3KLDA

Ptprg cntn4 complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
380
structure length
376
Chain Sequence
GSGPVFVQEPSHVMFPLDSEEKKVKLSCEVKGNPKPHIRWKLNGTDVDIRYSVVDGSLLINNPNKTQDAGTYQCIATNSFGTIVSREAKLQFAYLENFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLYIAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPAEKGTTVKLECFALGNPVPTILWRRADGKPIARKARRHKSNGILEIPNFQQEDAGSYECVAENSRGKNVAKGQLTFYAQPNWVQIINDIHVAMEESVFWECKANGRPKPTYRWLKNGDPLLTRDRIQIEQGTLNITIVNLSDAGMYQCVAENKHGVIFSSAELSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Contactin 4
publication title The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 90
structure length 376
sequence length 380
ec nomenclature
pdb deposition date 2009-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kldA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kldA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kldA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kldA03
3WJLA 5AYUL 5C08B 4OLEA 2WANA 3HZVB 4MA3B 4PRPE 4YQXH 4PR5B 1YN7B 4JFOA 1GGIL 3QISA 4ONGH 4KHTH 4YGVB 5E4IA 3S4SA 1P4IL 1ACYL 4ZNEA 3GMMA 2FYYB 3GJEA 5F3BB 3HAEG 5ICXB 3BX7C 4NCC2 4ZFOA 2DDQH 3HHRB 5INDB 1T7XA 2AXHA 4M6AA 1TIUA 4QGYA 4OF0A 4U6TA 3O3BA 4LIQL 3PHOA 5KG9B 2BHUA 2Z8VC 1A3QA 1ZLVK 1FVDA 2GFBA 4XPBH 3DRTA 4XP4L 2AGJL 2EDWA 4RA3A 2HJLB 2W65B 3MRPA 2ICES 1RIUL 3P9WB 2NY3C 3TVMA 2CUMA 1RULH 3TT1H 2A6DB 4WCYL 3UMTA 1FNEA 1TCMA 2FGWL 2R1WA 3GMLB 2V9QA 2IPTH 2E5EA 2VDOH 4JDZB 4P23A 3QG6A 2VISB 4RX4A 2Y36L 4XP6L 4XI5C 2XWJB 3Q1SL 1F02I 3EYOB 3MRRA 2ZKHH 5ID1A 1KPRB 1SHMA 5KSBE 4TPRL 5BMFL 3MFFB 1BPVA 4RMRA 5AWNH 1W0VA 1I7TB 2X4TA 1WZKA 2DTSA 1TVDA 4XT1C 3MODL 1DQLH 5E4EB 5T5NG 5GGUB 4R4BA 3T2NH 1NCUA 4PJIE 1A3RH 4U1MB 4DWHA 2AEWA 3Q48A 4PJCE 4XCCH 4ONFH 4W4OA 1F3DJ 3FONB 2H41A 2ARJB 3DX9A 3NTCL 5D70L 3MCG1 5IJVB 4PJ5B 4XMPH 2EYTA 1A64A 3JWDL 4PY7A 3VXPB 1ZSDB 4LHUD 3REWB 3QP3A 4X9IA 3DGGA 1GGCH 4OKDA 4GSDL 1YNKL 3MJ7A 1IKFL 4HQQH 4OFYA 4MB5A 1RAMA 1EHNA 1PD6A 3Q3GA 5A2FA 1HWHB 1UEMA 4OBRA 4PRID 3P77A 1KJ2L 3TH3T 5EORH 3U30B 3VMPA 2C3VB 2FIKA 3DO3A 5KN5B 2FO1A 4ZAKA 2VXSH 5D1QA 3GSXA 2YS4A 4NQEA 4XPAL 3F58H 1M7IB 1B88A 4PIRF 2VDNH 3T8XA 3CH1A 4ETQA 1P6AB 1S7UB 3EKCA 3HUJB 4GXUM 1EPFA 3VWKD 2C5DC 1RIVL 3A6CH 1OGAA 5TDNB 5GSVA 3OXRA 1Z0MA 2HT2C 4RNRB 5DJ6B 2HTLC 2X70B 2VLJD 3MX0A 1XGRB 5GS0C 4U2ZA 2BVPA 1UQSB 5IV2A 3FN0L 3WL9B 3PV6B 2IPUG 4I18C 4KTYA 1F4AA 4PTUB 4F2MA 4CNIA 1EEQA 3G6AB 4BQBA 3ISWA 4OZGB 4DFHA 1KB5B 5FDWB 1YECH 1YPZF 1AGBB 4LPTA 2RGSA 4ZQKB 2JE8A 4JN2B 3ZHDA 4TTDC 3WXVL 1NBYA 1RURH 2C7UA 3EYUH 3MQIA 4UBDC 4HV8B 4KJYB 4E42A 3VFNB 2UY6A 3DX6A 4QXWA 2GQHA 3NCMA 1EEYA 1K3IA 4LARL 1IGIH 1XT5A 5ICYA 2NTFB 2XPGA 1VADA 2VDKL 4AIOA 4QY8A 3U9UB 3WDHA 2NW2B 1WUNT 3OPZL 4QYOA 4QRPA 4KK9C 1JF1A 1MWAA 2VE6B 4GJTB 3T0ED 3CVIH 3GGWA 1NFIB 2CK0H 1H3UA 4YK4C 2Y6SD 2QHLA 4NKOB 1BZ7B 1K6QH 1ZLVH 4M3JA 3MLSL 4TQEH 1QG3A 3E2HC 1R3HB 3DBXB 5EO1B 1LEKA 3CDCA 4NKMB 1C5DA 4EDXB 1MFNA 1YYLL 3U6RB 3BAEH 4R7NA 3VD9A 2BOBA 1A4JB 3N1PC 3QO1A 2V2TB 5DVNA 2ATPA 3MRGA 4HXAL 4RIRA 3WLWD 3STLA 1I1AD 3TT3H 5C0CB 2DD8H 3UDWA 3UTSD 2O5YH 5CBEA 4O00A 4X5WB 4E41A 4J6RH 4CU6A 4YHYB 5BXFB 1I7UA 1LO3L 1Q94A 2O61A 3IS0X 4YPJA 1H9VA 1J0HA 2D9QB 1PG7L 2Z92B 4WI7A 4FXKB 3K81A 4XCYB 3GKWH 3TZVC 3ARDB 5ALBH 4KVCL 4EI6A 1N5AA 4X7DC 5E8EB 1CD8A 1DLHB 3W9DA 5SWQB 2CXKA 4AT6B 3B9KC 5ALCL 1KENH 4RMQA 5TDPA 3AUVA 4CMHC 1U3HB 1X5GA 5T1LB 2X40A 2XQYG 3LS4H 3O3EB 4U1KB 3MLXL 4L8SC 4K8RC 5DHYA 4XWOD 3RDTC 4FG6D 1WTLA 2FBJL 3FQRA 32C2B 4MS8C 5D7KE 1EBAA 1HOCA 5HYSB 1M71B 2R56L 3FRUB 2OL3B 4JRXA 1D5MB 2JIXA 2VL4A 4XHJC 1QFUL 5A16B 4L3AA 2X4UA 1ZHBA 5D6CB 5MEOA 1LK3H 4O58L 1KC5H 4CU8A 3O3DA 4XXCC 5B38B 3L5HA 3TYFA 1PKQB 4HPOL 2QR0B 4OLUL 2YD5A 5F1SA 3MBED 3PWUB 1P9MC 1UH4A 4YXHH 3CCHA 1YNLL 3GBML 4QO1A 5J8OA 5L0QC 2VLLA 4HT1H 1X5XA 4Y5YC 1AKJA 3MREB 3IDNB 2X1QA 3QEQD 3W0WA 3ULVE 5C9JB 3HB3C 2R0WL 1SVCP 3I3BA 3ZDZE 2FJHA 1OGTA 3IU4H 2UY7A 2DMBA 1MRFL 2DWEB 3B4NA 2W9DH 5DYOB 1AGDA 3KPNB 3KYOB 3MA9L 4GG6E 2ZCHL 2MMXA 3P0VL 4M62H 4F58L 5MP6H 1EXUA 1SEQL 3H42L 3O4OB 3ARRA 4QXGL 3U79A 4S2SA 3SKJH 3WS3B 4ELKA 4KK5C 4ZTPL 4G8EB 4WW1A 3PL6C 5SWSA 1QFWH 1XGTB 4KDTA 1KCLA 4WWKA 1JIBA 1C12B 2OJEA 1Z6JT 3WS6C 2Z93B 3MV8D 2K9UA 4NQDA 1NDMB 5TE7L 4OM1L 2CDFB 1LO2H 5GXBB 2GITB 3ZSSA 3EO9L 1MH5B 1KCSH 3O0RH 1U42A 2VDQL 2DYPD 4U1JB 2NY7L 4LFHG 3LEYL 4DKFH 2ZUVA 2AV1A 3CFKB 4BELD 5A2LH 3I50L 3C8KA 4MD5B 3GSNL 4H8WC 3VXNA 2XN9A 1TVBA 4D9QE 3B83A 4IIQB 3V52L 5HHOE 5C08E 3WKML 2NY0C 5IMMB 3P4NA 5DMKA 4I3SL 5BV7C 2B0SH 1HSBB 3RWHB 4HPYH 2J8HA 4PP1C 4N8CH 2EC8A 2NNAB 3IDJB 3RIFF 1MFAH 3V4UL 1AO7B 1TZGH 4Q6YA 3G6JE 1IAII 3C6SA 5LXGH 5GHWH 1CFVH 5DLMH 4HFUH 1J8HD 5C6PB 5AUMB 3SDCB 5DMIH 1M7DA 5E56A 5CGYC 1UB5B 2Y9RT 3QUZB 4UV4H 4KHXL 4HZLA 1X5JA 4UT7L 5CJXC 4MXQC 1YY8A 1FRGH 4D0BA 4F57L 3WUWA 1LEGA 3D2UD 1AC6A 3X3GH 3EYVB 3RUGB 4M7LL 2DN7A 1NCDH 4YDLC 5DJCA 1KCVH 1CXKA 5D71L 1YPZA 4HC1H 4LLUA 2XTLA 3U0WH 3P73A 4JO2H 3ULVC 4OZHE 3HC3H 1KGCD 3UTTE 5HI5C 2CDEB 2NMSA 4PJAB 3SJVD 4OCRH 3VFMB 1Z9OA 4MMZC 4MD0B 5J6GB 