3KLEA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
560
structure length
560
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
total genus 142
structure length 560
sequence length 560
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kleA05
1X9MA 4O3OA 3KHLA 4FJGA 2IMWP 3I0SA 1HYZA 4RW7A 4G1QA 5CYMB 3OYMA 1RT7B 2AWZA 5EDWA 3CM5A 3U3GA 2HMIB 3KLGA 4ZPAA 5HRNA 2RN2A 5C42B 3M8SA 3K5LA 1QSLA 2OPRA 2ZE2B 5KFXA 4ELTA 3MF5A 4O0IA 3L2WA 4ECQA 4WFXA 4W5NA 2JEFA 2HHXA 4FLZA 1BIZA 2FLLA 4Y2CA 1C1AA 2XGQA 2FVPA 2QKBA 1R0AA 1Z4UA 1L3VA 1VSLA 1WN7A 3VQCA 4J9MA 2XY5A 3MFHA 3ZT4A 3V4IB 2R2RA 4CGHA 4FLTA 3PJXA 2PZSA 4R0EA 1FKOA 4NCGA 5KFEA 4FZXC 4ZHRB 2CKWA 3N6MA 4J9PA 3V1RA 3TAEA 1T05B 3GV8B 1WSGA 4F2RA 3Q8PB 1OS5A 4IFYB 3NHGA 3TAGA 4DG1B 4R8UA 4HKQA 3NF9A 4IOBA 4IRCA 4MK7A 1JLGA 1JX4A 4ZP8A 1RT1A 1TKTA 2YKMB 5J2PB 4CFCA 3ZSVA 3SNNA 1SH0A 2OA8A 3QZ7A 1RAJA 2D0CA 5KRSA 1C0MA 3DI6B 4KI6A 2Q3SA 3EPGA 3LP0A 3KLEA 3ZSWA 4KHRA 2IS3A 1J5OB 3AVFA 3BDPA 3VQ5A 1T7PA 3DLEB 5HBMB 2IBKA 4ZHRA 1BQNB 2FLPA 2I1RA 4Y34A 3KKRA 4ZPDA 3HO1A 1DTQB 3QESA 5KG5A 4CHQA 4BDYA 2ZE2A 1Q8IA 4I9QA 1GX6A 1IKVB 1SKWA 3AVBA 3M9MB 4JS4A 1LW2B 1RT2A 4Q45A 3LWLA 2W9AA 4MIAA 1VRUB 2X6NA 4NLWA 1REVA 3WNEA 3DM2A 3DOKA 3SUPA 2R8KA 1HNVA 2QKKA 2B6AB 3C6TA 1IM4A 3VQDA 1I6JA 4BE0A 4H4OB 2OZMA 4ZVFA 4FCYA 2AU0A 4QW8A 4M3XA 4KTQA 3PW2A 1LWEA 1FK9B 4FJIA 4MFBB 1BQMA 1RTDA 1FKPB 5KFKA 1TV6A 2EX3A 1X9SA 2IAJB 1VRTA 1EKEA 4FJ9A 4ECRA 1JLFA 5KG4A 3OYNA 2HB5A 4WYLA 3LALA 4M3ZA 4CERA 4LSLB 4K4TA 3RMDA 3GQCA 1WSHA 5KFSA 3ALYA 1WNSA 4J2AA 4AHTA 1SH3A 2EC0A 3QLHB 3E01B 4CF9A 5K14B 4JRQA 3L2VA 3K5OA 3LP0B 2YKNB 2D0BA 3MTKA 1K1QA 1S1XB 2GV9A 4CGGA 1RDDA 5FDLA 1U49A 3AVNA 1TL3A 4YP3A 1RT1B 3BR9A 1L3UA 1BISA 4KTZA 1IO2A 4C8MA 4H4MA 1S48A 2AX0A 2FVQA 3RR8A 1FXXA 1S0NA 1RT5A 1JXBA 1JIHA 1QE1B 3G86A 2X74A 1WLJA 3IG1A 1N5YB 3QNOA 3NGDA 4DTSA 2ILYA 4NLOA 3DRSA 4Z4HA 4CGJA 4NYNA 3HM9A 3LANA 3TVKA 4NCGB 2OPPB 4MK9A 3QEWA 1S49A 4LSLA 3KLFA 4Q8EA 4DWIA 3OS0A 2UVUA 4TN2A 3TANA 4N5SA 4O3NA 4GVMA 4W5TA 2HVHA 5L1KA 3H59A 3MFIA 1T03A 2XRIA 1U48A 4NLYA 2GUIA 5C25A 4NYZA 3G6YA 4WFZA 1RBRA 4KAZA 2YNHB 4M95A 4ZMMA 3NGYA 1N6QB 3SYZA 1RT4A 5DG7A 5HRPA 1XR6A 2G8KA 2HHUA 3PY8A 4PWDA 1TK8A 1HQEB 1KVBA 3QNNA 2G8VA 1EXQA 4DQSA 3DLKA 2KTQA 1VSHA 3QLHA 4RZRA 3OL7A 3SCXA 5KFCA 1IKVA 1B9DA 4EYHB 3DRPA 4Y3CA 1JL2A 4JV0A 5KFJA 1W0HA 1T94A 4Q8FA 2BQUA 3LAKA 1L3TA 4ZTJA 4RUCA 4KHSA 2KFZA 4I2QA 3CDEA 4CF2A 1JKHA 1NKEA 1YTUA 4YMEA 1ZBLA 1YVUA 4BACA 2FVRA 1NKCA 1C0TB 4CEEA 2B5JA 3I8DA 3V9UA 4DQRA 3DI6A 1RA7A 3DYAA 4YR3A 4E7LA 4CECA 4OLBA 1RTHA 2AGOA 3I5BA 3P83D 2F8TA 3H5YA 3OHBA 4HUEA 4O3SA 1C1CA 5T7BA 3GIJA 3OYAA 1SV5B 1DTQA 3GIIA 2NUBA 4J9QA 1KRPA 3LZJA 5F9LA 3QGGA 1LWCB 3AVLA 4DSLA 4RNOA 1K1SA 1IKYA 4IH7A 1U45A 1HPZA 3G10A 2IJFA 1S9FA 2DY4A 5KT2A 4TXSA 2IGIA 4EZ9A 4CJRA 3VQSA 4RG8A 1U09A 1N48A 1S6PA 4IRDA 1VK0A 4B8CA 3KMQA 4CIEA 4M42A 4TSXA 1JL1A 2R2UA 4QWAA 5KFIA 3CJ2A 