3KKSA

Crystal structure of catalytic core domain of biv integrase in crystal form ii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
GSHLWQMDNTHWNKTIIWVAVETNSGLVEAQVIPEETALQVALCILQLIQRYTVLHLHSDNGPCFTAHRIENLCKYLGITKTTGIPYNPQSQGVVERAHRDLKDRLAAYQGDCETVEAALSLALVSLNKKRGGIGGHTPYEIYLESEHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of catalytic core domain of BIV integrase: implications for the interaction between integrase and target DNA
pubmed doi rcsb
source organism Bovine immunodeficiency virus
molecule tags Dna binding protein
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kksA00
3WNFA 1JKHA 1TKDA 4E7HA 3SQ2A 4DU1A 4I7FA 3U3GA 2KW4A 4FW2A 4CIFA 3KK2A 3O4NA 3SPYA 4JRPA 4CFCA 2OPSA 1XI1A 2GUIA 5J2QA 5KTQA 4B9LA 2HNYA 1T03A 2G8FA 3OYGA 2Y1IA 3JSMA 1KLNA 4HCCA 1KCFA 1SKWA 3NCIA 1DTTA 1C0UA 1JLCA 1Z26A 3HYFA 4DU3A 2LSNA 2KFZA 1KTQA 1D9FA 3K5OA 4CJQA 3M8SA 3LPUA 1L3VA 3OYMA 1KVCA 1BCOA 2XO7A 1QTMA 1TVRA 1LAWA 1EX4A 3SI6A 1RDAA 3NDKA 1HMVA 4BDZA 4FCYA 4OKKA 2GV9A 2OZSA 3OS0A 4CF2A 2A1RA 3ZSXA 2RN2A 3L2WA 4DTUA 4CHYA 1GOAA 2IOCA 4CERA 3AVMA 2OZMA 1S1WA 1JLEA 2FBTA 3FFIA 2P51A 2KQ2A 4B8AB 4B9UA 4W5OA 3HM9A 4OLBA 1HQEA 4JLHA 5FDLA 5K14A 3OYHA 1DLOA 2F8TA 2RPIA 2RF2A 3I0RA 3DLHA 4CF8A 3V81A 1SUQA 1ASUA 1RBRA 3HT3A 1CXUA 4CJFA 4KHNA 3L3VA 1L3SA 1TKZA 4CJVA 1NJZA 3RR7A 4IBNA 1IKYA 3IAYA 3MEDA 1TL1A 4LH4A 3L2VA 4Z0UA 2HHVA 2IC3A 1LWCA 3OYDA 3LDSA 4KHYA 4FW1A 4OKJA 5FRNA 1FK9A 3ZSQA 1W0HA 3L3UA 3S9HA 3AO3A 2YHAA 4NCGA 1C1BA 1NK4A 1TK5A 1FKOA 3IS9A 4MQ3A 4DSIA 1TGOA 4CJ4A 1IKWA 1S6QA 4KRFA 4HCBA 2WONA 3QINA 1LW2A 2ZE2A 4DTNA 3VQQA 3HJFA 2HHTA 2D0BA 3DLGA 5HBMA 1EP4A 4FJXA 3ZT2A 1L3TA 3S3OA 1WSHA 2PYLA 4CGGA 3LP0A 1RT3A 3LP1A 3K5MA 2R7YA 4BE2A 1XHZA 1C1CA 1NKBA 1U49A 3SQ1A 1NK5A 3OYAA 4OGCA 1FXXA 5KRTA 3ISNC 4FJ9A 1QSSA 3LAMA 1IKXA 3L8BA 3E01A 3OYJA 3K5LA 3DI6A 4DU4A 3V6DA 1RBVA 4N56A 3TAGA 3HP9A 4GVMA 4CJLA 2E6LA 4RW8A 3LAKA 3SUQA 1S9EA 3ZT4A 3RMDA 1WSGA 4AILC 2G8IA 3AO2A 4IFVA 4CJTA 1L3UA 2NUBA 3AVIA 1NKCA 4FK2A 3AVHA 3HL8A 4DF4A 4CEOA 1HYZA 1RBSA 3PX0A 2PY5A 4CGHA 2PYJA 3RRHA 2O4IA 1VSEA 4NYFA 4UQGA 2KFNA 4CFDA 4LSNA 3ZSOA 3DM2A 1SL1A 4CESA 1SKSA 2OPQA 3M8RA 3HO1A 1NK8A 2DTUA 1K6YA 3SNNA 1SL2A 2ATQA 2XY5A 3SUPA 1U4BA 2W42A 1WSJA 4M3TA 5CY4A 1BIZA 4CJPA 5KGWA 1QHTA 4C8OA 1SL0A 5KI6A 4F8RA 4CEAA 2HHXA 4CJSA 3KKRA 4FLWA 1NK7A 5FRMA 1HNVA 3ZSVA 3V4IA 3SUNA 1IG9A 2YNGA 2YNHA 4RW4A 4E7IA 1RTJA 3P1GA 4QOZB 3TR8A 5T7BA 4KREA 2G8WA 4BDPA 1RT4A 5CZ2A 4E19A 2XHBA 2BDPA 4JRQA 3ZT3A 2G8UA 2HNZA 3B6OA 1WSEA 5SWMA 2Z1GA 3V1OA 4F3TA 3OY9A 3MECA 1QQCA 1UWBA 1WN7A 1J53A 4ID5A 5HRRA 4CHPA 3L2UA 2D0AA 4CK3A 3DLEA 4Z4HA 4B08A 3K5NA 4DQSA 4FZYA 1S6PA 3AV9A 3AVNA 4HUEA 3SYZA 4CCHA 1YVUA 1J54A 2A1SA 1RNHA 3RR8A 4FJ5A 3BGRA 4OJRA 2HHWA 3VQ6A 3DOLA 3QNOA 4Z4EA 4GW6A 4NCAA 5HLFA 3AVCA 4NYNA 1NJWA 1SV5A 2JGUA 3JYTA 5C42A 4R5PA 2VWJA 4N47A 4CK1A 4FLYA 2OYQA 4FJLA 4J2BA 1EETA 1ZBUA 2KZZA 4HUGA 1RCHA 4E7KA 4CEBA 5I3UA 3EYZA 3C6UA 4DQRA 2YHBA 1S1VA 3SV4A 4E1NA 1KSPA 4EZ9A 2I5JA 4ZTFA 1C6VA 2G8VA 3H08A 2IDOA 4IG3A 3AA4A 4DTXA 4DTOA 3HSTB 1UAXA 4DFPA 1REVA 4OPJA 2B5JA 3VQBA 2FC0A 4FZZA 1O1WA 3V9ZA 4CECA 4ZHRA 1ZBLA 4CGFA 4DLEA 1KFDA 3D45A 3T3FA 1VRTA 1HJRA 3ZSYA 4DS4A 3QESA 1R0AA 4FJ7A 3PO4A 4KHWA 5J2MA 4CEZA 3S3MA 1U47A 1TK8A 1QSLA 1ZBIA 3SZ2A 1QS4A 2DFEA 1A5XA 2FBYA 3U6FA 3OYLA 1J5OA 1TK0A 1EKEA 1FKPA 4O44A 5CYMA 4E0DA 3CM6A 4H4MA 1NKEA 4KI4A 1C0MA 4DTSA 2Y1JA 3DRSA 1VSHA 2P5GA 2ZQBA 1TAQA 4DSEA 4F4KA 4KKOA 2QKBA 4KTQA 3LWLA 4W5RA 5FROA 2HHQA 3CM5A 1S1UA 3LANA 3T19A 3KLGA 2HB5A 3TAMA 1WAJA 5SZTA 2OPPA 5EU7A 2GBZA 5CYQA 3TAFA 2E6MA 3NE6A 2YKMA 1DTQA 4ICLA 4Z4FA 4PQUA 4KAZA 3AVJA 4FXDA 1Q8IA 2IGIA 3OYNA 3NGIA 1YTUA 3M8QA 2E4LA 3TAQA 3NGZA 1KVBA 4ELVA 4FJHA 4CJKA 1HQUA 4WE1A 3I0SA 5DMRA 4DFJA 4ELTA 3AVFA 4KI6A 3RMAA 1NK9A 4CGJA 3TARA 1NJYA 1N6QA 3NBPA 3T1AA 4NCBA 3TABA 4KB1A 3CG7A 1CXQA 2QK9A 1Q9YA 1ASVA 3D0PA 3QNNA 3ALYA 3KD1E 4FJIA 4EP4A 1D5AA 1RTIA 3DYAA 5C24A 3DRPA 4FYDA 4DFMA 2HHSA 3OVNA 3V1QA 4CIGA 2G8KA 4M3WA 1KLMA 2Z1IA 1EXQA 4AHUA 1B92A 3L2QA 4BACA 1I39A 4W5QA 4CF0A 4Z4IA 4CE9A 1YTAA 1C1AA 2AJQA 1XWLA 3HXMA 5HP1A 3WNEA 3HPHA 3DMJA 3AO5A 1RT1A 3AO4A 4FLZA 4DQPA 3B6PA 3AO1A 1I3AA 3KK3A 3UIQA 1NJXA 4C8KA 4RG8A 3OJSA 2ETJA 3C94A 1TKTA 1BIUA 1JLBA 2JLEA 2XRIA 3ZT0A 1BHLA 1BISA 2YNIA 1NOZA 1B9DA 2Z1JA 3LALA 4FM2A 2X6NA 1D9DA 2Q3SA 3QIOA 4KV8A 4EZ6A 4LH5A 1X9WA 1U04A 4DTPA 2ZD1A 1BL3A 4M3ZA 4RW9A 3PX6A 1RBTA 4CEQA 3THVA 4CGDA 1S1XA 3V9XA 4F2SA 1RT5A 1JLAA 1BQNA 3MXIA 3AVLA 4AHCA 3RMBA 3TANA 1TL3A 4E7JA 4I2QA 3CYMA 3ZSWA 4CJ5A 3VA0A 2QXFA 3QEPA 1JL1A 2XY8A 3SV3A 3RMCA 4FM0A 4FLVA 3QO9A 4CJUA 4B9MA 2FBVA 4LSLA 4FJGA 4KHSA 1WLJA 1WSFA 4N5SA 4F3OA 4OVLA 2D0CA 3NHGA 1VSJA 3SCXA 4OGEA 3C6TA 2YNFA 1BGXT 3NF7A 3AA2A 4DSJA 4OLAA 3QEIA 1BCMA 1B9FA 1BI4B 1WAFA 2BANA 3VA3A 4DQIA 3QEXA 4BDYA 3O3GA 4DG1A 3V9WA 1T7PA 1YT3A 3K59A 4CF1A 1HYVA 4BE0A 3DLKA 3VQ8A 4DSFA 1U45A 1D8YA 2D5RA 4FK4A 3KJVA 1XC9A 1RT2A 2EHGA 3QETA 3ASMA 1HRHA 4C8MA 5JS2A 2Z1HA 1VK0A 4Y1CA 3CFOA 4KPYA 4CIEA 3S3NA 3AVAA 2HW3A 3MEGA 4MFBA 4PY5A 1RDDA 3AA3A 5HRPA 3OYIA 4AH9A 3OYBA 3HPOA 4FJ8A 4Z4CA 4OKEA 5KGXA 1X9SA 1ITGA 3M8PA 3KD5E 1CZBA 1ZYQA 3TI0A 3V9UA 4ID1A 3SPZA 3OYCA 4I9LA 4IFYA 3VQPA 1WSIA 4B8CA 1N5YA 4M3XA 3RWUA 4YNQA 1W9HA 4QAGA 2ITGA 4RW7A 3VQCA 3L2RA 3TWHA 2F8SA 1XHXA 2BGGA 3HPGA 1Z25A 3G10A 3AVGA 1GOCA 1A5WA 4AHSA 4O0IA 4IG0A 3KK1A 3LZJA 1NK0A 3BDPA 4CJRA 3OYEA 4EP5A 3O3FA 4DS5A 2F96A 3NF8A 3QEVA 4DF8A 4FM1A 4DFKA 3V1RA 4O55A 2HNDA 5D3GA 4W5NA 4HTUA 4E1MA 3VQEA 3CQ8A 2IS3A 2HMIA 3K2PA 4Q5VA 2HVIA 3NGYA 3EZ5A 3HK2A 4JS5A 2VWKA 4BWMA 3G0ZA 4J2AA 3QLHA 5CZ1A 4DLGA 3SQ4A 1LW0A 1JXBA 4CHOA 1TV6A 4LY7A 1JLFA 1RTHA 4HHTA 5J2NA 3PUFA 2X6SA 2KZMA 3LP2A 4KO0A 4CF9A 2QKKA 3VQ9A 3O4QA 1L5UA 1JLQA 3NAEA 4K8XA 4M3RA 5HRNA 4PWDA 4LD0A 1F21A 1ASWA 3KLIA 3KIOA 4C8NA 4Z4GA 1TKXA 3HP6A 1U48A 1BI4A 3OYFA 3PY8A 3P5JA 5J1EA 4FZXC 2O4GA 3SQ0A 4K8ZA 2B4JA 4E3SA 4J2EA 3K58A 4DTJA 1KRPA 4CEFA 4M3YA 4DMNA 1VSFA 4HUFA 2EX3A 3IG1A 1ZBHA 1X9MA 2OA8A 1UA0A 1ZBFA 4CHZA 3QERA 3PV8A 4B9NA 3LZIA 1S9GA 4N76A 2DFHA 1JXEA 4CFAA 2HHUA 4B9SA 1GOBA 4DQQA 4M41A 1RDCA 4JS4A 1S1TA 3EY1A 1RDBA 3DOKA 4CHQA 4M42A 4CEDA 2HVHA 1VRUA 3U3YA 2G8HA 1S5JA 1QSYA 4E89A 3A2FA 4AHVA 2WOMA 3KLFA 1Y97A 4FK0A 1UA1A 1HPZA 1HNIA 1UOCA 2P5OA 3OJUA 3WNGA 2YV0X 1VSIA 5JS1A 4KTZA 4KB0A 4B9VA 4GMJB 2KTQA 1BQMA 3DLRA 1T05A 1MU2A 1J9AA 1KFSA 3HVRA 4PUOA 3OYKA 1NK6A 2X74A 3VQ4A 4B9TA 4FJKA 3MEEA 3KLHA 4FLTA 3V9SA 4KFBA 3F73A 2PZSA 3KKSA 1X1PA 4FLXA 3TAEA 1LV5A 3WNHA 4FJJA 4DTMA 3CFRA 2BE2A 3ZSZA 3LP3A 4G1QA 3O3HA 3DLBA 1CLQA 4I9QA 3QIPA 1RBUA 3ZSRA 4FJMA 3TAPA 4CJWA 2FBXA 4DTRA 4TSXA 4XIUA 3F9KA 4FVMA 5HRSA 3KTQA 4DWIA 4J2DA 4AHTA 4E7LA 3RTVA 3PX4A 4C8LA 4ELUA 4O5BA 5HROA 1HYSA 4IDKA 4RW6A 1QE1A 3MXJA 3NH2A 4CJEA 3RRGA 3HVTA 3LPTA 3DRRA 1T8EA 4CHNA 4YFUA 4M3UA 3MAQA 4HVJA 4CGIA 4DSLA 1C0TA 1G15A 1LWFA 1RILA 2IAJA 3CFPA 4FJNA 4CFBA 3IRXA 4AHRA 4KTWA 3AA5X 1KVAA 3PO5A 4N41A 4FLUA 3MXMA 3VQ5A 4CK2A 1RTDA 4KHQA 4OPKA 1VSKA 1JL2A 1RT6A 3QEWA 2DFFA 3I8DA 4H8KA 3ULDA 1IKVA 3NH1A 4Q0BA 1CZ9A 4O4GA 1WNSA 5E41A 4BE1A 2XY6A 3NF9A 1RT7A 3ITHA 3NF6A 2XY7A 1NOYA 1VSMA 3AVKA 2VG6A 4KHUA 3P83D 1SKRA 1A5VA 2VG5A 3ZCMA 4B3OA 3C95A 3VQ7A 1JLGA 4CEEA 4I2PA 3OS1A 1IO2A 3VN5A 4L8RB 2DY4A 3VQAA 3OS2A 4M45A 3VQDA 3AVBA 1IH7A 4BWJA 3NFAA 4IKFA 4W5TA 4QCLA 4O0JA 5C25A 5J2PA 2YKNA 4CJ3A 4ZTJA 5KRSA 1VSLA 3SJJA 1TAUA 2VG7A 4Y1DA 5DK5A 5I42A 3NH0A 1Q9XA 3KLEA 2RKIA 2P1JA 2B6AA 3LWMA 4H4OA 3K57A 1LAVA 1VSDA 1LWEA 2X78A 2OPRA 4PA1A 4F2RA 4DSKA 3ZT1A 3SUOA
chains in the Genus database with same CATH superfamily
