A 2XRIA 4F2RA 4ICLA 2HB5A 1QHTA 1A5WA 4CJQA 3OY9A 1IG9A 2FBVA 4KB0A 4CEEA 4M42A 4M3YA 1T05A 4FJNA 1J9AA 2GBZA 3O4NA 4ELVA 3HL8A 4C8NA 3WNHA 4KV8A 5I42A 3SCXA 2G8KA 1S9EA 3K58A 2Z1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LY7 A;  1YTA A;  3DOL A;  3SUP A;  2G8H A;  4CIF A;  1T8E A;  1LWC A;  3KK3 A;  2YNG A;  4DQI A;  4FM2 A;  3IAY A;  1A5X A;  3QIO A;  2BGG A;  3V1O A;  5HRN A;  3M8P A;  1VSE A;  2KTQ A;  4I2P A;  3LAN A;  2G8W A;  3L2W A;  1S1V A;  2I5J A;  4B9U A;  1JLG A;  2F8T A;  4KTW A;  1RBU A;  2FBT A;  3VQ7 A;  4FLX A;  5SWM A;  4DS5 A;  1GOA A;  4CEF A;  3ZT1 A;  2OPQ A;  4LD0 A;  1UAX A;  1FXX A;  4KFB A;  1A5V A;  1JL2 A;  3QO9 A;  1EET A;  1GOB A;  2KFZ A;  1NK6 A;  3AVK A;  5FDL A;  3MXM A;  3CFR A;  1RBV A;  3KLI A;  3ZSZ A;  3V9X A;  1D5A A;  2Z1H A;  3ZSV A;  3QNO A;  1X9S A;  4OKJ A;  3SQ4 A;  1L3T A;  4AHS A;  4HUE A;  3HYF A;  2HHS A;  3OYK A;  3MAQ A;  1RDB A;  2XY5 A;  1R0A A;  3M8Q A;  4O5B A;  4Y1C A;  4FJH A;  2HMI A;  2Y1J A;  4YNQ A;  4RW6 A;  4KTQ A;  4HHT A;  4GMJ B;  3TI0 A;  3FFI A;  1RDD A;  4DU4 A;  2FBX A;  3TR8 A;  3L3U A;  1S1W A;  3S3N A;  4I2Q A;  1D8Y A;  1FK9 A;  1EKE A;  1HPZ A;  1ZBL A;  3IS9 A;  2IS3 A;  3NGY A;  1L3S A;  4FZY A;  4Z0U A;  3ZSX A;  5DMR A;  4IKF A;  2RKI A;  2HW3 A;  1C0U A;  2VWJ A;  4CJT A;  3HT3 A;  5K14 A;  4B9S A;  4DQS A;  4EP4 A;  3AO2 A;  4J2A A;  5FRM A;  4F3O A;  3V9U A;  1ZBH A;  4CHP A;  3UIQ A;  2P1J A;  3SI6 A;  1XC9 A;  3LAL A;  3CYM A;  3L3V A;  2PY5 A;  3RMC A;  2AJQ A;  1ZBI A;  4LSN A;  2KW4 A;  3A2F A;  3OS2 A;  3VQ8 A;  2F8S A;  1RIL A;  3OYL A;  3LDS A;  4AHV A;  1HMV A;  3KLG A;  4Y1D A;  2EX3 A;  2YKM A;  3V1R A;  1VSF A;  3WNF A;  1RDC A;  4JS5 A;  1KFS A;  3ZT0 A;  1U04 A;  3VQ6 A;  3OYA A;  4DQQ A;  4CIG A;  1TK8 A;  3H08 A;  4CEB A;  4DS4 A;  4DF4 A;  3TAN A;  2ZQB A;  1RCH A;  3OYD A;  4B9V A;  3ZT2 A;  1RTI A;  2HND A;  2Z1G A;  3QLH A;  4O44 A;  3KK2 A;  4H4O A;  1VRU A;  5DK5 A;  3OYM A;  1KVA A;  4FM1 A;  5EU7 A;  1Y97 A;  2X78 A;  3HPG A;  4FVM A;  3JYT A;  4DTS A;  1J5O A;  3M8R A;  3RR7 A;  1GOC A;  4F8R A;  2O4I A;  2G8U A;  4K8Z A;  5FRO A;  4KTZ A;  1S9G A;  4FK0 A;  2Z1I A;  1RNH A;  1K6Y A;  3VQ5 A;  3HP9 A;  4JLH A;  3DLK A;  3L2R A;  2HHX A;  1NOZ A;  1WSF A;  2HHT A;  3V9S A;  3ZT4 A;  2HNZ A;  1HYV A;  3LWL A;  4DTO A;  1IKX A;  4I7F A;  4OVL A;  5J2P A;  3CM6 A;  1BCO A;  3AVI A;  1WSH A;  3NF6 A;  1BIZ A;  4CJR A;  1BIU A;  4KI6 A;  3MEC A;  1U4B A;  3PX4 A;  3NF7 A;  4DLG A;  1SL0 A;  4FJJ A;  1S5J A;  1Z25 A;  1RTJ A;  4FM0 A;  4DQR A;  4CJW A;  1RT3 A;  1JLF A;  4HVJ A;  2P5O A;  3KKR A;  4E7J A;  4CIE A;  1Q9Y A;  3QNN A;  1HJR A;  1S1T A;  1IKY A;  3OYN A;  3K57 A;  4BE1 A;  2VG6 A;  4DSL A;  4LH4 A;  5CZ1 A;  3QES A;  3CM5 A;  3L2U A;  2OPS A;  3NAE A;  3VQD A;  1NOY A;  4B8C A;  3KLH A;  4CGD A;  1SV5 A;  4DSF A;  4CGF A;  2BAN A;  1BQN A;  3VA3 A;  4B9L A;  4IG0 A;  2HHU A;  2B4J A;  3KLF A;  1ZYQ A;  3O3H A;  4FLY A;  4C8L A;  3S3M A;  3WNG A;  3DRP A;  3AA3 A;  4B9M A;  1IO2 A;  3I0R A;  3AO4 A;  4FK4 A;  5CYQ A;  3LP0 A;  3QEP A;  3HP6 A;  5CYM A;  2KQ2 A;  3RMB A;  1ASU A;  3CFP A;  3AA4 A;  3ITH A;  3SNN A;  3SYZ A;  4ELT A;  4M3Z A;  3AA5 X;  4FW2 A;  3NDK A;  1SL1 A;  3KIO A;  2JLE A;  4W5R A;  4KHS A;  3VA0 A;  5HP1 A;  4KB1 A;  1TGO A;  3LZI A;  1XHX A;  4CED A;  4CJL A;  4KHW A;  3VQE A;  4E89 A;  5J2N A;  4F2S A;  4CHZ A;  4BE2 A;  4KHU A;  3ZSQ A;  4PY5 A;  2YNH A;  2D0C A;  3I8D A;  4AHT A;  1XI1 A;  2FC0 A;  1WAJ A;  1X9W A;  4Z4C A;  1KVB A;  1RBS A;  4F4K A;  2ZE2 A;  1CXQ A;  1CZB A;  1WN7 A;  3B6P A;  1HRH A;  1TL1 A;  4CJ4 A;  2HHW A;  3NF8 A;  3D45 A;  4E1N A;  4QOZ B;  5KI6 A;  2RF2 A;  4Z4F A;  5HRO A;  2B6A A;  3WNE A;  3T3F A;  3NFA A;  4FLU A;  2KZM A;  1SL2 A;  4DTJ A;  3V81 A;  1QTM A;  3QIP A;  1LAV A;  1LW0 A;  2EHG A;  1VK0 A;  3RRG A;  2P5G A;  3TAP A;  1S6P A;  3C6U A;  1Z26 A;  4CEC A;  4DTN A;  4B3O A;  3HO1 A;  4W5N A;  2XHB A;  4CE9 A;  3SQ2 A;  1WAF A;  1RBR A;  4CGI A;  3OYH A;  2HHV A;  4N47 A;  4OPJ A;  3OS1 A;  3TWH A;  4W5T A;  5KRT A;  3RMD A;  4CF2 A;  3HVR A;  4ELU A;  4M3X A;  4KHQ A;  1BCM A;  3OYG A;  4HTU A;  1T03 A;  3AO3 A;  3HST B;  4FJ7 A;  1JXB A;  2IAJ A;  3CFO A;  4CJS A;  3TAE A;  4KHY A;  3AO5 A;  3NH1 A;  4NCB A;  2X6N A;  4E19 A;  2IGI A;  2G8V A;  4RW8 A;  3U3Y A;  1DTT A;  4K8X A;  1HYZ A;  5KGX A;  1SKW A;  1XHZ A;  4Z4H A;  4QAG A;  4FJG A;  4M3R A;  3EZ5 A;  4DF8 A;  1KSP A;  4QCL A;  4HCB A;  2YNI A;  4DSK A;  1TKZ A;  3SUQ A;  3HM9 A;  1NK8 A;  2Q3S A;  4FJX A;  3JSM A;  1VSD A;  5CZ2 A;  3O3G A;  4DU1 A;  4C8K A;  3V4I A;  4IFV A;  4CK3 A;  3EYZ A;  4ZTF A;  4E7I A;  3AVG A;  4F3T A;  4CFB A;  5KGW A;  4E0D A;  4GW6 A;  3DYA A;  3TAG A;  1RT7 A;  4DTR A;  1HNV A;  4DSE A;  4NCG A;  2IOC A;  3AVH A;  4IBN A;  1NJX A;  1HYS A;  3TAQ A;  3D0P A;  4CFA A;  2DTU A;  4DSJ A;  2IC3 A;  2PYJ A;  1VSJ A;  2NUB A;  2QXF A;  3O3F A;  3G0Z A;  1QSS A;  4L8R B;  4CGH A;  4IDK A;  4M3W A;  4DFP A;  3U6F A;  2R7Y A;  2OYQ A;  4R5P A;  2YHB A;  3OJU A;  3QET A;  3QEX A;  3DLH A;  3C94 A;  1D9F A;  4OLB A;  3HPH A;  4M3T A;  3PO4 A;  3NE6 A;  1JL1 A;  1TV6 A;  4CF8 