5DG8A 2ZQBA 1JLQA 5F8MA 2DFHA 1NJZA 4ZP6A 3NAEA 1GOAA 3D45A 2DPJA 2I5JB 4CF0A 1TGOA 5C42A 4ECZA 3CJ5A 4MKBA 4BDZA 3NBPA 4E0DA 2J6SA 5KG7A 3RAQA 4BE1A 4C8LA 4Y1DA 1T8EA 3ZT1A 2FBTA 4DTJA 3S3OA 3IGNA 1BCMA 4F4KA 5KFNA 1C6VA 5KT6A 2HHWA 5J2NB 3AO4A 4JV2A 3KK3A 1IKYB 3V4IA 4Q0BB 3VQBA 2VG5B 1LWFA 4O3QA 3KTQA 4CJLA 4J2DA 2HWHA 4C8NA 3QGIA 1HJRA 3HVTA 5HLFA 3QEPA 5KFMA 2ETJA 2HHVA 4OKKA 4NLPA 2OPRB 3ITHB 4O3PA 1VSIA 3NMAA 3V9ZA 3AVGA 5JXSA 3ZT3A 4J9LA 2FVSA 4WYWA 4FBTA 1JXLA 1SKSA 3KKSA 2VG6B 3OHAA 4CEDA 3DLKB 2XCPA 3LAMA 3H98A 1HNVB 2HNYA 4DF4A 4H4MB 1S6QA 4BDPA 4KREA 4K8ZA 1WAJA 5JS1A 2GIRA 5I42B 3M8RA 1TKXB 5KT7A 2QK9A 4PY5A 5CYMA 3HT3A 2F8EX 2OPQB 4ECVA 1GOCA 4DL6A 2OPSA 1HRHA 3OYCA 1KVAA 3QEXA 4XIUA 2E6LA 4OGEA 2RF2A 3OYLA 1ASVA 1RA6A 3N6NA 1JKHB 4FJNA 3HVWA 5EWFA 4RW6B 3V9WA 1KCFA 4QCLA 2WONB 3N6LA 3OYFA 2HVIA 5D3GB 3DLRA 2VA3A 5KI6A 3GYNA 3OYDA 3MEEA 1WAFA 3AVKA 3RRGA 2OPPA 4B9MA 1X1PA 2VWKA 4B9NA 3DOLA 3FQKA 3HP9A 3QEIA 4FYDA 5KFLA 3CO9A 1RT3B 5EU7A 4RW9B 1J5OA 2JGUA 3LP2B 1QTMA 1QE1A 1EP4A 2HHTA 2BDPA 2R8HA 4AHSA 3C6TB 2WHOA 4EEYA 3H2LA 1TKDA 1HQEA 4CFDA 2WOMA 1RDBA 4M94A 1C2PA 4NLDA 1X9WA 1HQUB 2YHAA 4KFBB 1S0OA 4IFVB 3AO3A 4ICLB 3OL8A 3HKWA 2VWJA 4DSEA 5KFTA 3RB4A 4W5QA 2BE2A 1DLOA 4Q0BA 5J1EA 1S6PB 4KHQA 3V1OA 1EETA 4Y2AA 4M3TA 1LWFB 1D1UA 4CFBA 3KMSA 1Z25A 3ZSZA 2IC3A 4ZPCA 4UQGA 4E7HA 3PR5B 3ZCMA 4M3UA 1ITGA 5DLFA 4CJEA 3AVAA 2IM0A 4DU3A 4EBEA 1NOYA 3NH0A 3ZSRA 3K58A 1SKRA 3IG1B 1N5YA 3MEDB 5KG1A 3PX0A 1DLOB 4CIGA 3RBEA 3KD1E 3WNHA 2FC0A 3NF6A 4FJJA 2VA2A 4IQXA 1CXQA 4CHYA 4PQUA 4KO0B 4FJ5A 1QSSA 4DTPA 5KFWA 3RB3A 5FDLB 4XPEA 1RT7A 4NCBA 4KPYA 1NOZA 2Z1GA 1L5UA 4EBCA 4HTUA 1KFSA 4B3OB 5I3UB 4FS2A 1EP4B 4DTUA 3CJ3A 4FLXA 4KHYA 4OJRA 1ZBIA 4HHTA 2FBVA 4EBDA 4H8KA 1RBVA 3HVAA 3MR5A 5EWEA 4JUZA 4DU4A 3MEEB 2ALZA 4KAIA 2ITGA 4RNMA 1TK0A 2C2RA 3HPGA 4J2EA 5EUHA 4ED2A 1U4BA 1UWBA 4RW4A 1TV6B 2B4JA 3DLBA 5KFFA 3SQ4A 2Z1IA 3KLIB 4DL4A 1WSEA 4ZVGA 2XO7A 1TVRB 5HRRA 2OPSB 2VG7B 3SUQA 4KV8A 4JS5A 1XHZA 5I3UA 2IJNA 3GV7B 4B3OA 3UQSA 2HHSA 4FZZA 1S1TA 1JLAB 1RYRA 4ZVEA 2HMIA 2UUWA 4JRPA 4NZ0A 4J9KA 4AHRA 3SFGA 2A1RA 3KHGA 2C2EA 4CK2A 1N6QA 3DOKB 2W8KA 3KNAA 4Z4IA 1HMVB 3EYZA 4MKAA 3C95A 4KKOB 4NRTA 4CJ5A 3MEDA 1ASWA 4RW4B 3SV3A 2JEIA 2XHBA 3H08A 1NJYA 1S9GB 1RTIA 3CFRA 3NDKA 4N76A 4FLYA 4I2QB 3QYYA 3VN5A 3MR6A 2E4LA 2RPIA 1IG9A 2BRKA 2V4RA 3OL6A 3OS2A 1NK4A 2KZMA 3T1AA 4FZYA 3PUFA 2D7SA 5KG2A 1IH7A 3K59A 4Z4EA 2AJQA 4FK0A 4ZP9A 2IM3A 2V9WA 4FJLA 1KHWA 2FBXA 3SI6A 4PWDB 4NLUA 4XO0A 4KHMA 3PO5A 3CM6A 4K50A 3VQPA 1HYVA 4BWMA 2FBYA 4CJFA 1JLGB 3VQAA 4DL7A 4CCHA 2V4QA 4ICLA 3GV5B 3C6UA 4DTNA 1RT5B 2W9CB 3SPYA 1HYSB 4O4GA 4HCCA 2G8WA 4IFYA 1BI4B 3LP2A 1ASUA 3S9HA 4NLSA 3OYIA 2YKNA 4IG0A 3WNGA 3LDSA 3OSNA 3CFPA 1BIUA 1KVCA 5F8GA 4CFAA 3U3YA 2BANA 3QIPA 1ZETA 4CK1A 2P5OA 1LWCA 2YNFA 2QXFA 4M41A 3JSMB 4I7FB 3M8PA 4KB1A 4ED0A 4CJVA 1RDRA 1SH2A 3LPUA 3PW5A 4CEBA 5KG6A 4MH8A 3M8QB 3QGHA 4XPCA 