3VESA 4QS7A 4E1JA 4BRKA 4DU1A 2KW4A 4CIFA 3KK2A 4NLCA 1VQPN 3VPZA 2GUIA 2ZJQL 2HNYA 2G8FA 2Y1IA 1VAZA 3JSMA 1KLNA 4HCCA 4IZ9A 4BR9A 2LSNA 2NNWA 2KFZA 1DGKN 3M8SA 1QTMA 1TVRA 1QVGM 3Q7BA 4BDZA 2OZSA 1MWKA 2QI2A 3OS0A 2A1RA 3ZSXA 2RN2A 1NG9A 3MN5A 2IOCA 4CERA 3AVMA 2P51A 1NGIA 4B8AB 4WF9L 4JV5K 3OYHA 2RF2A 4CF8A 1RBRA 4CJFA 1X3NA 1TKZA 4IBNA 1IKYA 5BRDA 1VQ6N 4LH4A 1NGHA 2UUAK 2Q36A 4LF6K 4YDUC 3IUCA 1NK4A 2A5XA 1FKOA 4BREA 4MQ3A 1M90O 4YHHK 1IKWA 1S6QA 4B1UB 1YAGA 3NVMA 4PKIA 2ZJRL 1RDUA 4HCBA 5ADXA 4JK8A 1E3MA 4JKDA 4BE2A 4JK9A 3SQ1A 4FJ9A 5LMUK 2F9TA 3OYJA 4IJNA 1M1KO 1VQ7N 3V6DA 1RBVA 3TAGA 2FSNA 4CZEA 3LAKA 3VETA 5B8HA 4CJTA 4FK2A 1TUUA 3HL8A 4DV7K 3KWIA 1HYZA 4BRNA 3CPEA 2IVOA 5EVZA 5GADP 3EN9A 2QWQA 4UQGA 2UXCK 4CESA 1MDUB 1K6YA 1DKGD 3SNNA 1U4BA 3TTCA 4M3TA 1BIZA 4CJPA 1TYQA 5KGWA 3VEXA 3CCSN 3MCAB 2HHXA 3KKRA 3THYA 4A57A 1G99A 4CBWA 3TR8A 2XHBA 4JRQA 4K42A 2Z1GA 3V1OA 1QQCA 1J53A 4ID5A 4DQSA 4HUEA 4CBXA 2NRWA 1NLVA 4WQ4C 3RR8A 1RNHA 3AARA 3FR0A 4GW6A 1IG8A 4WQ5C 4R5PA 2VWJA 4CK1A 4HUGA 3EYZA 4DQRA 1DT9A 1S1VA 3HBTA 4A2BA 2IDOA 3KVGA 1N8RO 1O1WA 3ID8A 4B3TK 1T6CA 4FJ7A 4JKBA 3U8XA 3GBTA 3HSCA 2FBYA 3CMAN 3OYLA 1TK0A 2A42A 4DTSA 2P5GA 4JI0K 2ASOA 2ZQBA 4DSEA 4J8FA 4KKOA 2O8CB 2HHQA 4B9QA 4NB4A 2GBZA 2E6MA 3NE6A 4Z4FA 1DTQA 4PQUA 4KAZA 1Q86O 1Q8IA 3OYNA 4FWSA 3TAQA 3H1QA 1YHQN 3A5MC 2BTFA 1ZXOA 3WXLA 4ELVA 4FJHA 1HQUA 3I0SA 5DMRA 3K9KA 4KI6A 3CCEN 2O8FB 2QK9A 4B3MK 3D0PA 2D0OA 3EL2A 5BR9A 4EP4A 1D5AA 1RTIA 4YOYA 3SJHA 4WFBL 3WXIA 2UUCK 4FYDA 1NGGA 3OVNA 3WXJA 2G8KA 4M3WA 4AHUA 2Z1IA 1B92A 5FPNA 3L2QA 3SBTA 4Z4IA 4Y0WA 1XUPO 2Q31A 3O6WA 2EWSA 3RVCA 3HPHA 3MN9A 2FF3B 3B6PA 3AO1A 4GKJK 3F9MA 5M1KA 2JLEA 1NGAA 2XRIA 1W97L 1B9DA 2X6NA 4JKCA 2Q3SA 2NRTA 5AQTA 1U04A 4CZMA 2ZD1A 4M3ZA 3PX6A 4OPHA 4BR7A 2NRXA 3GE1A 1RT5A 1JLAA 1BQNA 3MXIA 3E9PA 4A5AA 3TANA 5AFUA 4I2QA 3VA0A 3L6QA 3QFUA 3CMEN 1JL1A 5FPMA 3RSEB 3SV3A 4KHSA 4B9MA 1WSFA 4F3OA 2UYTA 5BREA 3C6TA 2YNFA 1BGXT 4OX9K 2VQEK 4GY2B 3QEIA 1BI4B 5LMNK 4DV5K 3ZEUB 4DQIA 5TKYA 5AQRA 2E2NA 3HI0A 1NNEA 4BE0A 1U45A 3DLKA 5AQGA 1NMNA 1HJOA 3KJVA 1XC9A 4FPBA 1RT2A 2EHGA 3ASMA 4CW7B 1VK0A 3ZETA 4KPYA 4JKFA 4MFBA 3L0QA 4KH5A 4MLEA 3AA3A 3CC4N 1X9SA 1ZYQA 4IWVA 3KHYA 4I9LA 4B8CA 1WSIA 1Q18A 4CD1A 3L2RA 3W3DA 3O5BA 3BF1A 3KK1A 1GOCA 3BDPA 3LZJA 2F96A 3I56N 3QEVA 3HOTA 4R79A 2HNDA 5F2RA 4QS9A 3NGYA 5KPTA 2VWKA 2I7NA 5CZ1A 4JEPA 1NGDA 4LY7A 3PUFA 2X6SA 4BRDA 5AQLA 3VQ9A 3C0BA 2HMPA 5AQZA 3NAEA 3QB0A 3KLIA 2CGLA 1TKXA 4K8ZA 3P5JA 5J1EA 3TTDA 4E3SA 4J2EA 2W6KA 4CEFA 3T69A 1P8ZA 4DMNA 1VSFA 2YHYA 4DQ8A 3IG1A 3C7NA 4JI3K 1ZBHA 4CHZA 3PV8A 3J7YP 2O8BA 4N76A 1JXEA 2HHUA 4DQQA 1RDCA 4JKEA 1S1TA 3EY1A 4CHQA 4DHYA 3QMLA 4AHVA 3KLFA 1Y97A 3UE5A 4FK0A 4BY9C 1UA1A 1HNIA 3OJUA 4LF8K 3WNGA 1VSIA 5JS1A 4B9VA 4B1ZA 4LF9K 2KTQA 1KFSA 3OYKA 1SAZA 4BVPA 4FJKA 3MEEA 3KLHA 4KFBA 3F73A 2E2OA 1YXQA 3KKSA 1JJ2M 3S41A 3ZYYX 4H0XB 3O1BA 4DV0K 5TKWA 5KQDA 3ZSRA 1RBUA 3D7EO 4J2DA 5M1FA 4E7LA 3RTVA 2QWRA 5AQMA 3NH2A 1QE1A 3OTOK 4YOTA 1T8EA 4M3UA 2Q0RA 4HVJA 4DSLA 1RILA 4AHRA 4FLUA 4IDHA 3VQ5A 4KHQA 1JL2A 5JLFA 4CZLA 3I8DA 4I6MB 3CJ7A 1IKVA 3CJCA 4BRQA 4CJ7A 3O4WA 1NOYA 3P83D 1A5VA 2VG5A 1DEJA 2OANA 4B3OA 1JLGA 4JHDB 4CEEA 3M3ZA 4I2PA 2WC9A 4HTLA 3VN5A 3VQDA 4NO7A 1IH7A 3NFAA 4O0JA 5C25A 4ZTJA 5EY4A 5KRSA 2VG7A 5EX5A 3MX2A 4V19S 2B6AA 4A62A 4YY3K 1LAVA 5AQXA 4F9OA 3BF3A 2NRHA 4WQ4A 1S22A 3WNFA 3SQ2A 3FFKB 4K25A 4FW2A 2VYPA 4GV9A 2OPSA 2VGMA 4WQ5A 1V4SA 1WUAA 4BQZA 1KCFA 1SKWA 2QW9A 4AM7A 1DTTA 1JLCA 1Z26A 4DU3A 1MA9B 1KTQA 5AQWA 3FE1A 3K5OA 1L3VA 2H3GX 1D4XA 2ZJPL 3OYMA 1KVCA 2XO7A 1EX4A 3SI6A 1RDAA 3KK7A 4MDBA 4OKKA 3BY5A 3L2WA 4JI1K 1JLEA 3FFIA 4W5OA 2UUBK 1HQEA 4JLHA 2GEMA 1DLOA 2RPIA 3V81A 1ASUA 1KAYA 1NM1A 1NGFA 3O9SA 3OHRA 1NJZA 3MEDA 1VQ4N 3HZ6A 1C0FA 3UKUB 2HHVA 4DCHA 3ZSQA 2YHAA 5C2FA 4NCGA 1WBBA 3DWLA 5AQNA 3THWB 2HHTA 3VQQA 4FOIA 5HBMA 1EP4A 3ZT2A 5BRFA 5JMVA 2PYLA 4OO1J 3K5MA 1KD1O 2GELA 1U49A 1FXXA 3SBGA 3E01A 4DU4A 1T6DA 3G25A 3D6RA 3HP9A 3BZKA 1N33K 3I8BA 3H46O 1S9EA 3ZT4A 5FLXO 1WSGA 5ELZA 4B3RK 4IFVA 5AQKA 3DLLL 4GV6A 3VTHA 1ATRA 3RRHA 2O4IA 4NYFA 2FSKA 4CFDA 3GL1A 5AQOA 4EAHD 5FPDA 3CHWA 2OPQA 2ATQA 2O8DB 1WSJA 2FSJA 3CF5L 3QICA 4C8OA 1SL0A 3KZBA 1HNVA 3ZSVA 4IEIA 3EZWA 4E7IA 4KREA 3P1GA 2GWKA 2ZGYA 5CZ2A 2BDPA 3ZT3A 2FF6A 3IFRA 5SWMA 4CZGA 3OY9A 3IMXA 1S72N 4H5TA 3L2UA 1O13A 3DLEA 1S6PA 4FWMA 5DM6L 4JKAA 4CCHA 1GLFO 2A1SA 2HHWA 4FJ5A 3VQ6A 4C23A 3CC2N 4X64K 3D2FB 4NXNK 1T3VA 4CBUA 3AVCA 5HLFA 3VEOA 4BQLA 3JYTA 1IBMK 4FJLA 2KZZA 4E7KA 1FW6A 4CEBA 5I3UA 3SMSA 5GIOA 3G6EN 2I5JA 4ZTFA 1C6VA 4U67L 1SZ2A 4JI8K 3AA4A 2F4VK 4RTFD 2YCHA 4OPJA 1KQSM 4UY8O 1ZBLA 4ZHRA 4CGFA 1KFDA 3D45A 3QESA 1R0AA 4KHWA 1TK8A 1ZBIA 1A5XA 4FWLA 2E1YA 3BEXA 1J5OA 4A61A 3J8AA 3MDQA 4H0PA 4E0DA 3VEVA 1NKEA 3A5LC 1N34K 3VEWA 4JNEA 3OBYA 5BR8K 3VOVA 3WEEB 5FROA 3CM5A 3T19A 3KLGA 5SZTA 1WAJA 2OPPA 3AVJA 2IGIA 3NGIA 3M8QA 2E4LA 1KVBA 4JKGB 4BRLA 4FPAA 3P4IA 4WE1A 4DFJA 4A59A 3D2EB 3RMAA 1NK9A 2O8EB 3T1AA 3TABA 1CXQA 1ASVA 2Q0UA 3PSIA 3DYAA 5C24A 3JS6A 4DFMA 3R6MA 4CIGA 4W5QA 5BPMA 2D4WA 4CE9A 1YTAA 3CJAA 1C1AA 1XWLA 5HP1A 3WNEA 1VQKN 3AO4A 3LDPA 4FLZA 4CD3A 2UXBK 4FWPA 3I55N 2CH5A 2D0PA 4LC9B 1EQYA 4JI5K 1TKTA 4G9ZA 3LALA 3Q7CA 4EZ6A 5KPZA 2CGKA 4DTPA 3QFPA 4RW9A 4LF5K 4DR4K 3THVA 4PL8A 3MWPA 4ISGA 4PKHA 2O8CA 2P9UB 4AHCA 1TL3A 2I7PA 3QEPA 2QM1A 2GWJA 3QO9A 2A3ZA 2FBVA 4FJGA 1ZBSA 4N5SA 1EWQA 4OVLA 2D0CA 4DSJA 3AA2A 4M63C 1VQMN 3WQTA 2O8FA 3E1YA 3O3GA 2YI1A 4DG1A 4CF1A 3VQ8A 3O9QA 2D5RA 1NGEA 2WBNA 5JVHL 4JI7K 3QETA 1HRHA 4C8MA 5JS2A 1BOTO 4Y1CA 3C65A 1QQNA 4CIEA 5BPLA 3S3NA 4PY5A 2P9LB 1U2VB 3FZMA 5KPRA 4FJ8A 3HPOA 4OKEA 3THXB 3M8PA 1WBDA 2F7TA 5GINA 3F5TA 1N5YA 1BO5O 4M3XA 4QAGA 5F1XA 5AQUA 4BVOA 4LF7K 3TWHA 1NK0A 4DS5A 4AF1A 4DF8A 4DFKA 4W5NA 4E1MA 3CQ8A 1FJGK 1WOQA 1YIJN 4DLGA 4BR2A 1JLFA 1RTHA 4HHTA 5HOOA 3RSEA 5I9EB 2KZMA 4KO0A 5AZJB 1JLQA 1F21A 1ASWA 5E26A 4Z4GA 3HP6A 1U48A 1BI4A 3PY8A 3ZEUA 5IT9O 1QVFM 2P9KB 1P90A 3LDOA 4BRMA 1VQ9N 2ZWHA 2HF3A 1ZBFA 4B9NA 3DAWA 3PSFA 4CFAA 4B9SA 4JS4A 4JD2B 4BGAA 5JICA 1OKJA 2VQFK 2HVHA 2ITMA 1S5JA 1QSYA 4XH5A 2WOMA 4DR7K 1Q81O 1HPZA 2A6AA 3P39A 2E8AA 4KB0A 5AQSA 1HNZK 1BQMA 1MU2A 1NGJA 3HVRA 2X74A 2DPNA 3VQ4A 4B9TA 4QS8A 4FLXA 3WNHA 3MN6A 4FJJA 4BC5A 4DTMA 3LP3A 4G1QA 4H0OA 1KC8O 3ZLJA 1BU6O 4FJMA 2FBXA 4TSXA 3F9KA 4FVMA 3ATVA 4M7YA 4O5BA 5LL6Z 4B1XB 5HROA 3EEQA 4IDKA 4RW6A 1HYSA 5C0YA 2KLAA 3DRRA 3MAQA 3CD6N 3BP8A 3CFPA 3HRGA 5BRHA 4CK2A 1VSKA 3WQUA 4B3SK 4DR1K 2QWOA 3GOIA 2VCPA 3MMVA 2YHXA 5JLHA 5LJWA 3NF9A 5CHIA 1RT7A 3NF6A 1VSMA 3AVKA 2VG6A 4KHUA 1CZAN 3ENHA 3CCJN 3C95A 3TSQA 5EXWA 1LOTB 3OS1A 5IWAK 2DY4A 1GLAG 5CE3A 4DV1K 2ASMA 2OTLN 3SJJA 3NH0A 1TUYA 1Q9XA 4ISEA 4H4OA 1QZ5A 1U6ZA 4JK7A 3LDQA 4OPAA 3ZT1A 3SUOA 1JKHA 4LFCK 4BC2A 5AQVA 3L4IA 3CQYA 4I7FA 3U3GA 2HBJA 3SPYA 2P9NB 4CFCA 3LM9A 4B1YB 1XI1A 1WB9A 5J2QA 1OVYA 2JWKA 3CCUN 1GLBG 1N36K 5GAHP 2Q97A 3NCIA 1C0UA 2HBMA 1D9FA 4CJQA 1K8KA 1BCOA 4DUZK 4X62K 3NDKA 1BWFO 1HMVA 4FCYA 2GV9A 4PKGA 4DTUA 2PBDA 3HOSA 4EHTA 2OZMA 1S1WA 3O80A 4I6MA 2KQ2A 3HM9A 4A5BA 3MCPA 5K14A 5M1OA 3I0RA 1SUQA 3VF4A 3VMFB 3HT3A 1IBLK 1L3SA 2HBLA 4JHDA 3B8AX 3R1XA 3L2VA 4B1VA 4JAXA 2KHOA 1QHAA 3CETA 3ULEB 3U9DA 1BUPA 2IC3A 4JYAK 4IEEA 3GG4A 4JI6K 3OYDA 3LDSA 4KHYA 4EHUA 5FRNA 1FK9A 1W0HA 1C1BA 1TK5A 2GTDA 3IKMA 5LJVA 4CJ4A 2D0BA 1XNQK 4KHPK 2OTJN 1ATSA 3S3OA 4YDUA 5FPEA 3LP0A 3TTFA 1XHZA 1C1CA 3OYAA 4OGCA 1QSSA 5AJ3K 3LAMA 1IKXA 3DXKB 1ILYA 3HM8A 1I94K 3K5LA 3DI6A 3CJBA 1NBWA 4N56A 4GVMA 1HKBA 3RMDA 4IJAA 2G8IA 1HNXK 3AO2A 1L3UA 3AVHA 1XQSC 1RBSA 3PX0A 4CGHA 4ILHA 2PAVA 1YF5L 2KFNA 4L3QA 3VGLA 5M1NA 4CZIA 4JN4A 1MWMA 2NRZA 2AP1A 1SKSA 2F9WA 3M8RA 3HO1A 1NK8A 2PFUA 3VGKA 2XY5A 3SUPA 2W42A 3DJCA 1R59O 2D1KA 4CEAA 4CJSA 1RDWX 1NK7A 5AQFA 1Z6RA 3SUNA 2YNGA 4QOZB 1RTJA 4BDPA 1ATNA 5AZIB 2G8UA 3UKUA 2RE2A 1OH8A 3B6OA 4F3TA 3MECA 1UWBA 4FL9A 3W0LA 1XMOK 4Z4HA 4B08A 4FZYA 3AV9A 3THWA 2YHWA 4AM6A 3SYZA 1GLDG 1J54A 3BGRA 4OJRA 2E5LK 3C6AA 3CCQN 2QXLA 4YOXA 3QNOA 4Z4EA 2E20A 3CXCM 2ASPA 4NCAA 4NYNA 3A5NC 2JGUA 4FO0A 3QBWA 4KH6A 4XH1A 4N47A 1ZBUA 2P9IB 1RCHA 3E66A 3WXKA 4EZ9A 4E1NA 2G8VA 4DTXA 4WCEL 1UAXA 2FC0A 4DR5K 4CECA 3H3NO 3T3FA 4XH4A 4DS4A 3PO4A 4CEZA 3S3MA 3DXMB 3FGUA 4A2AA 3U6FA 1EKEA 1FKPA 4H5VA 2P9SB 4O44A 2O8DA 3CM6A 4KI4A 1C0MA 2Y1JA 1VSHA 3R9PA 2HF4A 3TU5A 1TAQA 4F4KA 1NGCA 2WUSA 4XEIA 3LWLA 4W5RA 1S1UA 5EU7A 3EKUA 4ICLA 4K0KK 4X65K 4FXDA 1YTUA 5A2QO 3M1FA 3NGZA 1KXPA 4JI4K 4CJKA 5C10A 1NJIO 4ELTA 4FJIA 4CGJA 3TARA 1NJYA 2NRVA 4NCBA 3D2FA 4KB1A 3KD1E 3ALYA 4X66K 4DB3A 1S3XA 3V1QA 3VF6A 1KLMA 3SAGA 4BACA 4IO9L 3P38A 1I39A 4PHTX 1HX1A 3A0IX 1YJWN 3NVKA 3AO5A 1RT1A 3O9TA 4DQPA 3KK3A 1I3AA 3SAFA 1BA0A 4C8KA 3MK6A 4CZJA 1E4FT 1BHLA 4C1NK 3ZX3A 1GLEG 2YNIA 2Z1JA 1D9DA 1X9WA 1BL3A 1V4TA 1RBTA 2VWBA 4DV6K 4CGDA 1S1XA 4F2SA 3WEEA 3CJ1A 3O8MA 3RMBA 4E7JA 2QWNA 3CYMA 4CJ5A 2XY8A 3RMCA 4LSLA 1WLJA 2IVPA 4LFBK 4JKGA 3UKRB 3NHGA 1VSJA 1C0GA 4BRCA 3SCXA 3D2EA 4NXMK 1B9FA 2BANA 2O8EA 3QEXA 4BDYA 3SK3A 4H0VB 1YT3A 3K59A 1HYVA 1BDGA 1D8YA 5AQIA 4FK4A 5FRMA 1EWRA 3VEZA 3AVAA 5AQPA 3N4QA 4AH9A 2V7ZA 3OYBA 4Z4CA 3ATUA 5KGXA 3KD5E 1CZBA 1JCEA 3VQPA 4IFYA 4FVUA 3RWUA 3O9RA 2UU9K 1W9HA 2ITGA 1XHXA 1Z25A 3G10A 3AVGA 3K9JA 4IG0A 4CJRA 3OYEA 3OA9A 4BC3A 4FM1A 5D3GA 4O55A 2IS3A 4BG8A 2HMIA 4DKWA 2HVIA 2P9UA 3HK2A 4JS5A 3G0ZA 4J2AA 4CHOA 5EOYA 5H1SQ 5J2NA 3LP2A 3CCMN 4K8XA 4M3RA 5HRNA 4PWDA 3VTIA 2B4JA 3K58A 4DTJA 1KRPA 4M3YA 1VQ8N 4HUFA 2EX3A 1X9MA 3KWGA 4CI6A 3LZIA 3O9UA 1GLCG 2DFHA 5F0XA 1GOBA 3H45C 1XNRK 4M41A 1YJ9N 3AY9A 4H5NA 1Q7YO 3DOKA 4IOAL 3WXMB 2P9LA 3ENBA 1U2VA 3U3YA 4H0TB 4O8KA 3AAQA 3A2FA 4E89A 3THXA 2P9PB 1BA1A 1UOCA 2P5OA 1GLLO 2YV0X 2UXDK 4PUOA 3DLRA 3CCLN 1NK6A 2QA4N 3V9SA 4K41A 1IJJA 4BRFA 1LV5A 1CLQA 3O3HA 4DV4K 3DLBA 4I9QA 3QIPA 4CJWA 1HPMA 5DM7L 3KTQA 4DWIA 4AHTA 5C12A 5AZJA 5C2DA 4CJEA 4YFUA 2IAJA 4CFBA 3AA5X 1KVAA 3PO5A 4BROA 1RTDA 2P9KA 1RT6A 2FXUA 4H8KA 4MDAA 2BUPA 4DR6K 4Q0BA 1CZ9A 4O4GA 5M1PA 5E41A 4BE1A 2XY6A 5AR0A 2GX9A 