5DTFA 2IQAA 4UZGA 3QUKA 5I19H 3ZLQC 3OX8A 4QF1A 1CL7H 2DICA 4YHML 2BMKA 4YR6B 4NO5B 2X4NB 4X5XA 4XGZB 2WUCL 2YRLA 1QRNB 4N8VB 2MSPA 2H2SD 5CILH 2IH1B 3KYNA 1MRDH 2I24N 4YPGB 4APQD 1FL3A 1QLRA 4EBQH 1FNSH 3CDGB 3RVXC 5GGRY 1AY1L 3CVHL 1KG0A 1AHWA 4HMEA 4X6DF 5D7SL 3A6BL 3INUL 4J8RA 3VI4E 2DI7A 5DRNA 5HHQA 1MPAH 3SDYL 3NFSH 3WO4C 3P9MB 3IU3A 1T1YA 1A47A 5DEFA 1MCCA 4P5TA 4NOFA 1CU4H 2Z91B 4XC1L 4AEIH 2AI0L 2DQGH 3RGVD 2Y25A 3T3PF 1AQDB 2DWDA 1X4XA 5DVKA 3BXNB 4KI5D 4M1DH 4UTAL 1JL8A 5DJZA 4OCWL 1QFOA 1RZIB 1XGUB 3PF2A 4K94C 1PZ5A 4LDOB 3IFPA 1GGBL 4FZEH 1MCWW 2AJVH 3MRBB 3MSPA 5EUOB 2EKSA 4QLRA 5TPWH 4WGVB 3B5HA 5I18H 1XCTA 2ED7A 4JFZH 1U8QB 4WFGE 5DUMH 4OF3A 5IMLA 4Z5RB 3I85A 3NN8B 4QHKJ 3AB0B 3SGEI 1T1WB 1FAKT 2AEPL 4UILH 5BOZG 5M95B 4XNMA 3H9SA 5FYKD 1HDMA 3EGSB 4OZGE 1A7OH 5E2TL 1R3KB 4OF6A 2HKFL 4TUOB 1J1PH 1KTKE 2V9RA 4FNLH 4R90H 3QHFH 3D0VB 3V5HA 4U6XB 1G0DA 1DL7L 1XCQA 4AM0A 5DUPL 5E2VL 1T21A 3MRDB 4M93B 4EUPG 1EX0A 3H9YA 5D7LD 4PGJA 4BZ2H 5CINH 4OQTH 3LKPB 1VFBB 4QT5A 2ICWI 2R9HD 4ACPA 5IR1A 3DMMA 2VLJE 2CGRH 1RD6A 4NWTL 4H1LG 2X2YA 4G80B 1UXWB 4FXGB 2X41A 2GJZA 1JYVA 1JE6A 5L2KD 2FX7H 4JKMA 3OKYA 3G08A 4EEEA 4ZD3L 4XVJL 3OKKB 2AXGA 3HI5H 3O45B 5HBBA 2J8UE 4GKNB 1U91A 1P2CB 5F71A 4JN1L 4L5FL 3WN5A 4XP5L 3WFEH 2XXMB 3U30C 2XXCB 3SKNA 4K7FA 1KPUA 4RGMB 1G7LB 5C0IA 2ZUXA 4JZNB 4Y5XC 1JN6A 4K8RH 2W38A 5I1CH 5DD3H 4JFOB 3D9AH 3S4SB 5IROA 5HYJD 4ODHH 5DURD 3GMMB 2V7NA 1CFNA 2BP3A 1ES0A 4WENB 3GJEB 2DBJA 4FQCL 5HI3D 2AEQH 1RUQL 3MCKA 1PBYA 4ZSOA 2FEEI 3PHOB 4Z7OF 1CXIA 3RWFA 1FVDB 2DAVA 2GFBB 3DRTB 43CAA 2NX5B 2MCPH 3MRPB 1DDHA 3TVMB 4X4MA 4Y89A 3QZWA 3V4VL 2OK0H 1F3JA 1HHJA 1VSCA 1CR9H 1FNEB 2R1WB 4LFHD 5D96B 4QXUH 4MJ6A 2P47B 3WSQH 3VWJD 4P23B 3UTSE 2G75B 5KS9A 4EKXA 4JR9H 4MQ7B 2D7NA 1G9MH 4P5KA 5JDJA 3HRZB 3LRGA 3VWKC 3MRRB 3MLZL 2L0DA 5ID1B 1PKQE 4PREA 4GO6B 5E24E 4W6XB 1FP5A 4DCQB 1W0VB 4AJ0A 2B1AH 2X4TB 4TRPH 1MNUL 2Q8BL 5T3ZL 4B0MM 3TBTA 3QPQD 1RZKL 3PQYD 1FH5L 4PJ8D 1I3UA 1RIHH 1UVQA 1SBSL 1QYGH 4R4BB 3OQ3B 5CS7A 3FAXA 2VZVA 1TMCB 3HI6L 3N9GH 1NUNB 3HFMH 2VXTH 3MZGB 2OMBA 4R4ND 4NNYB 3C60A 3NIFF 3UEZA 3EDKA 2HFFA 4R2GD 1A7QL 3DX9B 2P8PA 4JQVC 4JO1L 2CRIA 2JJTA 2EYTB 3DVNA 3E6HA 4PY7B 2J1KA 1JGDA 4JY6A 4RISH 5ERWA 2JTDA 3DGGB 4H8WH 3GUTA 3BH8A 1L7TL 2I9LA 3MJ7B 3S5LG 2CMRL 1AXSA 3GRWA 4IOIA 4HF5L 3SE3A 3TESA 2G5BA 3Q3GB 1CXEA 4S11A 1CG9A 4WUUD 3P77B 4XVTL 5TQ0H 5BV7H 2VUOA 4YHYC 4X6DA 2FIKB 4JRYD 3L3GA 4ZAKB 5D1QB 3GSXB 2W91A 1GL4B 4MAYC 3T8XB 4X4ZA 1ED3A 5J1TC 1P4BH 4U1HB 5IQ9A 3NA9H 3ARED 4K71C 3D85D 1AI1H 3ARDC 5HYQA 3V0WL 2ZG3A 3QDMA 3QEQE 1UJ3A 1KT2A 1UH3A 2HRPH 1KIQA 4OLVL 4GBXC 4LVNB 1OGAB 4GRWF 2CD0A 5GSVB 3OXRB 1CN4A 5LKNA 1CFQA 3WV0A 1K9TA 4AG4L 1DJSA 1WLHA 2HA1A 4LSDA 2UVFA 2BVPB 4GAFB 2NY6D 2YD7A 5IV2B 3RWDA 3WLWC 5I30L 35C8H 3HN3A 1JZ3A 3ULVH 4U6HA 5C0BA 4P4KD 1CXFA 4F2MB 3MV8E 4CNIB 2OJZL 1PQZA 1BM3H 1E4XI 4KKNA 3X3FL 4B7IA 3IJSA 4QRQA 2E8ZA 4KTDL 4ZUUA 1MY5A 5M7QA 4EOWH 4F7TB 1NBYB 2C7UB 3WHXA 1Q9WA 2P5EA 3WNPA 5IB5A 4E42B 1OSPL 1RI8A 5C0AD 1TETH 3RUGE 4PGEA 3DX6B 1ND0A 3FL7A 2BSED 1EEYB 4R6UA 4B7LA 4LSUL 2Z31A 5ICYB 4N0YH 1N2RA 2XPGB 1VADB 2A9NH 4EDWH 1QRKA 4YXLL 4J2XA 1QA9A 4QY8B 1N0XL 4FG6C 4MA8L 2RCSH 5BRZD 4QYOB 5C8JA 4QRPB 5JHLL 3AMLA 1FIGH 3LHPL 1MWAB 3R8QA 3ZZ1A 3W2DH 3UTOA 1ETZA 5FFLA 3GGWB 3V6BR 3AXLA 3DIFB 1F4YH 4N5UA 1J8HE 5K33A 3MYZA 2FZ3A 1QBBA 3DXAA 5F7MC 4FABH 1K8IA 1C5DB 2HWZL 5GRZA 1VGEL 3FMGH 4U0RB 5BS0A 4R7NB 2LQRA 2BOBB 3QO1B 2ATPB 3MRGB 1C1EH 3ARGA 4OGXH 4RIRB 1DBAL 3STLB 2F9BT 4WY7H 4OIIL 5ILTL 4HXBL 4UT6H 5CBEB 4QCIA 3K8KA 4E41B 1EVUA 1G9NL 1I7UB 4OZFB 2O61B 1XR8A 4HMDA 4BSJA 1C5BL 5IF0A 3PWPA 2HVJA 4K94H 2LV4A 3QEHA 3VW3H 1KGCE 4GRMA 2VSDA 4WEMB 1REIA 5IFHH 4S1QH 5EWIH 2BVTA 4EI6B 4PRHA 1N5AB 2ZUTA 3SJVE 1MELA 1FCCA 4M1CC 1CXHA 4Q9QL 3W9DB 2YRPA 1R3IH 3O4LD 5I1KH 4FZ8L 1JZ5A 5TDPB 1HHGA 4U1IA 3O6KL 5DHYB 4WI8A 3P4LA 3FQRB 3SDCC 5EO9A 4MWFB 3ARBD 1HOCB 4XAWL 5JPNA 3QO0B 4NQCA 5HVHB 5D1ZD 4G6JL 2AQ3A 4JAMA 4JRXB 1IM9A 1LMKA 3PHQA 4KZEL 1MQ8A 2JIXB 1B6DA 1HKFA 4LCUB 4LSRL 1A02N 3C5ZA 4LQ1A 2O26U 2XG5A 1R6VA 1ZHBB 2X4UB 2GJ6E 4TUJA 5MEOB 1T7ZA 4NNXA 1BEYH 1JRHL 3O3DB 4Y4FD 2BXZA 4P3CH 2R69H 4QHUA 5C3LD 1OD9A 4HBCL 1OW0C 3CCHB 4N9GA 2LVCA 4F15B 1QBMH 1RJCA 2NLJA 1IGML 3D3VD 3UBXI 1AKJB 1F90L 3W0WB 1INEL 2OBGA 2LAGB 1NLBH 1T66C 5E94A 3FT3A 3HMXL 3QHZL 3MRLA 3MR9A 2FJHB 1HKLL 2BVQA 4B41A 5C3TA 1A0QH 1ZV5A 2MNUA 3I3EA 3VFWA 3SGJA 3KPQA 4HS8H 2EEDA 3UJTL 4X6BA 2V17L 5B3JE 2ZWLT 1EXUB 4NKDA 2BRRH 4S2SB 5D72H 1NKRA 1FLRH 4ELKB 1T83A 3SE4A 1K4DB 2NY5L 2ESVD 2BFVH 1A6VH 3KPRD 2R2BA 5E2JA 4WWKB 6FABL 3FKUS 2OJEB 4Z77A 3C6LD 4U1LA 4QHLA 3AU1A 4NQDB 1TPXB 5DMYA 4JPVL 1CICD 3P4MA 4GMSH 1QKZH 5FYKE 3IAQA 3O6ML 4JKLA 2UZYB 1MCJA 2WM0A 5L7XL 2AP2A 5F9OH 2FCBA 1G7PA 2AV1B 1NCCL 4UOJA 3WJJC 4OSUH 3EDDA 3KHQA 5IG7A 2XN9B 1AR2A 1TVBB 4G8GA 2QLVB 3KDMA 3KYKH 5D7LE 3CU1A 2A77H 1MCLA 3P4NB 5DMKB 4DGYH 4G6KL 4POUB 1AE6H 2AABH 1ZT7A 3B5TA 4LQFL 4LNRA 4L4VD 1VGKA 3N85L 4F7MB 4R8WH 3Q6FA 2XZCH 5IEKB 5GRUL 4WJ5A 3VD3A 4WHCA 3Q0HA 3RVWC 5IHUL 1D5XA 3P11H 