A;  3SV3 A;  2D0B A;  5HRR A;  1KRP A;  2WON A;  3DM2 A;  3MEE A;  3KK1 A;  2X74 A;  4GVM A;  4CHY A;  3NH2 A;  3F73 A;  3AVA A;  3RR8 A;  4WE1 A;  3ISN C;  3VQA A;  4CGG A;  4KHN A;  3KKS A;  4FYD A;  2RN2 A;  3V9W A;  4FZZ A;  1J53 A;  3NBP A;  2VG5 A;  1TKT A;  1SKS A;  4AHC A;  5T7B A;  4J2D A;  3HJF A;  1LAW A;  1BI4 A;  3K2P A;  3MEG A;  3PUF A;  3TAM A;  3PY8 A;  2ITG A;  2Y1I A;  4W5O A;  3THV A;  2DFE A;  1KCF A;  1S6Q A;  4ID5 A;  3ZCM A;  4AHU A;  3NH0 A;  4OKK A;  1NK7 A;  1KTQ A;  3NCI A;  3NHG A;  4FJ5 A;  4M3U A;  3CQ8 A;  1WNS A;  1WSI A;  4B9T A;  3OVN A;  2W42 A;  1B9F A;  1O1W A;  3LZJ A;  1LW2 A;  1BGX T;  5C24 A;  1JLQ A;  3MXI A;  3BDP A;  1ASW A;  4B9N A;  4O4G A;  1QSY A;  4J2B A;  4CHO A;  5I3U A;  1C6V A;  2PYL A;  3VQC A;  4J2E A;  4FJK A;  2ETJ A;  3LP1 A;  3AVL A;  2G8F A;  1B92 A;  3DLE A;  4UQG A;  1BHL A;  1WSG A;  1UA1 A;  1Q8I A;  2BE2 A;  4CEA A;  4CJV A;  4DFM A;  4ID1 A;  4ZTJ A;  1N5Y A;  5D3G A;  1JLA A;  5FRN A;  3VQB A;  4DG1 A;  5HLF A;  2DY4 A;  2DFH A;  3ZSY A;  1VSK A;  4CHN A;  3G10 A;  3ZSR A;  4PUO A;  5JS1 A;  3ULD A;  2JGU A;  1X9M A;  2GV9 A;  3PO5 A;  1NK5 A;  3T19 A;  3DLB A;  2QKB A;  1C1A A;  1IKW A;  2OPR A;  4O0J A;  4PA1 A;  1JLB A;  3VQ9 A;  1U49 A;  3HPO A;  3ZT3 A;  2HVH A;  1NK4 A;  4FJ9 A;  4FJL A;  1U47 A;  4JS4 A;  4DSI A;  4JRP A;  3SUN A;  4PWD A;  1LWE A;  2G8I A;  3AVC A;  5J1E A;  4OGC A;  4G1Q A;  4DLE A;  3V9Z A;  1G15 A;  2ZD1 A;  4CF1 A;  1NK9 A;  3DRS A;  3RWU A;  4CJU A;  1CLQ A;  1FKO A;  3KD5 E;  3SZ2 A;  2DFF A;  3QEW A;  4FJM A;  1WSE A;  2E6L A;  3LAK A;  4CER A;  3TAB A;  3DOK A;  1WSJ A;  2LSN A;  3O4Q A;  4JRQ A;  2VWK A;  4CES A;  3VQ4 A;  1RT1 A;  1IKV A;  1HNI A;  3DLR A;  1I3A A;  4NYF A;  1LWF A;  4N76 A;  1MU2 A;  3HVT A;  1NKE A;  4LSL A;  5HRS A;  4N41 A;  1XWL A;  3LAM A;  3RMA A;  2QKK A;  1JXE A;  4CJ3 A;  4RW4 A;  4B8A B;  1NKB A;  1EXQ A;  3EY1 A;  5C25 A;  1RBT A;  1L5U A;  4DQP A;  2D0A A;  2KZZ A;  4MFB A;  4AHR A;  3E01 A;  4B08 A;  4FLZ A;  1TK5 A;  2YV0 X;  1ASV A;  1VSH A;  1EX4 A;  1UA0 A;  3HXM A;  4BDP A;  2E6M A;  4CF9 A;  4PQU A;  3ZSW A;  1IH7 A;  4RW9 A;  1ITG A;  3OJS A;  2GUI A;  3T1A A;  2HVI A;  2WOM A;  1QSL A;  4CEZ A;  3NGZ A;  4BAC A;  1C0T A;  4E7H A;  3VN5 A;  4C8M A;  2XO7 A;  4DMN A;  1X1P A;  1BL3 A;  5KRS A;  3S9H A;  2HNY A;  3AO1 A;  4OJR A;  3SPZ A;  1C1B A;  3AV9 A;  3DLG A;  3MED A;  4LH5 A;  4CGJ A;  2B5J A;  1NJZ A;  4NCA A;  3OS0 A;  1TVR A;  3DMJ A;  4H8K A;  4DTM A;  4BWM A;  3PV8 A;  4KRE A;  1CZ9 A;  1RTH A;  1LV5 A;  4E7L A;  1L3V A;  1VSM A;  2OZS A;  1ZBU A;  1KVC A;  3AVN A;  1TAQ A;  1U48 A;  3F9K A;  1S1X A;  1QS4 A;  1J54 A;  3V6D A;  3BGR A;  3TAR A;  1DTQ A;  4CFD A;  4FLT A;  4BDZ A;  1ZBF A;  1TL3 A;  1I39 A;  3L2V A;  1Q9X A;  3IRX A;  1BQM A;  1C1C A;  4OGE A;  3V1Q A;  1FKP A;  2VG7 A;  5E41 A;  3QEI A;  3ASM A;  3C95 A;  4FZX C;  2A1S A;  4FW1 A;  4M41 A;  3NGI A;  4BWJ A;  3SJJ A;  4Q0B A;  3DRR A;  4FJI A;  1NJW A;  4IG3 A;  3NF9 A;  2FBY A;  5CY4 A;  1W0H A;  3OYB A;  1SKR A;  1D9D A;  4KPY A;  2QK9 A;  1VRT A;  4Q5V A;  1C0M A;  1VSI A;  2OA8 A;  2RPI A;  1HQU A;  4DWI A;  1QE1 A;  3LP3 A;  4CEQ A;  1CXU A;  2ATQ A;  3LWM A;  3MXJ A;  3OYI A;  2E4L A;  3U3G A;  3SV4 A;  3SPY A;  2HHQ A;  3OYF A;  1NKC A;  1REV A;  4RG8 A;  4CK2 A;  1W9H A;  3C6T A;  4OKE A;  4O0I A;  1JLE A;  4CJ5 A;  4YFU A;  2D5R A;  5JS2 A;  2PZS A;  1JLC A;  1RT5 A;  1YT3 A;  3S3O A;  1TKX A;  2OPP A;  3L8B A;  1RT6 A;  4BDY A;  1KFD A;  4XIU A;  5SZT A;  3AA2 A;  2A1R A;  1TK0 A;  4CK1 A;  2F96 A;  1UOC A;  3DI6 A;  5HRP A;  4CEO A;  3RRH A;  4I9L A;  2KFN A;  3PX0 A;  1DLO A;  3I0S A;  4I9Q A;  3HK2 A;  3P1G A;  4CHQ A;  4FK2 A;  3AVF A;  3SQ1 A;  4TSX A;  4HUG A;  5HBM A;  1KLM A;  4CFC A;  5KTQ A;  4DFJ A;  1VSL A;  4CJF A;  4DFK A;  4KAZ A;  1RT4 A;  3OYE A;  4FLV A;  1RTD A;  4E1M A;  3K5N A;  5J2M A;  4EZ9 A;  3OYJ A;  3AVB A;  3KLE A;  3KJV A;  4IFY A;  4BE0 A;  4HUF A;  1BI4 B;  4E7K A;  1T7P A;  4CJK A;  4FJ8 A;  1KLN A;  1SUQ A;  4EP5 A;  4FXD A;  3OYC A;  1WLJ A;  4CJE A;  4DU3 A;  1TKD A;  1B9D A;  1EP4 A;  1UWB A;  4CJP A;  4ZHR A;  4H4M A;  4W5Q A;  4C8O A;  2X6S A;  3CG7 A;  4MQ3 A;  4E3S A;  5J2Q A;  4DTX A;  4N5S A;  2OZM A;  4AIL C;  1N6Q A;  3P83 D;  4KI4 A;  4OLA A;  4FCY A;  1JKH A;  1F21 A;  4M45 A;  3LPU A;  4KKO A;  4RW7 A;  3KTQ A;  3TAF A;  1S1U A;  2XY7 A;  1QQC A;  4Z4E A;  4DTU A;  1RDA A;  3P5J A;  4DTP A;  1BIS A;  1NJY A;  2XY8 A;  1YTU A;  3ALY A;  1TAU A;  3K5M A;  1HQE A;  3RTV A;  4CCH A;  3QEV A;  4Z4G A;  4EZ6 A;  2XY6 A;  3ZSO A;  2IDO A;  2O4G A;  4O55 A;  4AH9 A;  4HCC A;  3QER A;  1RT2 A;  5C42 A;  3VQQ A;  2YHA A;  3K5L A;  1NK0 A;  4CF0 A;  2YNF A;  3PX6 A;  3AVM A;  3LP2 A;  4KO0 A;  4OPK A;  4NYN A;  3K59 A;  1U45 A;  2BDP A;  4Z4I A;  2YKN A;  3M8S A;  3L2Q A;  3QIN A;  2P51 A;  3KD1 E;  1YVU A;  1L3U A;  4KRF A;  4N56 A;  4FLW A;  3B6O A;  3SUO A;  3IG1 A;  3AVJ A;  3K5O A;  3LPT A;  3VQP A;  3SQ0 A;  2XRI A;  4F2R A;  4ICL A;  2HB5 A;  1QHT A;  1A5W A;  4CJQ A;  3OY9 A;  1IG9 A;  2FBV A;  4KB0 A;  4CEE A;  4M42 A;  4M3Y A;  1T05 A;  4FJN A;  1J9A A;  2GBZ A;  3O4N A;  4ELV A;  3HL8 A;  4C8N A;  3WNH A;  4KV8 A;  5I42 A;  3SCX A;  2G8K A;  1S9E A;  3K58 A;  2Z1J A; 