1K73O 3UB5A 3ID6A 4JD2A 2ZM6K 1EO1A 4FOEA 1IO2A 4FSVA 3OS2A 4M45A 4BWJA 4IKFA 3VF2A 5J2PA 1W7AA 2YKNA 5C15A 5I42A 2YX6A 3LWMA 3K57A 1LWEA 5GIPA 1SQKA 3EE8A 4DSKA 4BRGA 4PL7A 1TKDA 4E7HA 1HKCA 1Z05A 4GKKK 3O4NA 5AQJA 4JRPA 3G71N 3AAPA 5KTQA 4B9LA 4O5FA 1T03A 1IV0A 3OYGA 3HYFA 4LF4K 3LPUA 3CCVN 3CERA 1LAWA 4BR5A 5E84A 4CF2A 3R8EA 4CHYA 5HL7L 1GOAA 1BG3A 2FBTA 1NWKA 4B9UA 4OLBA 4H03B 5FDLA 1TYQB 2F8TA 3DLHA 3THYB 1CXUA 4KHNA 3L3VA 3RR7A 4CJVA 3T1YK 3IAYA 2W40A 1TL1A 4BRIA 4Z0UA 4IXCA 1GLJO 1LWCA 4IO8A 4FW1A 4OKJA 4DR3K 3S9HA 3L3UA 4MO5A 3AO3A 2NZTA 3FZLA 3HTVA 3IS9A 4DSIA 1TGOA 4KRFA 3VENA 2WONA 3QINA 1LW2A 2ZE2A 4C1NI 4DTNA 4KBOA 3HJFA 3DLGA 4FJXA 2HBKA 1L3TA 5JVGL 1WSHA 3MX5A 4CGGA 1NKBA 1RT3A 1J6ZA 3LP1A 2R7YA 1NK5A 5KRTA 3ISNC 3L8BA 4H5WA 2P9NA 3OBWA 4YORA 4CJLA 2E6LA 4RW8A 3CC7N 1E4GT 3SUQA 4AILC 3M6GA 2NUBA 3AVIA 1NKCA 2A41A 4DF4A 3BZCA 4CEOA 2PY5A 2QWPA 2PYJA 1VSEA 4WYBA 3H1VX 4LSNA 3ZSOA 3TSPA 1Q82O 3DM2A 1SL1A 3ZX2A 2DTUA 1SL2A 3VERA 4JI2K 2HHHK 3JAMO 5CY4A 1QHTA 4F8RA 1NU0A 5KI6A 4FLWA 3V4IA 1IG9A 1YJNN 2YNHA 4RW4A 5T7BA 2G8WA 1QQOA 1RT4A 4CZHA 4E19A 3QDKA 3ULEA 2WTUA 2HNZA 1WSEA 3PLAA 4NLBA 1WN7A 5HRRA 4CHPA 2D0AA 4CK3A 3K5NA 3AVNA 1VQ5N 4U7BA 1XC3A 1YVUA 5CR4A 2W6LA 3DOLA 5MLCQ 3R3LA 1SV5A 1NJWA 2OYQA 3DXKA 5C42A 4FLYA 4H5RA 4J2BA 1EETA 4ISFA 2HSTA 2QWMA 2V51B 4K43A 3C6UA 2YHBA 3SV4A 1KSPA 4M7XA 4IFEA 2ZF5O 3FZFA 3H08A 4DV2K 4IG3A 4DTOA 3J7AP 3HSTB 4DFPA 1REVA 2B5JA 3U4LA 3VQBA 4FZZA 3V9ZA 4DLEA 1KAXA 1VRTA 1HJRA 3ZSYA 4IOXA 1LCUA 5J2MA 3LM2A 1U47A 1N32K 3ENOA 4IOCL 2CH6A 1QSLA 3SZ2A 1QS4A 2DFEA 2YJEA 3E9OA 5CYMA 4H4MA 3FZHA 4FWQA 3WUHA 2FLOA 3JXUA 3DRSA 1HKGA 1HNWK 3NMUA 2QKBA 1KAZA 4KTQA 5AZIA 3LANA 1H1VA 2HB5A 1JCFA 3TAMA 2JWLA 4EIAA 1X3MA 1RGIA 5CYQA 3TAFA 2YKMA 3J80O 4MO4A 1OH6A 1X9JA 2QTDA 3AVFA 1N6QA 3NBPA 3CG7A 1Q9YA 2CGJA 3QNNA 1W2BM 2HHSA 3DRPA 4FWOA 2P9IA 5M1QA 4DV3K 2HOEA 1EXQA 3H6EA 4ILJA 4CF0A 3CJ9A 2AJQA 3ZETB 3G4SN 3HXMA 3DMJA 1SS6A 3QBXA 3K0SA 3PIOL 3UIQA 2Q1NA 3O08A 1NJXA 4RG8A 3OJSA 2ETJA 3C94A 4H0YB 1BIUA 1JLBA 1HLUA 3DXMA 3LDLA 3ZT0A 3OW2M 3SLCA 1BISA 4FM2A 1NOZA 2E88A 2P9SA 5ADXH 2OCEA 3QIOA 4KV8A 4Z94A 4LH5A 3GDQA 5BN8A 4CEQA 1T44A 4BR0A 3V9XA 4BRPA 3EE9A 3AVLA 3J81O 1RFQA 3ZSWA 4DR2K 5AQQA 2QXFA 1K8KB 3WT0A 4FM0A 4FLVA 4CJUA 2V52B 1QZ6A 1JCGA 2A40A 1HUXA 1HR0K 1IBKK 4OGEA 4OLAA 3NF7A 1BCMA 1NGBA 1WAFA 3VA3A 4EFHA 5KQ8A 3M5RA 3V9WA 1T7PA 4JKHA 1YVNA 4FWRA 3C7NB 4DSFA 4BC4A 1VHXA 3EKSA 2O8BB 3MWTA 3N4PA 3IDHA 2QEXN 2Z1HA 3CFOA 4CZKA 2HW3A 3MEGA 4RCHA 4BR4A 1RDDA 5GAGP 5HRPA 3OYIA 2GUPA 1OH7A 4BRHA 1ITGA 3FLCO 3TI0A 3V9UA 4ID1A 4YOWA 3OYCA 3SPZA 2W41A 4YOUA 4YNQA 4CZFA 4DUYK 3CIPA 4RW7A 5BN9A 3VQCA 2F8SA 2BGGA 3HPGA 1K8AO 4AHSA 1A5WA 4B1WB 4O0IA 4AQYK 4LFAK 4EP5A 3O3FA 3NF8A 3SMPA 3V1RA 3ZX0A 4HTUA 4HWIA 3PIPL 3VQEA 1VQLN 3VGMA 3K2PA 4Q5VA 3J7ZO 3EZ5A 3T1HK 4BWMA 1Y64A 3E9LA 3QLHA 3CQXA 3A8YA 1LW0A 1JXBA 3SQ4A 1TV6A 3L4QA 3U9ZA 2IIRA 2E1ZA 4BG9A 4BRAA 4CF9A 2QKKA 5AQHA 3O4QA 1L5UA 3VEYA 4LD0A 3T7ZA 3UKRA 3KIOA 4C8NA 1OVQA 1VQNN 4ILGB 3OYFA 4FZXC 2O4GA 3SQ0A 4BGBA 5AQYA 2QWLA 1XMQK 2OA8A 1UA0A 3QERA 1S9GA 1OH5A 1YI2N 2RHKA 3CPWM 1RDBA 4M42A 4MLHA 4CEDA 1VRUA 2G8HA 1NMDA 3O1WA 3A5OC 5BPNA 2E2QA 1QQMA 2IVNA 2J4RA 4GV3A 3CCRN 4KTZA 4GMJB 2AA4A 1T05A 1J9AA 4YOVA 4CVNE 4FLTA 2YJFA 3FZKA 2PZSA 3I33A 1X1PA 3TAEA 2V7YA 3CFRA 2BE2A 3ZSZA 4FWKA 3AGRA 3TAPA 4DTRA 4RWTA 4XIUA 5HRSA 2VGNA 3F2KA 2NLXA 4FWNA 4C8LA 3PX4A 1YUWA 4ELUA 3MXJA 3RRGA 3SAHA 2E2PA 3BUZB 3HVTA 3LPTA 4CHNA 5LY3A 2WFBA 4CGIA 1C0TA 1G15A 1LWFA 2NRRA 4FJNA 3IRXA 4KTWA 4N41A 3H3OB 3MXMA 3C6HA 4OPKA 4GVEA 3QEWA 2DFFA 3ULDA 2BH1A 3NH1A 4WFNL 4WFAL 1WNSA 4KH4A 2Q2RA 3ITHA 4O8UA 2XY7A 1ESVA 1SKRA 3ZCMA 3VQ7A 3EO3A 1YITN 3TSUA 1VQON 4L8RB 3VQAA 1ZC6A 5AFUH 3AVBA 4W5TA 4QCLA 2P9PA 4CJ3A 1VSLA 3LL3A 1TAUA 4Y1DA 5DK5A 3MN7A 3KLEA 2RKIA 1K9MO 3CI5A 2P1JA 2KKZA 2ZGZA 3AGKA 4GNIA 3TPQA 5GAEP 3P31A 1VSDA 2X78A 2OPRA 4PA1A 4F2RA 1J5EK 3LDNA
chains in the Genus database with same CATH topology
3WNFA 1JKHA 1TKDA 4E7HA 3SQ2A 4DU1A 4I7FA 3U3GA 2KW4A 4FW2A 4CIFA 3KK2A 3O4NA 3SPYA 4JRPA 4CFCA 2OPSA 1XI1A 2GUIA 5J2QA 5KTQA 4B9LA 2HNYA 1T03A 2G8FA 3OYGA 2Y1IA 3JSMA 1KLNA 4HCCA 1KCFA 1SKWA 3NCIA 1DTTA 1C0UA 1JLCA 1Z26A 3HYFA 4DU3A 2LSNA 2KFZA 1KTQA 1D9FA 3K5OA 4CJQA 3M8SA 3LPUA 1L3VA 3OYMA 1KVCA 1BCOA 2XO7A 1QTMA 1TVRA 1LAWA 1EX4A 3SI6A 1RDAA 3NDKA 1HMVA 4BDZA 4FCYA 4OKKA 2GV9A 2OZSA 3OS0A 4CF2A 2A1RA 3ZSXA 2RN2A 3L2WA 4DTUA 4CHYA 1GOAA 2IOCA 4CERA 3AVMA 2OZMA 1S1WA 1JLEA 2FBTA 3FFIA 2P51A 2KQ2A 4B8AB 4B9UA 4W5OA 3HM9A 4OLBA 1HQEA 4JLHA 5FDLA 5K14A 3OYHA 1DLOA 2F8TA 2RPIA 2RF2A 3I0RA 3DLHA 4CF8A 3V81A 1SUQA 1ASUA 1RBRA 3HT3A 1CXUA 4CJFA 4KHNA 3L3VA 1L3SA 1TKZA 4CJVA 1NJZA 3RR7A 4IBNA 1IKYA 3IAYA 3MEDA 1TL1A 4LH4A 3L2VA 4Z0UA 2HHVA 2IC3A 1LWCA 3OYDA 3LDSA 4KHYA 4FW1A 4OKJA 5FRNA 1FK9A 3ZSQA 1W0HA 3L3UA 3S9HA 3AO3A 2YHAA 4NCGA 1C1BA 1NK4A 1TK5A 1FKOA 3IS9A 4MQ3A 4DSIA 1TGOA 4CJ4A 1IKWA 1S6QA 4KRFA 4HCBA 2WONA 3QINA 1LW2A 2ZE2A 4DTNA 3VQQA 3HJFA 2HHTA 2D0BA 3DLGA 5HBMA 1EP4A 4FJXA 3ZT2A 1L3TA 3S3OA 1WSHA 2PYLA 4CGGA 3LP0A 1RT3A 3LP1A 3K5MA 2R7YA 4BE2A 1XHZA 1C1CA 1NKBA 1U49A 3SQ1A 1NK5A 3OYAA 4OGCA 1FXXA 5KRTA 3ISNC 4FJ9A 1QSSA 3LAMA 1IKXA 3L8BA 3E01A 3OYJA 3K5LA 3DI6A 4DU4A 3V6DA 1RBVA 4N56A 3TAGA 3HP9A 4GVMA 4CJLA 2E6LA 4RW8A 3LAKA 3SUQA 1S9EA 3ZT4A 3RMDA 1WSGA 4AILC 2G8IA 3AO2A 4IFVA 4CJTA 1L3UA 2NUBA 3AVIA 1NKCA 4FK2A 3AVHA 3HL8A 4DF4A 4CEOA 1HYZA 1RBSA 3PX0A 2PY5A 4CGHA 2PYJA 3RRHA 2O4IA 1VSEA 4NYFA 4UQGA 2KFNA 4CFDA 4LSNA 3ZSOA 3DM2A 1SL1A 4CESA 1SKSA 2OPQA 3M8RA 3HO1A 1NK8A 2DTUA 1K6YA 3SNNA 1SL2A 2ATQA 2XY5A 3SUPA 1U4BA 2W42A 1WSJA 4M3TA 5CY4A 1BIZA 4CJPA 5KGWA 1QHTA 4C8OA 1SL0A 5KI6A 4F8RA 4CEAA 2HHXA 4CJSA 3KKRA 4FLWA 1NK7A 5FRMA 1HNVA 3ZSVA 3V4IA 3SUNA 1IG9A 2YNGA 2YNHA 4RW4A 4E7IA 1RTJA 3P1GA 4QOZB 3TR8A 5T7BA 4KREA 2G8WA 4BDPA 1RT4A 5CZ2A 4E19A 2XHBA 2BDPA 4JRQA 3ZT3A 2G8UA 2HNZA 3B6OA 1WSEA 5SWMA 2Z1GA 3V1OA 4F3TA 3OY9A 3MECA 1QQCA 1UWBA 1WN7A 1J53A 4ID5A 5HRRA 4CHPA 3L2UA 2D0AA 4CK3A 3DLEA 4Z4HA 4B08A 3K5NA 4DQSA 4FZYA 1S6PA 3AV9A 3AVNA 4HUEA 3SYZA 4CCHA 1YVUA 1J54A 2A1SA 1RNHA 3RR8A 4FJ5A 3BGRA 4OJRA 2HHWA 3VQ6A 3DOLA 3QNOA 4Z4EA 4GW6A 4NCAA 5HLFA 3AVCA 4NYNA 1NJWA 1SV5A 2JGUA 3JYTA 5C42A 4R5PA 2VWJA 4N47A 4CK1A 4FLYA 2OYQA 4FJLA 4J2BA 1EETA 1ZBUA 2KZZA 4HUGA 1RCHA 4E7KA 4CEBA 5I3UA 3EYZA 3C6UA 4DQRA 2YHBA 1S1VA 3SV4A 4E1NA 1KSPA 4EZ9A 2I5JA 4ZTFA 1C6VA 2G8VA 3H08A 2IDOA 4IG3A 3AA4A 4DTXA 4DTOA 3HSTB 1UAXA 4DFPA 1REVA 4OPJA 2B5JA 3VQBA 2FC0A 4FZZA 1O1WA 3V9ZA 4CECA 4ZHRA 1ZBLA 4CGFA 4DLEA 1KFDA 3D45A 3T3FA 1VRTA 1HJRA 3ZSYA 4DS4A 3QESA 1R0AA 4FJ7A 3PO4A 4KHWA 5J2MA 4CEZA 3S3MA 1U47A 1TK8A 1QSLA 1ZBIA 3SZ2A 1QS4A 2DFEA 1A5XA 2FBYA 3U6FA 3OYLA 1J5OA 1TK0A 1EKEA 1FKPA 4O44A 5CYMA 4E0DA 3CM6A 4H4MA 1NKEA 4KI4A 1C0MA 4DTSA 2Y1JA 3DRSA 1VSHA 2P5GA 2ZQBA 1TAQA 4DSEA 4F4KA 4KKOA 2QKBA 4KTQA 3LWLA 4W5RA 5FROA 2HHQA 3CM5A 1S1UA 3LANA 3T19A 3KLGA 2HB5A 3TAMA 1WAJA 5SZTA 2OPPA 5EU7A 2GBZA 5CYQA 3TAFA 2E6MA 3NE6A 2YKMA 1DTQA 4ICLA 4Z4FA 4PQUA 4KAZA 3AVJA 4FXDA 1Q8IA 2IGIA 3OYNA 3NGIA 1YTUA 3M8QA 2E4LA 3TAQA 3NGZA 1KVBA 4ELVA 4FJHA 4CJKA 1HQUA 4WE1A 3I0SA 5DMRA 4DFJA 4ELTA 3AVFA 4KI6A 3RMAA 1NK9A 4CGJA 3TARA 1NJYA 1N6QA 3NBPA 3T1AA 4NCBA 3TABA 4KB1A 3CG7A 1CXQA 2QK9A 1Q9YA 1ASVA 3D0PA 3QNNA 3ALYA 3KD1E 4FJIA 4EP4A 1D5AA 1RTIA 3DYAA 5C24A 3DRPA 4FYDA 4DFMA 2HHSA 3OVNA 3V1QA 4CIGA 2G8KA 4M3WA 1KLMA 2Z1IA 1EXQA 4AHUA 1B92A 3L2QA 4BACA 1I39A 4W5QA 4CF0A 4Z4IA 4CE9A 1YTAA 1C1AA 2AJQA 1XWLA 3HXMA 5HP1A 3WNEA 3HPHA 3DMJA 3AO5A 1RT1A 3AO4A 4FLZA 4DQPA 3B6PA 3AO1A 1I3AA 3KK3A 3UIQA 1NJXA 4C8KA 4RG8A 3OJSA 2ETJA 3C94A 1TKTA 1BIUA 1JLBA 2JLEA 2XRIA 3ZT0A 1BHLA 1BISA 2YNIA 1NOZA 1B9DA 2Z1JA 3LALA 4FM2A 2X6NA 1D9DA 2Q3SA 3QIOA 4KV8A 4EZ6A 4LH5A 1X9WA 1U04A 4DTPA 2ZD1A 1BL3A 4M3ZA 4RW9A 3PX6A 1RBTA 4CEQA 3THVA 4CGDA 1S1XA 3V9XA 4F2SA 1RT5A 1JLAA 1BQNA 3MXIA 3AVLA 4AHCA 3RMBA 3TANA 1TL3A 4E7JA 4I2QA 3CYMA 3ZSWA 4CJ5A 3VA0A 2QXFA 3QEPA 1JL1A 2XY8A 3SV3A 3RMCA 4FM0A 4FLVA 3QO9A 4CJUA 4B9MA 2FBVA 4LSLA 4FJGA 4KHSA 1WLJA 1WSFA 4N5SA 4F3OA 4OVLA 2D0CA 3NHGA 1VSJA 3SCXA 4OGEA 3C6TA 2YNFA 1BGXT 3NF7A 3AA2A 4DSJA 4OLAA 3QEIA 1BCMA 1B9FA 1BI4B 1WAFA 2BANA 3VA3A 4DQIA 3QEXA 4BDYA 3O3GA 4DG1A 3V9WA 1T7PA 1YT3A 3K59A 4CF1A 1HYVA 4BE0A 3DLKA 3VQ8A 4DSFA 1U45A 1D8YA 2D5RA 4FK4A 3KJVA 1XC9A 1RT2A 2EHGA 3QETA 3ASMA 1HRHA 4C8MA 5JS2A 2Z1HA 1VK0A 4Y1CA 3CFOA 4KPYA 4CIEA 3S3NA 3AVAA 2HW3A 3MEGA 4MFBA 4PY5A 1RDDA 3AA3A 5HRPA 3OYIA 4AH9A 3OYBA 3HPOA 4FJ8A 4Z4CA 4OKEA 5KGXA 1X9SA 1ITGA 3M8PA 3KD5E 1CZBA 1ZYQA 3TI0A 3V9UA 4ID1A 3SPZA 3OYCA 4I9LA 4IFYA 3VQPA 1WSIA 4B8CA 1N5YA 4M3XA 3RWUA 4YNQA 1W9HA 4QAGA 2ITGA 4RW7A 3VQCA 3L2RA 3TWHA 2F8SA 1XHXA 2BGGA 3HPGA 1Z25A 3G10A 3AVGA 1GOCA 1A5WA 4AHSA 4O0IA 4IG0A 3KK1A 3LZJA 1NK0A 3BDPA 4CJRA 3OYEA 4EP5A 