1JZ8A 1IGJA 1M7DB 1NBVL 3HE7A 2L7UA 2VERN 2Y5TA 5FGBA 3ZKND 4P0DA 1MI5A 4NUGH 1CE1L 4YDVA 4HZLB 5DI8A 2H26A 4C83A 5FKAA 5D5ME 1HSAA 2NX5E 1YY8B 4YQXL 4D0BB 3WUWB 3AB0C 4L9LC 4ONGL 1LEGB 3EJZC 3H9HA 4HIJA 5CEXA 1I3GH 3O6FA 3EJJX 5HYSG 5TFSH 5DJCB 3K8LA 4UNUA 4DVBA 1O7VA 1RVFH 4I0PD 5EU6A 4LLUB 3JTTA 4P48A 3L3DA 3P73B 2WQ8A 1N6QH 5CUSH 4QNPE 2X9YA 3HNVH 4M93C 4C57C 2GIYA 3FAWA 4XPBL 4NHCL 1KJ2B 4GH7B 5D2LF 4Y2DD 4UB0H 1A22B 4M7LT 5DTFB 2IQAB 4M8QA 3FTGA 3QUKB 3OX8B 4QF1B 2QQNH 2BMKB 3TT1L 4X9BA 1ZVHA 3MUHL 4X5XB 4LP5A 3VXRD 1MVFA 4YHZL 4PRDA 1XIWA 5DZNA 3S35H 5E9DD 3KYNB 3GNMH 4TUKL 3EOBA 4BZ1H 4KMLB 4Z0XA 2IBZY 3NPZB 2HT4D 1FL3B 1QLRB 4LMQE 1G6VK 1CXLA 1YY9D 2D4FA 4DUXA 1KG0B 1AHWB 2DQDL 1A1OA 4J8RB 3QXAA 5J3HD 1OD7A 3VXOA 5DRNB 1B4JH 5HHQB 3JUZA 1VDGA 2VLKA 4RGMC 3KPPA 2E7HA 3IU3B 1T1YB 3T2NL 1I9IH 1Q1JH 5DEFB 4P5TB 4HFWA 2BY3A 3MUZ1 4ONFL 4AMKL 3SCMD 5HDQH 3RU8L 2HFTA 2R9HC 2EE3A 3ZKQD 1IC1A 4X4YA 5CCKH 1Z0NA 1OAUH 3HC0A 5IB3A 4KVNL 2CKBA 5JR1L 3SGDH 1MCIA 5MEPA 2B39A 4HLZG 4NDMA 5DJZB 1TTGA 1U8JA 3P2TA 1INQA 5K9OA 1PZ5B 2XA3A 1BF8A 1JGUL 2IGFL 5SWZA 2CR3A 3IFPB 2R1XA 4JM2D 2F8XC 2EKSB 3O2DA 5EORL 1XCTB 1UM4L 1J0KA 3SBWA 1V7MH 2EKJA 5J06A 3VXUA 1DLFH 5CKGA 2HKHH 5GISL 2VDNL 5IMLB 3RX8A 4HKXA 5JUEH 1U41A 1BZQK 4XNMB 3H9SB 1NFDF 4OZIE 2A9MH 3TLRA 1BQLL 1WFTA 2YC1A 1VPOH 4JRYE 3CFCH 4HH9A 3SOBH 1NH6A 1QR1A 4I1NB 3L5WA 4WW2F 3V5HB 1SMOA 4RFEA 1XCQB 4AM0B 5HHNA 1T21B 4Y19A 2VZ3A 1MFBL 1ADQL 5HI3C 1K2DA 3F8UB 3IJYA 5FKPB 1G84A 3RTQA 3ALXA 2R2CA 3ARXA 2X89A 4QT5B 4V1DA 4J3OC 1UYWH 3GB7A 3DMMB 4WGWB 3WYRA 5ACLA 5IR1B 4ZUTA 2DS4A 3AC0A 4P4RA 1YECL 1ULVA 5C09D 4ZFGH 1PX4A 4HWEH 1MJ8L 1RURL 3EYUL 3RI5K 3UTQA 1MCSA 3VDAA 5EU5A 1RMFL 3G08B 2BHYA 4LVEA 4Q7DA 5T5FH 2AXGB 1IGIL 1U91B 5DZLA 1ZHLB 2VAJA 3WN5B 1H3PH 4E5XA 1YC8A 1FYTD 3K4ZA 1HH6A 3AS3A 1A6UL 3SKNB 4K7FB 1KPUB 3BGMA 2UWEE 4EVNA 1JK8A 5D1QC 5C0IB 3X12A 4PG9A 1RHFA 1JN6B 1AGCA 4PJ8C 1Q9KA 3T0WA 2E9JA 3CVIL 2BNQD 3UBXG 3J7HA 2DL9A 1B4RA 1K6QL 5HYEA 5BO1H 5BVPL 1LO4H 2YPLA 1PLGH 2HFGH 5LJYH 4DVRH 2QSCL 1OWWA 2V7NB 1CFNB 3H8NA 1ES0B 5I74B 5BRZE 5CKAA 5D8JH 8CGTA 2AJYL 4GRLB 3G5ZB 5T1KA 1W2KT 1BVKA 1IGYA 3MCKB 4ZSOB 4R26H 3TT3L 1PG7X 2DD8L 2F53D 5JA8B 3MGTA 43CAB 4J6RL 4JHZA 1QSFD 3HMXA 1DDHB 3MLYL 2X7LA 1U8LB 3QZWB 1OARH 4O51A 1ONQA 3QQ3A 1FDLH 3MOBH 5ALBL 1T22A 4WHYH 5KS9B 2VC2L 1U0QA 1QSEE 1CF8H 5LGHH 5CJQL 3SY0B 4P5KB 3DYOA 2B2XH 4D8PA 2ITCA 3ILQC 4PREB 3D1MC 3O6LL 4GMTL 4PD4K 5FYJD 4G6ML 4LGSB 2FH8A 5CZXC 1PZUB 4LVHC 3TBTB 2ZP0T 5HHVH 2WNGA 3T77A 3O4LE 1UVQB 1E6JH 1NBZA 2F54A 2LTQC 2NXYB 1YUHA 2NY6C 5IB1A 4BQ8A 1T7YA 2I5YL 4QOKD 5D2LA 3FFCA 3WFBL 3GJFK 1EJOH 1LK3L 3C60B 1KC5L 2HFFB 2I60L 2P8PB 2PTVA 4U1GB 3WIHA 1JJUA 4KJWC 4MYWB 4XNYH 3ZE0F 1UM5L 3DVNB 3E6HB 4LASL 4RCAA 1JGDB 5FV2A 4JY6B 5ERWB 5F44A 5GJSH 1UCBH 3BH8B 3GUTB 2I9LB 2CKNA 4Z7WE 4PB0H 4ZDHA 4HT1L 2Q3AA 4Q6IA 2V5SA 2G5BB 5J9PB 1UA6L 2A2QT 1CG9B 4I2XA 4Q0XL 1JF6A 5I0DA 2BX5A 4X6DB 3ULUL 4PP2A 5D2NA 2VIRA 4LIQE 3ZE2F 3L3GB 3IU4L 4J3UA 1N64H 4EN3A 4PJ9D 4NO3A 3ZTJH 3L5XH 3UYRH 1KFAL 1ED3B 5L6YH 2EDDA 1BD2A 2QADC 2ENYA 1F8TH 4M62L 4P9HC 5HYQB 3KS0J 3CFDA 3QDMB 3V6ZA 4FTVA 4PJXA 5L8JB 1UJ3B 3SKJL 1KT2B 2C1PA 1KIQB 1QFWL 3BKJL 1UJTA 4HG4J 3UTPD 1BF2A 2CQVA 3LOWA 4TN9A 5I75B 2VABA 4TSBH 2AK1H 1CFQB 5KJRH 1FFOA 3MOAH 2VB5A 1XF4A 4H20L 3NCFB 5D7IF 1KCSL 2FB4H 2ESVE 3RWDB 4NCC1 4ODBD 3O3UN 1DVFA 1MCRA 3KPRE 4DKFL 5HVHC 4XBGA 2ENSA 4LPYA 4U6HB 2G2RB 5C0BB 1FBIH 1PQZB 2PUQT 4LCIL 4MZ3A 4PUBL 4LGRB 3IJSB 4QRQB 3RVVD 4JZJC 1MHPL 4MNQD 4ZUUB 4U7KA 1Q9WB 2P5EB 5IB5B 3MV9A 4F15C 4PGEB 4KDWA 1ND0B 4L8DA 4JLRA 3GSRB 3LMJL 2CK2A 1XR9A 5BVJA 1TZGL 1FPTH 2Z31B 5KTEL 1QQDA 3FFDA 5LXGL 3F7YA 1CFVL 3OHXA 4RFNB 5DLML 1N2RB 5DMIL 1QA9B 4WW2A 5IIEB 4ISVB 4UV4L 1CCZA 2FECL 4HHAA 5C8JB 3CK0L 4LLVA 5FYKH 4L4VE 4LRIA 3VRLE 3D69A 4DEPB 3C2AH 1ETZB 3AXLB 5D1ZC 3R1GH 1HINH 4NZRH 4P46D 3NIDE 5I76B 1KCKA 4P9MH 1NCDL 3NCCB 2FZ3B 3DXAB 1KCVL 2W0FA 2W1NA 1K8IB 2DLGA 5DJAA 3RP1A 3QWRD 5BS0B 1KULA 4Z8FH 1T20A 3ARGB 1J86A 1EMTH 3QUZD 4Z7QE 4NJ9H 5B39A 3L6FA 4QCIB 1XR8B 3QDGD 2F8VA 1NDGB 2R0KH 3UROR 5IF0B 1CL7L 3PWPB 2HVJB 5IGXH 3QEHB 4GRMB 4NKQB 5E2WL 1XGQA 4NBXB 3S6CA 3CZJA 4JKWA 1NC2D 4PRHB 1MRDL 3ARFD 2EIZA 3BE1L 3GI8H 4P3DA 1FNSL 5DD0H 2D03L 3PDOB 4YHOL 3GJFH 3DSNA 5GGVH 3JZ7A 3VXRE 3FQWA 3KLDA 5E9DE 5FUZH 3FZUD 2F15A 3MLTA 5EO9B 5IHBA 1MPAL 3K4AA 5JPNB 1QRND 2P45B 2DM2A 3NFSL 4NQCB 2Y4SA 4LBEA 1IM9B 4YO0A 2FRGP 5GGTL 3PHQB 3D25A 3UPCA 1CU4L 3C5ZB 3I6GB 4JM4H 3KXFD 4RRPG 3DVGB 4AEIL 2I25N 3CLEH 2DQGL 4NNXB 2NTSP 3JWDC 1CGSH 4P5MA 4QHUB 5D6DA 3KYAA 1CFTA 3EOTH 2HMID 5E7FA 5J57B 4N9GB 2FLRT 4A6YL 4M1DL 3P30H 1A3LL 4NN7B 5ISZE 2P24A 4QRRA 3TO2A 2KZ1B 2HLAA 4FZEL 4WV1A 4XVUC 2AJVL 2R2HB 4MMXC 5E6ZA 5TPWL 2X44D 4S1RH 4PJGF 4KROD 4U6VL 2XKNA 5F1KC 1Q9OA 3FT3B 1JGLH 3MR9B 2H8PA 2BVQB 5DUML 1CS6A 1JPFA 1QBLH 4G7VL 3WNNA 4Y4HD 3TBYA 3VFWB 3KPQB 3OWEA 3WO3B 3ZKNC 4X6BB 3CU7A 1HH9A 1IBGH 4UILL 4HUKB 5LQBH 4JDTL 3U7WL 2Q3ZA 3HCVA 2Y5EA 4NKIL 1A7OL 2YN3A 2PETA 2R2BB 5T3ZD 1J1PL 2XOTA 1FORL 4NRXA 4OFVA 4Z77B 4U1LB 