4Z4FA 3ZT2A 3KK2A 4MQ3A 1G15A 1BI4A 3SZ2A 5KFPA 3HYFA 3RB0A 1TL3B 1HQUA 3T5KA 3O3HA 4IDKB 4QWDA 4FM0A 3TAPA 1O1WA 1WSJA 1NHUA 4YR0A 1D0EA 2ASDA 1DTTB 1QHTA 1S1XA 1IKWA 3DYAB 4B9LA 5K14A 1RCHA 1BCOA 4DEZA 3KK2B 4KHUA 4TY9A 2J6TA 1ZBUA 4DQIA 1K6YA 2XGPA 4O55A 4FJMA 3SUOA 2ILZA 4ZPBA 1NK6A 1VRTB 5DQHA 3V6JA 2X6SA 3QEVA 3C94A 3IRXA 3KLHB 3MECB 4Z0UA 4QWEA 3UDLA 4DLEA 1HNIA 3PX4A 3ICLA 4WZMA 1MMLA 4KTWA 1LAVA 4NCAA 3CFOA 4ECYA 1VSMA 3VQEA 4Q44A 3Q8SB 3ZSYA 4M3RA 4ECUA 4FBUA 1XC9A 4K4ZA 4IG0B 3CG7A 1VSDA 3HJFA 4IKFA 4F3TA 3FDSA 1IKWB 5KFZA 3NAIA 5DQIA 2FVCA 3C6UB 3QETA 5HROB 4E1NA 2E9TA 3Q8QB 2I5JA 5DK5A 3I0RA 3K2PA 1JXEA 3TWHA 2PYLA 5KT5A 2BGGA 3NGZA 1TL1A 5C24B 1SUQA 1XR5A 4B9UA 1TVRA 3BSCA 3AVMA 1WSFA 4DG1A 4OVLA 4EO6A 2W8LA 2ASLA 1T3NA 3DLHA 4J2BA 4DTXA 5KG3A 1HPZB 3GIMA 2RDJA 1ZYQA 4IBNA 2G8FA 4WE1A 2PY5A 3KK3B 4LQ9A 3AA2A 3RB6A 1TKZB 1NNDA 2FJXA 2CJQA 3UR0A 3TQ1A 3AO1A 4KKOA 2C2DA 3DRSB 4DFJA 1S9EA 4I2PB 2KFNA 3V81B 1GX5A 3PZPA 3LWMA 2A1SA 1TL1B 2W7OA 4PA1A 3KK1A 5F8HA 5CZ1A 4ZP7A 4PUOA 2C22A 3T19A 3HK2A 1BL3A 4QWBA 3HPHA 1YTAA 4IG3A 1QQCA 1SL2A 4F4XA 2EHGA 2KQ2A 3KJVA 3KIOA 2B5JB 4CIFA 4JV1A 3SQ1A 2XI3A 1C0UB 3E51A 1T05A 4NLVA 3ULDA 1J53A 1B9FA 3I5AA 3VQ6A 3OJUA 1TKZA 4CJTA 3MXMA 3CYMA 3IAYA 4M3YA 4FLVA 4IR1A 3LP1B 1NK7A 4KSEB 4LH4A 5SZTA 4ECSA 2YNIA 1EETB 4AHUA 2D5RA 2AGPA 1CSJA 4URQU 4RW8A 3IS9B 2WB4A 5F8IA 1SUQB 1L3SA 3ZSXA 1I3AA 3DRPB 2QE5A 3V6KA 2G8IA 1TKXA 3I0RB 1D9FA 3CDUA 4NLTA 5L1JA 3AA5X 4FK2A 4Z4CA 1XWLA 3OYGA 4F3OA 4DFPA 3RBDA 3BQ2A 3SUNA 4TY8B 4DU1A 1S1WA 1LW2A 1RT2B 4CGDA 2YNHA 3KLHA 2GC8A 1NK8A 5J2QB 4LD0A 3KLIA 4DFMA 2JLEA 1QUVA 2X78A 3PX6A 3KD5E 2YNFB 4FJKA 5J2NA 2GBZA 3SV4A 2J6UA 1GOBA 4DS5A 3EZUA 4OGCA 3QIOA 3KJVB 3G6XA 3KLEB 4DL2A 4O5BA 2P51A 1LAWA 3K5NA 3T3FA 1NK9A 5HRSA 1BHLA 2IM1A 4E19A 5F9NA 3KOAA 3OL9A 5CYQB 2F96A 2WOMB 5FRNA 1S10A 3U6FA 4O4GB 4NLQA 1C1BB 2D3ZA 2VG6A 4FM1A 1S1VB 1RT4B 3FRZA 1T03B 3MXIA 3RWUA 2YV0X 3NAHA 3A2FA 5KFUA 3M8PB 1YT3A 1HARA 2FLNA 3ISND 3HL8A 5C5JA 1U47A 4OKEA 3AA4A 4DQQA 3RMAA 4ZVHA 1XI1A 4I7FA 3CIZA 3Q8RB 5D3GA 2ATQA 2WONA 1N4LA 5KT3A 1JLEA 4DTRA 4LSNA 3V6DB 1SL1A 5DGBA 3O4NA 3NFAA 1JLFB 3IGVA 2BE2B 4CHOA 3SPZA 4GC6A 3D5MA 5L1IA 4CJ3A 3BQ1A 3RR7A 2DFEA 1WSIA 3OS1A 1ZTWA 4G3IA 3OYHA 3KLGB 1NK5A 4TY8A 4K4YA 5F8LA 4RUAA 4CJ4A 5KFGA 4F8RA 3OLBA 5KGWA 4AHVA 3BGRB 2WCXA 2W9BB 1JLCA 1RT6B 4RU9A 4RW9A 1S1UA 4DL3A 3B6PA 4ECWA 5L1LA 1CZ9A 4CEOA 2Z1JA 3K5MA 3E01A 4CEZA 5KFVA 1RNHA 3HVRA 3HSTB 2G8HA 2W42A 1KFDA 4CGIA 1LV5A 4ED1A 1ZTTA 5KFDA 2HAIA 3PHEA 4FW2A 3IN5A 5FRMA 5F8JA 1S9GA 2P5GA 5KFHA 4K4SA 2UVRA 4F2SA 1IKXB 2E9RX 1A5VA 1RT6A 3LP1A 3HXMA 4IRKA 3LPTA 3RAXA 1W9HA 4H4OA 2ASJA 1UOCA 4GW6A 3TR8A 2KZZA 3NH2A 4E7KA 3V1QA 3CVKA 4K4XA 4EZ6A 3F9KA 4FJXA 1RYSA 3OYEA 4R5PB 4U7CA 2YKMA 4IDKA 4IKAA 4B8AB 2D3UA 4DTMA 1S97A 2XI2A 4J9RA 4YFUA 1KTQA 3ITHA 3BSOA 5DMRA 3HP6A 3OLAA 5F8NA 5L9XA 1J54A 4LSNB 1B92A 3MXJA 4YNQA 4CK3A 5HP1B 4ED3A 4ID5B 4NLXA 