3O3FA 4DS5A 2F96A 3NF8A 3QEVA 4DF8A 4FM1A 4DFKA 3V1RA 4O55A 2HNDA 5D3GA 4W5NA 4HTUA 4E1MA 3VQEA 3CQ8A 2IS3A 2HMIA 3K2PA 4Q5VA 2HVIA 3NGYA 3EZ5A 3HK2A 4JS5A 2VWKA 4BWMA 3G0ZA 4J2AA 3QLHA 5CZ1A 4DLGA 3SQ4A 1LW0A 1JXBA 4CHOA 1TV6A 4LY7A 1JLFA 1RTHA 4HHTA 5J2NA 3PUFA 2X6SA 2KZMA 3LP2A 4KO0A 4CF9A 2QKKA 3VQ9A 3O4QA 1L5UA 1JLQA 3NAEA 4K8XA 4M3RA 5HRNA 4PWDA 4LD0A 1F21A 1ASWA 3KLIA 3KIOA 4C8NA 4Z4GA 1TKXA 3HP6A 1U48A 1BI4A 3OYFA 3PY8A 3P5JA 5J1EA 4FZXC 2O4GA 3SQ0A 4K8ZA 2B4JA 4E3SA 4J2EA 3K58A 4DTJA 1KRPA 4CEFA 4M3YA 4DMNA 1VSFA 4HUFA 2EX3A 3IG1A 1ZBHA 1X9MA 2OA8A 1UA0A 1ZBFA 4CHZA 3QERA 3PV8A 4B9NA 3LZIA 1S9GA 4N76A 2DFHA 1JXEA 4CFAA 2HHUA 4B9SA 1GOBA 4DQQA 4M41A 1RDCA 4JS4A 1S1TA 3EY1A 1RDBA 3DOKA 4CHQA 4M42A 4CEDA 2HVHA 1VRUA 3U3YA 2G8HA 1S5JA 1QSYA 4E89A 3A2FA 4AHVA 2WOMA 3KLFA 1Y97A 4FK0A 1UA1A 1HPZA 1HNIA 1UOCA 2P5OA 3OJUA 3WNGA 2YV0X 1VSIA 5JS1A 4KTZA 4KB0A 4B9VA 4GMJB 2KTQA 1BQMA 3DLRA 1T05A 1MU2A 1J9AA 1KFSA 3HVRA 4PUOA 3OYKA 1NK6A 2X74A 3VQ4A 4B9TA 4FJKA 3MEEA 3KLHA 4FLTA 3V9SA 4KFBA 3F73A 2PZSA 3KKSA 1X1PA 4FLXA 3TAEA 1LV5A 3WNHA 4FJJA 4DTMA 3CFRA 2BE2A 3ZSZA 3LP3A 4G1QA 3O3HA 3DLBA 1CLQA 4I9QA 3QIPA 1RBUA 3ZSRA 4FJMA 3TAPA 4CJWA 2FBXA 4DTRA 4TSXA 4XIUA 3F9KA 4FVMA 5HRSA 3KTQA 4DWIA 4J2DA 4AHTA 4E7LA 3RTVA 3PX4A 4C8LA 4ELUA 4O5BA 5HROA 1HYSA 4IDKA 4RW6A 1QE1A 3MXJA 3NH2A 4CJEA 3RRGA 3HVTA 3LPTA 3DRRA 1T8EA 4CHNA 4YFUA 4M3UA 3MAQA 4HVJA 4CGIA 4DSLA 1C0TA 1G15A 1LWFA 1RILA 2IAJA 3CFPA 4FJNA 4CFBA 3IRXA 4AHRA 4KTWA 3AA5X 1KVAA 3PO5A 4N41A 4FLUA 3MXMA 3VQ5A 4CK2A 1RTDA 4KHQA 4OPKA 1VSKA 1JL2A 1RT6A 3QEWA 2DFFA 3I8DA 4H8KA 3ULDA 1IKVA 3NH1A 4Q0BA 1CZ9A 4O4GA 1WNSA 5E41A 4BE1A 2XY6A 3NF9A 1RT7A 3ITHA 3NF6A 2XY7A 1NOYA 1VSMA 3AVKA 2VG6A 4KHUA 3P83D 1SKRA 1A5VA 2VG5A 3ZCMA 4B3OA 3C95A 3VQ7A 1JLGA 4CEEA 4I2PA 3OS1A 1IO2A 3VN5A 4L8RB 2DY4A 3VQAA 3OS2A 4M45A 3VQDA 3AVBA 1IH7A 4BWJA 3NFAA 4IKFA 4W5TA 4QCLA 4O0JA 5C25A 5J2PA 2YKNA 4CJ3A 4ZTJA 5KRSA 1VSLA 3SJJA 1TAUA 2VG7A 4Y1DA 5DK5A 5I42A 3NH0A 1Q9XA 3KLEA 2RKIA 2P1JA 2B6AA 3LWMA 4H4OA 3K57A 1LAVA 1VSDA 1LWEA 2X78A 2OPRA 4PA1A 4F2RA 4DSKA 3ZT1A 3SUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNF A;  1JKH A;  1TKD A;  4E7H A;  3SQ2 A;  4DU1 A;  4I7F A;  3U3G A;  2KW4 A;  4FW2 A;  4CIF A;  3KK2 A;  3O4N A;  3SPY A;  4JRP A;  4CFC A;  2OPS A;  1XI1 A;  2GUI A;  5J2Q A;  5KTQ A;  4B9L A;  2HNY A;  1T03 A;  2G8F A;  3OYG A;  2Y1I A;  3JSM A;  1KLN A;  4HCC A;  1KCF A;  1SKW A;  3NCI A;  1DTT A;  1C0U A;  1JLC A;  1Z26 A;  3HYF A;  4DU3 A;  2LSN A;  2KFZ A;  1KTQ A;  1D9F A;  3K5O A;  4CJQ A;  3M8S A;  3LPU A;  1L3V A;  3OYM A;  1KVC A;  1BCO A;  2XO7 A;  1QTM A;  1TVR A;  1LAW A;  1EX4 A;  3SI6 A;  1RDA A;  3NDK A;  1HMV A;  4BDZ A;  4FCY A;  4OKK A;  2GV9 A;  2OZS A;  3OS0 A;  4CF2 A;  2A1R A;  3ZSX A;  2RN2 A;  3L2W A;  4DTU A;  4CHY A;  1GOA A;  2IOC A;  4CER A;  3AVM A;  2OZM A;  1S1W A;  1JLE A;  2FBT A;  3FFI A;  2P51 A;  2KQ2 A;  4B8A B;  4B9U A;  4W5O A;  3HM9 A;  4OLB A;  1HQE A;  4JLH A;  5FDL A;  5K14 A;  3OYH A;  1DLO A;  2F8T A;  2RPI A;  2RF2 A;  3I0R A;  3DLH A;  4CF8 A;  3V81 A;  1SUQ A;  1ASU A;  1RBR A;  3HT3 A;  1CXU A;  4CJF A;  4KHN A;  3L3V A;  1L3S A;  1TKZ A;  4CJV A;  1NJZ A;  3RR7 A;  4IBN A;  1IKY A;  3IAY A;  3MED A;  1TL1 A;  4LH4 A;  3L2V A;  4Z0U A;  2HHV A;  2IC3 A;  1LWC A;  3OYD A;  3LDS A;  4KHY A;  4FW1 A;  4OKJ A;  5FRN A;  1FK9 A;  3ZSQ A;  1W0H A;  3L3U A;  3S9H A;  3AO3 A;  2YHA A;  4NCG A;  1C1B A;  1NK4 A;  1TK5 A;  1FKO A;  3IS9 A;  4MQ3 A;  4DSI A;  1TGO A;  4CJ4 A;  1IKW A;  1S6Q A;  4KRF A;  4HCB A;  2WON A;  3QIN A;  1LW2 A;  2ZE2 A;  4DTN A;  3VQQ A;  3HJF A;  2HHT A;  2D0B A;  3DLG A;  5HBM A;  1EP4 A;  4FJX A;  3ZT2 A;  1L3T A;  3S3O A;  1WSH A;  2PYL A;  4CGG A;  3LP0 A;  1RT3 A;  3LP1 A;  3K5M A;  2R7Y A;  4BE2 A;  1XHZ A;  1C1C A;  1NKB A;  1U49 A;  3SQ1 A;  1NK5 A;  3OYA A;  4OGC A;  1FXX A;  5KRT A;  3ISN C;  4FJ9 A;  1QSS A;  3LAM A;  1IKX A;  3L8B A;  3E01 A;  3OYJ A;  3K5L A;  3DI6 A;  4DU4 A;  3V6D A;  1RBV A;  4N56 A;  3TAG A;  3HP9 A;  4GVM A;  4CJL A;  2E6L A;  4RW8 A;  3LAK A;  3SUQ A;  1S9E A;  3ZT4 A;  3RMD A;  1WSG A;  4AIL C;  2G8I A;  3AO2 A;  4IFV A;  4CJT A;  1L3U A;  2NUB A;  3AVI A;  1NKC A;  4FK2 A;  3AVH A;  3HL8 A;  4DF4 A;  4CEO A;  1HYZ A;  1RBS A;  3PX0 A;  2PY5 A;  4CGH A;  2PYJ A;  3RRH A;  2O4I A;  1VSE A;  4NYF A;  4UQG A;  2KFN A;  4CFD A;  4LSN A;  3ZSO A;  3DM2 A;  1SL1 A;  4CES A;  1SKS A;  2OPQ A;  3M8R A;  3HO1 A;  1NK8 A;  2DTU A;  1K6Y A;  3SNN A;  1SL2 A;  2ATQ A;  2XY5 A;  3SUP A;  1U4B A;  2W42 A;  1WSJ A;  4M3T A;  5CY4 A;  1BIZ A;  4CJP A;  5KGW A;  1QHT A;  4C8O A;  1SL0 A;  5KI6 A;  4F8R A;  4CEA A;  2HHX A;  4CJS A;  3KKR A;  4FLW A;  1NK7 A;  5FRM A;  1HNV A;  3ZSV A;  3V4I A;  3SUN A;  1IG9 A;  2YNG A;  2YNH A;  4RW4 A;  4E7I A;  1RTJ A;  3P1G A;  4QOZ B;  3TR8 A;  5T7B A;  4KRE A;  2G8W A;  4BDP A;  1RT4 A;  5CZ2 A;  4E19 A;  2XHB A;  2BDP A;  4JRQ A;  3ZT3 A;  2G8U A;  2HNZ A;  3B6O A;  1WSE A;  5SWM A;  2Z1G A;  3V1O A;  4F3T A;  3OY9 A;  3MEC A;  1QQC A;  1UWB A;  1WN7 A;  1J53 A;  4ID5 A;  5HRR A;  4CHP A;  3L2U A;  2D0A A;  4CK3 A;  3DLE A;  4Z4H A;  4B08 A;  3K5N A;  4DQS A;  4FZY A;  1S6P A;  3AV9 A;  3AVN A;  4HUE A;  3SYZ A;  4CCH A;  1YVU A;  1J54 A;  2A1S A;  1RNH A;  3RR8 A;  4FJ5 A;  3BGR A;  4OJR A;  2HHW A;  3VQ6 A;  3DOL A;  3QNO A;  4Z4E A;  4GW6 A;  4NCA A;  5HLF A;  3AVC A;  4NYN A;  1NJW A;  1SV5 A;  2JGU A;  3JYT A;  5C42 A;  4R5P A;  2VWJ A;  4N47 A;  4CK1 A;  4FLY A;  2OYQ A;  4FJL A;  4J2B A;  1EET A;  1ZBU A;  2KZZ A;  4HUG A;  1RCH A;  4E7K A;  4CEB A;  5I3U A;  3EYZ A;  3C6U A;  4DQR A;  2YHB A;  1S1V A;  3SV4 A;  4E1N A;  1KSP A;  4EZ9 A;  2I5J A;  4ZTF A;  1C6V A;  2G8V A;  3H08 A;  2IDO A;  4IG3 A;  3AA4 A;  4DTX A;  4DTO A;  3HST B;  1UAX A;  4DFP A;  1REV A;  4OPJ A;  2B5J A;  3VQB A;  2FC0 A;  4FZZ A;  1O1W A;  3V9Z A;  4CEC A;  4ZHR A;  1ZBL A;  4CGF A;  4DLE A;  1KFD A;  3D45 A;  3T3F A;  1VRT A;  1HJR A;  3ZSY A;  4DS4 A;  3QES A;  1R0A A;  4FJ7 A;  3PO4 A;  4KHW A;  5J2M A;  4CEZ A;  3S3M A;  1U47 A;  1TK8 A;  1QSL A;  1ZBI A;  3SZ2 A;  1QS4 A;  2DFE A;  1A5X A;  2FBY A;  3U6F A;  3OYL A;  1J5O A;  1TK0 A;  1EKE A;  1FKP A;  4O44 A;  5CYM A;  4E0D A;  3CM6 A;  4H4M A;  1NKE A;  4KI4 A;  1C0M A;  4DTS A;  2Y1J A;  3DRS A;  1VSH A;  2P5G A;  2ZQB A;  1TAQ A;  4DSE A;  4F4K A;  4KKO A;  2QKB A;  4KTQ A;  3LWL A;  4W5R A;  5FRO A;  2HHQ A;  3CM5 A;  1S1U A;  3LAN A;  3T19 A;  3KLG A;  2HB5 A;  3TAM A;  1WAJ A;  5SZT A;  2OPP A;  5EU7 A;  2GBZ A;  5CYQ A;  3TAF A;  2E6M A;  3NE6 A;  2YKM A;  1DTQ A;  4ICL A;  4Z4F A;  4PQU A;  4KAZ A;  3AVJ A;  4FXD A;  1Q8I A;  2IGI A;  3OYN A;  3NGI A;  1YTU A;  3M8Q A;  2E4L A;  3TAQ A;  3NGZ A;  1KVB A;  4ELV A;  4FJH A;  4CJK A;  1HQU A;  4WE1 A;  3I0S A;  5DMR A;  4DFJ A;  4ELT A;  3AVF A;  4KI6 A;  3RMA A;  1NK9 A;  4CGJ A;  3TAR A;  1NJY A;  1N6Q A;  3NBP A;  3T1A A;  4NCB A;  3TAB A;  4KB1 A;  3CG7 A;  1CXQ A;  2QK9 A;  1Q9Y A;  1ASV A;  3D0P A;  3QNN A;  3ALY A;  3KD1 E;  4FJI A;  4EP4 A;  1D5A A;  1RTI A;  3DYA A;  5C24 A;  3DRP A;  4FYD A;  4DFM A;  2HHS A;  3OVN A;  3V1Q A;  4CIG A;  2G8K A;  4M3W A;  1KLM A;  2Z1I A;  1EXQ A;  4AHU A;  1B92 A;  3L2Q A;  4BAC A;  1I39 A;  4W5Q A;  4CF0 A;  4Z4I A;  4CE9 A;  1YTA A;  1C1A A;  2AJQ A;  1XWL A;  3HXM A;  5HP1 A;  3WNE A;  3HPH A;  3DMJ A;  3AO5 A;  1RT1 A;  3AO4 A;  4FLZ A;  4DQP A;  3B6P A;  3AO1 A;  1I3A A;  3KK3 A;  3UIQ A;  1NJX A;  4C8K A;  4RG8 A;  3OJS A;  2ETJ A;  3C94 A;  1TKT A;  1BIU A;  1JLB A;  2JLE A;  2XRI A;  3ZT0 A;  1BHL A;  1BIS A;  2YNI A;  1NOZ A;  1B9D A;  2Z1J A;  3LAL A;  4FM2 A;  2X6N A;  1D9D A;  2Q3S A;  3QIO A;  4KV8 A;  4EZ6 A;  4LH5 A;  1X9W A;  1U04 A;  4DTP A;  2ZD1 A;  1BL3 A;  4M3Z A;  4RW9 A;  3PX6 A;  1RBT A;  4CEQ A;  3THV A;  4CGD A;  1S1X A;  3V9X A;  4F2S A;  1RT5 A;  1JLA A;  1BQN A;  3MXI A;  3AVL A;  4AHC A;  3RMB A;  3TAN A;  1TL3 A;  4E7J A;  4I2Q A;  3CYM A;  3ZSW A;  4CJ5 A;  3VA0 A;  2QXF A;  3QEP A;  1JL1 A;  2XY8 A;  3SV3 A;  3RMC A;  4FM0 A;  4FLV A;  3QO9 A;  4CJU A;  4B9M A;  2FBV A;  4LSL A;  4FJG A;  4KHS A;  1WLJ A;  1WSF A;  4N5S A;  4F3O A;  4OVL A;  2D0C A;  3NHG A;  1VSJ A;  3SCX A;  4OGE A;  3C6T A;  2YNF A;  1BGX T;  3NF7 A;  3AA2 A;  4DSJ A;  4OLA A;  3QEI A;  1BCM A;  1B9F A;  1BI4 B;  1WAF A;  2BAN A;  3VA3 A;  4DQI A;  3QEX A;  4BDY A;  3O3G A;  4DG1 A;  3V9W A;  1T7P A;  1YT3 A;  3K59 A;  4CF1 A;  1HYV A;  4BE0 A;  3DLK A;  3VQ8 A;  4DSF A;  1U45 A;  1D8Y A;  2D5R A;  4FK4 A;  3KJV A;  1XC9 A;  1RT2 A;  2EHG A;  3QET A;  3ASM A;  1HRH A;  4C8M A;  5JS2 A;  2Z1H A;  1VK0 A;  4Y1C A;  3CFO A;  4KPY A;  4CIE A;  3S3N A;  3AVA A;  