3QHFL 3ZKSD 1GH7A 4QHLB 3AU1B 1I7RA 4LSPL 5EG6C 3ARWA 3SGKC 3TP4A 4YDKL 2FIRT 5GSRA 4BK4A 1CFSA 4KRPB 3OKDA 4MCYA 1OPGH 4N0CD 4OQTL 3V6OE 3WEXA 1TJHH 1ZS8A 3JBG7 4D2NA 1FZJB 1G7PB 1SJHA 1BFOB 4WUKH 4L4TD 1OAQH 5F7HA 2VKWA 3QCUH 3HG1B 4Y2DC 4K3EH 5IG7B 4G8GB 5E5MA 3KDMB 1WWAX 3GIVA 3RY4A 3GO1H 1MJUH 3SO3C 5C07A 3RKPA 2EICA 2FX7L 2VR9A 1N6UA 1ZT7B 1N3NA 4LNRB 3THMH 5KSBF 4M5ZH 2JF1A 1VGKB 3RY6A 1C08A 5EOQH 4W6YB 3Q6FB 3QUYD 4GRWB 5C09E 4WJ5B 1EGJL 4L29A 5JXED 5JZ7D 1KJ3H 1YY9C 1D5XB 1OTSD 4C4KT 1QEWA 4HBQA 1IGJB 3FO9A 3HE7B 5EH1A 4PJIF 2Y5TB 4O9HH 3H6JA 1MI5B 4OZ4B 4YDVB 3CXDH 5D7IA 4PJCF 3Q2CA 5DI8B 3MNWA 3U4AA 3Q6GH 4C83B 1FC1A 2IQ9H 4RAUA 5DD3L 3D9AL 3ZDXE 3KPOB 2D9CA 4Z7NF 1FYTE 3H9HB 4HIJB 1UG9A 5CEXB 2LU7A 3O6FB 4FQJL 4Y16A 3SCMC 4FFVD 1QZ1A 4DVBB 2VLRA 4I48A 3IAPA 3RFZC 3SDAD 3BW9A 1NEUA 4Z7UF 5EU6B 3SDDD 1H8OA 3JTTB 3EBAA 3L3DB 2EO9A 5K93A 2BNQE 2NY1D 4XNXH 4Y5VC 5J6HA 5FIEA 3QUXA 3D39E 4O2EA 4G9FE 3ZKXB 3PIQA 3VXSA 2W60A 1WBXA 4P2YA 1IGTA 5H35A 4OLZH 2BC4A 2ICWJ 4JM2C 1OL0A 1ZGLA 5C0GA 1NPUA 4M8QB 3FTGB 2BSRA 2Y72A 4QKXB 3QH3A 3ZT7A 2OK0L 2E8YA 1OAZL 1DN0A 2X4RA 5IESL 2RAMA 4PRDB 1XIWB 2GSIA 2ZUYA 2F53E 2VJXA 1YEKH 1QNZL 3EOBB 1YMMA 4OZFH 4Z0XB 4Y4KA 3VFRA 4AEFA 3K46A 1MQKL 1G9ML 2AK4A 4TSCL 5I16A 4K3JH 4JO3L 3VI3E 1A1OB 3MNVA 3VFSA 4TRPL 3WN5C 3QXAB 5K59E 3VXOB 1V5JA 4UNTA 4PJFE 4QGTA 2VLKB 3KPPB 3VGAB 2VQTA 5C92A 1UZ6F 3HFML 4HFWB 4J1UA 3BYTA 1D9KB 5FYJE 2DM7A 2DQJL 4R0LC 1XGPA 1R5VA 4L1HA 1QTYT 3RVUC 1X5KA 4YFDB 4AZ8A 5CEZD 2YD4A 2H3NB 3HC0B 3NACH 3KR3H 5IB3B 2CKBB 1O5DT 2R0LH 4GRLC 1MLBA 2DLTA 4ZPTB 5HDBE 1G7JB 3MLWL 4NDMB 4QOKE 4PJDA 1U8JB 3TN0D 1INQB 4EUPH 5K9OB 1S7QA 5SWZB 2R1XB 3J8F7 4MLSA 2FSEA 3IRPX 3LPWA 5TQ0L 1EFXA 1T0PB 1RUAH 2R4SH 5E08L 5CGMA 3VXUB 5ECJE 5C9KA 1ZGLM 1P4BL 2R29L 3NA9L 3W11D 1AI1L 3LSOB 4HKXB 2IADA 1QLEL 2BZDA 2KPNA 4R4FH 1DFBH 4OFYD 2YC1B 1D5IH 5GRJL 4HC1A 4HH9B 4ZXBD 5HGGS 1QR1B 1JNHA 4E0RA 3UYPA 2AW2A 2WQRA 4N90D 1GGIH 4GKSA 4RFEB 4LLMA 3ROOA 3WUWG 3M45A 1P4IH 3O2VL 4JG0H 5HHNB 4Y19B 2ZSWA 4NQED 2R8SL 2ZJSL 3KPSB 4NHUA 1K2DB 3IJYB 5F7LB 35C8L 1FZOA 3AAZB 4XCEA 3UTPE 4V1DB 2WP3T 4P2RA 2EDEA 1ZWIA 5JHDA 4ZUTB 2Z0BA 4LIQH 4PJGA 4P4RB 2WWKT 3O3AA 1KN2H 4ZPVA 4FQXD 1XF1A 2AGJH 3BZ4A 4PRPA 4EOWL 4HH8A 1YZZA 5DGRA 5BCAA 1NFKA 1VESA 5EU5B 3NCYP 1TETL 4WCYH 5MHSD 4JEGB 1TNNA 1I8LC 2FX8L 4ODTH 2FH6A 3HLAA 4N0YL 4F7EA 5I73B 4E5XB 2A9NL 4EDWL 1HH6B 43C9A 3Q1SH 3BGMB 2AAVA 2RCSL 4EVNB 1JK8B 5IVOA 3X12B 2EC9T 5BW7C 4PG9B 1FIGL 5BMFH 1AGCB 1RZJC 1PAMA 1Q9KB 3CX5K 3W2DL 5IVXE 3P40A 3TO4B 1U3ZA 1BQHB 4IJ3B 3VGBA 2YPLB 3MODH 5IW1A 1JWSA 3UJJL 4XNZB 2IEPA 1PVHA 3GBLA 3TA3C 4FABL 5DGQA 3WMSA 1RHHA 5I75C 3FMGL 5T1KB 3AY4C 4JFYA 1BVKB 3UX9B 1MHCA 4GXUN 1IGYB 1DEEA 5ABDE 3B3IB 1J11A 3ULVF 1O0VA 3CD4A 1UGNA 4UT6L 5KSBA 3MGTB 3O9WD 4MJ2A 3ZDZF 2R2EA 1F4WL 4GG8A 5JXAH 5J11B 4GSDH 1QSZA 2X7LB 4K94L 4GG6F 3VW3L 3LY6A 4GW5B 4KUCD 4O51B 1ONQB 4ETYA 4OKVA 4PJIA 1A21A 1NLDL 3RJQB 2R4RH 1T22B 1KJ2H 3G6DL 3K8MA 4X80L 4PJCA 4PRNB 5D7JD 2DQIH 4RFOH 3JVGC 1R3IL 3FQTA 4YHLL 4OGYH 3ET9F 4D8PB 2ITCB 4WO4D 3SDXE 2NQCA 1X7QA 4AEHH 4RFNC 1QVOA 3EHBD 3CIQA 3T77B 2PCPA 4OQTA 2YPVL 1NBZB 2F54B 4RZCA 5T3XD 1YUHB 4DTGL 3BIKB 2PN5A 4DEPC 5IB1B 5JPMB 2DIJA 1ZHKA 5D2LB 3FFCB 5DA0B 4JFFD 1DBBH 5IP4A 1JPGB 1E4WL 1I9RH 1BEYL 3X14A 1AGEA 3Q5TA 3U36A 4BFBD 3DV6B 1BBJA 3H3KA 1KLUA 5SX5K 1NEZA 4AENA 1QBML 3X13A 5C6TH 3G6JF 2XWTB 3KXFE 4OLWH 4Q6IB 3TZVA 1NC4A 3NAAL 4JRXD 4I2XB 3M8OL 2HAZA 1NLBL 2C4XA 3B9KA 4C4KO 4PP2B 5D2NB 2VIRB 3K2UH 2VR4A 2DI8A 4EN3B 1A0QL 3BT2H 4NO3B 4L8SA 3CZFA 1J10A 3RDTA 1BD2B 5DD6A 1KYOJ 15C8L 4U33A 3S3SA 3CFDB 4FTVB 4PJXB 2BRRL 2M1KA 1FLRL 3HG1E 1AH1A 3OPZH 4Z76B 5EU7E 5SV4A 1T6VN 4OZHF 4RGNB 2VABB 1UB6A 3PWJB 1FFOB 3MLSH 1XF4B 1AR1C 4XXCA 4GMSL 2ICCA 1P9MA 1YYLH 4MGXA 2CPCA 1KB9J 5T3ZE 4NT6A 1XMWA 4OSUL 4HXAH 3NFPA 4Y5YA 5SWSD 4XTRD 1T5XA 2NXZB 1SM3H 4WWKD 3A6OA 4X8JA 5CWSA 4BA8A 2A77L 4FQHA 1RJZA 5SX4I 1FCGA 3QAZC 4CVUA 1KSRA 3MV9B 1AE6L 5FM8A 3GSQA 2AABL 1BJ1J 4WVRA 4L4TE 3LKQA 4NN7C 4L8DB 3ES6A 5I8KH 4JLRB 4P57A 4R8WL 1JF5A 5BVJB 4I0KA 2XZCL 4OCNC 3VI4F 3I6LE 1QQDB 3FFDB 3F7YB 3P11L 1FFQA 2PO6D 4XX1G 5E99L 3PL6A 4WW2B 1A5FH 1W0WA 3QI9C 4OV5A 4NUGL 2DLFH 2R1YA 2H6PA 4HHAB 2W9EL 4FQQB 4LLVB 3WS6A 1T1ZA 3TBSB 1CDJA 3MLXH 3D69B 4EQ2A 3SGJC 1NJ9A 5GPRA 1RZGA 1ZT4A 2FBJH 4HAGA 5AG8A 3SE4C 2R56H 2BOCA 2A0LD 3O8XB 4XPFL 2EYRB 1RVFL 1MCBA 2H2PD 2W0FB 4K9EL 2AJSL 3WCYA 1C8PA 1ORQA 1TENA 1QFUH 1N6QL 3F6IA 5CUSL 3I2CH 1T20B 2XNAA 3QFDA 1NCWH 3FQNB 2HMIC 4KRPC 5B39B 3P0YH 1T5WA 4HPOH 4UOW1 2VSCA 2EDHA 3VRIB 1XH3B 2OSLA 4TVPD 1NANI 1XGQB 1EO7A 5F1NA 3S35L 1OVZA 2R0WH 4OZGF 3GMPA 3GNML 4Y4HC 2EIZB 4BZ1L 1ZGLP 3QDHA 4NM4H 4P3DB 2EZ0C 4KRMB 3QIBD 4NFCA 5DFWH 5H37H 5MENB 1J05B 5CJXA 5C0DA 1S7VA 3L9RB 1YC7A 4KXZI 1TJGH 2ZCHH 3P0VH 5DUBA 1JHTB 1SEQH 2K7QA 3H42H 3FQWB 2OLDA 1SEBA 1OB1A 2XIDA 3IRZA 3MLTB 4KAQH 1RZKC 4ZTPH 1B4JL 3VDBA 3LDBB 2EDXA 1I9JL 4LBEB 4YO0B 1CIUA 1U3JA 3ME0A 1S9WA 4OM1H 2WP3O 3D25B 5D93B 5TE7H 3C8DA 2GCYB 2YHGA 1RK1A 1FG2A 5HDQL 1E4JA 3EO9H 2WWKO 4KKLD 4KKBD 