1NHVA 3QIPB 4WE1B 2RDIA 1KLMB 3BJYA 4DSIA 4CF1A 3H5SA 5J1EB 4DSFA 4Q43A 4C8OA 4J9OA 2IM2A 4FS1A 3EY1A 2RKIA 1J9AA 1W25A 4CE9A 4OPKA 3PR4A 1QAJA 1D5AA 1RTJA 2HW3A 5J2PA 1WNEA 1C1BA 3OYKA 4KRFA 3L3VA 1RBSA 3SFUA 3WNFA 4KO0A 2O4IA 5C24A 5JS2A 4FJHA 4CJUA 4TQRA 3L2RA 4M45A 5DLGA 4BE2A 1S9EB 2XY8A 4O4RA 2C28A 1RBTA 3RMBA 3AV9A 1BGXT 4E7IA 3KHRA 3DMJA 4KI4A 3TAQA 5KT4A 5EWGA 3BREA 4IH6A 4Y1CA 2WK4A 1TAUA 3PW4A 4FLUA 3SI8A 3NH1A 4ED6A 2IA6A 5CY4A 4URSA 4L8RB 4X2BA 4OKJA 2D0AA 3DLGB 3SQ0A 3G0ZA 3H40A 2IDOA 3OJSA 4TYAA 5J2QA 1HNIB 3LP3A 3FFIA 5HP1A 1RTIB 2WRMA 1Q9XA 4MK8A 3D28A 2F8SA 4OPJA 5J2MB 4ECXA 4F50A 1RDCA 3GIKA 5KFYA 2XCAA 4CEFA 3BSAA 1DTTA 1CLQA 3M9OB 2XY6A 3CJ4A 4CEQA 5KFAA 2BR0A 1F21A 1S1TB 3K57A 4CHZA 2HNYB 1XHXA 5HROA 2KW4A 1KHVA 3QERA 4G1QB 1S5JA 1NKBA 1SL0A 3ZSOA 3DOLB 2IOCA 1IKXA 4RW8B 2HNZA 5C25B 2W7PA 2VG7A 3VQ7A 2V0NA 4K4VA 1YVFA 4TLRA 3PV8A 1UAXA 4DTOA 1D8YA 3V6DA 4CHPA 2YNGA 3VQ9A 2R2SA 4LQ3A 3JSMA 3MECA 4FJ7A 1KSPA 5KFOA 5DQGA 3QIDA 4FLWA 4Z4GA 2O5DA 4KB7A 4EP5A 4K8XA 2W9BA 2BANB 5SWMA 4N56A 3SQ2A 2HNZB 3NBPB 1MU2B 2DPIA 5KFRA 1S1UB 3V6HA 3NE6A 1ZBHA 3TAMA 3VA3A 1QS4A 4AILC 3AVCA 2O4GA 3DMJB 4KBIA 1S1VA 4FW1A 5KRTA 4DFKA 4M3WA 4CESA 4IG3B 3CJ0A 4FVMA 3KK1B 1JLQB 5FROA 2ZD1A 4DMNA 2FJVA 4IH5A 1TKTB 1HYSA 4KE5A 4QPXA 4O44B 2W9CA 4DQPA 4PQUB 1NJWA 4KHNA 3HVTB 5HLFB 1N56A 3OVNA 4QOZB 2AX1A 2XY7A 2OH2A 1NK0A 4EYIB 3UIQA 1CXUA 2RKIB 3H4BA 3HHKA 1RDAA 3DRRA 1RTJB 3MEGB 3MR3A 4ED7A 2YNIB 4YQWA 1XR7A 4RNHA 3ASMA 4N41A 2R2TA 3KLVA 4DLGA 4E89A 5KGXA 3NL0A 3LZIA 2UUTA 1TK5A 3FQLA 1FKOB 3TARA 1Y97A 2PYJA 1UA0A 3NF7A 4DSJA 2FJWA 3BQ0A 4NLRA 4H54A 1KLNA 4WXWA 5DG9A 1BQMB 4OLAA 1LW0A 3PO4A 1S1WB 4CJPA 4LH5A 2XWYA 1VSJA 3L8BA 4J9SA 3OSPA 2R8IA 1TQLA 2JEGA 4CHNA 4QW9A 4PUOB 3CWJA 2DFFA 4TYBA 4CJQA 4B9VA 3TAFA 1RILA 5CYQA 3I0SB 4I2PA 4ELVA 1Z26A 4DF8A 4E3SA 3P5JA 4R5PA 4TQSA 3PJWA 2HNDA 4N47A 4QWCA 1VSKA 3O3FA 3RRHA 1C0TA 3TAMB 1EX4A 3NGIA 4FK4A 1UA1A 3QZ8A 3PW0A 4NRUA 3QO9A 3SJJA 5JUMA 1UWBB 4IR9A 3L2QA 1FKPA 2RF2B 3T5LA 1JLBA 2UVVA 1BQNA 4MIBA 3OYBA 2IAJA 1C1CB 3OYJA 1LWEB 4QAGA 1RBUA 2HWIA 1SV5A 5CZ2A 4E1MA 4WZQA 1C0UA 4HUFA 1RTHB 3JYTB 4YR2A 4FM2A 2AQ4A 1JLAA 3V9SA 2JEJA 3BGRA 3HPOA 3DM2B 4EO8A 4B08A 4AHCA 2BQ3A 2B6AA 1VRUA 4GC7A 3B6OA 3NCIA 3G6VA 4JLHA 3FSIA 4R8UB 3EZ5A 4E7JA 1QSYA 3H5UA 4CJWA 5DGAA 3PW7A 1TAQA 1LW0B 2LSNA 3GILA 4EP4A 5J2MA 3FFIB 3I5CA 3O4QA 2Y1JA 2G8UA 3TI0A 3O3GA 3VA0A 3AVIA 1JLBB 4HUGA 3OY9A 2QV6A 5KFQA 2IC3B 2R7YA 3L2UA 2BRLA 4HVJA 3F73A 5KFBA 4B9TA 3S3MA 3QO9B 4AH9A 2HNDB 4F4WA 4URGA 2HHQA 4O0JA 3VQ4A 4DL5A 4O3RA 1CZBA 2JC0A 3MEGA 4CGFA 2WTFA 4WXOA 4U6PA 4J9NA 4HYKA 4KFBA 4O44A 1Q9YA 1VSFA 4BWJA 2DTUA 3THVA 2P1JA 4W5RA 4LY7A 1S4FA 3BSNA 4K4WA 4DS4A 4CF8A 1S0MA 3QINA 4RW7B 3V81A 1A5WA 2Z1HA 2UVWA 3M8QA 1U04A 1MU2A 2ATLA 4ZTFA 2R8JA 2XC9A 4F4YA 2B43A 4K4UA 3ZSQA 3TABA 3M9NB 1JLEB 4I9LA 2OZSA 4ECTA 3P1GA 3D0PA 3MR2A 3KLFB 4ED8A 3CQ8A 3CDWA 4NLGA 3AVHA 1KLMA 