2HW3 A;  3MEG A;  4MFB A;  4PY5 A;  1RDD A;  3AA3 A;  5HRP A;  3OYI A;  4AH9 A;  3OYB A;  3HPO A;  4FJ8 A;  4Z4C A;  4OKE A;  5KGX A;  1X9S A;  1ITG A;  3M8P A;  3KD5 E;  1CZB A;  1ZYQ A;  3TI0 A;  3V9U A;  4ID1 A;  3SPZ A;  3OYC A;  4I9L A;  4IFY A;  3VQP A;  1WSI A;  4B8C A;  1N5Y A;  4M3X A;  3RWU A;  4YNQ A;  1W9H A;  4QAG A;  2ITG A;  4RW7 A;  3VQC A;  3L2R A;  3TWH A;  2F8S A;  1XHX A;  2BGG A;  3HPG A;  1Z25 A;  3G10 A;  3AVG A;  1GOC A;  1A5W A;  4AHS A;  4O0I A;  4IG0 A;  3KK1 A;  3LZJ A;  1NK0 A;  3BDP A;  4CJR A;  3OYE A;  4EP5 A;  3O3F A;  4DS5 A;  2F96 A;  3NF8 A;  3QEV A;  4DF8 A;  4FM1 A;  4DFK A;  3V1R A;  4O55 A;  2HND A;  5D3G A;  4W5N A;  4HTU A;  4E1M A;  3VQE A;  3CQ8 A;  2IS3 A;  2HMI A;  3K2P A;  4Q5V A;  2HVI A;  3NGY A;  3EZ5 A;  3HK2 A;  4JS5 A;  2VWK A;  4BWM A;  3G0Z A;  4J2A A;  3QLH A;  5CZ1 A;  4DLG A;  3SQ4 A;  1LW0 A;  1JXB A;  4CHO A;  1TV6 A;  4LY7 A;  1JLF A;  1RTH A;  4HHT A;  5J2N A;  3PUF A;  2X6S A;  2KZM A;  3LP2 A;  4KO0 A;  4CF9 A;  2QKK A;  3VQ9 A;  3O4Q A;  1L5U A;  1JLQ A;  3NAE A;  4K8X A;  4M3R A;  5HRN A;  4PWD A;  4LD0 A;  1F21 A;  1ASW A;  3KLI A;  3KIO A;  4C8N A;  4Z4G A;  1TKX A;  3HP6 A;  1U48 A;  1BI4 A;  3OYF A;  3PY8 A;  3P5J A;  5J1E A;  4FZX C;  2O4G A;  3SQ0 A;  4K8Z A;  2B4J A;  4E3S A;  4J2E A;  3K58 A;  4DTJ A;  1KRP A;  4CEF A;  4M3Y A;  4DMN A;  1VSF A;  4HUF A;  2EX3 A;  3IG1 A;  1ZBH A;  1X9M A;  2OA8 A;  1UA0 A;  1ZBF A;  4CHZ A;  3QER A;  3PV8 A;  4B9N A;  3LZI A;  1S9G A;  4N76 A;  2DFH A;  1JXE A;  4CFA A;  2HHU A;  4B9S A;  1GOB A;  4DQQ A;  4M41 A;  1RDC A;  4JS4 A;  1S1T A;  3EY1 A;  1RDB A;  3DOK A;  4CHQ A;  4M42 A;  4CED A;  2HVH A;  1VRU A;  3U3Y A;  2G8H A;  1S5J A;  1QSY A;  4E89 A;  3A2F A;  4AHV A;  2WOM A;  3KLF A;  1Y97 A;  4FK0 A;  1UA1 A;  1HPZ A;  1HNI A;  1UOC A;  2P5O A;  3OJU A;  3WNG A;  2YV0 X;  1VSI A;  5JS1 A;  4KTZ A;  4KB0 A;  4B9V A;  4GMJ B;  2KTQ A;  1BQM A;  3DLR A;  1T05 A;  1MU2 A;  1J9A A;  1KFS A;  3HVR A;  4PUO A;  3OYK A;  1NK6 A;  2X74 A;  3VQ4 A;  4B9T A;  4FJK A;  3MEE A;  3KLH A;  4FLT A;  3V9S A;  4KFB A;  3F73 A;  2PZS A;  3KKS A;  1X1P A;  4FLX A;  3TAE A;  1LV5 A;  3WNH A;  4FJJ A;  4DTM A;  3CFR A;  2BE2 A;  3ZSZ A;  3LP3 A;  4G1Q A;  3O3H A;  3DLB A;  1CLQ A;  4I9Q A;  3QIP A;  1RBU A;  3ZSR A;  4FJM A;  3TAP A;  4CJW A;  2FBX A;  4DTR A;  4TSX A;  4XIU A;  3F9K A;  4FVM A;  5HRS A;  3KTQ A;  4DWI A;  4J2D A;  4AHT A;  4E7L A;  3RTV A;  3PX4 A;  4C8L A;  4ELU A;  4O5B A;  5HRO A;  1HYS A;  4IDK A;  4RW6 A;  1QE1 A;  3MXJ A;  3NH2 A;  4CJE A;  3RRG A;  3HVT A;  3LPT A;  3DRR A;  1T8E A;  4CHN A;  4YFU A;  4M3U A;  3MAQ A;  4HVJ A;  4CGI A;  4DSL A;  1C0T A;  1G15 A;  1LWF A;  1RIL A;  2IAJ A;  3CFP A;  4FJN A;  4CFB A;  3IRX A;  4AHR A;  4KTW A;  3AA5 X;  1KVA A;  3PO5 A;  4N41 A;  4FLU A;  3MXM A;  3VQ5 A;  4CK2 A;  1RTD A;  4KHQ A;  4OPK A;  1VSK A;  1JL2 A;  1RT6 A;  3QEW A;  2DFF A;  3I8D A;  4H8K A;  3ULD A;  1IKV A;  3NH1 A;  4Q0B A;  1CZ9 A;  4O4G A;  1WNS A;  5E41 A;  4BE1 A;  2XY6 A;  3NF9 A;  1RT7 A;  3ITH A;  3NF6 A;  2XY7 A;  1NOY A;  1VSM A;  3AVK A;  2VG6 A;  4KHU A;  3P83 D;  1SKR A;  1A5V A;  2VG5 A;  3ZCM A;  4B3O A;  3C95 A;  3VQ7 A;  1JLG A;  4CEE A;  4I2P A;  3OS1 A;  1IO2 A;  3VN5 A;  4L8R B;  2DY4 A;  3VQA A;  3OS2 A;  4M45 A;  3VQD A;  3AVB A;  1IH7 A;  4BWJ A;  3NFA A;  4IKF A;  4W5T A;  4QCL A;  4O0J A;  5C25 A;  5J2P A;  2YKN A;  4CJ3 A;  4ZTJ A;  5KRS A;  1VSL A;  3SJJ A;  1TAU A;  2VG7 A;  4Y1D A;  5DK5 A;  5I42 A;  3NH0 A;  1Q9X A;  3KLE A;  2RKI A;  2P1J A;  2B6A A;  3LWM A;  4H4O A;  3K57 A;  1LAV A;  1VSD A;  1LWE A;  2X78 A;  2OPR A;  4PA1 A;  4F2R A;  4DSK A;  3ZT1 A;  3SUO A; 
#chains in the Genus database with same CATH topology
 3VES A;  4QS7 A;  4E1J A;  4BRK A;  4DU1 A;  2KW4 A;  4CIF A;  3KK2 A;  4NLC A;  1VQP N;  3VPZ A;  2GUI A;  2ZJQ L;  2HNY A;  2G8F A;  2Y1I A;  1VAZ A;  3JSM A;  1KLN A;  4HCC A;  4IZ9 A;  4BR9 A;  2LSN A;  2NNW A;  2KFZ A;  1DGK N;  3M8S A;  1QTM A;  1TVR A;  1QVG M;  3Q7B A;  4BDZ A;  2OZS A;  1MWK A;  2QI2 A;  3OS0 A;  2A1R A;  3ZSX A;  2RN2 A;  1NG9 A;  3MN5 A;  2IOC A;  4CER A;  3AVM A;  2P51 A;  1NGI A;  4B8A B;  4WF9 L;  4JV5 K;  3OYH A;  2RF2 A;  4CF8 A;  1RBR A;  4CJF A;  1X3N A;  1TKZ A;  4IBN A;  1IKY A;  5BRD A;  1VQ6 N;  4LH4 A;  1NGH A;  2UUA K;  2Q36 A;  4LF6 K;  4YDU C;  3IUC A;  1NK4 A;  2A5X A;  1FKO A;  4BRE A;  4MQ3 A;  1M90 O;  4YHH K;  1IKW A;  1S6Q A;  4B1U B;  1YAG A;  3NVM A;  4PKI A;  2ZJR L;  1RDU A;  4HCB A;  5ADX A;  4JK8 A;  1E3M A;  4JKD A;  4BE2 A;  4JK9 A;  3SQ1 A;  4FJ9 A;  5LMU K;  2F9T A;  3OYJ A;  4IJN A;  1M1K O;  1VQ7 N;  3V6D A;  1RBV A;  3TAG A;  2FSN A;  4CZE A;  3LAK A;  3VET A;  5B8H A;  4CJT A;  4FK2 A;  1TUU A;  3HL8 A;  4DV7 K;  3KWI A;  1HYZ A;  4BRN A;  3CPE A;  2IVO A;  5EVZ A;  5GAD P;  3EN9 A;  2QWQ A;  4UQG A;  2UXC K;  4CES A;  1MDU B;  1K6Y A;  1DKG D;  3SNN A;  1U4B A;  3TTC A;  4M3T A;  1BIZ A;  4CJP A;  1TYQ A;  5KGW A;  3VEX A;  3CCS N;  3MCA B;  2HHX A;  3KKR A;  3THY A;  4A57 A;  1G99 A;  4CBW A;  3TR8 A;  2XHB A;  4JRQ A;  4K42 A;  2Z1G A;  3V1O A;  1QQC A;  1J53 A;  4ID5 A;  4DQS A;  4HUE A;  4CBX A;  2NRW A;  1NLV A;  4WQ4 C;  3RR8 A;  1RNH A;  3AAR A;  3FR0 A;  4GW6 A;  1IG8 A;  4WQ5 C;  4R5P A;  2VWJ A;  4CK1 A;  4HUG A;  3EYZ A;  4DQR A;  1DT9 A;  1S1V A;  3HBT A;  4A2B A;  2IDO A;  3KVG A;  1N8R O;  1O1W A;  3ID8 A;  4B3T K;  1T6C A;  4FJ7 A;  4JKB A;  3U8X A;  3GBT A;  3HSC A;  2FBY A;  3CMA N;  3OYL A;  1TK0 A;  2A42 A;  4DTS A;  2P5G A;  4JI0 K;  2ASO A;  2ZQB A;  4DSE A;  4J8F A;  4KKO A;  2O8C B;  2HHQ A;  4B9Q A;  4NB4 A;  2GBZ A;  2E6M A;  3NE6 A;  4Z4F A;  1DTQ A;  4PQU A;  4KAZ A;  1Q86 O;  1Q8I A;  3OYN A;  4FWS A;  3TAQ A;  3H1Q A;  1YHQ N;  3A5M C;  2BTF A;  1ZXO A;  3WXL A;  4ELV A;  4FJH A;  1HQU A;  3I0S A;  5DMR A;  3K9K A;  4KI6 A;  3CCE N;  2O8F B;  2QK9 A;  4B3M K;  3D0P A;  2D0O A;  3EL2 A;  5BR9 A;  4EP4 A;  1D5A A;  1RTI A;  4YOY A;  3SJH A;  4WFB L;  3WXI A;  2UUC K;  4FYD A;  1NGG A;  3OVN A;  3WXJ A;  2G8K A;  4M3W A;  4AHU A;  2Z1I A;  1B92 A;  5FPN A;  3L2Q A;  3SBT A;  4Z4I A;  4Y0W A;  1XUP O;  2Q31 A;  3O6W A;  2EWS A;  3RVC A;  3HPH A;  3MN9 A;  2FF3 B;  3B6P A;  3AO1 A;  4GKJ K;  3F9M A;  5M1K A;  2JLE A;  1NGA A;  2XRI A;  1W97 L;  1B9D A;  2X6N A;  4JKC A;  2Q3S A;  2NRT A;  5AQT A;  1U04 A;  4CZM A;  2ZD1 A;  4M3Z A;  3PX6 A;  4OPH A;  4BR7 A;  2NRX A;  3GE1 A;  1RT5 A;  1JLA A;  1BQN A;  3MXI A;  3E9P A;  4A5A A;  3TAN A;  5AFU A;  4I2Q A;  3VA0 A;  3L6Q A;  3QFU A;  3CME N;  1JL1 A;  5FPM A;  3RSE B;  3SV3 A;  4KHS A;  4B9M A;  1WSF A;  4F3O A;  2UYT A;  5BRE A;  3C6T A;  2YNF A;  1BGX T;  4OX9 K;  2VQE K;  4GY2 B;  3QEI A;  1BI4 B;  5LMN K;  4DV5 K;  3ZEU B;  4DQI A;  5TKY A;  5AQR A;  2E2N A;  3HI0 A;  1NNE A;  4BE0 A;  1U45 A;  3DLK A;  5AQG A;  1NMN A;  1HJO A;  3KJV A;  1XC9 A;  4FPB A;  1RT2 A;  2EHG A;  3ASM A;  4CW7 B;  1VK0 A;  3ZET A;  4KPY A;  4JKF A;  4MFB A;  3L0Q A;  4KH5 A;  4MLE A;  3AA3 A;  3CC4 N;  1X9S A;  1ZYQ A;  4IWV A;  3KHY A;  4I9L A;  4B8C A;  1WSI A;  1Q18 A;  4CD1 A;  3L2R A;  3W3D A;  3O5B A;  3BF1 A;  3KK1 A;  1GOC A;  3BDP A;  3LZJ A;  2F96 A;  3I56 N;  3QEV A;  3HOT A;  4R79 A;  2HND A;  5F2R A;  4QS9 A;  3NGY A;  5KPT A;  2VWK A;  2I7N A;  5CZ1 A;  4JEP A;  1NGD A;  4LY7 A;  3PUF A;  2X6S A;  4BRD A;  5AQL A;  3VQ9 A;  3C0B A;  2HMP A;  5AQZ A;  3NAE A;  3QB0 A;  3KLI A;  2CGL A;  1TKX A;  4K8Z A;  3P5J A;  5J1E A;  3TTD A;  4E3S A;  4J2E A;  2W6K A;  4CEF A;  3T69 A;  1P8Z A;  4DMN A;  1VSF A;  2YHY A;  4DQ8 A;  3IG1 A;  3C7N A;  4JI3 K;  1ZBH A;  4CHZ A;  3PV8 A;  3J7Y P;  2O8B A;  4N76 A;  1JXE A;  2HHU A;  4DQQ A;  1RDC A;  4JKE A;  1S1T A;  3EY1 A;  4CHQ A;  4DHY A;  3QML A;  4AHV A;  3KLF A;  1Y97 A;  3UE5 A;  4FK0 A;  4BY9 C;  1UA1 A;  1HNI A;  3OJU A;  4LF8 K;  3WNG A;  1VSI A;  5JS1 A;  4B9V A;  4B1Z A;  4LF9 K;  2KTQ A;  1KFS A;  3OYK A;  1SAZ A;  4BVP A;  4FJK A;  3MEE A;  3KLH A;  4KFB A;  3F73 A;  2E2O A;  1YXQ A;  3KKS A;  1JJ2 M;  3S41 A;  3ZYY X;  4H0X B;  3O1B A;  4DV0 K;  5TKW A;  5KQD A;  3ZSR A;  1RBU A;  3D7E O;  4J2D A;  5M1F A;  4E7L A;  3RTV A;  2QWR A;  5AQM A;  3NH2 A;  1QE1 A;  3OTO K;  4YOT A;  1T8E A;  4M3U A;  2Q0R A;  4HVJ A;  4DSL A;  1RIL A;  4AHR A;  4FLU A;  4IDH A;  3VQ5 A;  4KHQ A;  1JL2 A;  5JLF A;  4CZL A;  3I8D A;  4I6M B;  3CJ7 A;  1IKV A;  3CJC A;  4BRQ A;  4CJ7 A;  3O4W A;  1NOY A;  3P83 D;  1A5V A;  2VG5 A;  1DEJ A;  2OAN A;  4B3O A;  1JLG A;  4JHD B;  4CEE A;  3M3Z A;  4I2P A;  2WC9 A;  4HTL A;  3VN5 A;  3VQD A;  4NO7 A;  1IH7 A;  3NFA A;  4O0J A;  5C25 A;  4ZTJ A;  5EY4 A;  5KRS A;  2VG7 A;  5EX5 A;  3MX2 A;  