#chains in the Genus database with same CATH topology
 2W6L A;  3E9P A;  4LY7 A;  4CZG A;  3R8E A;  3LL3 A;  4BR9 A;  4C1N K;  1SAZ A;  2BGG A;  3V1O A;  5HRN A;  2OTJ N;  2KTQ A;  3LAN A;  2G8W A;  3L2W A;  4JI8 K;  3WQU A;  1JLG A;  2F8T A;  2FBT A;  1GOA A;  3ZT1 A;  4BRG A;  2VYP A;  4KFB A;  5AZJ B;  2IIR A;  3O80 A;  2QWN A;  5FDL A;  3BP8 A;  1D5A A;  1L3T A;  1HNX K;  1E3M A;  1U2V A;  4JI0 K;  3OBW A;  4DV3 K;  3EE8 A;  2HMI A;  4JI2 K;  3A8Y A;  4GMJ B;  1RDD A;  2ITM A;  2FBX A;  3L3U A;  4I2Q A;  1EKE A;  4FPB A;  2P9L B;  1QHA A;  3H3N O;  5DMR A;  1YXQ A;  3U9D A;  4J2A A;  2KHO A;  3P4I A;  4LSN A;  3OS2 A;  3VQ8 A;  1EQY A;  3OYL A;  5BRE A;  2WTU A;  1HMV A;  1SQK A;  2YX6 A;  4BY9 C;  3V1R A;  4BG8 A;  3CQX A;  3ZYY X;  3H08 A;  1HNW K;  1GLE G;  2HND A;  3QLH A;  3KK2 A;  4H4O A;  1WBD A;  2FLO A;  2X78 A;  3HPG A;  3M8R A;  4F8R A;  2O4I A;  1MWM A;  4MO4 A;  4KTZ A;  4FK0 A;  2Z1I A;  1RNH A;  3VQ5 A;  3L2R A;  4LFA K;  3QBX A;  3ZT4 A;  1Q82 O;  4I7F A;  3CM6 A;  1BCO A;  3SAF A;  4CJR A;  4KI6 A;  3MEC A;  3PX4 A;  1T6C A;  4FJJ A;  1J6Z A;  3R1X A;  1Z25 A;  4DUY K;  4FM0 A;  2P5O A;  3QML A;  4O5F A;  1KAX A;  4E7J A;  3VF4 A;  1S72 N;  4BE1 A;  3K57 A;  3L4I A;  2A42 A;  2QW9 A;  2VG6 A;  4G9Z A;  3CM5 A;  3L2U A;  2OPS A;  3NAE A;  1YJN N;  3VQD A;  1VQP N;  1K8K B;  4B8C A;  2NRV A;  3HRG A;  4WF9 L;  4BC4 A;  1BQN A;  3I33 A;  3VPZ A;  2B4J A;  4DR4 K;  1VQ7 N;  3S3M A;  3AO4 A;  4H03 B;  3D2E A;  5CYM A;  3RMB A;  5GIN A;  3AA4 A;  3CQY A;  2P9N A;  1OVY A;  1XQS C;  3SYZ A;  1VQK N;  4KHS A;  2W6K A;  3VA0 A;  1NMD A;  2V7Y A;  3ID6 A;  4E89 A;  5LJV A;  1RBS A;  1ATS A;  1WN7 A;  1CZB A;  1T44 A;  4GVE A;  1HRH A;  2D0P A;  4CJ4 A;  3JAM O;  2E1Y A;  2HHW A;  2P9I A;  4E1N A;  5JMV A;  2FXU A;  3C0B A;  4Z4F A;  1NWK A;  5EX5 A;  1MA9 B;  1LAV A;  4U67 L;  1VK0 A;  3RRG A;  3TAP A;  3C6U A;  1Z26 A;  4DTN A;  3EO3 A;  2XHB A;  2QWP A;  3SQ2 A;  5M1Q A;  4YOY A;  3EZW A;  4WQ4 A;  3O5B A;  3OS1 A;  4JKG A;  3TWH A;  5C12 A;  1BCM A;  3UE5 A;  3TTF A;  1T03 A;  4ILG B;  3LDL A;  3HST B;  1GLA G;  3M6G A;  3HZ6 A;  4CJS A;  4KHY A;  4NCB A;  5BN9 A;  4K8X A;  1HYZ A;  1SKW A;  3VTI A;  4FJG A;  4QAG A;  4M3R A;  3EZ5 A;  4JHD B;  4HCB A;  2YNI A;  1Y64 A;  3SUQ A;  1V4T A;  3KWI A;  4BC5 A;  2IVN A;  4DU1 A;  2NRH A;  4YOX A;  3EYZ A;  4ZTF A;  4IOC L;  4LF5 K;  5BPM A;  4NB4 A;  4DV0 K;  1RT7 A;  3QIC A;  2IOC A;  4IBN A;  4CFA A;  1RFQ A;  2Q1N A;  4WFA L;  4GKK K;  2GUP A;  3FGU A;  2QXF A;  4L8R B;  3U6F A;  3QFP A;  4R5P A;  1X3N A;  3MDQ A;  2O8E A;  1HLU A;  3DLH A;  1D9F A;  4AM7 A;  3NE6 A;  3CIP A;  5BPN A;  2WON A;  3L6Q A;  4WE1 A;  3VQA A;  4KHN A;  1T3V A;  3KKS A;  4FYD A;  2RN2 A;  4ISG A;  4JKA A;  1NGJ A;  5GAE P;  4AM6 A;  1TKT A;  4J2D A;  5T7B A;  2Y1I A;  4W5O A;  4ID5 A;  1NK7 A;  4CVN E;  3THY B;  3OVN A;  2W42 A;  4JV5 K;  4ISE A;  4WQ4 C;  1B9F A;  3LZJ A;  5C24 A;  1JLQ A;  3BDP A;  1ASW A;  5M1K A;  3DXK A;  3VEO A;  3VQC A;  4J2E A;  2ETJ A;  3LP1 A;  3AVL A;  1NGD A;  1B92 A;  1M90 O;  2BE2 A;  3DXK B;  3HSC A;  5AQZ A;  4ZTJ A;  5D3G A;  2YHW A;  2DFH A;  3ZSR A;  1VQO N;  3DLB A;  2QKB A;  1YHQ N;  2OPR A;  4O0J A;  1U49 A;  3ZT3 A;  4FJ9 A;  3MWT A;  5FLX O;  1YIT N;  5TKY A;  4JN4 A;  4BC3 A;  3AVC A;  4DQ8 A;  4IJA A;  5HOO A;  2VQE K;  3DRS A;  4JI3 K;  3RWU A;  3KD5 E;  1MWK A;  3PSI A;  3QEW A;  4FJM A;  1WSE A;  3DOK A;  1WSJ A;  4LF9 K;  4CES A;  1KAZ A;  1HNI A;  3THX B;  3KK7 A;  3HVT A;  4DR5 K;  1NKE A;  4LSL A;  3VGL A;  5HRS A;  3EL2 A;  1JXE A;  3GL1 A;  4Y0W A;  4CJ3 A;  4I6M B;  1EXQ A;  3ENO A;  4LF7 K;  1L5U A;  3E01 A;  4B08 A;  2YV0 X;  1VSH A;  1EX4 A;  3M5R A;  3ZSW A;  4RW9 A;  1ITG A;  5AZI A;  2WOM A;  4H0T B;  1QSL A;  3J7Y P;  3WXL A;  3S9H A;  4DMN A;  1BL3 A;  4NCA A;  4OJR A;  1C1B A;  4CGJ A;  3CHW A;  3JS6 A;  3HOS A;  3OS0 A;  3DMJ A;  4BWM A;  2FF6 A;  1N8R O;  1LV5 A;  1L3V A;  2Q0U A;  1VSM A;  1TAQ A;  3PIP L;  1U48 A;  5JLH A;  1TYQ A;  1DTQ A;  3ENH A;  3ZLJ A;  3GBT A;  4BR7 A;  3V1Q A;  2VG7 A;  1QQM A;  4FZX C;  2P9S B;  2A1S A;  3OBY A;  4FW1 A;  4M41 A;  3DXM A;  3MX2 A;  3DRR A;  4FJI A;  1NJW A;  4CZK A;  1W97 L;  1K9M O;  1W0H A;  1GLL O;  2QK9 A;  2ZGY A;  3K9K A;  2E4L A;  3WXK A;  5AQP A;  1NKC A;  1W9H A;  3T1H K;  1NMN A;  2HBL A;  4CJ5 A;  2D5R A;  2PZS A;  1RT5 A;  3S3O A;  2ZGZ A;  1TKX A;  1RT6 A;  1KFD A;  1XMQ K;  3DI6 A;  2KFN A;  3CCS N;  1DLO A;  3HK2 A;  5ADX H;  5AQW A;  4KAZ A;  1O13 A;  4DKW A;  4FPA A;  4BE0 A;  3MX5 A;  1BI4 B;  1SUQ A;  4H0O A;  3CET A;  2A41 A;  3EN9 A;  3FZF A;  1EP4 A;  4CJP A;  3TSU A;  4W5Q A;  4C8O A;  3BF1 A;  5J2Q A;  3UKU B;  4DTX A;  3O9S A;  1JKH A;  4KKO A;  4BR2 A;  4RW7 A;  3KTQ A;  4Z4E A;  3AGR A;  2XY8 A;  5AQY A;  3CJC A;  4NO7 A;  1BA1 A;  3QEV A;  1ILY A;  4O55 A;  3QBW A;  2E88 A;  2E20 A;  2NRW A;  4PKI A;  4DV5 K;  4YOR A;  5AFU H;  3ENB A;  3K59 A;  4C23 A;  2YKN A;  4PHT X;  1YVU A;  4KRF A;  4BRE A;  5LMU K;  3VQP A;  3THW A;  4M7X A;  1M1K O;  4ICL A;  4L3Q A;  3OY9 A;  4CEE