4OL8A 1TP7A 3DRRB 3ZT0A 4RNFA 5KTQA 1D9DA 3PVXA 1R0AB 4ID5A 3AO5A 4W5OA 4IFVA 3T5HA 5T14A 1HMVA 1I39A 3RTVA 3NF8A 3AVJA 3L3UA 2OPQA 4NYFA 1A5XA 2BQRA 3ISNC 2ZD1B 3MAQA 1S6QB 2Y1IA 2AGQA 1VSEA 4C8KA 1REVB 5I42A 4FJ8A 4ID1A 5E41A 4ELUA 2OYQA 3S3NA 1ZBFA 1QAIA 4Q5VA 4KB0A 2R8GA 3EPIA 3UPFA 1RT3A 4RNNA 3KHHA 4KV8B 3JYTA 3RMCA 1NJXA 2JC1A 3V9XA 2ZKUA 3H4DA 3T5JA 4B9SA 3IS9A 2YNGB 2D41A 2E6MA 4RW6A 4WFYA 4CJSA 5KG0A 2YHBA 3DLGA 3AA3A 3IRXB 1RTDB 3NKYA 2VG5A 4CJKA 4FXDA 2GIQA 5HBMA 4HCBA 3VQQA 1JLCB 3VQ8A 4MFBA 2E9ZA 1FK9A 4F4ZA 3H5XA 4CEAA 3AO2A 4DSKA 3DLEA 4KHWA 3DDKA 4GMJB
chains in the Genus database with same CATH superfamily
3VENA 1TMMA 1U02A 2Z56B 4O3OA 3KHLA 1HYZA 5CQGA 3BM7A 1W7WA 1RHMB 4PABA 3OYMA 2HHHK 2H5IB 4PRFA 4Y28C 3T9ZA 4U9RA 2E88A 3CNQP 1FJ7A 5C10A 4CYUA 2HFVA 3TVYA 4W5NA 1N32K 3CCMS 3RBXA 3R5DA 3A4TA 3CJ1A 4FLZA 3U02A 2FLLA 1TUWA 2HQGA 5IFMA 1C1AA 2XMJA 1LOUA 1GH8A 1VSLA 3E3XA 1ATSA 3MFHA 4CGHA 1PAEX 4DR2K 4P2XA 2NXCA 1T02A 3PTWA 4HI2A 1C0GA 2VFVA 3GV8B 1Q82O 4F2RA 3GWCA 3Q8PB 1EX8A 1UFKA 3TAGA 2QO3A 4DG1B 3NF9A 4CLZA 1HW8A 3OFEA 4NXNF 1KWMA 4DR5F 4ERDA 3VAMA 1RT1A 1HD0A 5M2UA 2YQ0A 3ZSVA 3SNNA 1SH0A 2OA8A 3QZ7A 2D0CA 3TTCA 3DI6B 4WTYA 1M0SA 5HVGA 5AXMA 5D4PA 3KLEA 3SMSA 3ETOA 3AVFA 2D4WA 2DR8A 5HBMB 1PAUB 1G1XA 2UXDF 4ZHRA 3RZAA 2W4DA 5AQFA 2YKOA 3KKRA 2DNQA 3VAFA 2UU9K 1A7GE 5F2RA 3QESA 2MZQA 2ZE2A 1GX6A 1VJQA 1XMOJ 1YI2S 2VF3A 3AVBA 1LW2B 3LWLA 2UXDK 1VRUB 4NLWA 3WNEA 2ZHOA 1Q53A 3CERA 1I6JA 2QA2A 2XMVA 1VQMN 3A3OB 3MMCA 4ZVFA 1I1GA 4CZJA 2XYPB 3KWGA 1WC3A 4QW8A 3IDHA 1ZM3A 3C2PA 4LF7K 1FK9B 4FJIA 1BQMA 3A5LC 1YITS 2HK2A 4K8RA 3M3ZA 1R3NA 1EKEA 1GMWD 1S7HA 1KD1T 4Y2KA 4M5IA 3ZFVA 4M3ZA 3THTA 4K4TA 3H20A 1UL3A 3LGMA 3WEEA 3DU5A 5I4MA 4J2AA 3E01B 5ETKA 2DGWA 3KUHA 1MROB 5M1NA 1F3VA 4U95A 4LRFA 2V67A 2GV9A 4DUYK 3CDAA 4TNOA 1RDDA 1U49A 1C4CA 1FE0A 3BR9A 1M5HA 1L3UA 1BISA 4KTZA 4C8MA 1YJNS 1IBKK 4HTIA 1SZ2A 5THWA 1RT5A 1MLAA 1JIHA 4FWNA 2QLWA 2NZ4A 5GAGU 1N36J 3QNOA 3OT9A 4NLOA 4Z4HA 1MMNA 4IYQA 5G0RA 2B56A 1A0OB 4CLTA 1FEHA 2DNOA 3DDNA 1QZ6A 4DHVA 3KLFA 4Q8EA 2O8EA 2UVUA 3NCQA 4TN2A 3BBCA 4N5SA 1U6ZA 4O3NA 4GVMA 2HVHA 5L1KA 3MFIA 3HRGA 1U48A 4Z37A 2JLFA 4NYZA 2IHR1 3CCVS 2NSCA 4FYXB 2O01C 4NMLA 4ZMMA 4M8LA 2VC0A 1T6CA 2HBZB 2HHUA 1K0TA 1GFWB 4PWDA 2GQQA 1UW4A 3SIPB 1KVBA 2G8VA 3TSUA 4FVCA 3DLKA 1S0VA 2HF4A 4DQ8A 1C4AA 5FIIA 1FDDA 3BS9A 2M0GB 4RZRA 3OL7A 3SCXA 5KFCA 3EE9A 1R8BA 4EYHB 3HOSA 2H65B 4Y3CA 5F3TA 1T94A 3LM9A 4KYZA 1EARA 4ZTJA 3CPEA 4RUCA 3NS7B 1P6TA 2Q6BA 2YWHA 3CCQN 1NKEA 1JKHA 2NS1B 1N34J 3SXLA 1YTUA 3CC2N 3KJFB 4H4KC 4FPRA 1HWLA 1X3NA 1YVUA 3HZEA 2EFNA 3MMCB 3PG9A 3HFZB 2C2OB 4ANDA 1XNQJ 1R8PA 5A8WB 1XEZA 4HDHA 2ZZNA 4JKEA 3ZTOA 4E7LA 4CECA 3P83D 3H5YA 4DN9A 5AR0A 4HUEA 1AA1B 2G2ZA 2V63A 3PNIA 2EWHA 4FF3A 4FWQA 3GIJA 2CQ2A 2PN6A 3C16B 1NDLA 2DHSA 3LDLA 3A12A 1VQ8N 3J80O 1KRPA 5F9LA 5H1SV 5GADU 2FC9A 1SAZA 1LWCB 3AVLA 3OUYB 4FKYA 4DSLA 4GV3A 3MMJA 2P9LB 