4V19 S;  2B6A A;  4A62 A;  4YY3 K;  1LAV A;  5AQX A;  4F9O A;  3BF3 A;  2NRH A;  4WQ4 A;  1S22 A;  3WNF A;  3SQ2 A;  3FFK B;  4K25 A;  4FW2 A;  2VYP A;  4GV9 A;  2OPS A;  2VGM A;  4WQ5 A;  1V4S A;  1WUA A;  4BQZ A;  1KCF A;  1SKW A;  2QW9 A;  4AM7 A;  1DTT A;  1JLC A;  1Z26 A;  4DU3 A;  1MA9 B;  1KTQ A;  5AQW A;  3FE1 A;  3K5O A;  1L3V A;  2H3G X;  1D4X A;  2ZJP L;  3OYM A;  1KVC A;  2XO7 A;  1EX4 A;  3SI6 A;  1RDA A;  3KK7 A;  4MDB A;  4OKK A;  3BY5 A;  3L2W A;  4JI1 K;  1JLE A;  3FFI A;  4W5O A;  2UUB K;  1HQE A;  4JLH A;  2GEM A;  1DLO A;  2RPI A;  3V81 A;  1ASU A;  1KAY A;  1NM1 A;  1NGF A;  3O9S A;  3OHR A;  1NJZ A;  3MED A;  1VQ4 N;  3HZ6 A;  1C0F A;  3UKU B;  2HHV A;  4DCH A;  3ZSQ A;  2YHA A;  5C2F A;  4NCG A;  1WBB A;  3DWL A;  5AQN A;  3THW B;  2HHT A;  3VQQ A;  4FOI A;  5HBM A;  1EP4 A;  3ZT2 A;  5BRF A;  5JMV A;  2PYL A;  4OO1 J;  3K5M A;  1KD1 O;  2GEL A;  1U49 A;  1FXX A;  3SBG A;  3E01 A;  4DU4 A;  1T6D A;  3G25 A;  3D6R A;  3HP9 A;  3BZK A;  1N33 K;  3I8B A;  3H46 O;  1S9E A;  3ZT4 A;  5FLX O;  1WSG A;  5ELZ A;  4B3R K;  4IFV A;  5AQK A;  3DLL L;  4GV6 A;  3VTH A;  1ATR A;  3RRH A;  2O4I A;  4NYF A;  2FSK A;  4CFD A;  3GL1 A;  5AQO A;  4EAH D;  5FPD A;  3CHW A;  2OPQ A;  2ATQ A;  2O8D B;  1WSJ A;  2FSJ A;  3CF5 L;  3QIC A;  4C8O A;  1SL0 A;  3KZB A;  1HNV A;  3ZSV A;  4IEI A;  3EZW A;  4E7I A;  4KRE A;  3P1G A;  2GWK A;  2ZGY A;  5CZ2 A;  2BDP A;  3ZT3 A;  2FF6 A;  3IFR A;  5SWM A;  4CZG A;  3OY9 A;  3IMX A;  1S72 N;  4H5T A;  3L2U A;  1O13 A;  3DLE A;  1S6P A;  4FWM A;  5DM6 L;  4JKA A;  4CCH A;  1GLF O;  2A1S A;  2HHW A;  4FJ5 A;  3VQ6 A;  4C23 A;  3CC2 N;  4X64 K;  3D2F B;  4NXN K;  1T3V A;  4CBU A;  3AVC A;  5HLF A;  3VEO A;  4BQL A;  3JYT A;  1IBM K;  4FJL A;  2KZZ A;  4E7K A;  1FW6 A;  4CEB A;  5I3U A;  3SMS A;  5GIO A;  3G6E N;  2I5J A;  4ZTF A;  1C6V A;  4U67 L;  1SZ2 A;  4JI8 K;  3AA4 A;  2F4V K;  4RTF D;  2YCH A;  4OPJ A;  1KQS M;  4UY8 O;  1ZBL A;  4ZHR A;  4CGF A;  1KFD A;  3D45 A;  3QES A;  1R0A A;  4KHW A;  1TK8 A;  1ZBI A;  1A5X A;  4FWL A;  2E1Y A;  3BEX A;  1J5O A;  4A61 A;  3J8A A;  3MDQ A;  4H0P A;  4E0D A;  3VEV A;  1NKE A;  3A5L C;  1N34 K;  3VEW A;  4JNE A;  3OBY A;  5BR8 K;  3VOV A;  3WEE B;  5FRO A;  3CM5 A;  3T19 A;  3KLG A;  5SZT A;  1WAJ A;  2OPP A;  3AVJ A;  2IGI A;  3NGI A;  3M8Q A;  2E4L A;  1KVB A;  4JKG B;  4BRL A;  4FPA A;  3P4I A;  4WE1 A;  4DFJ A;  4A59 A;  3D2E B;  3RMA A;  1NK9 A;  2O8E B;  3T1A A;  3TAB A;  1CXQ A;  1ASV A;  2Q0U A;  3PSI A;  3DYA A;  5C24 A;  3JS6 A;  4DFM A;  3R6M A;  4CIG A;  4W5Q A;  5BPM A;  2D4W A;  4CE9 A;  1YTA A;  3CJA A;  1C1A A;  1XWL A;  5HP1 A;  3WNE A;  1VQK N;  3AO4 A;  3LDP A;  4FLZ A;  4CD3 A;  2UXB K;  4FWP A;  3I55 N;  2CH5 A;  2D0P A;  4LC9 B;  1EQY A;  4JI5 K;  1TKT A;  4G9Z A;  3LAL A;  3Q7C A;  4EZ6 A;  5KPZ A;  2CGK A;  4DTP A;  3QFP A;  4RW9 A;  4LF5 K;  4DR4 K;  3THV A;  4PL8 A;  3MWP A;  4ISG A;  4PKH A;  2O8C A;  2P9U B;  4AHC A;  1TL3 A;  2I7P A;  3QEP A;  2QM1 A;  2GWJ A;  3QO9 A;  2A3Z A;  2FBV A;  4FJG A;  1ZBS A;  4N5S A;  1EWQ A;  4OVL A;  2D0C A;  4DSJ A;  3AA2 A;  4M63 C;  1VQM N;  3WQT A;  2O8F A;  3E1Y A;  3O3G A;  2YI1 A;  4DG1 A;  4CF1 A;  3VQ8 A;  3O9Q A;  2D5R A;  1NGE A;  2WBN A;  5JVH L;  4JI7 K;  3QET A;  1HRH A;  4C8M A;  5JS2 A;  1BOT O;  4Y1C A;  3C65 A;  1QQN A;  4CIE A;  5BPL A;  3S3N A;  4PY5 A;  2P9L B;  1U2V B;  3FZM A;  5KPR A;  4FJ8 A;  3HPO A;  4OKE A;  3THX B;  3M8P A;  1WBD A;  2F7T A;  5GIN A;  3F5T A;  1N5Y A;  1BO5 O;  4M3X A;  4QAG A;  5F1X A;  5AQU A;  4BVO A;  4LF7 K;  3TWH A;  1NK0 A;  4DS5 A;  4AF1 A;  4DF8 A;  4DFK A;  4W5N A;  4E1M A;  3CQ8 A;  1FJG K;  1WOQ A;  1YIJ N;  4DLG A;  4BR2 A;  1JLF A;  1RTH A;  4HHT A;  5HOO A;  3RSE A;  5I9E B;  2KZM A;  4KO0 A;  5AZJ B;  1JLQ A;  1F21 A;  1ASW A;  5E26 A;  4Z4G A;  3HP6 A;  1U48 A;  1BI4 A;  3PY8 A;  3ZEU A;  5IT9 O;  1QVF M;  2P9K B;  1P90 A;  3LDO A;  4BRM A;  1VQ9 N;  2ZWH A;  2HF3 A;  1ZBF A;  4B9N A;  3DAW A;  3PSF A;  4CFA A;  4B9S A;  4JS4 A;  4JD2 B;  4BGA A;  5JIC A;  1OKJ A;  2VQF K;  2HVH A;  2ITM A;  1S5J A;  1QSY A;  4XH5 A;  2WOM A;  4DR7 K;  1Q81 O;  1HPZ A;  2A6A A;  3P39 A;  2E8A A;  4KB0 A;  5AQS A;  1HNZ K;  1BQM A;  1MU2 A;  1NGJ A;  3HVR A;  2X74 A;  2DPN A;  3VQ4 A;  4B9T A;  4QS8 A;  4FLX A;  3WNH A;  3MN6 A;  4FJJ A;  4BC5 A;  4DTM A;  3LP3 A;  4G1Q A;  4H0O A;  1KC8 O;  3ZLJ A;  1BU6 O;  4FJM A;  2FBX A;  4TSX A;  3F9K A;  4FVM A;  3ATV A;  4M7Y A;  4O5B A;  5LL6 Z;  4B1X B;  5HRO A;  3EEQ A;  4IDK A;  4RW6 A;  1HYS A;  5C0Y A;  2KLA A;  3DRR A;  3MAQ A;  3CD6 N;  3BP8 A;  3CFP A;  3HRG A;  5BRH A;  4CK2 A;  1VSK A;  3WQU A;  4B3S K;  4DR1 K;  2QWO A;  3GOI A;  2VCP A;  3MMV A;  2YHX A;  5JLH A;  5LJW A;  3NF9 A;  5CHI A;  1RT7 A;  3NF6 A;  1VSM A;  3AVK A;  2VG6 A;  4KHU A;  1CZA N;  3ENH A;  3CCJ N;  3C95 A;  3TSQ A;  5EXW A;  1LOT B;  3OS1 A;  5IWA K;  2DY4 A;  1GLA G;  5CE3 A;  4DV1 K;  2ASM A;  2OTL N;  3SJJ A;  3NH0 A;  1TUY A;  1Q9X A;  4ISE A;  4H4O A;  1QZ5 A;  1U6Z A;  4JK7 A;  3LDQ A;  4OPA A;  3ZT1 A;  3SUO A;  1JKH A;  4LFC K;  4BC2 A;  5AQV A;  3L4I A;  3CQY A;  4I7F A;  3U3G A;  2HBJ A;  3SPY A;  2P9N B;  4CFC A;  3LM9 A;  4B1Y B;  1XI1 A;  1WB9 A;  5J2Q A;  1OVY A;  2JWK A;  3CCU N;  1GLB G;  1N36 K;  5GAH P;  2Q97 A;  3NCI A;  1C0U A;  2HBM A;  1D9F A;  4CJQ A;  1K8K A;  1BCO A;  4DUZ K;  4X62 K;  3NDK A;  1BWF O;  1HMV A;  4FCY A;  2GV9 A;  4PKG A;  4DTU A;  2PBD A;  3HOS A;  4EHT A;  2OZM A;  1S1W A;  3O80 A;  4I6M A;  2KQ2 A;  3HM9 A;  4A5B A;  3MCP A;  5K14 A;  5M1O A;  3I0R A;  1SUQ A;  3VF4 A;  3VMF B;  3HT3 A;  1IBL K;  1L3S A;  2HBL A;  4JHD A;  3B8A X;  3R1X A;  3L2V A;  4B1V A;  4JAX A;  2KHO A;  1QHA A;  3CET A;  3ULE B;  3U9D A;  1BUP A;  2IC3 A;  4JYA K;  4IEE A;  3GG4 A;  4JI6 K;  3OYD A;  3LDS A;  4KHY A;  4EHU A;  5FRN A;  1FK9 A;  1W0H A;  1C1B A;  1TK5 A;  2GTD A;  3IKM A;  5LJV A;  4CJ4 A;  2D0B A;  1XNQ K;  4KHP K;  2OTJ N;  1ATS A;  3S3O A;  4YDU A;  5FPE A;  3LP0 A;  3TTF A;  1XHZ A;  1C1C A;  3OYA A;  4OGC A;  1QSS A;  5AJ3 K;  3LAM A;  1IKX A;  3DXK B;  1ILY A;  3HM8 A;  1I94 K;  3K5L A;  3DI6 A;  3CJB A;  1NBW A;  4N56 A;  4GVM A;  1HKB A;  3RMD A;  4IJA A;  2G8I A;  1HNX K;  3AO2 A;  1L3U A;  3AVH A;  1XQS C;  1RBS A;  3PX0 A;  4CGH A;  4ILH A;  2PAV A;  1YF5 L;  2KFN A;  4L3Q A;  3VGL A;  5M1N A;  4CZI A;  4JN4 A;  1MWM A;  2NRZ A;  2AP1 A;  1SKS A;  2F9W A;  3M8R A;  3HO1 A;  1NK8 A;  2PFU A;  3VGK A;  2XY5 A;  3SUP A;  2W42 A;  3DJC A;  1R59 O;  2D1K A;  4CEA A;  4CJS A;  1RDW X;  1NK7 A;  5AQF A;  1Z6R A;  3SUN A;  2YNG A;  4QOZ B;  1RTJ A;  4BDP A;  1ATN A;  5AZI B;  2G8U A;  3UKU A;  2RE2 A;  1OH8 A;  3B6O A;  4F3T A;  3MEC A;  1UWB A;  4FL9 A;  3W0L A;  1XMO K;  4Z4H A;  4B08 A;  4FZY A;  3AV9 A;  3THW A;  2YHW A;  4AM6 A;  3SYZ A;  1GLD G;  1J54 A;  3BGR A;  4OJR A;  2E5L K;  3C6A A;  3CCQ N;  2QXL A;  4YOX A;  3QNO A;  4Z4E A;  2E20 A;  3CXC M;  2ASP A;  4NCA A;  4NYN A;  3A5N C;  2JGU A;  4FO0 A;  3QBW A;  4KH6 A;  4XH1 A;  4N47 A;  1ZBU A;  2P9I B;  1RCH A;  3E66 A;  3WXK A;  4EZ9 A;  4E1N A;  2G8V A;  4DTX A;  4WCE L;  1UAX A;  2FC0 A;  4DR5 K;  4CEC A;  3H3N O;  3T3F A;  4XH4 A;  4DS4 A;  3PO4 A;  4CEZ A;  3S3M A;  3DXM B;  3FGU A;  4A2A A;  3U6F A;  1EKE A;  1FKP A;  4H5V A;  2P9S B;  4O44 A;  2O8D A;  3CM6 A;  4KI4 A;  1C0M A;  2Y1J A;  1VSH A;  3R9P A;  2HF4 A;  3TU5 A;  1TAQ A;  4F4K A;  1NGC A;  2WUS A;  4XEI A;  3LWL A;  4W5R A;  1S1U A;  5EU7 A;  3EKU A;  4ICL A;  4K0K K;  4X65 K;  4FXD A;  1YTU A;  5A2Q O;  3M1F A;  3NGZ A;  1KXP A;  4JI4 K;  4CJK A;  5C10 A;  1NJI O;  4ELT A;  4FJI A;  4CGJ A;  3TAR A;  1NJY A;  2NRV A;  4NCB A;  3D2F A;  4KB1 A;  3KD1 E;  3ALY A;  4X66 K;  4DB3 A;  1S3X A;  3V1Q A;  3VF6 A;  1KLM A;  3SAG A;  4BAC A;  4IO9 L;  3P38 A;  1I39 A;  4PHT X;  1HX1 A;  3A0I X;  1YJW N;  3NVK A;  3AO5 A;  1RT1 A;  3O9T A;  4DQP A;  3KK3 A;  1I3A A;  3SAF A;  1BA0 A;  4C8K A;  3MK6 A;  4CZJ A;  1E4F T;  1BHL A;  4C1N K;  3ZX3 A;  1GLE G;  2YNI A;  2Z1J A;  1D9D A;  1X9W A;  1BL3 A;  1V4T A;  1RBT A;  2VWB A;  4DV6 K;  4CGD A;  1S1X A;  4F2S A;  3WEE A;  3CJ1 A;  3O8M A;  3RMB A;  4E7J A;  2QWN A;  3CYM A;  4CJ5 A;  2XY8 A;  3RMC A;  4LSL A;  1WLJ A;  2IVP A;  4LFB K;  4JKG A;  3UKR B;  3NHG A;  1VSJ A;  1C0G A;  4BRC A;  3SCX A;  3D2E A;  4NXM K;  1B9F A;  2BAN A;  2O8E A;  3QEX A;  4BDY A;  3SK3 A;  4H0V B;  1YT3 A;  3K59 A;  1HYV A;  1BDG A;  1D8Y A;  5AQI A;  4FK4 A;  5FRM A;  1EWR A;  3VEZ A;  3AVA A;  5AQP A;  3N4Q A;  4AH9 A;  2V7Z A;  3OYB A;  4Z4C A;  3ATU A;  5KGX A;  3KD5 E;  1CZB A;  1JCE A;  3VQP A;  4IFY A;  4FVU A;  3RWU A;  3O9R A;  2UU9 K;  1W9H A;  2ITG A;  1XHX A;  1Z25 