A;  5FPE A;  4FJN A;  1QZ6 A;  1NGG A;  3O4N A;  5AQM A;  4CZE A;  1NGI A;  2NNW A;  5GIP A;  1K73 O;  2V52 B;  5AQG A;  3DOL A;  3SUP A;  2G8H A;  4MO5 A;  4JKD A;  3RSE A;  2YNG A;  3IAY A;  4DB3 A;  5E26 A;  2O8F A;  3BUZ B;  1VQ8 N;  1S22 A;  4B9U A;  3DLL L;  1NM1 A;  3SBG A;  4FLX A;  5SWM A;  4LD0 A;  1UAX A;  4KH5 A;  3QO9 A;  2KFZ A;  3CFR A;  3KLI A;  3V9X A;  3QNO A;  2Z1H A;  3VEY A;  3CXC M;  4HUE A;  1YI2 N;  3E9L A;  3OYK A;  4BVP A;  2XY5 A;  4BQZ A;  4FJH A;  1E4G T;  3KZB A;  4YNQ A;  3P31 A;  4HHT A;  3TI0 A;  2VGM A;  3Q7B A;  4WYB A;  4CD3 A;  1ZBL A;  3IS9 A;  3NGY A;  2F9T A;  4Z0U A;  1N33 K;  2RKI A;  4BRA A;  1C0U A;  4ILJ A;  3ZET A;  5K14 A;  2GX9 A;  4DQS A;  5FRM A;  4A2A A;  3SI6 A;  3QDK A;  3LDN A;  3LAL A;  3L3V A;  3RMC A;  2VGN A;  1RIL A;  5BR8 K;  3SK3 A;  3SLC A;  4Y1D A;  2YKM A;  3EEQ A;  1RDC A;  1KFS A;  2HBJ A;  1U04 A;  4DF4 A;  3TAN A;  3OYD A;  4B9V A;  4FWS A;  1NGB A;  3ZX3 A;  2O8C A;  4FM1 A;  4FOE A;  1Q81 O;  5EU7 A;  1Y97 A;  4FVM A;  2E1Z A;  3JYT A;  4H0X B;  1J5O A;  3ZX2 A;  5FRO A;  1K6Y A;  3SMP A;  2O8C B;  3HP9 A;  4RWT A;  2HHX A;  1NOZ A;  5AQN A;  1OH6 A;  3AVI A;  2QWR A;  3O1W A;  3CCQ N;  1U4B A;  3CPE A;  3LDQ A;  3VEW A;  1SL0 A;  3CJ9 A;  1KD1 O;  4CJW A;  3DWL A;  3KKR A;  1Q7Y O;  4CD1 A;  4IEI A;  4EHU A;  4U7B A;  1NGC A;  3QES A;  4JI1 K;  3KLH A;  5EVZ A;  2IVP A;  3CCM N;  2UXC K;  4CGD A;  4DSF A;  2NRT A;  4CGF A;  4FWM A;  4BRP A;  2HHU A;  1ZYQ A;  3O3H A;  4C8L A;  3DRP A;  3I0R A;  4FK4 A;  3WXM B;  2YI1 A;  3QEP A;  1VQ9 N;  2KQ2 A;  2O8D A;  5CHI A;  3CFP A;  3SNN A;  5DM7 L;  4A57 A;  1SL1 A;  4W5R A;  5HP1 A;  4KB1 A;  2OTL N;  3LZI A;  4H5V A;  4CED A;  4PKG A;  5J2N A;  4KHU A;  2P9P A;  1XI1 A;  4Z4C A;  2ZJQ L;  3AAR A;  2UU9 K;  1TL1 A;  5HRO A;  3O9T A;  3FZL A;  3IFR A;  4K42 A;  3WNE A;  3T3F A;  4DTJ A;  4JKE A;  3V81 A;  2GEL A;  2HBK A;  2EHG A;  4CZJ A;  1ATN A;  2P5G A;  3CJ7 A;  5JVG L;  1FW6 A;  4B3O A;  3HO1 A;  4MLE A;  3HI0 A;  3TSQ A;  4BRQ A;  1D4X A;  2HHV A;  2HBM A;  4OPJ A;  5KRT A;  3D2F A;  4CF2 A;  4ELU A;  2DPN A;  4KHQ A;  4M3X A;  3OYG A;  4R79 A;  1YJ9 N;  3CFO A;  1OH7 A;  2G8V A;  1DTT A;  4A59 A;  5KGX A;  1XHZ A;  1U2V B;  3CCR N;  4DF8 A;  1DT9 A;  1KSP A;  1RDW X;  1TKZ A;  1NK8 A;  3O3G A;  3V4I A;  5AR0 A;  3O9R A;  1VQ4 N;  5KGW A;  4DV6 K;  3CC7 N;  4DTR A;  3VEV A;  4DSE A;  2ASM A;  2W40 A;  3G0Z A;  1BO5 O;  4IDK A;  3H6E A;  2R7Y A;  2OYQ A;  3QET A;  4OLB A;  1TV6 A;  3MEE A;  3KK1 A;  2X74 A;  4GVM A;  4BRC A;  3F73 A;  2YJE A;  3ISN C;  4CGG A;  4RCH A;  2BUP A;  4ILH A;  3J8A A;  2PFU A;  3VOV A;  4AHC A;  2GTD A;  3K2P A;  3PY8 A;  5BN8 A;  1N34 K;  2DFE A;  5FPN A;  3TU5 A;  3NH0 A;  5E84 A;  4FJ5 A;  3CQ8 A;  3CC2 N;  4B9T A;  1P90 A;  4BGB A;  1GLC G;  3O6W A;  1BGX T;  4J2B A;  4CHO A;  3EKU A;  3WUH A;  2HOE A;  3QFU A;  2NRR A;  4UQG A;  1UA1 A;  1Q8I A;  4CEA A;  4DFM A;  2PBD A;  3MCA B;  4ID1 A;  3LM9 A;  2QM1 A;  2DY4 A;  4CJ7 A;  4PUO A;  4CHN A;  3G10 A;  3ULD A;  3PO5 A;  5AQR A;  2A40 A;  3T19 A;  3CME N;  4JKF A;  4PA1 A;  3VQ9 A;  3L4Q A;  3CD6 N;  2HVH A;  4DSI A;  5JIC A;  3SUN A;  4IEE A;  4PWD A;  3D2E B;  4OGC A;  3V9Z A;  2P9N B;  2ZD1 A;  4ISF A;  4M63 C;  4WQ5 C;  2OAN A;  3VGK A;  4CJU A;  4B1W B;  3F2K A;  4GV6 A;  1CLQ A;  4DR3 K;  3TAB A;  4JKC A;  3O4Q A;  2UXB K;  4JRQ A;  2VWK A;  3WQT A;  2VWB A;  1RT1 A;  1IKV A;  3C7N A;  3DLR A;  3L0Q A;  2P9I B;  2EWS A;  3TTD A;  3RMA A;  3A5N C;  4RW4 A;  4BR0 A;  2KZZ A;  3IDH A;  4BDP A;  4H5W A;  2E6M A;  1BOT O;  4CW7 B;  3WEE A;  4H5N A;  5AQK A;  3OJS A;  4X62 K;  3T1A A;  2HVI A;  4JKG B;  3NGZ A;  1C0T A;  2F9W A;  5AQV A;  1NK4 A;  1KLN A;  3SPZ A;  1NJZ A;  5MLC Q;  4DTM A;  1KQS M;  5AQT A;  1CZ9 A;  1RTH A;  3VF2 A;  4A61 A;  1WOQ A;  5LY3 A;  3VER A;  4CBU A;  2OZS A;  3ID8 A;  3BF3 A;  3D7E O;  2I7P A;  4GV9 A;  3GOI A;  4CFD A;  4FLT A;  3OA9 A;  1I39 A;  3O4W A;  3L2V A;  2GWJ A;  3C6A A;  5E41 A;  3QEI A;  3ASM A;  4BWJ A;  4B1U B;  2FBY A;  4DUZ K;  5CY4 A;  3OYB A;  4CZM A;  4DV1 K;  1D9D A;  1VRT A;  1HQU A;  3LWM A;  1CXU A;  3MXJ A;  4IXC A;  3SPY A;  3U3G A;  5GIO A;  4RG8 A;  4IO9 L;  5H1S Q;  2O8E B;  1JLC A;  4FOI A;  2GWK A;  4BDY A;  4XIU A;  5KQ8 A;  1TK0 A;  4CK1 A;  3RRH A;  4I9L A;  1GLD G;  4FK2 A;  3AVF A;  1YAG A;  1R59 O;  5KTQ A;  4DFJ A;  1VSL A;  4FLV A;  4E1M A;  4KBO A;  1MDU B;  3UB5 A;  3KJV A;  4FJ8 A;  4IFY A;  4HUF A;  4CJK A;  3AAQ A;  4EFH A;  4B1Y B;  2HHH K;  3H45 C;  5BPL A;  4CJE A;  1TKD A;  1UWB A;  4ZHR A;  3MCP A;  1K8A O;  3SMS A;  2I7N A;  4AIL C;  4BR5 A;  4OLA A;  3LPU A;  3TAF A;  1QQC A;  3N4P A;  4B9Q A;  4PL8 A;  1TAU A;  3HM8 A;  5ELZ A;  3K5M A;  3RTV A;  4CCH A;  4Z4G A;  4JAX A;  3BY5 A;  5DM6 L;  3SAG A;  4H5T A;  3QER A;  1QVG M;  5C42 A;  3K5L A;  5F1X A;  4JK7 A;  4BRK A;  2ASP A;  1TUY A;  5KQD A;  5AQU A;  2D0O A;  4FSV A;  3IG1 A;  3K5O A;  3PLA A;  4F2R A;  3VEX A;  3H3O B;  4NXN K;  3UKR A;  1Z05 A;  3G71 N;  4ELV A;  3HL8 A;  4C8N A;  4BRH A;  2NRX A;  3SCX A;  4O44 A;  1S9E A;  4OO1 J;  4CK3 A;  4B1V A;  1YTA A;  4GKJ K;  3KK3 A;  3T7Z A;  3MN6 A;  1A5X A;  