3DHXA 4IH7A 1KQSM 3AAPA 5AQPA 1Y3JA 1X5TA 1G3OA 1S9FA 5LL6Z 3CE8A 4ZVRB 2IGIA 1NNEA 2EI5A 4CJRA 1HLUA 3OTOJ 2MHEA 3CIMA 1N48A 4H0PA 2AMCB 2YQ3A 4ZLLA 3G71S 1RJJA 4I1TA 3MM8A 1NJZA 4ZP6A 3MGJA 2KLAA 1P8GA 4QYZK 2OFGX 3CJ5A 1VQ9N 4BDZA 5KOXA 1HKBA 4YUDA 1MNEA 3TZYA 2P9EA 5GINA 2I0XA 1U2VB 2IVMA 3RAQA 2VPWB 4C8LA 2DXFA 1T8EA 4Y1DA 2FBTA 3ZT1A 3M32B 3IGNA 2QWOA 1UTAA 5K8NA 2DR7A 3Q24A 3SAFA 3O08A 3OW2M 3CULA 3O5BA 2OMLA 4ILLA 1FEEA 2WAQD 2WSFC 2F9DA 3BO3A 1B0PA 4AE5A 3J7YI 3CCLN 3KTQA 4J2DA 4JKFA 1X4DA 3QGIA 5H1SQ 5KFMA 3FCVA 2BKPA 3HMJG 4J9VA 3HHDA 1TZ0A 3NMAA 5HJXA 2C2MB 2FVSA 5JMNA 2CPJA 1VBZA 1FRLA 3OHAA 4P7TA 2XCPA 3LAMA 2UZAA 1Q4RA 3PJ9A 1HIYA 3H98A 1S6QA 2J9CA 1WAJA 4KHPF 4NE9C 2E5GA 3W60A 4HVZA 4BQLA 2ZVSA 1NM2A 1WBBA 3UW1A 5CXTA 3CMQA 3WDOA 1U1LA 1QAXA 3G8TA 4YDUC 4Y0FA 3MM7B 4OGEA 3OYLA 2A3JA 3QQCD 1YIJN 3N6NA 4FJNA 1OY6A 4Q2MA 2CJ9A 5M1QA 4A4JA 4A8SA 1HNWF 2VB6A 2QLXA 2CJBA 3J7AN 5D3GB 3DLRA 2F8MA 3B8HA 4ED4A 3MEEA 4DR5J 3A8JA 3KJNB 4KQZA 4UQTA 3RRGA 1CVJA 5EN1A 4B9NA 5A8RB 3HP9A 2VHGA 1VISA 2EXUA 4RW9B 3NVKA 1J5OA 3A8IA 1Q79A 4ZDNA 2BDPA 5B0EA 4AHSA 2QMXA 1YQHA 4LFCK 3H2LA 1TKDA 4M5MA 3UKUB 3BBFA 4NLDA 4Q2LA 5LMUF 1HQUB 2YHAA 3TNVA 3W9JA 4CLKA 3QRQA 4LVNP 4DSEA 2GMJA 2A6MA 4WF9L 1N5VA 4W5QA 2X51A 3ZLJA 2BE2A 3R2DJ 4YOYA 4LFCJ 4M3TA 1QZ5A 1LWFB 1D1UA 2F4VF 3K9KA 5GAGP 4ZN1A 2XWXA 2VL1A 3KMSA 5DDPC 4BVPA 2IC3A 2QMWA 1NPPA 2IVFB 2VFUA 5DLFA 2IM0A 1NOYA 1FX4A 3ZEUA 1VQPN 3JXOA 3IG1B 1U0SA 1FFGB 2FC0A 4N8NA 3UNGC 3M5RA 4IQXA 5AQOA 4ID8A 3QNWB 4CHYA 4IEIA 1UZHA 4KO0B 4M5KA 4FJ5A 1CC7A 5KFWA 2Z30B 2ABYA 4FPAA 1GXUA 2JL9A 2Z1GA 2WTUA 4CIOA 1L5UA 3MHYA 2MZJA 4EBCA 4B3OB 4YY3F 4DJBA 1EP4B 3W2VA 1ZPWX 2CJXB 3KFWX 4KHYA 4ZA1A 4HHTA 3HVAA 4BGAA 2BJ3A 5EWEA 2ASYA 1EQ0A 3KZBA 4H5TA 3DXKB 5HL7L 3AOAA 4KY3A 4RNMA 1R8HA 4BREA 3HPGA 2XM3A 1HNZF 5E84A 3K7RA 3QT6A 2DGQA 4RW4A 4Z94A 2B4JA 4NYPA 1RAFB 2OEJA 5B0GA 3TA0A 1WSEA 5AQXA 2DIVA 5HRRA 4WP9A 1PO6A 3OTEA 5KAKA 5CZXA 2V8PA 4JS5A 1UVNA 4MO5A 1OY9A 3M30A 1QUPA 1KVKA 5HL7Q 2JFKA 3UQSA 1OYEA 4FZZA 1S1TA 2WVEA 4Y6IA 1JLAB 3MD3A 3HFVA 1UP1A 3EGZA 3KG1A 4NZ0A 4AHRA 2FQQB 3IAS9 3WX4A 2A1RA 3N4PA 4CK2A 2X1FA 2W8KA 4IOCQ 2RH3A 4Z4IA 1PYSB 3C95A 5AQLA 4CJ5A 1V5IB 3K0SA 1YBAA 3TJAA 2ZH9A 4LF6K 3M2VB 4AD6A 2JEIA 2C2NA 7FD1A 5L38A 1ZM2A 5A0YB 4G1IA 2I7PA 4JHDB 2CJKA 1IG9A 2BRKA 2KYZA 3OL6A 3OS2A 4FZYA 2YH0A 5GADP 2W2QP 3IBFB 2AJQA 4FK0A 2P9SB 4LF6F 4FJLA 1KHWA 2KXHA 2FBXA 1KQFB 1FNXH 3THWB 3PFOA 3WC0A 2CAJA 3PIPL 2FBYA 2V4QA 3GV5B 5KOWA 3O8WA 3C6UA 3CGIA 4O4GA 1KS2A 4IFYA 3BZKA 4D3HA 3LP2A 1FE4A 4NLSA 4DUZK 5I3PA 3NXZA 2J7KA 3OSNA 1V4TA 3CFPA 1IBCB 3KUGA 1VQNN 1KVCA 3HULA 5F8GA 4LC9B 5CAAA 1MWKA 3L0QA 2BANA 3MWPA 2MJUA 2QXFA 3ENBA 4PKIA 4M41A 4ZVOB 3M8PA 2CG8A 3LPUA 3JAMO 4KH6A 4IO1A 3UN5A 3ZT2A 5KPZA 3C16A 4GKJF 1DRZA 1IR1A 5HAOA 1GK8A 4WQ4C 3HYFA 2YH1A 3T5KA 4IDKB 4QWDA 4IJAA 4FM0A 3JAMY 2VUGA 3ULEB 4ZLPA 2JNJA 4LVOP 5K20B 2W24A 3OVSA 3RVCA 2X1AA 1S1XA 