2NY7H 4GG6A 4NGHL 1MAMH 3LEYH 1NGZA 1UXSA 4P5MB 5CCKL 1CFTB 4WTWA 1GZPA 4X0KA 3GSNH 2J8UF 4GAGL 2NY4B 2P24B 4QRRB 3TO2B 5EC1A 1ZANL 2BSSB 2HLAB 1CDUA 4WV1B 5KZCD 3KG5A 1XZ0A 4GKZA 3ZKXC 4AK1A 5I1IL 4OI9A 2DL2A 1ZVSA 5CEZE 5GRYA 3QUYC 2XKNB 3BOVA 5JZ7C 4F3FA 3AFLA 1X5IA 1WK0A 2H8PB 1YEJL 4M7ZC 4JHWH 2B4CC 1OTSC 1S7SA 3KPSE 1EO5A 1JPFB 4NC2B 3TBYB 2OTUA 4QTHA 2RBLA 1WVZA 1QP1A 1CTNA 4O5LH 1HH9B 5FXCH 4DZBA 5JUEL 4YC2C 5IKCA 5FYJH 3HCVB 3LZFH 2F74A 4G6FD 5EUKB 1GPOL 4IEFB 2XV6B 1VPOL 4KHXH 5HJ3B 3SOBL 5HHOA 5CD3B 2OI9C 5C08A 1RZJH 5E95B 3U1SL 4NRXB 1YN7A 1I7RB 4FFVC 4JJ5B 1P69B 4NQVA 1A6PA 3SDAC 2BNRD 3SDDC 5GSRB 4M7LH 1CFSB 4Z78A 5E8DH 3OKDB 4MCYB 4WHTA 3ZDYE 5GIRA 4ORGA 3G6JA 1NGWA 2WV3A 1N5YH 1ZTXH 3WEXB 1ZS8B 5KBNC 1QO3A 3IGAA 5EU3A 1SJHB 4WFFE 1UYWL 1D9KC 3LEVL 4LOUD 5E6IA 2XKSA 3GIVB 2N56A 2HJLA 2DQUH 4D0CA 2W65A 1KTDA 3LN4A 4YHMH 2A6DA 3UAJC 5LVEA 2WUCH 1C08B 3ULUD 4JDZA 1G7QA 2X9XA 1ROWA 1T0MB 2E7LA 4OZHA 3CX2A 3SKOA 2FHCA 3UTTA 1QEWB 3FO9B 1CGTA 3H7LA 3P4OA 3CVHH 5D7IB 5IK3A 4JFED 1KEGH 3MNWB 5MHSE 3MFFA 4XPGL 4OGAC 2E9IA 1OLLA 2GK2A 4RAUB 3INUH 3HPJA 2BNUA 3U0PB 2HJKB 5DDHA 5BO1L 1QPPA 1LO4L 3F7PC 2HFGL 4P2OB 4I3RL 3EOAA 2GI7A 3CSPA 1KELL 4Y16B 1E4XH 3MRNB 2KBGA 2VLRB 4I48B 3BW9B 5FOJA 5M94B 3LQZA 1KBGH 3TJEH 2ARJA 4R26L 5J6HB 2M8XA 3QUXB 4O2EB 1KXVC 4RGOL 3PIQB 3Q5OA 2EDBA 2W60B 3VXSB 3GK8L 1IGTB 5F7DA 1G9NC 2JB6A 1ZSDA 3REWA 5H35B 1L6ZA 4LPUA 1NL0L 1ZGLB 5B4MD 4U2YA 3C09B 3QH3B 5DR5H 1OARL 4K07A 4NC1E 2JKXA 2X4PB 4X5LA 4CN4A 2X4RB 2GSIB 3MOBL 4N0FA 2DM3A 4Q58C 1CGUA 1YMMB 3T2OA 3VFRB 5F88A 1CF8L 2NY2C 5LGHL 4ELME 2AK4B 3S9DB 2XTJB 4Y5XA 5I16B 2B2XL 1NUDA 3B2VH 4HUXA 3MV7B 4KKCD 5DJXA 3ZT6A 5J0BA 5KVFL 3VFSB 2AEPH 5F8QC 1VHPA 5I73C 2ICEA 5IVZB 2VITA 4K2UL 4LAQH 1FO0H 2NZ9D 5HHVL 3HR6A 1CQYA 2RB8A 5TDNA 3RWJA 4XZUA 5CFHA 4IOSD 5DD1L 1T4KA 3ALWA 1VEMA 1Z3GH 4KZDH 4J1UB 1Z9LA 5E2VH 2VN7A 4LHUA 3TO4C 3T1FA 3NBNA 1HCVA 1UQSA 1XGPB 1R5VB 5MEQA 2X5PA 4XNZC 4XNYL 3TNNA 3RUGF 5T3XE 2NY3B 5FCSH 2CO6B 4PJXE 4OZGA 5T5NF 1UCBL 5FDWA 4PJDB 1KJVA 3QJFB 1S7QB 5EOCJ 3BD5A 3HE6D 3D48R 5LG1A 1EFXB 3IJHA 4UIKL 3RX7A 3QNYA 2O93L 3C60D 4XVJH 3VWKA 1JGEA 1MFEL 4MDJA 3UYRL 5L6YL 4J3WA 3T2QA 4JN1H 3DX7A 3CGTA 3DETC 1MIML 1HQ4A 3FQXA 2IADB 2VLJA 1JYXA 4NFBA 2NY5C 5ANME 4V2BA 5E5RB 2XY2A 1EHAA 1JNHB 4YDIH 4M6ML 4TSBL 5GS1C 5KJRL 3MOAL 5C1MB 5DK3A 4FOMA 4GKSB 4LLMB 3ROOB 2DQEL 1U2HA 2ZSWB 4YDJA 5I6XC 5TE4H 1DR9A 4JQVA 2EIBA 2JJUA 2J8UA 4NC1C 2FB4L 4FQCH 4ODVH 5GGRB 1FZOB 1YMHA 3PGFL 3O9WC 4P2RB 4EI5D 3RAJL 1FBIL 3B9AA 1ZWIB 5JHDB 3TWCH 4PJGB 3S3JA 5DMJB 1HYRC 1H3VA 3O3AB 4CADB 1Y6MR 4L8BA 4ZPVB 4OCXH 4X5WA 4UMGA 4D3CH 3BZ4B 4ZG1A 1PW3A 3V4VH 5D7JC 2Z92A 4MAYA 2P8MA 5B21A 1FQ9C 4MVBD 4Q6IC 2SEBA 3ARDA 4K7PY 3HLAB 1FVEA 4F7EB 3WDIA 4HK3N 1CLOL 2YBRA 5E8EA 4GBXA 43C9B 4OV6F 2VL5A 5J12C 3MLZH 5T1LA 4O4YH 3RIAF 2P5ED 1MNUH 2Q8BH 1OLZA 5T3ZH 1HINL 1IVLA 5B8CB 4Y1AD 1RZKH 1WAAE 1JWSB 1I1AA 3NH7L 2V9TA 4X6CE 4ERSH 3UTSA 1RHHB 3HI6H 5IBLD 4NM8L 3IB4A 3CAFA 4KJPD 4G43A 1MHCB 1DEEB 1EMTL 4JFPA 5D6CA 2DJSA 1JHKH 1ZHNA 4NJ9L 1A7QH 5MENE 4PJBE 1PKQA 5FM4A 5KSBB 4NQTA 2R2EB 1P4LA 2VQ1A 4YFEA 4LCWB 1BWMA 3OB8A 1L7TH 3D6GA 5GZNC 5B3JF 4HF5H 3TIEB 2NXZC 5C7XH 2EE6A 4U7MA 4OKVB 1MOEA 3IDNA 4PJIB 5E1HB 4PJCB 4M61B 1F11A 1B90A 3ARGD 3LRHA 3T65A 4X83A 3FQTB 9CGTA 1IAKA 2B4CH 2E7CA 4WDIA 4TVPE 4I3GA 4IBLT 5C0EB 4YK4B 2PYEB 5GGVL 1KIPA 1X7QB 2ADGB 4MXVF 3QIWD 5FUZL 1QVOB 4KU1A 4HJ0C 2WZPD 1RU9L 2PCPB 3WD5L 2YZ8A 4KPHH 4MNGE 1F58L 4RZCB 4LVOC 2WBKA 3PWLA 4JE4B 4PRHD 3UJIH 4H88H 4PG2C 1KTRL 1BAFH 1NAML 1ZHKB 4W70A 2GITA 3IDMA 3DX8B 5BZWA 4CJ0A 1CD1A 2ARWA 3X14B 1AGEB 2E3VA 3LS5L 3HI1A 1DBJH 3O8XC 3U36B 1CGSL 3IDIA 1BBJB 3W39A 3QEQA 1RUMH 1R0AH 3EOTL 1KLUB 2BVUA 1NEZB 3I02A 4MD5A 3P30L 4AENB 3X3FH 1P6FA 4PLJD 1MAJA 4NQCD 1MCOL 4KTDH 1S3KL 1NUFA 3TZVB 1NC4B 3PWVA 5DHVB 3C5ZD 5KVEL 4ALAL 1SMAA 1O7SA 1HSBA 2XICA 4S1RL 3B9KB 1OSPH 1JGLL 1FLTX 2NNAA 5D5MF 1T89A 1QBLL 4NNPH 3VA2C 3CZFB 4NP4L 3RDTB 4NZDA 5DD6B 3DO7A 3AMKA 2OR9L 3BPCA 5CEYA 3SDCA 5B3NA 3MV8A 4YXLH 2X4OA 2HLFD 5DQJA 4B50A 5FCUH 3TCLA 5IFJA 2V5RA 2YWYA 4XPHL 1JGVL 2NCMA 5ADPL 5JHLH 1RJYA 4QNPF 3DHMA 1N4XL 2JELH 1JFQH 1UB6B 5FUOH 4YEEA 4UDUA 1II4E 3NPSC 3SE8H 3EYVA 1JHLH 3RUGA 5IWLA 1OPGL 1VACA 4LSVH 4K23L 5J1AA 3LDBC 1B9ZA 1CDCA 1OW0A 1TJHL 2HWZH 1VGEH 2PR4L 1WICA 1N6VA 5L0QB 4NT6B 1QLFA 4G5ZL 4WUKL 5CEZH 4OFKA 2NR6C 3QCUL 1A1NA 3NFPB 4Y5YB 4K3EL 4Z9KB 1T5XB 2BNRE 4OIIH 5C86A 4WI2A 3RJDA 1OAKH 4X8JB 4UTBH 1HNFA 5CWSB 2Q86A 1MJUL 1JYNA 4FQHB 1RJZB 1TXKA 1YQVH 5EO0A 1R5WA 3BISA 4QWWC 5AZ2L 4ODUB 1J8HA 1EO8L 1EHXA 3GSQB 3THML 5DQDH 1P1ZB 3LKQB 2YN5A 3ES6B 4XGZA 3VXMB 4P57B 2NY4C 3QIBC 4LEXH 1I1YB 4WV1C 1BIHA 1KJ3L 4O02L 4Q9QH 2JK5A 4G8FB 4UQ2A 1H0DA 1W0WB 1T04A 4O9HL 4OV5B 3MGOA 2R1YB 2H6PB 3CXDL 1UC6A 1T1ZB 3F6LA 1NJ9B 5I8OH 3ULUE 1ZT4B 4G8IB 4XAWH 4IRSC 4PGCA 4UINL 2BOCB 2AJXL 3MRCA 3WJJA 4KKLC 4YBLB 4JFEE 3SJVA 1ORQB 1YMME 4S0SD 2GJJA 3VFOA 3EFDH 3HE7D 3N50A 1YEFH 4IM8A 3QFDB 4LLDA 1VERA 1EHLL 2N7BA 1JRHH 2PTTA 5IEHA 2NY0B 1T5WB 3MV7E 5BV7B 3GSWA 4KI1A 1WWBX 