3Q7C A;  1XNR K;  5EXW A;  3M8P A;  4DR1 K;  5EY4 A;  4KH4 A;  1P8Z A;  1VAZ A;  5F0X A;  1RBU A;  5AZI B;  3VQ7 A;  4OPH A;  4CEF A;  2OPQ A;  2H3G X;  1A5V A;  1JL2 A;  1EET A;  1NK6 A;  2RE2 A;  2QWQ A;  5KPZ A;  1RBV A;  1X9S A;  1Q86 O;  3SQ4 A;  2QTD A;  1X9J A;  4B3R K;  1XMO K;  3HYF A;  3AAP A;  4CZI A;  3M8Q A;  4O5B A;  1TYQ B;  4RW6 A;  3GG4 A;  3G25 A;  4Z94 A;  3TSP A;  2UUB K;  4DU4 A;  3TR8 A;  1S1W A;  1D8Y A;  3GE1 A;  1HPZ A;  2IS3 A;  4FZY A;  3ZSX A;  3DXM B;  2HW3 A;  4JK9 A;  2VWJ A;  2E2O A;  4GNI A;  4XH1 A;  3HT3 A;  4B9S A;  4EP4 A;  4F3O A;  5AQH A;  2P1J A;  3LDP A;  4YOW A;  2E2N A;  4JI7 K;  2KW4 A;  3IMX A;  3A5L C;  3LDS A;  3KLG A;  4A5B A;  1H1V A;  3WNF A;  4JS5 A;  3ZT0 A;  1V4S A;  3VQ6 A;  3OYA A;  4DQQ A;  1TK8 A;  4CEB A;  5B8H A;  3GDQ A;  3ULE A;  1QZ5 A;  4CBX A;  2V51 B;  1VRU A;  3OYM A;  1KXP A;  2W41 A;  4DTS A;  3ULE B;  3RR7 A;  1GOC A;  5C2D A;  1ESV A;  5AQX A;  2GEM A;  4KH6 A;  3DLK A;  1WSF A;  2HHT A;  3LWL A;  4DTO A;  1HYV A;  5J2P A;  3O1B A;  4IO8 A;  3OTO K;  3NF7 A;  4DLG A;  3W3D A;  4FWL A;  1HPM A;  1JLF A;  1RT3 A;  2A3Z A;  3CCL N;  4PKH A;  1GLF O;  2KLA A;  4CIE A;  1SS6 A;  3QNN A;  1HJR A;  3WXI A;  5HL7 L;  5M1F A;  1HX1 A;  1J5E K;  2JWL A;  4LH4 A;  2FF3 B;  1OH5 A;  1IBM K;  4BGA A;  3O9U A;  4H0V B;  1IG8 A;  3U8X A;  3VA3 A;  4NXM K;  4IG0 A;  4K0K K;  4FLY A;  4B9M A;  3AA3 A;  1IO2 A;  1Z6R A;  3KVG A;  1N36 K;  4M3Z A;  3AA5 X;  4BR4 A;  4HWI A;  5EOY A;  1XHX A;  4CJL A;  3THW B;  4CHZ A;  4BE2 A;  4PY5 A;  2D0C A;  2Q0R A;  3I8D A;  1X9W A;  2FC0 A;  2E5L K;  5LL6 Z;  1KVB A;  4F4K A;  4MLH A;  3JXU A;  1CXQ A;  3NF8 A;  4IOA L;  2RF2 A;  3NFA A;  3RSE B;  1LW0 A;  4YDU C;  4BRM A;  3CER A;  4CEC A;  2O8F B;  4W5N A;  3VEN A;  4CE9 A;  5ADX A;  2VQF K;  1WAF A;  2D4W A;  1RBR A;  2J4R A;  3PSF A;  4CGI A;  4DHY A;  1QQO A;  3OYH A;  3A5M C;  1NBW A;  3KWG A;  2IAJ A;  2QWL A;  3TAE A;  5FPD A;  3AO5 A;  1VQ6 N;  2X6N A;  4RW8 A;  2BH1 A;  1OVQ A;  4JEP A;  3W0L A;  1JJ2 M;  3FLC O;  2IVO A;  4B1Z A;  4FJX A;  2Q3S A;  3H1Q A;  3JSM A;  1VSD A;  1LOT B;  1VHX A;  1RGI A;  4CFB A;  3AY9 A;  3ZET B;  4E0D A;  2RHK A;  4GW6 A;  3TAG A;  1HNZ K;  1HNV A;  3PIO L;  1HYS A;  3TAQ A;  3D0P A;  5AFU A;  2DTU A;  4B1X B;  2IC3 A;  3C65 A;  2PYJ A;  2NUB A;  3O3F A;  1QSS A;  1YVN A;  4DFP A;  2YCH A;  2YHB A;  3OJU A;  3C94 A;  4M3T A;  3PO4 A;  4CF8 A;  3SV3 A;  1GLJ O;  5HRR A;  1VQM N;  3AVA A;  2CGL A;  5AQS A;  3AGK A;  1QVF M;  1LCU A;  3TPQ A;  3V9W A;  2QWO A;  3NBP A;  3S41 A;  2VG5 A;  2ZF5 O;  3FZK A;  3RVC A;  3KHY A;  1SKS A;  1LAW A;  3TAM A;  3F5T A;  4JD2 A;  3PUF A;  2ITG A;  3CJ1 A;  3THV A;  4OX9 K;  1S6Q A;  3ZEU A;  1JCF A;  3NCI A;  3NHG A;  4UY8 O;  4M3U A;  4BQL A;  1O1W A;  5AQL A;  2CGK A;  3MXI A;  2P9U A;  4O4G A;  5JLF A;  1QSY A;  1DKG D;  5AQI A;  2PYL A;  3OHR A;  4FJK A;  2QEX N;  4A2B A;  2G8F A;  3DLE A;  5AJ3 K;  3DAW A;  4CJV A;  3VES A;  1N5Y A;  3EE9 A;  5FRN A;  1JLA A;  4DG1 A;  5HLF A;  1NU0 A;  3EKS A;  2FSN A;  2QA4 N;  2GV9 A;  2P9K A;  4CZH A;  1NK5 A;  4FL9 A;  3CMA N;  1IKW A;  1JLB A;  2KKZ A;  4JS4 A;  1EWQ A;  4JRP A;  1LWE A;  1GLB G;  2O8D B;  1G15 A;  1C0G A;  4CF1 A;  4MDB A;  4CER A;  3LAK A;  4DR2 K;  3O8M A;  2P9P B;  4AQY K;  5GAG P;  3VQ4 A;  3P39 A;  1LWF A;  3MN9 A;  4N76 A;  1SZ2 A;  1MU2 A;  3ATV A;  4EIA A;  1W2B M;  1HUX A;  2F7T A;  1XWL A;  2QKK A;  3SBT A;  3CCU N;  4B8A B;  1NKB A;  3EY1 A;  1RBT A;  1FJG K;  2D0A A;  3ZX0 A;  4FLZ A;  1TK5 A;  1ASV A;  1ZC6 A;  1UA0 A;  3HXM A;  3VET A;  3D6R A;  1BA0 A;  4E1J A;  4YOU A;  4X66 K;  2GUI A;  3CCV N;  3FE1 A;  3D2F B;  4BAC A;  4E7H A;  5C0Y A;  1NGH A;  4H0Y B;  1X1P A;  5KRS A;  2HNY A;  3AO1 A;  5AZJ A;  1XUP O;  3AV9 A;  3MED A;  4LH5 A;  2Q36 A;  4JI6 K;  2B5J A;  2ASO A;  3PV8 A;  4KRE A;  2Q2R A;  1BDG A;  1X3M A;  3MK6 A;  4BRO A;  4JKH A;  1ZBU A;  1KVC A;  3AVN A;  5AQQ A;  4CZL A;  1QS4 A;  1J54 A;  3V6D A;  3TAR A;  1VQ5 N;  4BDZ A;  1ZBF A;  1TL3 A;  4J8F A;  3IRX A;  2NZT A;  1BQM A;  1FKP A;  2P9L A;  3C95 A;  3CJA A;  4WQ5 A;  3SJJ A;  4Q0B A;  5JVH L;  1ATR A;  3NF9 A;  5M1N A;  1RDU A;  4IJN A;  1SKR A;  5IT9 O;  4Q5V A;  1C0M A;  1VSI A;  4DWI A;  4CEQ A;  2UUC K;  3OYI A;  4CK2 A;  3C6T A;  4XH4 A;  4OKE A;  4YFU A;  3NMU A;  4OPA A;  5JS2 A;  3CPW M;  5A2Q O;  3O9Q A;  1YT3 A;  5TKW A;  2V7Z A;  1EWR A;  3MN7 A;  5HRP A;  1UOC A;  4JI4 K;  4CEO A;  4LFC K;  4I9Q A;  3I0S A;  4QS7 A;  5AQO A;  3P1G A;  3SQ1 A;  1KLM A;  4CFC A;  4DFK A;  4CJF A;  3FZM A;  5J2M A;  3CCJ N;  4EZ9 A;  3AVB A;  1T7P A;  4CBW A;  4O8U A;  1WLJ A;  4DU3 A;  1WUA A;  4DV4 K;  1B9D A;  4H4M A;  4K25 A;  2X6S A;  3CG7 A;  4E3S A;  4B3T K;  4N5S A;  3WXJ A;  5M1O A;  1KC8 O;  1N6Q A;  5I9E B;  4KI4 A;  4FCY A;  1F21 A;  1TUU A;  2F4V K;  1S1U A;  3U4L A;  2XY7 A;  3NVM A;  1RDA A;  3M3Z A;  1NJY A;  3MWP A;  4BRD A;  2PAV A;  4YOT A;  1W7A A;  1HQE A;  4EZ6 A;  2XY6 A;  4K41 A;  3ZSO A;  3J80 O;  3FFK B;  2IDO A;  1K8K A;  4AH9 A;  3CCE N;  4HCC A;  4F9O A;  3VQQ A;  1NNE A;  2NRZ A;  2OCE A;  1HKC A;  2YHA A;  4DV7 K;  1NK0 A;  4CF0 A;  1YJW N;  3HTV A;  3A5O