A;  3G10 A;  3AVG A;  3K9J A;  4IG0 A;  4CJR A;  3OYE A;  3OA9 A;  4BC3 A;  4FM1 A;  5D3G A;  4O55 A;  2IS3 A;  4BG8 A;  2HMI A;  4DKW A;  2HVI A;  2P9U A;  3HK2 A;  4JS5 A;  3G0Z A;  4J2A A;  4CHO A;  5EOY A;  5H1S Q;  5J2N A;  3LP2 A;  3CCM N;  4K8X A;  4M3R A;  5HRN A;  4PWD A;  3VTI A;  2B4J A;  3K58 A;  4DTJ A;  1KRP A;  4M3Y A;  1VQ8 N;  4HUF A;  2EX3 A;  1X9M A;  3KWG A;  4CI6 A;  3LZI A;  3O9U A;  1GLC G;  2DFH A;  5F0X A;  1GOB A;  3H45 C;  1XNR K;  4M41 A;  1YJ9 N;  3AY9 A;  4H5N A;  1Q7Y O;  3DOK A;  4IOA L;  3WXM B;  2P9L A;  3ENB A;  1U2V A;  3U3Y A;  4H0T B;  4O8K A;  3AAQ A;  3A2F A;  4E89 A;  3THX A;  2P9P B;  1BA1 A;  1UOC A;  2P5O A;  1GLL O;  2YV0 X;  2UXD K;  4PUO A;  3DLR A;  3CCL N;  1NK6 A;  2QA4 N;  3V9S A;  4K41 A;  1IJJ A;  4BRF A;  1LV5 A;  1CLQ A;  3O3H A;  4DV4 K;  3DLB A;  4I9Q A;  3QIP A;  4CJW A;  1HPM A;  5DM7 L;  3KTQ A;  4DWI A;  4AHT A;  5C12 A;  5AZJ A;  5C2D A;  4CJE A;  4YFU A;  2IAJ A;  4CFB A;  3AA5 X;  1KVA A;  3PO5 A;  4BRO A;  1RTD A;  2P9K A;  1RT6 A;  2FXU A;  4H8K A;  4MDA A;  2BUP A;  4DR6 K;  4Q0B A;  1CZ9 A;  4O4G A;  5M1P A;  5E41 A;  4BE1 A;  2XY6 A;  5AR0 A;  2GX9 A;  1K73 O;  3UB5 A;  3ID6 A;  4JD2 A;  2ZM6 K;  1EO1 A;  4FOE A;  1IO2 A;  4FSV A;  3OS2 A;  4M45 A;  4BWJ A;  4IKF A;  3VF2 A;  5J2P A;  1W7A A;  2YKN A;  5C15 A;  5I42 A;  2YX6 A;  3LWM A;  3K57 A;  1LWE A;  5GIP A;  1SQK A;  3EE8 A;  4DSK A;  4BRG A;  4PL7 A;  1TKD A;  4E7H A;  1HKC A;  1Z05 A;  4GKK K;  3O4N A;  5AQJ A;  4JRP A;  3G71 N;  3AAP A;  5KTQ A;  4B9L A;  4O5F A;  1T03 A;  1IV0 A;  3OYG A;  3HYF A;  4LF4 K;  3LPU A;  3CCV N;  3CER A;  1LAW A;  4BR5 A;  5E84 A;  4CF2 A;  3R8E A;  4CHY A;  5HL7 L;  1GOA A;  1BG3 A;  2FBT A;  1NWK A;  4B9U A;  4OLB A;  4H03 B;  5FDL A;  1TYQ B;  2F8T A;  3DLH A;  3THY B;  1CXU A;  4KHN A;  3L3V A;  3RR7 A;  4CJV A;  3T1Y K;  3IAY A;  2W40 A;  1TL1 A;  4BRI A;  4Z0U A;  4IXC A;  1GLJ O;  1LWC A;  4IO8 A;  4FW1 A;  4OKJ A;  4DR3 K;  3S9H A;  3L3U A;  4MO5 A;  3AO3 A;  2NZT A;  3FZL A;  3HTV A;  3IS9 A;  4DSI A;  1TGO A;  4KRF A;  3VEN A;  2WON A;  3QIN A;  1LW2 A;  2ZE2 A;  4C1N I;  4DTN A;  4KBO A;  3HJF A;  3DLG A;  4FJX A;  2HBK A;  1L3T A;  5JVG L;  1WSH A;  3MX5 A;  4CGG A;  1NKB A;  1RT3 A;  1J6Z A;  3LP1 A;  2R7Y A;  1NK5 A;  5KRT A;  3ISN C;  3L8B A;  4H5W A;  2P9N A;  3OBW A;  4YOR A;  4CJL A;  2E6L A;  4RW8 A;  3CC7 N;  1E4G T;  3SUQ A;  4AIL C;  3M6G A;  2NUB A;  3AVI A;  1NKC A;  2A41 A;  4DF4 A;  3BZC A;  4CEO A;  2PY5 A;  2QWP A;  2PYJ A;  1VSE A;  4WYB A;  3H1V X;  4LSN A;  3ZSO A;  3TSP A;  1Q82 O;  3DM2 A;  1SL1 A;  3ZX2 A;  2DTU A;  1SL2 A;  3VER A;  4JI2 K;  2HHH K;  3JAM O;  5CY4 A;  1QHT A;  4F8R A;  1NU0 A;  5KI6 A;  4FLW A;  3V4I A;  1IG9 A;  1YJN N;  2YNH A;  4RW4 A;  5T7B A;  2G8W A;  1QQO A;  1RT4 A;  4CZH A;  4E19 A;  3QDK A;  3ULE A;  2WTU A;  2HNZ A;  1WSE A;  3PLA A;  4NLB A;  1WN7 A;  5HRR A;  4CHP A;  2D0A A;  4CK3 A;  3K5N A;  3AVN A;  1VQ5 N;  4U7B A;  1XC3 A;  1YVU A;  5CR4 A;  2W6L A;  3DOL A;  5MLC Q;  3R3L A;  1SV5 A;  1NJW A;  2OYQ A;  3DXK A;  5C42 A;  4FLY A;  4H5R A;  4J2B A;  1EET A;  4ISF A;  2HST A;  2QWM A;  2V51 B;  4K43 A;  3C6U A;  2YHB A;  3SV4 A;  1KSP A;  4M7X A;  4IFE A;  2ZF5 O;  3FZF A;  3H08 A;  4DV2 K;  4IG3 A;  4DTO A;  3J7A P;  3HST B;  4DFP A;  1REV A;  2B5J A;  3U4L A;  3VQB A;  4FZZ A;  3V9Z A;  4DLE A;  1KAX A;  1VRT A;  1HJR A;  3ZSY A;  4IOX A;  1LCU A;  5J2M A;  3LM2 A;  1U47 A;  1N32 K;  3ENO A;  4IOC L;  2CH6 A;  1QSL A;  3SZ2 A;  1QS4 A;  2DFE A;  2YJE A;  3E9O A;  5CYM A;  4H4M A;  3FZH A;  4FWQ A;  3WUH A;  2FLO A;  3JXU A;  3DRS A;  1HKG A;  1HNW K;  3NMU A;  2QKB A;  1KAZ A;  4KTQ A;  5AZI A;  3LAN A;  1H1V A;  2HB5 A;  1JCF A;  3TAM A;  2JWL A;  4EIA A;  1X3M A;  1RGI A;  5CYQ A;  3TAF A;  2YKM A;  3J80 O;  4MO4 A;  1OH6 A;  1X9J A;  2QTD A;  3AVF A;  1N6Q A;  3NBP A;  3CG7 A;  1Q9Y A;  2CGJ A;  3QNN A;  1W2B M;  2HHS A;  3DRP A;  4FWO A;  2P9I A;  5M1Q A;  4DV3 K;  2HOE A;  1EXQ A;  3H6E A;  4ILJ A;  4CF0 A;  3CJ9 A;  2AJQ A;  3ZET B;  3G4S N;  3HXM A;  3DMJ A;  1SS6 A;  3QBX A;  3K0S A;  3PIO L;  3UIQ A;  2Q1N A;  3O08 A;  1NJX A;  4RG8 A;  3OJS A;  2ETJ A;  3C94 A;  4H0Y B;  1BIU A;  1JLB A;  1HLU A;  3DXM A;  3LDL A;  3ZT0 A;  3OW2 M;  3SLC A;  1BIS A;  4FM2 A;  1NOZ A;  2E88 A;  2P9S A;  5ADX H;  2OCE A;  3QIO A;  4KV8 A;  4Z94 A;  4LH5 A;  3GDQ A;  5BN8 A;  4CEQ A;  1T44 A;  4BR0 A;  3V9X A;  4BRP A;  3EE9 A;  3AVL A;  3J81 O;  1RFQ A;  3ZSW A;  4DR2 K;  5AQQ A;  2QXF A;  1K8K B;  3WT0 A;  4FM0 A;  4FLV A;  4CJU A;  2V52 B;  1QZ6 A;  1JCG A;  2A40 A;  1HUX A;  1HR0 K;  1IBK K;  4OGE A;  4OLA A;  3NF7 A;  1BCM A;  1NGB A;  1WAF A;  3VA3 A;  4EFH A;  5KQ8 A;  3M5R A;  3V9W A;  1T7P A;  4JKH A;  1YVN A;  4FWR A;  3C7N B;  4DSF A;  4BC4 A;  1VHX A;  3EKS A;  2O8B B;  3MWT A;  3N4P A;  3IDH A;  2QEX N;  2Z1H A;  3CFO A;  4CZK A;  2HW3 A;  3MEG A;  4RCH A;  4BR4 A;  1RDD A;  5GAG P;  5HRP A;  3OYI A;  2GUP A;  1OH7 A;  4BRH A;  1ITG A;  3FLC O;  3TI0 A;  3V9U A;  4ID1 A;  4YOW A;  3OYC A;  3SPZ A;  2W41 A;  4YOU A;  4YNQ A;  4CZF A;  4DUY K;  3CIP A;  4RW7 A;  5BN9 A;  3VQC A;  2F8S A;  2BGG A;  3HPG A;  1K8A O;  4AHS A;  1A5W A;  4B1W B;  4O0I A;  4AQY K;  4LFA K;  4EP5 A;  3O3F A;  3NF8 A;  3SMP A;  3V1R A;  3ZX0 A;  4HTU A;  4HWI A;  3PIP L;  3VQE A;  1VQL N;  3VGM A;  3K2P A;  4Q5V A;  3J7Z O;  3EZ5 A;  3T1H K;  4BWM A;  1Y64 A;  3E9L A;  3QLH A;  3CQX A;  3A8Y A;  1LW0 A;  1JXB A;  3SQ4 A;  1TV6 A;  3L4Q A;  3U9Z A;  2IIR A;  2E1Z A;  4BG9 A;  4BRA A;  4CF9 A;  2QKK A;  5AQH A;  3O4Q A;  1L5U A;  3VEY A;  4LD0 A;  3T7Z A;  3UKR A;  3KIO A;  4C8N A;  1OVQ A;  1VQN N;  4ILG B;  3OYF A;  4FZX C;  2O4G A;  3SQ0 A;  4BGB A;  5AQY A;  2QWL A;  1XMQ K;  2OA8 A;  1UA0 A;  3QER A;  1S9G A;  1OH5 A;  1YI2 N;  2RHK A;  3CPW M;  1RDB A;  4M42 A;  4MLH A;  4CED A;  1VRU A;  2G8H A;  1NMD A;  3O1W A;  3A5O C;  5BPN A;  2E2Q A;  1QQM A;  2IVN A;  2J4R A;  4GV3 A;  3CCR N;  4KTZ A;  4GMJ B;  2AA4 A;  1T05 A;  1J9A A;  4YOV A;  4CVN E;  4FLT A;  2YJF A;  3FZK A;  2PZS A;  3I33 A;  1X1P A;  3TAE A;  2V7Y A;  3CFR A;  2BE2 A;  3ZSZ A;  4FWK A;  3AGR A;  3TAP A;  4DTR A;  4RWT A;  4XIU A;  5HRS A;  2VGN A;  3F2K A;  2NLX A;  4FWN A;  4C8L A;  3PX4 A;  1YUW A;  4ELU A;  3MXJ A;  3RRG A;  3SAH A;  2E2P A;  3BUZ B;  3HVT A;  3LPT A;  4CHN A;  5LY3 A;  2WFB A;  4CGI A;  1C0T A;  1G15 A;  1LWF A;  2NRR A;  4FJN A;  3IRX A;  4KTW A;  4N41 A;  3H3O B;  3MXM A;  3C6H A;  4OPK A;  4GVE A;  3QEW A;  2DFF A;  3ULD A;  2BH1 A;  3NH1 A;  4WFN L;  4WFA L;  1WNS A;  4KH4 A;  2Q2R A;  3ITH A;  4O8U A;  2XY7 A;  1ESV A;  1SKR A;  3ZCM A;  3VQ7 A;  3EO3 A;  1YIT N;  3TSU A;  1VQO N;  4L8R B;  3VQA A;  1ZC6 A;  5AFU H;  3AVB A;  4W5T A;  4QCL A;  2P9P A;  4CJ3 A;  1VSL A;  3LL3 A;  1TAU A;  4Y1D A;  5DK5 A;  3MN7 A;  3KLE A;  2RKI A;  1K9M O;  3CI5 A;  2P1J A;  2KKZ A;  2ZGZ A;  3AGK A;  4GNI A;  3TPQ A;  5GAE P;  3P31 A;  1VSD A;  2X78 A;  2OPR A;  4PA1 A;  4F2R A;  1J5E K;  3LDN A; 
#chains in the Genus database with same CATH homology
 3WNF A;  1JKH A;  1TKD A;  4E7H A;  3SQ2 A;  4DU1 A;  4I7F A;  3U3G A;  2KW4 A;  4FW2 A;  4CIF A;  3KK2 A;  3O4N A;  3SPY A;  4JRP A;  4CFC A;  2OPS A;  1XI1 A;  2GUI A;  5J2Q A;  5KTQ A;  4B9L A;  2HNY A;  1T03 A;  2G8F A;  3OYG A;  2Y1I A;  3JSM A;  1KLN A;  4HCC A;  1KCF A;  1SKW A;  3NCI A;  1DTT A;  1C0U A;  1JLC A;  1Z26 A;  3HYF A;  4DU3 A;  2LSN A;  2KFZ A;  1KTQ A;  1D9F A;  3K5O A;  4CJQ A;  3M8S A;  3LPU A;  1L3V A;  3OYM A;  1KVC A;  1BCO A;  2XO7 A;  1QTM A;  1TVR A;  1LAW A;  1EX4 A;  3SI6 A;  1RDA A;  3NDK A;  1HMV A;  4BDZ A;  4FCY A;  4OKK A;  2GV9 A;  2OZS A;  3OS0 A;  4CF2 A;  2A1R A;  3ZSX A;  2RN2 A;  3L2W A;  4DTU A;  4CHY A;  1GOA A;  2IOC A;  4CER A;  3AVM A;  2OZM A;  1S1W A;  1JLE A;  2FBT A;  3FFI A;  2P51 A;  2KQ2 A;  4B8A B;  4B9U A;  4W5O A;  3HM9 A;  4OLB A;  1HQE A;  4JLH A;  5FDL A;  5K14 A;  3OYH A;  1DLO A;  2F8T A;  2RPI A;  2RF2 A;  3I0R A;  3DLH A;  4CF8 A;  3V81 A;  1SUQ A;  1ASU A;  1RBR A;  3HT3 A;  1CXU A;  4CJF A;  4KHN A;  3L3V A;  1L3S A;  1TKZ A;  4CJV A;  1NJZ A;  3RR7 A;  4IBN A;  1IKY A;  3IAY A;  3MED A;  1TL1 A;  4LH4 A;  3L2V A;  4Z0U A;  2HHV A;  2IC3 A;  1LWC A;  3OYD A;  3LDS A;  4KHY A;  4FW1 A;  4OKJ A;  5FRN A;  1FK9 A;  3ZSQ A;  1W0H A;  3L3U A;  3S9H A;  3AO3 A;  2YHA A;  4NCG A;  1C1B A;  1NK4 A;  1TK5 A;  1FKO A;  3IS9 A;  4MQ3 A;  4DSI A;  1TGO A;  4CJ4 A;  1IKW A;  1S6Q A;  4KRF A;  4HCB A;  2WON A;  3QIN A;  1LW2 A;  2ZE2 A;  4DTN A;  3VQQ A;  3HJF A;  2HHT A;  2D0B A;  3DLG A;  5HBM A;  1EP4 A;  4FJX A;  3ZT2 A;  1L3T A;  3S3O A;  1WSH A;  2PYL A;  4CGG A;  3LP0 A;  1RT3 