4HBCH 4S0TD 1U36A 2C3WA 2BY0A 3P0GB 5FHAH 3HNTH 2OSLB 1RZIA 5CMAA 5E7BA 3X11A 4APQA 5F1NB 2QTEA 4YJZL 2DTMH 4OZIF 4BKLA 1INEH 4X7SH 2ARJQ 1U6AH 3QPXH 1S8DA 3AS0A 3RRQA 3QHZH 3BDXA 4C59B 4Y8AA 2GJ6A 5LGKA 1KEML 4IOFD 2VDRL 5C0DB 1S7VB 3RY6C 3DSFH 3UJTH 4PJ7E 4C56B 4CN6A 2V17H 4L9LA 5DUBB 4U3CA 3BMVA 3ALPA 1SEBB 1OB1B 1G9EA 2NY5H 4YDLB 2YZ1A 3RL1A 1XIWD 1HILA 1G6RH 5EOCH 3BN9C 1S9WB 1INDL 5FOBA 1RK1B 3AM8C 5J7CC 1S7TA 5HHPA 1A6ZA 4P2OC 2E6QA 1UKSA 5I15H 3U0TA 4GG6B 1F97A 2RIKA 1NGZB 1UXSB 2ERJB 4RDQF 5IB4A 3HA0A 3KR3L 1WIPA 1GZPB 4X0KB 4LSTL 2R39A 2VDPH 4DN4L 1F5WA 3GM8A 4Z0BH 1F4XL 5EC1B 1OAYL 2FL5B 1XZ0B 1U8NA 4GKZB 3VRJA 1FL6B 5GGQL 2DKUA 1ZVSB 2UWEF 2H45A 4G6KH 3RPIA 3ULUC 4LQFH 5FYLL 1NMCB 4TNWK 2OR8A 1S7SB 1U8OA 3EYSH 3N85H 3O45A 5A43C 2X9WA 4LNVA 4NRYA 4QTHB 4RSVA 5EU4A 3F12A 5LGJA 1Z9MA 4DZBB 5DC4B 1I85C 4HK3J 4IS6B 5IKCB 4R4FL 4KJQC 1MUJA 2F74B 1CE1H 3DOSA 2QL1A 1GC1L 4HIHA 3EO0A 4JZNA 5D7LA 3RVTC 3UPAA 5HHOB 1T6WA 4W68A 3T08A 1LDSA 4U3HA 1CZ8L 5T3XH 4NQVB 5FECA 3B43A 3STZA 4JG0L 2X10A 4Z78B 3VXUD 2OX5A 4YHIB 1U9KA 3NCEB 1OP3K 4WHTB 4JO4H 5EULV 1WF5A 5GIRB 4ORGB 3G6JB 1NGWB 3V8CA 2W0LA 1QO3B 2ZUWA 3IGAB 5EU3B 3CDYA 1KPVA 5FO8B 4IMKC 1KN2L 5B39G 5E6IB 4NHCH 2PNDA 5D5MA 4UT9H 5HHXH 2NX5A 3C5SA 1ZLWH 4D0CB 4IMLA 1KTDB 4QTIL 3LN4B 4FFZL 1VKXA 3RTQD 3GJFA 4YHZH 4ODTL 4OI8A 2X89D 1G7QB 2G75A 4TUKH 3L7EA 5JNYB 4OZHB 3EYQD 4KKCC 4JRWA 3SKOB 3UTTB 4MQ7A 5DJYB 2J6EL 2P42B 4CVXA 3HRZA 5EFIB 3P4OB 1NGXA 3QQ9D 4L3ED 2NZ9C 5F96L 5IK3B 2DQDH 1N8ZA 2EXWD 2E7BA 5GRXG 4DCQA 4NZJA 3F7QA 5IMKA 3HPJB 4HGWA 2BNUB 4LCWE 5DDHB 1FSKC 3EOAB 4MJ4A 5F8RC 1NCBH 2VKXA 5HHMD 5CBAA 4CKVX 4Z7WF 2CUIA 3LQZB 3V9FA 4AMKH 3RU8H 3PGDB 4NNYA 3DTXA 4X6FA 5HI4C 5ICZA 4Y1AE 3L3OA 5GRVK 1PKOA 4PGZA 2PYEE 5F7DB 3VWJA 2JB6B 4JPIA 4KVNH 5JR1H 4BM7A 3HE6C 2FR4A 5JXAL 2YPLD 4CDGC 1IAIL 4LP4A 4FA8A 1JGUH 2IGFH 5KOVC 4DOHB 3WIIL 2R4RL 5HD8D 4N0FB 5EBLA 2DQIL 5I66B 4RFOL 1UM4H 5F88B 3OF6A 25C8L 2J4WL 5F7NC 4WTZG 4XC3L 2KQNA 4OGYL 1GZQB 4Y5XB 5F9WB 4LGPB 3WXWH 4PJ8A 5GISH 4HUXB 4U1HA 5DJXB 1DQQB 1H8NA 3D0LA 4AEHL 3QUMH 1UWGL 1BVZA 2ICEB 2VXQL 2VITB 4JY4A 1BQLH 2DQTH 5FYJU 3RWJB 4XZUB 1X9QA 5FAAA 1T4KB 2UZXB 3DGCR 3LD8B 4YE4L 1SJEA 2M2DA 4LHUB 1DBBL 5LAXA 3T1FB 1MFBH 5B8CC 1ADQH 4EI5C 1I9RL 2XZAL 5MEQB 2FD6L 4F33A 2PXYD 3TNNB 4J12A 1HIMH 1WCQA 3B6SA 3HZYA 3ABZA 4OZIA 1JMXA 2IC2A 1WZLA 5C6TL 3FOLA 1YYML 3V0VA 4JRYA 4OLWL 1KJVB 4R96A 4RWYH 1NGYA 4TVPH 4JGJA 5DJDB 3CLFH 1MJ8H 4F7TA 5F7EH 5CIPB 3IJHB 3KNBB 3V0AC 3SQOL 2Q6WA 1EAPA 3FFCD 5LCVH 3D85A 3QNYB 2D4DA 4MXWH 3DECA 1RMFH 3K2UL 3VRLF 2HFEA 3VWKB 1JGEB 3O41A 3BT2L 4MDJB 2BSTB 4WI5A 1MRCH 1PY4A 4I13B 1J9CT 3DX7B 4GQ9H 1OP3H 3NIDF 2HG5B 3MJ6A 3DURA 1HQ4B 3FQXB 2VLJB 1K8DA 1A6UH 3DHJA 3HR5A 3S34H 5AAMA 3BP6A 1R24A 3V6FA 4JFHD 2EH8H 4HJJL 2YK1L 3DIFA 4Z7QF 2BCKA 5DK0A 5BQ7A 1IGFH 5BVPH 2LVEA 4KGLA 4P4KA 5AZEH 2QSCH 2V2WA 4YDJB 3RIFK 4PLKC 5TH2B 2J8UB 2IANE 3LQAL 4PB9L 3VXME 3BH9A 1ACZA 2AJYH 2JJSC 1YMHB 1F13A 4PBVC 3WNKA 2UWEA 3ZHLA 1SM3L 1DCLA 4L8BB 3CNKA 3HZKA 3MJ8A 5EBGA 4OZFA 1DQDH 2FGZA 3EOYG 3MLYH 2YOCA 4WI3A 3BUTA 3K0WA 3B9VA 4BK5A 2Q76A 4M7JH 4MAYB 5TQ2L 2P8MB 1MVUB 5I8KL 2QQKL 1DVFD 5DVOA 5BRZA 4Z95H 4K71B 4KQ4L 2SEBB 4UI2A 3FN3A 8FABB 4MA1B 1FVEB 2VC2H 4NSKA 4PGDA 2YBRB 2Q8AH 3T0EB 1Q38A 2YMXH 3D5OF 4GBXB 5CJQH 1XEDA 1A5FL 5GGSY 2VL5B 4NQXA 3FO2A 3QIWC 2DLFL 1AFVH 3O6LH 4GMTH 5HTSA 4G6MH 1PEZA 1J12A 2WBJD 3S8WA 1U95A 4MWFA 3QO0A 2IBZX 2GTZA 1EZVY 1I1AB 3RGHA 1C5CL 3RA7H 3UTSB 2EDQA 2J2ZA 4LCUA 2I5YH 1QSEA 4XMKL 3ZYZA 4G43B 3I2CL 3WFBH 4JFPB 4EUPA 1NCWL 4JZJA 1V3MA 5DMGC 1ZHNB 3LKNA 1J5OL 2I60H 3P0YL 2D2OA 3S35X 4PLJC 1UM5H 4C56E 1CGXA 1H5BC 2P44B 3MPCA 1P4LB 4I9WD 4LASH 2VQ1B 3PXHA 3F65A 1WISA 2ZG1A 3O4LA 1I8MA 4JM2F 1KIUA 3S36H 4HULB 1KLFA 1VA9A 1S9KC 1UA6H 4LLAA 1AIFA 1MCNA 4Q0XH 2DQCL 1F11B 3V4PH 3ULUH 4DGIL 3BSZH 4KK8D 3T65B 3CFIC 1G9MC 1FIEA 1JP5A 3EZ8A 4NM4L 1IAKB 4OCMC 4N5ED 4WDIB 3OKOA 1CIDA 1KFAH 1RUKH 5JQ6H 1TJGL 5JLZB 1KIPB 3PNWA 5D1ZA 2VQUA 1M4KA 5F97E 3EJYC 1K4DA 4KAQL 4Z7WA 2CIIA 3FO1B 5D1XD 4ZOEA 1X6LA 4CN1A 1IM3A 3BKJH 4KFZC 2VZUA 2KH2B 2FEEL 2X4QA 3PWLB 2HTKD 1DEDA 4G42A 3MBEB 1FNAA 3LRSA 1CWVA 3IDMB 4H20H 1E28A 4OFPA 5BZWB 3ARZA 2YPKA 1CD1B 4N9OB 2BVYA 1XFPA 3HAEB 3HI1B 2A6KA 3BEWA 1MAML 3IDIB 4L1DA 1FYHB 5GZOC 3W39B 3QEQB 2DLIA 4YBLC 3I02B 4JJHA 4LCIH 2ZUQB 1IJ9A 3L3HA 3QA3A 4PUBH 4S1DC 2P49B 1MHPH 5JORA 3TJHD 2D7PA 5D9SA 3PWVB 3VH8A 5DF0A 5AAWA 4POZD 3KLHC 4YFLF 2IAMD 3IKCA 4GLRI 2DJ4A 4JHWL 4FFWD 3VMOA 3UO1H 2ESVA 3LMJH 4F7MA 3VXTB 1JPTH 3WFZA 5IEKA 3KPRA 1N0LA 1ZVYA 3ZDXF 5KTEH 4ZODA 3DO7B 1Q9LB 4O5LL 3BPCB 3E0GA 4HIXL 5CEYB 1W0YT 3MV8B 2C3GA 2X4OB 5EBMA 3OKLB 5DQJB 2QKIB 3P3YA 5FYJL 3TCLB 3OSKA 5IFJB 3LZFL 3UC0L 12E8L 3CK0H 3IS1X 5KS9F 1RJYB 4P99A 1RZJL 3BHBA 2R23B 4OD2A 3FHAA 4UDUB 3D18A 4YEFA 5E8DL 4I77H 2I07A 4WI4A 1PDKA 1VACB 2FX9L 1X4YA 2VZ1A 3MGAA 4JB9L 1N5YL 5J1AB 1ZTXL 3RNKA 4ZO8A 3BPNC 3QB7C 1QLFB 3UYOD 4JDVA 3LPGA 1MCKA 1A1NB 4JVWA 4DW2L 1WFNA 1A4KA 4L4VA 1TDQA 1KJ2A 3B2UD 1NAKH 2DQUL 2Q86B 3GHBH 4BH8A 2ERJC 5EO0B 1R5WB 2X6MA 3UZVB 