1QHTA 1AROP 4B9LA 1RCHA 3WXJA 4UTGA 3A5NC 3W1YC 2CYYA 3GL1A 6FD1A 2J6TA 3HJVA 1HNXJ 3U8XA 4A59A 2BJ8A 1NK6A 2LQ8A 1B64A 2X6SA 3U1MA 3MM9A 3MECB 1N32J 1SVDA 1RISA 1SQEA 4KTWA 2UP1A 3GJSB 3QRRA 3CFOA 1VSMA 4LRCA 4XDCA 1S4EA 2GELA 4K4ZA 5CCMA 2IPOB 4IG0B 1YLXA 3CG7A 1X4CA 3HJFA 2D0PA 2U2FA 4IKFA 3W8PA 2BX6A 4NEYA 3CCUS 3FDSA 1IKWB 1CZAN 1GLDG 2FVCA 1TFWA 1ZBSA 3E9LA 5D0RA 3ZZ0A 4LF9J 3I55S 3DWLA 3B6BA 2PYLA 1X9JA 4BC4A 2BTFA 1TL1A 4B9UA 4LF9F 4A8WA 1TVRA 2O8CB 1FHTA 4PG5A 3AVMA 3B4MA 4RBTA 3GYGA 4CZMA 2H5EA 5T7LB 1MSWD 5KG3A 1HPZB 5HQLA 3CHWA 1CJTB 2MQQA 4DPXA 2MEWA 3R7BB 2KFYA 4WE1A 4MTPA 5D15A 2BJ7A 4LR8A 3U9DA 3CJ7A 2RHKA 1TKZB 2CJQA 3TQ1A 2MLXA 3BB5A 2CQ1A 2R9LA 4CQ1A 2KFNA 2V9KA 4PA1A 1KOHA 4JN4A 4ZP7A 2P9KB 2MSTA 2KG0A 3THWA 4GKJK 1BL3A 1YTAA 2HRTA 3ZYYX 2WC9A 3CT9A 5DETA 1K8AO 3BEGB 4DR3K 1T05A 1RBAA 4NLVA 3ULDA 1J53A 3VQ6A 1M5KC 1TKZA 4L73A 3EZOA 3MXMA 3K2YA 4KH1B 2ZH7A 3D6RA 4FLVA 4W92B 1UJ5A 2A10A 2AZ1A 3HI9A 4DKWA 2AYEA 2JH3A 4JBCA 2D5RA 4XK8C 4RW8A 3IS9B 1WHWA 2MY8A 4IFEA 4NI2A 2CPHA 1WI6A 1L3SA 1F2GA 4LFAF 3DRPB 2CZ9A 2QE5A 4Q7AA 2G8IA 1YK9A 4DR3F 2VFRA 4CO5A 3AA5X 5C7PA 2ZWOA 3TX8A 2HKEA 4Z4CA 4PXBA 2CGLA 3EGNA 4DU1A 2MJNA 1FDNA 1J5EF 4LBPA 2N4DA 2YNHA 4JI3J 2MZ1A 2RSQA 1NK8A 3M4XA 3ENAA 1GLEG 4YOVA 2GBZA 3KVGA 1YJVA 3Q83A 5AQNA 2HQFA 4DL2A 4O5BA 3F56A 2A6OA 2P51A 4PHTX 1LAWA 4DR2J 3T3FA 1S99A 2GJFA 3NP5A 4RWTA 7FDRA 3RRKA 3OL9A 5FRNA 2QLJB 4NLQA 1C1BB 2D3ZA 3I56N 1CS4B 4JKHA 4FM1A 2PMHA 2N3OA 2P6TA 3FRZA 2PSZA 2V2QA 1T9UA 3FVYA 3NAHA 4FWKA 3A2FA 5KFUA 5LOQA 1N36F 3HL8A 2QFJA 2DR6A 3RMAA 2G0JA 4DHYA 4JI7J 3D6FB 2GW8A 1U0HB 3EICA 3QJJA 4L6V3 3C7NA 1VHIA 1RLDA 1IXKA 2AJ0A 1N4LA 1RB0A 1JLEA 4DTRA 5FJ4A 4G9ZA 2VICA 1XJWB 3L7OA 3QJLA 3P5TL 4GVBB 2W2OP 4CHOA 2DGSA 1GTEA 4CJ3A 3BQ1A 3RR7A 4FWSA 3DXBA 2DFEA 2MZRA 3G2XA 3KLGB 4UT4A 3OYHA 1KTVA 1RHJB 5IV4A 3FCHA 4RUAA 4CJ4A 4A8KA 4MYTA 2XZWA 4FF4A 2QWQA 3O1LA 5A8WA 4IUFA 2HBQB 4RU9A 2P9SA 4FXWA 4Y00A 5L1LA 1UAWA 3HVRA 3HSTB 1VK8A 2W42A 4CT9A 5ITHA 1AUSL 2FB0A 5A0YA 1Y5LB 4WBFA 5KFDA 5LXYA 5F8JA 3VGKA 2G9OA 4F2SA 1IKXB 2YQ1A 3LP1A 1BXNA 2NREA 3RJMB 1NGFA 4BRFA 2ZH8A 2PO4A 2M70A 4OX7A 4ALZA 1MDUB 1S72N 3SMZA 3W5XA 1KDNA 3NH2A 3V1QA 4E7KA 2VV5A 4EZ6A 3F9KA 4LFCF 1YWXA 2YKMA 4IDKA 4IKAA 4DR3J 1S97A 4F0KA 5C2FA 2E5HA 2CNNB 4GKJJ 3WC2A 3ITHA 4OX9F 4KGVB 5DMRA 4BRGA 4MLHA 2ZOMA 3C3LA 4LSNB 4F4AA 1B92A 4ID5B 4NLXA 4UZBA 4OZ3A 3D6HB 4WE1B 3NMUA 1KLMB 1VQOS 3W2WA 2E1ZA 5T7LA 4CF1A 1ULRA 3UDVA 3RG6A 5K8PA 4J9OA 5RUBA 4FS1A 3HBTA 4CE9A 4OPKA 1VQ9S 3ZXWA 3M6UA 3L3VA 3BPSP 3SFUA 1K0VA 2O4IA 4CJUA 2YHWA 4I67A 4BE2A 5DLGA 5D4OA 2MZSA 3PHTA 4WK3A 4WCEQ 1RBTA 3RMBA 3AV9A 1BGXT 2DNLA 4KI4A 1M90O 2ZFHA 2A18A 4O5FA 3W9HA 4DOZA 5LSLA 2ZBRA 3IO1A 3LGNA 2EK1A 3NH1A 5D77A 3TSQA 5CY4A 1PBAA 1ZBTA 2Q43A 2P8IA 1X5SA 2GS8A 4X2BA 4NZ6A 2D0AA 4FVUA 2ACYA 2HOEA 2XNQA 4HR2A 5AQKA 3FEZA 1KD1O 2ZZTA 4BS2A 4TYAA 5BPLA 3LP3A 5D0EA 4N7TA 3VPZA 3M2RB 2AJFE 3ZZUA 