C;  3AVM A;  4KO0 A;  2BDP A;  2O8B A;  3T1Y K;  3M8S A;  3QIN A;  2P51 A;  2O8B B;  2D1K A;  3AVJ A;  4EAH D;  1VQL N;  1A5W A;  5AQF A;  4CJQ A;  1IG9 A;  2FBV A;  4KB0 A;  4M3Y A;  3VMF B;  3C7N B;  1OKJ A;  1YUW A;  2GBZ A;  4H5R A;  3WNH A;  4KV8 A;  2A6A A;  3CI5 A;  4CIF A;  1T8E A;  1LWC A;  3BZC A;  4DQI A;  3VGM A;  4FM2 A;  3QIO A;  1VSE A;  4I2P A;  1IJJ A;  1S1V A;  2I5J A;  3HBT A;  3WEE B;  4KTW A;  1WB9 A;  4DR6 K;  4JK8 A;  4DS5 A;  3H46 O;  1FXX A;  3E9O A;  1GOB A;  1Q18 A;  3AVK A;  3MXM A;  3ZSZ A;  3ZSV A;  4JYA K;  4OKJ A;  4AHS A;  1VQN N;  2HHS A;  3MAQ A;  4A5A A;  1RDB A;  1R0A A;  4Y1C A;  2AA4 A;  4JHD A;  2Y1J A;  4KTQ A;  3FFI A;  3S3N A;  2NLX A;  1XC3 A;  1FK9 A;  4V19 S;  1L3S A;  2JWK A;  4IKF A;  4MDA A;  4CJT A;  1NLV A;  1QQN A;  5BRH A;  3AO2 A;  2YJF A;  3V9U A;  1ZBH A;  4CHP A;  3UIQ A;  1XC9 A;  3CYM A;  2PY5 A;  2AJQ A;  2HST A;  1NGA A;  1ZBI A;  3A2F A;  2F8S A;  1BUP A;  4AHV A;  2EX3 A;  1VSF A;  4WCE L;  4JI5 K;  5C2F A;  4CIG A;  1HR0 K;  4DS4 A;  2ZQB A;  1RCH A;  2Q97 A;  3ZT2 A;  1RTI A;  2Z1G A;  4QS8 A;  5DK5 A;  1KVA A;  2FSK A;  4H0P A;  2G8U A;  4K8Z A;  3R9P A;  1S9G A;  5C15 A;  1I94 K;  4JLH A;  3K0S A;  3V9S A;  4DR7 K;  2HNZ A;  3IKM A;  1IKX A;  4OVL A;  4BRI A;  3THY A;  2ZJR L;  1WSH A;  3NF6 A;  4IDH A;  1BIZ A;  1BIU A;  1E4F T;  1T6D A;  3E1Y A;  1S5J A;  4A62 A;  1RTJ A;  1IBL K;  4DQR A;  4HVJ A;  4FWN A;  1Q9Y A;  4X65 K;  1S1T A;  3OYN A;  1IKY A;  3I55 N;  5IWA K;  4DSL A;  5CZ1 A;  4FO0 A;  4FWK A;  1NOY A;  3J81 O;  2HF4 A;  1SV5 A;  2BAN A;  1HKB A;  3G4S N;  1HKG A;  4WFB L;  4B9L A;  4HTL A;  3KLF A;  4BRL A;  1XNQ K;  3WNG A;  2CGJ A;  4M7Y A;  5CYQ A;  1NGF A;  3LP0 A;  3HP6 A;  3BEX A;  1ASU A;  4ELT A;  3ITH A;  3NDK A;  4FW2 A;  3KIO A;  2JLE A;  1S3X A;  5AQJ A;  2Q31 A;  1TGO A;  5KPT A;  4KHW A;  3VQE A;  4F2S A;  2UYT A;  3ZSQ A;  2YNH A;  2UXD K;  2CH6 A;  4AHT A;  1WAJ A;  3N4Q A;  3UKR B;  2ZE2 A;  4KHP K;  3B6P A;  2AP1 A;  3D45 A;  3O08 A;  4QOZ B;  3THX A;  5KI6 A;  1HJO A;  2B6A A;  4IWV A;  4LC9 B;  2UUA K;  4FLU A;  2KZM A;  1SL2 A;  1QTM A;  2HF3 A;  4I6M A;  3QIP A;  3SAH A;  2FSJ A;  1S6P A;  3NVK A;  4BRF A;  4DV2 K;  3CF5 L;  4N47 A;  4W5T A;  3RMD A;  3HVR A;  4IFE A;  1NJI O;  4BG9 A;  4HTU A;  3AO3 A;  4FJ7 A;  5LMN K;  1JXB A;  3NH1 A;  4E19 A;  2IGI A;  3U3Y A;  4Z4H A;  4QCL A;  3R6M A;  3E66 A;  4DSK A;  3HM9 A;  2E8A A;  3K9J A;  5CZ2 A;  4C8K A;  4IFV A;  5LJW A;  2P9S A;  4E7I A;  3AVG A;  4F3T A;  5CR4 A;  4FWR A;  1YIJ N;  3DYA A;  1NG9 A;  4IOX A;  1N32 K;  5C10 A;  4NCG A;  3AVH A;  1NJX A;  4DSJ A;  1VSJ A;  4CGH A;  4M3W A;  1IBK K;  1DEJ A;  2WC9 A;  1NGE A;  3ATU A;  3F9M A;  4YDU A;  3QEX A;  2ZJP L;  3HPH A;  1JL1 A;  2D0B A;  4WFN L;  3MMV A;  1KRP A;  3DM2 A;  4FWP A;  4CHY A;  3NH2 A;  3RR8 A;  1WBB A;  4FWO A;  4FZZ A;  4LF6 K;  4X64 K;  1J53 A;  3HOT A;  4YOV A;  3HJF A;  1BI4 A;  3MEG A;  4EHT A;  4AHU A;  1KCF A;  3ZCM A;  4GY2 B;  4OKK A;  1KTQ A;  1WNS A;  1WSI A;  4DCH A;  1JCG A;  2YHX A;  3UKU A;  1LW2 A;  4B9N A;  5I3U A;  1C6V A;  3G6E N;  4B3M K;  1BHL A;  1G99 A;  1WSG A;  2E2Q A;  1BWF O;  4IZ9 A;  5GAH P;  4CZF A;  3H1V X;  3VQB A;  3ZSY A;  1VSK A;  5JS1 A;  4AF1 A;  2JGU A;  1X9M A;  1U6Z A;  4K43 A;  4XH5 A;  1C1A A;  3HPO A;  4FJL A;  1U47 A;  2G8I A;  5J1E A;  4DLE A;  4G1Q A;  1NK9 A;  4NLC A;  1FKO A;  3SZ2 A;  2DFF A;  2E6L A;  1JCE A;  4LF8 K;  2LSN A;  4BVO A;  3J7A P;  3LDO A;  1I3A A;  4NYF A;  3U9Z A;  4N41 A;  4BRN A;  3LAM A;  5C25 A;  4DQP A;  2CH5 A;  4MFB A;  4AHR A;  4YHH K;  4CF9 A;  3FR0 A;  5BR9 A;  2WFB A;  1IH7 A;  4LF4 K;  2HMP A;  4BC2 A;  3VEZ A;  4CEZ A;  3T69 A;  3VN5 A;  4C8M A;  4CI6 A;  4FWQ A;  2XO7 A;  3MN5 A;  3DLG A;  2YHY A;  4PQU A;  3LM2 A;  1TVR A;  4H8K A;  4E7L A;  3BZK A;  4O8K A;  3F9K A;  1S1X A;  2QWM A;  3DJC A;  3BGR A;  4XEI A;  4FVU A;  3CC4 N;  2A5X A;  1Q9X A;  1C1C A;  4OGE A;  2E2P A;  2ZWH A;  3NGI A;  4LFB K;  5FPM A;  2ZM6 K;  4IG3 A;  3P38 A;  1CZA N;  5CE3 A;  4KPY A;  1EO1 A;  1ZBS A;  3CJB A;  2OA8 A;  2RPI A;  1QE1 A;  3FZH A;  3LP3 A;  2ATQ A;  1L3U A;  2HHQ A;  3SV4 A;  3OYF A;  1REV A;  5BRF A;  4O0I A;  1JLE A;  5M1P A;  2QXL A;  5GAD P;  2OPP A;  4JNE A;  3L8B A;  5SZT A;  3AA2 A;  2A1R A;  4B3S K;  2F96 A;  1YF5 L;  3PX0 A;  2WBN A;  4CHQ A;  4YY3 K;  3B8A X;  4QS9 A;  4TSX A;  4HUG A;  5HBM A;  4GV3 A;  3I56 N;  5BRD A;  1RT4 A;  3OYE A;  1RTD A;  3K5N A;  3OYJ A;  3KLE A;  4E7K A;  4JD2 B;  2BTF A;  1KAY A;  4EP5 A;  4FXD A;  1BU6 O;  3OYC A;  3ZEU B;  1ZXO A;  2VCP A;  3J7Z O;  2QI2 A;  4MQ3 A;  3OW2 M;  2OZM A;  1DGK N;  2P9U B;  3A0I X;  5KPR A;  3P83 D;  4M45 A;  5F2R A;  4DTU A;  4DTP A;  3P5J A;  1BIS A;  1YTU A;  3ALY A;  2O4G A;  3R3L A;  3SJH A;  1IV0 A;  3TTC A;  2P9K B;  1RT2 A;  1C0F A;  3M1F A;  2YNF A;  3PX6 A;  3LP2 A;  1U45 A;  4OPK A;  4NYN A;  4Z4I A;  4C1N I;  3L2Q A;  3VTH A;  3KD1 E;  4N56 A;  3C6H A;  4FLW A;  3B6O A;  3IUC A;  1BG3 A;  3SUO A;  4NLB A;  4JKB A;  3LPT A;  3VF6 A;  3SQ0 A;  2XRI A;  4RTF D;  2HB5 A;  1QHT A;  1OH8 A;  4PL7 A;  2WUS A;  4M42 A;  1T05 A;  1J9A A;  3WT0 A;  5I42 A;  2G8K A;  3QB0 A;  3I8B A;  3K58 A;  2Z1J A; 