2ATKA 1J8HB 3S5LA 3BQUC 2RQ8A 3VI3F 5E2WH 1S78D 2FBOJ 2AKRA 3QIUD 1PY9A 5K59F 3R0MA 4IOFC 4PJFF 2YSSA 3BE1H 1VEOA 1TQBC 3OJ2C 2JK5B 4UQ2B 1H0DB 3RHWK 1T04B 3D2UB 2D03H 1NMCC 5L8KB 3MGOB 2ADIA 1F3DH 2D7OA 3U7AA 1PEWA 1M05A 1KEGL 5L9DL 4YHOH 2MHAA 3FO0L 4I0PA 2VWEE 5C07D 3SGKA 3F7VA 1RZ7H 4PGCB 4OFIA 1E4XL 5HYFA 4DOHE 5HDBF 3MRCB 5GGTH 4CDHA 4CMMA 3SJVB 4HS6B 5HGBA 4Y2DA 3VFOB 1KBGL 3TJEL 3E8UH 4LLDB 2PTTB 5IEHB 4M7KL 2YXMA 4URTB 1GJIA 3VXRA 3GSWB 5MI0C 5E9DA 2MQCA 4A6YH 2OP4L 1V05A 4DAGH 1A3LH 1HNGA 5CMAB 5DR5L 2YUZA 3MJ9H 4KK6D 3X11B 4APQB 5EA0H 1XF2A 5E6IC 3U2SA 4BKLB 4JZOB 4GXVL 3MV11 4U6VH 4DJMA 1YNTA 3RZWA 1S8DB 3IAGC 3C8HA 2GJ6B 3DUSA 1L0XA 1V3KA 5DZOA 4G7VH 3B2VL 3U83A 4L9LB 3QDJD 4PRIE 4JQXC 2E7LC 4JDTH 3U7WH 2CIKB 4LAQL 1FO0L 4MJ5B 2Z9TA 4NKIH 1RK0A 2P5WD 1OQOA 5ISZA 3SCMA 4HCRH 3QG7L 2DOCA 2GHWB 3RL1B 1H3TA 3BP7A 1HILB 2DRUA 3RGVB 2YD1A 1FORH 4IRJD 1TZHA 3FB6A 2V5TA 3AGVA 1Z3GL 4KZDL 4Y4KD 1R3LA 4LSPH 4Y5VA 5FOBB 4A2LA 4YDKH 5CLWA 2XTJD 4NJAL 5CLTA 4UU9A 1S7TB 3VFTA 5FKPA 5HHPB 1A6ZB 4CBPA 3LKSA 5F6IC 3U0TB 5IB4B 4JM2A 1GCFA 1H3GA 1KJMA 5KSAD 3CC5A 2F5BL 1FNHA 3MLVH 5C0JA 1HWGB 1HHKA 4YXKL 5CSGA 1U8NB 3RX5A 3VRJB 2KQMA 4ZNCD 4BQ6A 2UV3A 2N7AA 3RPIB 2A38A 1U8OB 5IVXF 5C0ND 1IC4H 4PFEA 4NRYB 3V6OA 1ZHLA 1EGJH 2OTWA 5EU4B 3F12B 2EH7L 1QPXA 5LGJB 3QCVH 5DHVH 2WK2A 2ZNWA 1BREA 5FGRA 3C2SA 1MUJB 3A0OA 3OR7A 3EO0B 4HIHB 5F9WC 5D7LB 2FNBA 5DJ2A 1V3LA 4YDIL 5F1IA 4FFYH 4R97C 4J4PD 5FECB 4R0LA 3STZB 5FV1L 5IBUG 5B22A 3V5DA 5TE4L 4FQJH 5KAQF 1X44A 4WEUD 5C09A 2K7PA 4ODVL 3U4BH 2DKMA 4GRLA 3G5ZA 1RZ8A 4HKZA 1G1CA 3T0EE 4JFHE 1KPVB 3LD8C 4XMLL 1IZKA 1S7XA 3TWCL 1I8KB 1LGVA 3VMNA 5L2KB 4HW6A 1CK0L 1FJ1A 1E4KC 2Z35A 1X5LA 4OCXL 4D3CL 5D5MB 2BY1A 3T0VA 3C5SB 3KAAA 3MLUL 4IMLB 3VG0H 3G5YB 5HD8C 4UOW0 1FYTA 1I3VA 4DUWA 1U8LA 2LAAA 4NBYB 1OAZH 1VKXB 2A1WL 5F6HI 5IESH 3GJFB 3NABH 3L5JA 1QD0A 4EQ3A 1QBAA 2A83A 1QNZH 4P2RD 3L7EB 1CDIA 2BNQA 2XZQH 1FG9C 1MQKH 3SY0A 4CVXB 3D39A 4TSCH 3FB5A 3T1WA 1JWUA 4G9FA 2EE2A 1NGXB 4JO3H 5HYJB 3KPMA 5DURB 4PRPD 4X8XA 1N8ZB 4O4YL 4PGBA 5IMKB 1LNUA 3L7FA 4HGWB 4HKBB 2WIIB 4YAQA 2EIEA 4ERSL 4YH6A 2MCG1 3RWCA 2F53A 2G9HB 4K9EC 3GIZH 4LDEB 5CBAB 3BGFC 3GSNA 4HIIB 1FFNA 5SV3A 1QSFA 2B1HL 2DQJH 5SX4H 1IFHL 3GBNL 2HT2D 4LCYA 1JHKL 3DTXB 4X6FB 5ICZB 1NSNH 3L3OB 4XNUH 1NFDE 7CGTA 5GS0D 4F7PA 3VWJB 4JPIB 5ADOL 3MLWH 4RAVA 2FR4B 4HAFA 4PJFA 1I8LA 2WUBL 5DHXB 5JOPD 4OB5H 4J3TA 5C7XL 1VCAA 5J9PA 5CZVL 3MRQA 1E27A 2V5YA 3QFJD 3QRFM 4NRZA 1R5IA 1JNJA 5EBLB 2IF7A 5DEGA 5E08H 4I9WE 1GHFH 4MA7H 5HXMA 2B4CL 5BW7A 5IQ7L 4TTDD 3KHOA 4PJ8B 4UBDD 2R29H 3SGDI 3R0NA 1BGXL 4MJID 2EO1A 3D0LB 4HGMA 4MA1C 1BFVH 1QLEH 3T0EC 4QOKA 2Y6SC 4JY4B 3TA3A 1U8PA 2Y07H 5GRJH 1HI6A 4HUNB 1ODAA 4KPHL 4R2GB 5CJ5A 5C0FA 3UJIL 3AY4A 1MCQA 4H88L 4JFDD 1BAFL 1SJEB 3B8SA 5I8CA 2ADFL 3O2VH 4OCLC 5TGBB 5LAXB 2R8SH 4KK9D 2ZJSH 4NO0D 5I1LA 1I1AC 1DBJL 3GMNA 4Y7MA 4MHHI 2X42A 4F33B 2EDNA 1R0AL 1RUML 4WUUB 2G2RA 3B6SB 3HZYB 2CLRB 4OZIB 3N1FC 5IB2B 3FOLB 3V0VB 4JRYB 4R96B 1NGYB 2YWZA 4HX1A 3ZYIA 4PJ9A 5I71C 1V7NH 1HHIA 1YN6A 2Q6WB 1EAPB 3JVGA 3AREB 4ZFOL 3D85B 1JZ2A 3BRGC 2HFEB 2AQ2A 1HXYA 3CVHA 4NNPL 2FX8H 3GSRA 3K7UA 3O41B 5CJBA 2EDOA 3RL2A 2GAZA 3WFHA 1FNFA 3LH2L 2FATL 1LP9E 3DURB 4LVHB 2LU4A 4KTEL 1DBKH 1K8DB 4XWOC 5FCUL 4GW1A 5IIEA 4ISVA 4FHBD 3TZVD 2WBJC 3HR5B 2LTQB 2FDBP 2NY6B 3BRDA 3BP6B 4AYFA 2JELL 1R24B 4LRNH 1JFQL 3V6FB 5FUOL 1FHGA 3ARVA 4DFIA 4JPWH 3B9KD 4OCSL 5DK0B 2BCKB 4YX2H 5BQ7B 4DKDC 3SE8L 1JHLL 1JUFA 4RMTA 5IW3A 4P4KB 5I76A 3W5MA 2V2WB 4U7SA 2ED9A 4LSVL 4NZUH 3UJJH 2FJFA 3BH9B 3UP1A 3CXHJ 2DIAA 4MS8D 4F9LC 1ZLUK 1X5ZA 3DRQA 5CEZL 1Q0XL 1P7HL 3MBEC 4LPWA 2UWEB 3QEGL 1CDHA 3HZKB 1OAKL 4UTBL 3T4YA 3MJ8B 5IVXA 4OCYH 5JW4N 3FQUA 1YQVL 4HWZA 1F4WH 1NGQH 1NDGA 2HH0H 2C4FT 1X5AA 2ZUQC 5DQDL 2Q76B 2YR3A 3GSVA 5F7WC 4KK8C 2QADB 5BRZB 1NLDH 1Q0YL 4H0HB 4LEXL 3G6DH 2JJVA 4N5EC 4TVSa 3NIGE 4X80H 1A9EA 5FYLD 5IVNA 4NSKB 4PGDB 1FO0A 3OJMB 1FE8L 4YHLH 3TBVA 4NQXB 4P46A 3HC4H 3FO2B 3PDOA 2W07A 3SE9L 1BOYA 3HB3D 1T89C 4ONOA 3CPLB 5K9JH 4W81A 4LHJB 4U6YA 5I8OL 2ZCKH 3MCLL 4G3YL 3LCYA 5I8EA 1J0IA 1U95B 1SY6H 1FGVH 2PW1A 5FUCE 2GTZB 4YWGL 2YPVH 3GSUA 2XT1B 4DTGH 2YUWA 3LN9A 4KK5D 1MIEL 4W4NA 1QSEB 1MSPA 3IXAB 1T2QH 3PL6D 3I6GA 3EFDL 3CSBA 5IBTL 3QDGA 1YEFL 3BKYL 3DVGA 4GS7C 4YIQA 4EUPB 4JZJB 1E4WH 5IWLC 3LKNB 5CJOL 4WI6A 3SDXA 5TE6H 1BQUA 1IGCH 3TJHC 1A6TA 1NC2A 1EUTA 3ARFA 3HPLA 5FHAL 3HNTL 5I1GH 3MLRL 4POZC 3ORJA 3O4LB 1XAUA 1I8MB 4JHAH 2M26A 3NAAH 1YJDH 1AIFB 2DTML 2R2HA 3M8OH 4X7SL 1U6AL 3QPXL 1YEEL 2E7MA 3QI9A 1LE9A 2VO5A 1I1FA 4KI5E 4ODWA 5F89A 2QEJA 4HWNA 2E27L 3LKRA 2NY0D 2RFXB 3OKOB 3DSFL 5KANI 5DEZA 15C8H 1KOAA 3RZCD 5D1ZB 3PNWB 4PS4H 3W9EA 1AQKL 4PP1D 1WT5C 1K3ZA 3RWEA 3ZDYF 5T1DH 1GXEA 4Z7WB 2CIIB 3KXFA 1IM3B 3KJ6H 1LVEA 5IMOA 3QXDA 5IFAH 1G6RL 1LO5A 1QR4A 4Y4FB 3UBXA 2X4QB 4M02A 5CGYD 5H8DA 5E1AA 4XBEH 5EOCL 4OBSA 3BP4A 4X7TA 4G42B 3LRSB 3IYLW 1HXMA 1E28B 3I3DA 4WHDA 3QDJE 4YUEL 2YPKB 3VD4A 2P5WE 5I15L 3D3VB 2A6KB 3BEWB 4PYHA 1FZJA 2D0FA 1RJLA 1BFOA 2HN7A 3HG1A 4TSAL 3L3HB 3QA3B 1KTLB 4EXPX 