A;  3LP1 A;  3K5M A;  2R7Y A;  4BE2 A;  1XHZ A;  1C1C A;  1NKB A;  1U49 A;  3SQ1 A;  1NK5 A;  3OYA A;  4OGC A;  1FXX A;  5KRT A;  3ISN C;  4FJ9 A;  1QSS A;  3LAM A;  1IKX A;  3L8B A;  3E01 A;  3OYJ A;  3K5L A;  3DI6 A;  4DU4 A;  3V6D A;  1RBV A;  4N56 A;  3TAG A;  3HP9 A;  4GVM A;  4CJL A;  2E6L A;  4RW8 A;  3LAK A;  3SUQ A;  1S9E A;  3ZT4 A;  3RMD A;  1WSG A;  4AIL C;  2G8I A;  3AO2 A;  4IFV A;  4CJT A;  1L3U A;  2NUB A;  3AVI A;  1NKC A;  4FK2 A;  3AVH A;  3HL8 A;  4DF4 A;  4CEO A;  1HYZ A;  1RBS A;  3PX0 A;  2PY5 A;  4CGH A;  2PYJ A;  3RRH A;  2O4I A;  1VSE A;  4NYF A;  4UQG A;  2KFN A;  4CFD A;  4LSN A;  3ZSO A;  3DM2 A;  1SL1 A;  4CES A;  1SKS A;  2OPQ A;  3M8R A;  3HO1 A;  1NK8 A;  2DTU A;  1K6Y A;  3SNN A;  1SL2 A;  2ATQ A;  2XY5 A;  3SUP A;  1U4B A;  2W42 A;  1WSJ A;  4M3T A;  5CY4 A;  1BIZ A;  4CJP A;  5KGW A;  1QHT A;  4C8O A;  1SL0 A;  5KI6 A;  4F8R A;  4CEA A;  2HHX A;  4CJS A;  3KKR A;  4FLW A;  1NK7 A;  5FRM A;  1HNV A;  3ZSV A;  3V4I A;  3SUN A;  1IG9 A;  2YNG A;  2YNH A;  4RW4 A;  4E7I A;  1RTJ A;  3P1G A;  4QOZ B;  3TR8 A;  5T7B A;  4KRE A;  2G8W A;  4BDP A;  1RT4 A;  5CZ2 A;  4E19 A;  2XHB A;  2BDP A;  4JRQ A;  3ZT3 A;  2G8U A;  2HNZ A;  3B6O A;  1WSE A;  5SWM A;  2Z1G A;  3V1O A;  4F3T A;  3OY9 A;  3MEC A;  1QQC A;  1UWB A;  1WN7 A;  1J53 A;  4ID5 A;  5HRR A;  4CHP A;  3L2U A;  2D0A A;  4CK3 A;  3DLE A;  4Z4H A;  4B08 A;  3K5N A;  4DQS A;  4FZY A;  1S6P A;  3AV9 A;  3AVN A;  4HUE A;  3SYZ A;  4CCH A;  1YVU A;  1J54 A;  2A1S A;  1RNH A;  3RR8 A;  4FJ5 A;  3BGR A;  4OJR A;  2HHW A;  3VQ6 A;  3DOL A;  3QNO A;  4Z4E A;  4GW6 A;  4NCA A;  5HLF A;  3AVC A;  4NYN A;  1NJW A;  1SV5 A;  2JGU A;  3JYT A;  5C42 A;  4R5P A;  2VWJ A;  4N47 A;  4CK1 A;  4FLY A;  2OYQ A;  4FJL A;  4J2B A;  1EET A;  1ZBU A;  2KZZ A;  4HUG A;  1RCH A;  4E7K A;  4CEB A;  5I3U A;  3EYZ A;  3C6U A;  4DQR A;  2YHB A;  1S1V A;  3SV4 A;  4E1N A;  1KSP A;  4EZ9 A;  2I5J A;  4ZTF A;  1C6V A;  2G8V A;  3H08 A;  2IDO A;  4IG3 A;  3AA4 A;  4DTX A;  4DTO A;  3HST B;  1UAX A;  4DFP A;  1REV A;  4OPJ A;  2B5J A;  3VQB A;  2FC0 A;  4FZZ A;  1O1W A;  3V9Z A;  4CEC A;  4ZHR A;  1ZBL A;  4CGF A;  4DLE A;  1KFD A;  3D45 A;  3T3F A;  1VRT A;  1HJR A;  3ZSY A;  4DS4 A;  3QES A;  1R0A A;  4FJ7 A;  3PO4 A;  4KHW A;  5J2M A;  4CEZ A;  3S3M A;  1U47 A;  1TK8 A;  1QSL A;  1ZBI A;  3SZ2 A;  1QS4 A;  2DFE A;  1A5X A;  2FBY A;  3U6F A;  3OYL A;  1J5O A;  1TK0 A;  1EKE A;  1FKP A;  4O44 A;  5CYM A;  4E0D A;  3CM6 A;  4H4M A;  1NKE A;  4KI4 A;  1C0M A;  4DTS A;  2Y1J A;  3DRS A;  1VSH A;  2P5G A;  2ZQB A;  1TAQ A;  4DSE A;  4F4K A;  4KKO A;  2QKB A;  4KTQ A;  3LWL A;  4W5R A;  5FRO A;  2HHQ A;  3CM5 A;  1S1U A;  3LAN A;  3T19 A;  3KLG A;  2HB5 A;  3TAM A;  1WAJ A;  5SZT A;  2OPP A;  5EU7 A;  2GBZ A;  5CYQ A;  3TAF A;  2E6M A;  3NE6 A;  2YKM A;  1DTQ A;  4ICL A;  4Z4F A;  4PQU A;  4KAZ A;  3AVJ A;  4FXD A;  1Q8I A;  2IGI A;  3OYN A;  3NGI A;  1YTU A;  3M8Q A;  2E4L A;  3TAQ A;  3NGZ A;  1KVB A;  4ELV A;  4FJH A;  4CJK A;  1HQU A;  4WE1 A;  3I0S A;  5DMR A;  4DFJ A;  4ELT A;  3AVF A;  4KI6 A;  3RMA A;  1NK9 A;  4CGJ A;  3TAR A;  1NJY A;  1N6Q A;  3NBP A;  3T1A A;  4NCB A;  3TAB A;  4KB1 A;  3CG7 A;  1CXQ A;  2QK9 A;  1Q9Y A;  1ASV A;  3D0P A;  3QNN A;  3ALY A;  3KD1 E;  4FJI A;  4EP4 A;  1D5A A;  1RTI A;  3DYA A;  5C24 A;  3DRP A;  4FYD A;  4DFM A;  2HHS A;  3OVN A;  3V1Q A;  4CIG A;  2G8K A;  4M3W A;  1KLM A;  2Z1I A;  1EXQ A;  4AHU A;  1B92 A;  3L2Q A;  4BAC A;  1I39 A;  4W5Q A;  4CF0 A;  4Z4I A;  4CE9 A;  1YTA A;  1C1A A;  2AJQ A;  1XWL A;  3HXM A;  5HP1 A;  3WNE A;  3HPH A;  3DMJ A;  3AO5 A;  1RT1 A;  3AO4 A;  4FLZ A;  4DQP A;  3B6P A;  3AO1 A;  1I3A A;  3KK3 A;  3UIQ A;  1NJX A;  4C8K A;  4RG8 A;  3OJS A;  2ETJ A;  3C94 A;  1TKT A;  1BIU A;  1JLB A;  2JLE A;  2XRI A;  3ZT0 A;  1BHL A;  1BIS A;  2YNI A;  1NOZ A;  1B9D A;  2Z1J A;  3LAL A;  4FM2 A;  2X6N A;  1D9D A;  2Q3S A;  3QIO A;  4KV8 A;  4EZ6 A;  4LH5 A;  1X9W A;  1U04 A;  4DTP A;  2ZD1 A;  1BL3 A;  4M3Z A;  4RW9 A;  3PX6 A;  1RBT A;  4CEQ A;  3THV A;  4CGD A;  1S1X A;  3V9X A;  4F2S A;  1RT5 A;  1JLA A;  1BQN A;  3MXI A;  3AVL A;  4AHC A;  3RMB A;  3TAN A;  1TL3 A;  4E7J A;  4I2Q A;  3CYM A;  3ZSW A;  4CJ5 A;  3VA0 A;  2QXF A;  3QEP A;  1JL1 A;  2XY8 A;  3SV3 A;  3RMC A;  4FM0 A;  4FLV A;  3QO9 A;  4CJU A;  4B9M A;  2FBV A;  4LSL A;  4FJG A;  4KHS A;  1WLJ A;  1WSF A;  4N5S A;  4F3O A;  4OVL A;  2D0C A;  3NHG A;  1VSJ A;  3SCX A;  4OGE A;  3C6T A;  2YNF A;  1BGX T;  3NF7 A;  3AA2 A;  4DSJ A;  4OLA A;  3QEI A;  1BCM A;  1B9F A;  1BI4 B;  1WAF A;  2BAN A;  3VA3 A;  4DQI A;  3QEX A;  4BDY A;  3O3G A;  4DG1 A;  3V9W A;  1T7P A;  1YT3 A;  3K59 A;  4CF1 A;  1HYV A;  4BE0 A;  3DLK A;  3VQ8 A;  4DSF A;  1U45 A;  1D8Y A;  2D5R A;  4FK4 A;  3KJV A;  1XC9 A;  1RT2 A;  2EHG A;  3QET A;  3ASM A;  1HRH A;  4C8M A;  5JS2 A;  2Z1H A;  1VK0 A;  4Y1C A;  3CFO A;  4KPY A;  4CIE A;  3S3N A;  3AVA A;  2HW3 A;  3MEG A;  4MFB A;  4PY5 A;  1RDD A;  3AA3 A;  5HRP A;  3OYI A;  4AH9 A;  3OYB A;  3HPO A;  4FJ8 A;  4Z4C A;  4OKE A;  5KGX A;  1X9S A;  1ITG A;  3M8P A;  3KD5 E;  1CZB A;  1ZYQ A;  3TI0 A;  3V9U A;  4ID1 A;  3SPZ A;  3OYC A;  4I9L A;  4IFY A;  3VQP A;  1WSI A;  4B8C A;  1N5Y A;  4M3X A;  3RWU A;  4YNQ A;  1W9H A;  4QAG A;  2ITG A;  4RW7 A;  3VQC A;  3L2R A;  3TWH A;  2F8S A;  1XHX A;  2BGG A;  3HPG A;  1Z25 A;  3G10 A;  3AVG A;  1GOC A;  1A5W A;  4AHS A;  4O0I A;  4IG0 A;  3KK1 A;  3LZJ A;  1NK0 A;  3BDP A;  4CJR A;  3OYE A;  4EP5 A;  3O3F A;  4DS5 A;  2F96 A;  3NF8 A;  3QEV A;  4DF8 A;  4FM1 A;  4DFK A;  3V1R A;  4O55 A;  2HND A;  5D3G A;  4W5N A;  4HTU A;  4E1M A;  3VQE A;  3CQ8 A;  2IS3 A;  2HMI A;  3K2P A;  4Q5V A;  2HVI A;  3NGY A;  3EZ5 A;  3HK2 A;  4JS5 A;  2VWK A;  4BWM A;  3G0Z A;  4J2A A;  3QLH A;  5CZ1 A;  4DLG A;  3SQ4 A;  1LW0 A;  1JXB A;  4CHO A;  1TV6 A;  4LY7 A;  1JLF A;  1RTH A;  4HHT A;  5J2N A;  3PUF A;  2X6S A;  2KZM A;  3LP2 A;  4KO0 A;  4CF9 A;  2QKK A;  3VQ9 A;  3O4Q A;  1L5U A;  1JLQ A;  3NAE A;  4K8X A;  4M3R A;  5HRN A;  4PWD A;  4LD0 A;  1F21 A;  1ASW A;  3KLI A;  3KIO A;  4C8N A;  4Z4G A;  1TKX A;  3HP6 A;  1U48 A;  1BI4 A;  3OYF A;  3PY8 A;  3P5J A;  5J1E A;  4FZX C;  2O4G A;  3SQ0 A;  4K8Z A;  2B4J A;  4E3S A;  4J2E A;  3K58 A;  4DTJ A;  1KRP A;  4CEF A;  4M3Y A;  4DMN A;  1VSF A;  4HUF A;  2EX3 A;  3IG1 A;  1ZBH A;  1X9M A;  2OA8 A;  1UA0 A;  1ZBF A;  4CHZ A;  3QER A;  3PV8 A;  4B9N A;  3LZI A;  1S9G A;  4N76 A;  2DFH A;  1JXE A;  4CFA A;  2HHU A;  4B9S A;  1GOB A;  4DQQ A;  4M41 A;  1RDC A;  4JS4 A;  1S1T A;  3EY1 A;  1RDB A;  3DOK A;  4CHQ A;  4M42 A;  4CED A;  2HVH A;  1VRU A;  3U3Y A;  2G8H A;  1S5J A;  1QSY A;  4E89 A;  3A2F A;  4AHV A;  2WOM A;  3KLF A;  1Y97 A;  4FK0 A;  1UA1 A;  1HPZ A;  1HNI A;  1UOC A;  2P5O A;  3OJU A;  3WNG A;  2YV0 X;  1VSI A;  5JS1 A;  4KTZ A;  4KB0 A;  4B9V A;  4GMJ B;  2KTQ A;  1BQM A;  3DLR A;  1T05 A;  1MU2 A;  1J9A A;  1KFS A;  3HVR A;  4PUO A;  3OYK A;  1NK6 A;  2X74 A;  3VQ4 A;  4B9T A;  4FJK A;  3MEE A;  3KLH A;  4FLT A;  3V9S A;  4KFB A;  3F73 A;  2PZS A;  3KKS A;  1X1P A;  4FLX A;  3TAE A;  1LV5 A;  3WNH A;  4FJJ A;  4DTM A;  3CFR A;  2BE2 A;  3ZSZ A;  3LP3 A;  4G1Q A;  3O3H A;  3DLB A;  1CLQ A;  4I9Q A;  3QIP A;  1RBU A;  3ZSR A;  4FJM A;  3TAP A;  4CJW A;  2FBX A;  4DTR A;  4TSX A;  4XIU A;  3F9K A;  4FVM A;  5HRS A;  3KTQ A;  4DWI A;  4J2D A;  4AHT A;  4E7L A;  3RTV A;  3PX4 A;  4C8L A;  4ELU A;  4O5B A;  5HRO A;  1HYS A;  4IDK A;  4RW6 A;  1QE1 A;  3MXJ A;  3NH2 A;  4CJE A;  3RRG A;  3HVT A;  3LPT A;  3DRR A;  1T8E A;  4CHN A;  4YFU A;  4M3U A;  3MAQ A;  4HVJ A;  4CGI A;  4DSL A;  1C0T A;  1G15 A;  1LWF A;  1RIL A;  2IAJ A;  3CFP A;  4FJN A;  4CFB A;  3IRX A;  4AHR A;  4KTW A;  3AA5 X;  1KVA A;  3PO5 A;  4N41 A;  4FLU A;  3MXM A;  3VQ5 A;  4CK2 A;  1RTD A;  4KHQ A;  4OPK A;  1VSK A;  1JL2 A;  1RT6 A;  3QEW A;  2DFF A;  3I8D A;  4H8K A;  3ULD A;  1IKV A;  3NH1 A;  4Q0B A;  1CZ9 A;  4O4G A;  1WNS A;  5E41 A;  4BE1 A;  2XY6 A;  3NF9 A;  1RT7 A;  3ITH A;  3NF6 A;  2XY7 A;  1NOY A;  1VSM A;  3AVK A;  2VG6 A;  4KHU A;  3P83 D;  1SKR A;  1A5V A;  2VG5 A;  3ZCM A;  4B3O A;  3C95 A;  3VQ7 A;  1JLG A;  4CEE A;  4I2P A;  3OS1 A;  1IO2 A;  3VN5 A;  4L8R B;  2DY4 A;  3VQA A;  3OS2 A;  4M45 A;  3VQD A;  3AVB A;  1IH7 A;  4BWJ A;  3NFA A;  4IKF A;  4W5T A;  4QCL A;  4O0J A;  5C25 A;  5J2P A;  2YKN A;  4CJ3 A;  4ZTJ A;  5KRS A;  1VSL A;  3SJJ A;  1TAU A;  2VG7 A;  4Y1D A;  5DK5 A;  5I42 A;  3NH0 A;  1Q9X A;  3KLE A;  2RKI A;  2P1J A;  2B6A A;  3LWM A;  4H4O A;  3K57 A;  1LAV A;  1VSD A;  1LWE A;  2X78 A;  2OPR A;  4PA1 A;  4F2R A;  4DSK A;  3ZT1 A;  3SUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...