#chains in the Genus database with same CATH homology
 4LY7 A;  1YTA A;  3DOL A;  3SUP A;  2G8H A;  4CIF A;  1T8E A;  1LWC A;  3KK3 A;  2YNG A;  4DQI A;  4FM2 A;  3IAY A;  1A5X A;  3QIO A;  2BGG A;  3V1O A;  5HRN A;  3M8P A;  1VSE A;  2KTQ A;  4I2P A;  3LAN A;  2G8W A;  3L2W A;  1S1V A;  2I5J A;  4B9U A;  1JLG A;  2F8T A;  4KTW A;  1RBU A;  2FBT A;  3VQ7 A;  4FLX A;  5SWM A;  4DS5 A;  1GOA A;  4CEF A;  3ZT1 A;  2OPQ A;  4LD0 A;  1UAX A;  1FXX A;  4KFB A;  1A5V A;  1JL2 A;  3QO9 A;  1EET A;  1GOB A;  2KFZ A;  1NK6 A;  3AVK A;  5FDL A;  3MXM A;  3CFR A;  1RBV A;  3KLI A;  3ZSZ A;  3V9X A;  1D5A A;  2Z1H A;  3ZSV A;  3QNO A;  1X9S A;  4OKJ A;  3SQ4 A;  1L3T A;  4AHS A;  4HUE A;  3HYF A;  2HHS A;  3OYK A;  3MAQ A;  1RDB A;  2XY5 A;  1R0A A;  3M8Q A;  4O5B A;  4Y1C A;  4FJH A;  2HMI A;  2Y1J A;  4YNQ A;  4RW6 A;  4KTQ A;  4HHT A;  4GMJ B;  3TI0 A;  3FFI A;  1RDD A;  4DU4 A;  2FBX A;  3TR8 A;  3L3U A;  1S1W A;  3S3N A;  4I2Q A;  1D8Y A;  1FK9 A;  1EKE A;  1HPZ A;  1ZBL A;  3IS9 A;  2IS3 A;  3NGY A;  1L3S A;  4FZY A;  4Z0U A;  3ZSX A;  5DMR A;  4IKF A;  2RKI A;  2HW3 A;  1C0U A;  2VWJ A;  4CJT A;  3HT3 A;  5K14 A;  4B9S A;  4DQS A;  4EP4 A;  3AO2 A;  4J2A A;  5FRM A;  4F3O A;  3V9U A;  1ZBH A;  4CHP A;  3UIQ A;  2P1J A;  3SI6 A;  1XC9 A;  3LAL A;  3CYM A;  3L3V A;  2PY5 A;  3RMC A;  2AJQ A;  1ZBI A;  4LSN A;  2KW4 A;  3A2F A;  3OS2 A;  3VQ8 A;  2F8S A;  1RIL A;  3OYL A;  3LDS A;  4AHV A;  1HMV A;  3KLG A;  4Y1D A;  2EX3 A;  2YKM A;  3V1R A;  1VSF A;  3WNF A;  1RDC A;  4JS5 A;  1KFS A;  3ZT0 A;  1U04 A;  3VQ6 A;  3OYA A;  4DQQ A;  4CIG A;  1TK8 A;  3H08 A;  4CEB A;  4DS4 A;  4DF4 A;  3TAN A;  2ZQB A;  1RCH A;  3OYD A;  4B9V A;  3ZT2 A;  1RTI A;  2HND A;  2Z1G A;  3QLH A;  4O44 A;  3KK2 A;  4H4O A;  1VRU A;  5DK5 A;  3OYM A;  1KVA A;  4FM1 A;  5EU7 A;  1Y97 A;  2X78 A;  3HPG A;  4FVM A;  3JYT A;  4DTS A;  1J5O A;  3M8R A;  3RR7 A;  1GOC A;  4F8R A;  2O4I A;  2G8U A;  4K8Z A;  5FRO A;  4KTZ A;  1S9G A;  4FK0 A;  2Z1I A;  1RNH A;  1K6Y A;  3VQ5 A;  3HP9 A;  4JLH A;  3DLK A;  3L2R A;  2HHX A;  1NOZ A;  1WSF A;  2HHT A;  3V9S A;  3ZT4 A;  2HNZ A;  1HYV A;  3LWL A;  4DTO A;  1IKX A;  4I7F A;  4OVL A;  5J2P A;  3CM6 A;  1BCO A;  3AVI A;  1WSH A;  3NF6 A;  1BIZ A;  4CJR A;  1BIU A;  4KI6 A;  3MEC A;  1U4B A;  3PX4 A;  3NF7 A;  4DLG A;  1SL0 A;  4FJJ A;  1S5J A;  1Z25 A;  1RTJ A;  4FM0 A;  4DQR A;  4CJW A;  1RT3 A;  1JLF A;  4HVJ A;  2P5O A;  3KKR A;  4E7J A;  4CIE A;  1Q9Y A;  3QNN A;  1HJR A;  1S1T A;  1IKY A;  3OYN A;  3K57 A;  4BE1 A;  2VG6 A;  4DSL A;  4LH4 A;  5CZ1 A;  3QES A;  3CM5 A;  3L2U A;  2OPS A;  3NAE A;  3VQD A;  1NOY A;  4B8C A;  3KLH A;  4CGD A;  1SV5 A;  4DSF A;  4CGF A;  2BAN A;  1BQN A;  3VA3 A;  4B9L A;  4IG0 A;  2HHU A;  2B4J A;  3KLF A;  1ZYQ A;  3O3H A;  4FLY A;  4C8L A;  3S3M A;  3WNG A;  3DRP A;  3AA3 A;  4B9M A;  1IO2 A;  3I0R A;  3AO4 A;  4FK4 A;  5CYQ A;  3LP0 A;  3QEP A;  3HP6 A;  5CYM A;  2KQ2 A;  3RMB A;  1ASU A;  3CFP A;  3AA4 A;  3ITH A;  3SNN A;  3SYZ A;  4ELT A;  4M3Z A;  3AA5 X;  4FW2 A;  3NDK A;  1SL1 A;  3KIO A;  2JLE A;  4W5R A;  4KHS A;  3VA0 A;  5HP1 A;  4KB1 A;  1TGO A;  3LZI A;  1XHX A;  4CED A;  4CJL A;  4KHW A;  3VQE A;  4E89 A;  5J2N A;  4F2S A;  4CHZ A;  4BE2 A;  4KHU A;  3ZSQ A;  4PY5 A;  2YNH A;  2D0C A;  3I8D A;  4AHT A;  1XI1 A;  2FC0 A;  1WAJ A;  1X9W A;  4Z4C A;  1KVB A;  1RBS A;  4F4K A;  2ZE2 A;  1CXQ A;  1CZB A;  1WN7 A;  3B6P A;  1HRH A;  1TL1 A;  4CJ4 A;  2HHW A;  3NF8 A;  3D45 A;  4E1N A;  4QOZ B;  5KI6 A;  2RF2 A;  4Z4F A;  5HRO A;  2B6A A;  3WNE A;  3T3F A;  3NFA A;  4FLU A;  2KZM A;  1SL2 A;  4DTJ A;  3V81 A;  1QTM A;  3QIP A;  1LAV A;  1LW0 A;  2EHG A;  1VK0 A;  3RRG A;  2P5G A;  3TAP A;  1S6P A;  3C6U A;  1Z26 A;  4CEC A;  4DTN A;  4B3O A;  3HO1 A;  4W5N A;  2XHB A;  4CE9 A;  3SQ2 A;  1WAF A;  1RBR A;  4CGI A;  3OYH A;  2HHV A;  4N47 A;  4OPJ A;  3OS1 A;  3TWH A;  4W5T A;  5KRT A;  3RMD A;  4CF2 A;  3HVR A;  4ELU A;  4M3X A;  4KHQ A;  1BCM A;  3OYG A;  4HTU A;  1T03 A;  3AO3 A;  3HST B;  4FJ7 A;  1JXB A;  2IAJ A;  3CFO A;  4CJS A;  3TAE A;  4KHY A;  3AO5 A;  3NH1 A;  4NCB A;  2X6N A;  4E19 A;  2IGI A;  2G8V A;  4RW8 A;  3U3Y A;  1DTT A;  4K8X A;  1HYZ A;  5KGX A;  1SKW A;  1XHZ A;  4Z4H A;  4QAG A;  4FJG A;  4M3R A;  3EZ5 A;  4DF8 A;  1KSP A;  4QCL A;  4HCB A;  2YNI A;  4DSK A;  1TKZ A;  3SUQ A;  3HM9 A;  1NK8 A;  2Q3S A;  4FJX A;  3JSM A;  1VSD A;  5CZ2 A;  3O3G A;  4DU1 A;  4C8K A;  3V4I A;  4IFV A;  4CK3 A;  3EYZ A;  4ZTF A;  4E7I A;  3AVG A;  4F3T A;  4CFB A;  5KGW A;  4E0D A;  4GW6 A;  3DYA A;  3TAG A;  1RT7 A;  4DTR A;  1HNV A;  4DSE A;  4NCG A;  2IOC A;  3AVH A;  4IBN A;  1NJX A;  1HYS A;  3TAQ A;  3D0P A;  4CFA A;  2DTU A;  4DSJ A;  2IC3 A;  2PYJ A;  1VSJ A;  2NUB A;  2QXF A;  3O3F A;  3G0Z A;  1QSS A;  4L8R B;  4CGH A;  4IDK A;  4M3W A;  4DFP A;  3U6F A;  2R7Y A;  2OYQ A;  4R5P A;  2YHB A;  3OJU A;  3QET A;  3QEX A;  3DLH A;  3C94 A;  1D9F A;  4OLB A;  3HPH A;  4M3T A;  3PO4 A;  3NE6 A;  1JL1 A;  1TV6 A;  4CF8 A;  3SV3 A;  2D0B A;  5HRR A;  1KRP A;  2WON A;  3DM2 A;  3MEE A;  3KK1 A;  2X74 A;  4GVM A;  4CHY A;  3NH2 A;  3F73 A;  3AVA A;  3RR8 A;  4WE1 A;  