2VDPL 3MNZA 1L9NA 4Z0BL 3NVQA 4QHMA 4YBHA 5JORB 1RUPL 4Y4HA 5D9SB 3VH8B 3LIZH 3SKUD 5HI5D 2H2SC 2BERA 2CRMA 2ORBH 3IKCB 3U4EA 4G6AD 3EYSL 2YUXA 2ESVB 4APQC 4EIGB 3KPRB 3SKMA 4OUOA 5CIPH 3SEPA 5EBMB 5E99H 5L2KE 1DANU 5TDOA 1CICB 4OZ4A 1ZLUH 2W9EH 4R3SB 5FB8A 3BHBB 4OD2B 4M48L 1T0NA 1WBYA 5T3XL 3KPOA 3D18B 3RVXD 4L4TA 3BJ91 4P2QD 2I07B 4JO4L 3CXHK 4XPFH 1UACH 1H8SA 4K9EH 1AGFA 3RNKB 3RGVC 2AJSH 2ZCLL 1MCDA 1KV3A 2OZ4H 1LWRA 4JDVB 5E2UL 4KI5C 1GGTA 1A4KB 2DQHL 5C08D 4N1HB 4L4VB 5B38G 5DO2D 5HYJE 1B3JA 4UT9L 5HHXL 3K1DA 2H32H 4ELMF 4OD1H 3DI3B 3QUYA 4BH8B 2ATKB 2AXJA 3S5LB 3N1QC 2CJUL 4YLQT 4KUCF 4RBPK 5GS2D 3IDUA 5EBWA 2AKRB 1U8HA 5J56B 3F7RA 3GMOA 1NQBA 4MHHG 2YSSB 5ESVA 1OF2A 2B5IB 2Y1VA 1IQWH 3H3PL 2ADIB 1EV2E 2IALA 1M05B 3QXUA 3NCBB 2MHAB 3TBWB 5A2KH 1T7WA 1KCUH 3BD3A 3SDAA 4I0PB 3SDDA 3F7VB 2E9WA 3KPLA 4IRJC 4J3VA 1WEJH 1X5FA 1I9JH 3OAZK 1NCBL 3ESVF 4QRSA 1I9EA 4PJXF 3KPTA 3UTTD 4CMMB 3E6FB 5L8LB 1D9KA 5HGBB 5T33H 4Y2DB 4X7EC 3JWOH 5FA3A 3JV5A 5KSAC 4ZFFA 3PQYE 3QCTH 5HPOA 2DBLH 4H0IA 4N0RA 4NGHH 2HT3D 3SO3B 2H3NA 3VXRB 3U48A 3QQ4A 4ZPTA 5E9DB 4OI7A 3GDBA 1G7JA 1CLYL 1EEZA 4GAGH 4X9GA 1LE5A 2EECA 4XCNA 3BGAA 1D6EA 3MV01 1ZANH 3S96A 1QHOA 1XF2B 5I1IH 3U2SB 5C0NC 4JFXA 1HEZA 2AJZB 1YNTB 4NCDA 5IHLB 1YEJH 3DUSB 4PBWD 4YZFE 5C2BL 3AS1A 3WXWL 4PJ5D 4RMUA 1ZEAL 2JCCE 2FWOA 5JOPE 1OQXA 4EZMA 2CDGA 3LSOA 4WUUE 3QUML 3QFJE 4LMQI 3DJ9A 4H26A 1GSMA 1M6OA 4YBQD 1RK0B 2IPUK 3SCMB 1GPOH 2DQTL 1JNNH 5ISZB 4J4PC 4BJLA 4FMFA 4NUJB 3BP7B 3U1SH 3DROA 1TZHB 3FB6B 4BH7A 1A7RL 4I8DA 1R3LB 4MJIE 4Y5VB 3IVKA 1RFDH 3REVA 1DQML 1EERB 3KPSA 3WLBA 3G5XA 1K4CA 4UU9B 3VFTB 3TN0A 3LKSB 2GTWB 3AAZA 1IAOA 4JM2B 1HIML 1KJMB 4KY1H 3CC5B 4RMSA 4JFDE 3LEVH 2XQBH 1MJ7L 1BMGA 1W8OA 3Q5YA 2W0PA 5C0JB 4RWYL 3WIFA 4Z7NE 4TVPL 1HHKB 3WBDA 3CLFL 4B53A 4WHYG 1WZ1L 5E03A 3HAEH 5F7EL 3EZJB 4HEPG 3ZL4H 5LCVL 3VWJC 4WFGD 4MXWL 1NUGA 4Z7UE 3VG9C 4BUHA 2KL6A 5FGCE 1MRCL 4N8VG 2OTWB 4ZXBA 1WAAF 4GQ9L 4WU5A 4AH2A 4X6CF 4HD9A 2ICWB 4HEME 5C0AE 2OXGA 4ENED 3S34L 3OR7B 3QPQC 1JCKA 2GSGA 5DJ2B 1F2QA 2CXGA 4OLYL 4XPGH 2EH8L 3K1KC 5F1IB 5FM5M 3TO4A 1BQHA 1IGFL 4PJBF 4R0LB 5AZEL 1T03H 3V5DB 4JG1L 4I3RH 3IFLL 4PTTA 1KELH 4LLYB 4R4NC 4RQQA 7FABL 3QEUB 1S5HA 5C09B 1FNGA 1NCAL 4FQXA 2BJMH 4R2GC 1RZ8B 4RBPH 5KANG 4HKZB 1J0YA 4AY0A 4RRPA 1FNLA 3B3IA 1FV1A 3JXAA 1S7XB 4N1CA 4TNWF 3C08H 4GW4A 1FJ1B 4RGOH 2Z35B 1WQVT 3GK8H 1DQDL 1NL0H 2J3SA 1BIIA 4GAJL 3R4DA 1FYTB 2XQYK 5GJTL 1UZ6E 4KMQA 4M7JL 4GW5A 3ZTJG 3LEXA 3OKNA 1ZK9A 4Z95L 4JVPA 1ITCA 1S7WB 5ITBL 4PRNA 2A83B 1ZT1A 2RR3A 2Q8AL 2BNQB 2YMXL 3OAZH 5C0CD 3AREC 4CVZA 4X9FA 3D39B 4MNHA 3FB5B 3KJ4B 4K3DL 2GKIA 1AXTL 1JWUB 4G9FB 1AFVL 1G6RA 4U1SA 2J12B 3IDYB 3KPMB 5GS1A 2J5LB 4YHNB 2G60H 5KVFH 3PV7A 4PGBB 5IT2H 2FEDD 1LNUB 3L7FB 5FYLE 4K2UH 5GRVL 4OD3L 5K9KA 4MAYD 4YAQB 3MACL 2J7LA 1UT9A 2PKDA 4AIZA 3ARDD 5DD1H 4N68A 3RA7L 3RWCB 2F53B 4IHOA 3BIKA 1YA5A 2K3TA 4PJEE 4QHNA 3O9WA 5JPMA 1P53A 5J89A 3GSNB 4GBXD 1FFNB 1QSFB 4ELMA 5CP7A 1L7IL 4E9LA 5I9QC 1JPGA 1U3HD 4LCYB 2KDGA 4P4KC 5T1LD 3BVNA 3PJSB 3QR2A 1G7MA 3DV6A 5I1JL 3EUUA 1YEIH 4F7PB 1F4HA 1TLKA 4OF5A 1ZA6A 4N0UE 1F45A 4PBXA 5D7JA 4RAVB 1C7SA 3P9LA 3ARUA 2XWTA 4MD4A 4PJFB 1NMBL 1RZFH 5DJ8A 3S36L 3TPKA 3MRQB 1E27B 4M43L 4NRZB 4UIKH 1R5IB 1CT8A 3TYGL 3MRMB 4WO4A 3V4PL 3BSZL 5DEGB 1NCNA 2WLYA 4NZTL 3MRIA 1MFEH 3VGGA 4XHQA 1RUKL 5JQ6L 1IE5A 3D3VE 3MMEA 3JTSA 1TTFA 1MIMH 3TFKD 1OWRM 2AVGA 4F9PA 4QOKB 4JFFA 4Z76A 1JWMB 2R15A 1U8PB 2X4SA 3TA3B 3PG2A 3ARPA 5F93C 1HI6B 2Q87A 1N59A 4Z7VE 1C16A 5C0FB 4M6MH 1UFUA 3PWJA 4MDIA 5I8CB 2EDRA 2DQEH 2FO4A 2ZUSA 3GHEH 3S4SG 5E70A 1MEXL 5I1LB 1S5IH 1TVHA 2VDLH 1IKNC 3GMNB 4JKKA 1ZA3A 1WITA 4PRAA 3MTRA 3PGFH 5A3ID 3RAJH 2IMMA 2IMNA 5ANMA 1W72H 5JW5A 3ARYA 1HN1A 4HX1B 4YNYA 4PJ9B 1URLA 1HHIB 1YN6B 5EB9A 2D7TH 1IEHA 2YKLL 4XXDA 3FT2A 2CLZB 2AQ1A 1HXYB 3CVHB 3UO1L 3ULUF 4JPKL 1JPTL 3PP4H 3B9EA 3T2PA 3RL2B 4DQOL 2GAZB 3WFHB 4OUUB 3I9GL 1G1YA 3RKDD 1CLOH 3PABB 1UH2A 1P7QA 3MUJA 4GW1B 3EDEA 2AJUL 5AD0A 3RNQB 1GGYA 1GC1C 4FQQA 3TBSA 3ARBC 4PG2A 1DE4B 4HJGB 2IFFH 4M1CD 4LPCA 4XWGL 4FP8H 4PJHB 5EZOH 5E0QA 4RAHA 3L1OL 4MAUH 1JUFB 2ZSVA 1C7TA 2I9TA 4I77L 1S9VA 1AO7D 3NH7H 3O8XA 3LB6D 2EYRA 2FJFB 4ZS7L 4Q9CA 4MNQB 4NM8H 4Y4FC 3SDCD 2F58H 1NGPH 3DRQB 2OQJA 3FQNA 2MOVA 1M7XA 2QSTA 4P2QE 2VXUH 1NAKL 3T4YB 5IVXB 1LEIA 3FQUB 3GHBL 3VRIA 1XH3A 4HWZB 4HKJA 1CD0A 1A7BA 1WAAA 4RWHA 4BFGA 2PO6A 4PJ7F 1MFCL 5JW4R 4X6CA 3GSVB 3OG4B 4UAOB 1KLGB 4LL9A 1LO0H 4ZYKA 1DZBA 1F2XK 1Y18B 3QUMA 1A9EB 4PJDF 1FO0B 5AYQA 2D31B 3IETA 3RZCC 3BZFA 3TBVB 4P46B 5MENA 1J05A 4FXLA 4PJBA 1T80A 3L9RA 3GRWL 2XA8H 1T66D 1JHTA 2WINA 4U6YB 1AD0A 3KLAA 1B0RA 1RZ7L 5I8EB 1F3RB 1ADQA 3C6LC 5ESAA 2VOTA 1RU9H 4GAYA 1S9XA 1T7VA 2PW1B 4TNVK 3LQMA 3WD5H 4CW1B 1CICC 1PX3A 3GSUB 1F58H 1RQ5A 2ADJA 1EA9C 4I4WA 1NAMH 2GCYA 4FRWA 3LPFA 2BY2A 2XKUA 3QDGB 4MQXD 1DQJA 1GIGL 3E8UL 4YIQB 4ZUWA 5K9QI 5CJ8A 3B5GA 1SJVA 3CJJA 3LS5H 3BRFA 4K3GA 3SDXB 1MJJA 3T0BA 3VCLA 3QAZB 1D5BA 4ODXA 1KUMA 2ZZUT 1A6TB 1NC2B 4DN3H 3ARFB 4DAGL 3PWNA 3HPLB 3ARTA 1MCOH 3MJ9L 1S3KH 3QIBA 4MNGA 2P46