3ISN C;  3VQA A;  4CGG A;  4KHN A;  3KKS A;  4FYD A;  2RN2 A;  3V9W A;  4FZZ A;  1J53 A;  3NBP A;  2VG5 A;  1TKT A;  1SKS A;  4AHC A;  5T7B A;  4J2D A;  3HJF A;  1LAW A;  1BI4 A;  3K2P A;  3MEG A;  3PUF A;  3TAM A;  3PY8 A;  2ITG A;  2Y1I A;  4W5O A;  3THV A;  2DFE A;  1KCF A;  1S6Q A;  4ID5 A;  3ZCM A;  4AHU A;  3NH0 A;  4OKK A;  1NK7 A;  1KTQ A;  3NCI A;  3NHG A;  4FJ5 A;  4M3U A;  3CQ8 A;  1WNS A;  1WSI A;  4B9T A;  3OVN A;  2W42 A;  1B9F A;  1O1W A;  3LZJ A;  1LW2 A;  1BGX T;  5C24 A;  1JLQ A;  3MXI A;  3BDP A;  1ASW A;  4B9N A;  4O4G A;  1QSY A;  4J2B A;  4CHO A;  5I3U A;  1C6V A;  2PYL A;  3VQC A;  4J2E A;  4FJK A;  2ETJ A;  3LP1 A;  3AVL A;  2G8F A;  1B92 A;  3DLE A;  4UQG A;  1BHL A;  1WSG A;  1UA1 A;  1Q8I A;  2BE2 A;  4CEA A;  4CJV A;  4DFM A;  4ID1 A;  4ZTJ A;  1N5Y A;  5D3G A;  1JLA A;  5FRN A;  3VQB A;  4DG1 A;  5HLF A;  2DY4 A;  2DFH A;  3ZSY A;  1VSK A;  4CHN A;  3G10 A;  3ZSR A;  4PUO A;  5JS1 A;  3ULD A;  2JGU A;  1X9M A;  2GV9 A;  3PO5 A;  1NK5 A;  3T19 A;  3DLB A;  2QKB A;  1C1A A;  1IKW A;  2OPR A;  4O0J A;  4PA1 A;  1JLB A;  3VQ9 A;  1U49 A;  3HPO A;  3ZT3 A;  2HVH A;  1NK4 A;  4FJ9 A;  4FJL A;  1U47 A;  4JS4 A;  4DSI A;  4JRP A;  3SUN A;  4PWD A;  1LWE A;  2G8I A;  3AVC A;  5J1E A;  4OGC A;  4G1Q A;  4DLE A;  3V9Z A;  1G15 A;  2ZD1 A;  4CF1 A;  1NK9 A;  3DRS A;  3RWU A;  4CJU A;  1CLQ A;  1FKO A;  3KD5 E;  3SZ2 A;  2DFF A;  3QEW A;  4FJM A;  1WSE A;  2E6L A;  3LAK A;  4CER A;  3TAB A;  3DOK A;  1WSJ A;  2LSN A;  3O4Q A;  4JRQ A;  2VWK A;  4CES A;  3VQ4 A;  1RT1 A;  1IKV A;  1HNI A;  3DLR A;  1I3A A;  4NYF A;  1LWF A;  4N76 A;  1MU2 A;  3HVT A;  1NKE A;  4LSL A;  5HRS A;  4N41 A;  1XWL A;  3LAM A;  3RMA A;  2QKK A;  1JXE A;  4CJ3 A;  4RW4 A;  4B8A B;  1NKB A;  1EXQ A;  3EY1 A;  5C25 A;  1RBT A;  1L5U A;  4DQP A;  2D0A A;  2KZZ A;  4MFB A;  4AHR A;  3E01 A;  4B08 A;  4FLZ A;  1TK5 A;  2YV0 X;  1ASV A;  1VSH A;  1EX4 A;  1UA0 A;  3HXM A;  4BDP A;  2E6M A;  4CF9 A;  4PQU A;  3ZSW A;  1IH7 A;  4RW9 A;  1ITG A;  3OJS A;  2GUI A;  3T1A A;  2HVI A;  2WOM A;  1QSL A;  4CEZ A;  3NGZ A;  4BAC A;  1C0T A;  4E7H A;  3VN5 A;  4C8M A;  2XO7 A;  4DMN A;  1X1P A;  1BL3 A;  5KRS A;  3S9H A;  2HNY A;  3AO1 A;  4OJR A;  3SPZ A;  1C1B A;  3AV9 A;  3DLG A;  3MED A;  4LH5 A;  4CGJ A;  2B5J A;  1NJZ A;  4NCA A;  3OS0 A;  1TVR A;  3DMJ A;  4H8K A;  4DTM A;  4BWM A;  3PV8 A;  4KRE A;  1CZ9 A;  1RTH A;  1LV5 A;  4E7L A;  1L3V A;  1VSM A;  2OZS A;  1ZBU A;  1KVC A;  3AVN A;  1TAQ A;  1U48 A;  3F9K A;  1S1X A;  1QS4 A;  1J54 A;  3V6D A;  3BGR A;  3TAR A;  1DTQ A;  4CFD A;  4FLT A;  4BDZ A;  1ZBF A;  1TL3 A;  1I39 A;  3L2V A;  1Q9X A;  3IRX A;  1BQM A;  1C1C A;  4OGE A;  3V1Q A;  1FKP A;  2VG7 A;  5E41 A;  3QEI A;  3ASM A;  3C95 A;  4FZX C;  2A1S A;  4FW1 A;  4M41 A;  3NGI A;  4BWJ A;  3SJJ A;  4Q0B A;  3DRR A;  4FJI A;  1NJW A;  4IG3 A;  3NF9 A;  2FBY A;  5CY4 A;  1W0H A;  3OYB A;  1SKR A;  1D9D A;  4KPY A;  2QK9 A;  1VRT A;  4Q5V A;  1C0M A;  1VSI A;  2OA8 A;  2RPI A;  1HQU A;  4DWI A;  1QE1 A;  3LP3 A;  4CEQ A;  1CXU A;  2ATQ A;  3LWM A;  3MXJ A;  3OYI A;  2E4L A;  3U3G A;  3SV4 A;  3SPY A;  2HHQ A;  3OYF A;  1NKC A;  1REV A;  4RG8 A;  4CK2 A;  1W9H A;  3C6T A;  4OKE A;  4O0I A;  1JLE A;  4CJ5 A;  4YFU A;  2D5R A;  5JS2 A;  2PZS A;  1JLC A;  1RT5 A;  1YT3 A;  3S3O A;  1TKX A;  2OPP A;  3L8B A;  1RT6 A;  4BDY A;  1KFD A;  4XIU A;  5SZT A;  3AA2 A;  2A1R A;  1TK0 A;  4CK1 A;  2F96 A;  1UOC A;  3DI6 A;  5HRP A;  4CEO A;  3RRH A;  4I9L A;  2KFN A;  3PX0 A;  1DLO A;  3I0S A;  4I9Q A;  3HK2 A;  3P1G A;  4CHQ A;  4FK2 A;  3AVF A;  3SQ1 A;  4TSX A;  4HUG A;  5HBM A;  1KLM A;  4CFC A;  5KTQ A;  4DFJ A;  1VSL A;  4CJF A;  4DFK A;  4KAZ A;  1RT4 A;  3OYE A;  4FLV A;  1RTD A;  4E1M A;  3K5N A;  5J2M A;  4EZ9 A;  3OYJ A;  3AVB A;  3KLE A;  3KJV A;  4IFY A;  4BE0 A;  4HUF A;  1BI4 B;  4E7K A;  1T7P A;  4CJK A;  4FJ8 A;  1KLN A;  1SUQ A;  4EP5 A;  4FXD A;  3OYC A;  1WLJ A;  4CJE A;  4DU3 A;  1TKD A;  1B9D A;  1EP4 A;  1UWB A;  4CJP A;  4ZHR A;  4H4M A;  4W5Q A;  4C8O A;  2X6S A;  3CG7 A;  4MQ3 A;  4E3S A;  5J2Q A;  4DTX A;  4N5S A;  2OZM A;  4AIL C;  1N6Q A;  3P83 D;  4KI4 A;  4OLA A;  4FCY A;  1JKH A;  1F21 A;  4M45 A;  3LPU A;  4KKO A;  4RW7 A;  3KTQ A;  3TAF A;  1S1U A;  2XY7 A;  1QQC A;  4Z4E A;  4DTU A;  1RDA A;  3P5J A;  4DTP A;  1BIS A;  1NJY A;  2XY8 A;  1YTU A;  3ALY A;  1TAU A;  3K5M A;  1HQE A;  3RTV A;  4CCH A;  3QEV A;  4Z4G A;  4EZ6 A;  2XY6 A;  3ZSO A;  2IDO A;  2O4G A;  4O55 A;  4AH9 A;  4HCC A;  3QER A;  1RT2 A;  5C42 A;  3VQQ A;  2YHA A;  3K5L A;  1NK0 A;  4CF0 A;  2YNF A;  3PX6 A;  3AVM A;  3LP2 A;  4KO0 A;  4OPK A;  4NYN A;  3K59 A;  1U45 A;  2BDP A;  4Z4I A;  2YKN A;  3M8S A;  3L2Q A;  3QIN A;  2P51 A;  3KD1 E;  1YVU A;  1L3U A;  4KRF A;  4N56 A;  4FLW A;  3B6O A;  3SUO A;  3IG1 A;  3AVJ A;  3K5O A;  3LPT A;  3VQP A;  3SQ0 A;  2XRI A;  4F2R A;  4ICL A;  2HB5 A;  1QHT A;  1A5W A;  4CJQ A;  3OY9 A;  1IG9 A;  2FBV A;  4KB0 A;  4CEE A;  4M42 A;  4M3Y A;  1T05 A;  4FJN A;  1J9A A;  2GBZ A;  3O4N A;  4ELV A;  3HL8 A;  4C8N A;  3WNH A;  4KV8 A;  5I42 A;  3SCX A;  2G8K A;  1S9E A;  3K58 A;  2Z1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...