4BCAA 4MK8A 4ED5A 5IT9U 2MHNA 4WFAQ 2IDEA 4ECXA 3GIKA 2VFTA 4CNYA 2NXUA 2IVOA 4JI7F 4ZJLA 5AQQA 2PAVA 4OPHA 5DDRC 4CEQA 3CCRN 4OHXA 4B3TF 2HNYB 4UZCA 2KW4A 4X64K 1FJGK 4G1QB 3QFHA 4NXNK 5IV3A 1SL0A 3ZSOA 1Q16B 3EGVA 1I94F 1MROA 5DZ7A 1FTRA 3MM5A 3U9ZA 5C25B 2Y3YA 4IXCA 1VQ6S 1P1LA 3QFUA 5MLCQ 2L9DA 4DTOA 2YNGA 1UETA 4ER8A 3MECA 2MLYA 9RUBA 3QIDA 1HNWJ 4KB7A 4EP5A 3Q7CA 3CCVN 2HNZB 2NXJA 1GLFO 1MU2B 3O9TA 2DPIA 3NE6A 4AILC 1P9YA 2O4GA 4JEPA 3MCNA 3RW6A 1VQKN 5KRTA 3NEKA 4M3WA 4CESA 3PCOB 2H54B 2I9SA 2LFVA 4DR4F 1HYSA 3O9RA 4NA3A 4O44B 3MAAB 3I87A 2KB2A 4QOZB 4KHNA 3HVTB 3R1HA 4JI1F 3ZTQA 2OH2A 3SMPA 1WHVA 3UIQA 1RWWB 3HHKA 2CG4A 4CW7B 4N41A 1FKAF 1KAZA 3KLVA 4DLGA 3SCKE 2BJEA 3ZZPA 4PAAA 3CJQA 3F44A 1TK5A 4DCJB 5G0RB 1FXDA 1YJRA 3FE1A 1NGDA 1UA0A 3NF7A 3A0IX 2RMLA 5HMXA 5E3QA 4NLRA 2WFBA 3AOCA 4WXWA 1KLNA 4LH5A 2XWYA 4J9SA 3BYRA 3MURP 2R8IA 1TQLA 1HI8A 2CNLB 2QLBB 2HBKA 2PI5A 4BROA 2PD1A 3GP9A 2LU1A 3I0SB 4LF5F 2BM0A 4CLYA 4I2PA 4QQBA 1Z26A 4WQ4A 4E3SA 2RUSA 4R5PA 4QWCA 3RRHA 4WQ5C 2IIRA 2XZDB 1WBDA 4DV5K 4FK4A 4NRUA 4JK9A 2C3YA 3BF3A 5AJ3K 3J81O 5GMEA 3FZMA 4DV7F 3NNAA 8ATCB 4IR9A 4OJHA 1GLCG 3MN6A 2HFSA 3GG1A 2RF2B 1BQNA 2V7YA 4MIBA 4A8XA 3O80A 4QAGA 3LPYA 3PIOL 1A9NB 3CCWA 1C0UA 1QD1A 4YHHJ 1RTHB 3JYTB 2KYXA 5M1PA 4FM2A 3FFKB 3QSIA 2BACA 1APSA 2FHOB 4PQAA 1H1VA 1VQ8S 1ZAXA 1KOOA 3MAHA 4AHCA 2MQPA 1ITPA 4CD1A 3G6VA 3IP0A 3L3CA 3FSYA 4R8UB 3EZ5A 1MA9B 4E7JA 4OYBA 3H5UA 4QIWD 1DJ0A 3PW7A 1LW0B 4JKBA 3HSDA 2CQ0A 1DY3A 3VEXA 3GILA 4EP4A 3FFIB 1IBMK 5HVHA 2GMHA 3O4QA 3TI0A 3F5TA 3O3GA 3VA0A 4HUGA 2MQNA 2QL9B 2MKCA 4XH1A 2IC3B 2R7YA 3L2UA 1BHNA 3F73A 4B9TA 3S3MA 1QY7A 2HNDB 2W2NP 1XTZA 3SDEB 2KH9A 4PKDB 4O3RA 2JC0A 4CGFA 4WXOA 4DV1K 4HYKA 2QIFA 3S41A 1Q9YA 1PKUA 1VSFA 3UKUA 4NXMJ 2O8DB 1S4FA 3T1HK 2B9EA 4UOHA 3QINA 4DUTA 3MX2A 4ETZA 2XS5A 2OTJS 3SDEA 2UVWA 1U04A 2V8GA 4F4YA 5ADZA 2B43A 4HWIA 1HHQA 1RGVA 3MR7A 4NASA 4EFAC 2B51A 2ROGA 3AVHA 4L3NA 4OL8A 4USTA 3DRRB 2EKNA 1D9DA 2VU5A 1ZAVA 3JTOA 4IOCL 1J6ZA 2QJ3A 2RUGA 4PEOA 1GLLO 4IFVA 2VQEF 3R5JB 1I39A 3H2UB 1X4GA 3J7YP 4CH0S 2DY9A 2KT3A 2OJ3A 2CPYA 4OX9J 4MO4A 3NS6A 3R6GB 3SLCA 4O8UA 3UD3P 4PL8A 3MAQA 4B1UB 2Y1IA 1NJIT 1QQNA 1FX2A 3QB0A 3WQUA 2MYFA 4ELUA 2QSWA 4AL5A 2OYQA 4UY85 4H0TB 3S3NA 1ZBFA 2W41A 3EPIA 3WZ0A 2QT7A 1FRHA 4RNNA 3RMCA 1NJXA 2JC1A 3V9XA 1T9TA 2CA9A 4Y2MA 1HI0P 4LF4K 3H4DA 5EXWA 3IS9A 2YNGB 2D41A 2QFIA 4CJSA 4OHVA 1Q1KA 5DDOC 1RTDB 2VG5A 4FXDA 3G4SS 2GIQA 3B78A 2OLWA 4JKAA 4C2MA 2XTJP 2RJZA 2UUAK 4PL7A 4CEAA 3AO2A 3DDKA 4GMJB 1X9MA 2IMWP 3I0SA 1VOMA 2FJBB 1CJUB 2QWRA 3TYTA 5EDWA 1YHQS 4CO1A 1T0TV 1NLVA 2HBLA 1YZ6A 3CB4A 2NRZA 1GMWA 1RWVB 5LXRA 2HZCA 5KFXA 4HHHA 3PFEA 4ECQA 3QATA 1BIZA 1I3OB 3VQCA 1DKGD 1UVKA 3ZT4A 5LL6d 5BR8F 4FLTA 1SC4B 1V3RA 4UOCA 4OYMA 1FKOA 4NL5A 1IBLK 4ZHRB 2GGPB 3D4JA 3V1RA 3LTOA 5F41A 1YUWA 3TAEA 5IC6B 2FUG9 3CMES 2IYGA 2NPFA 1JCEA 5D8HB 4HKQA 2BUPA 2OELA 1EKRA 3AXMA 1JLGA 4Z2XA 3VTHA 1CULB 1TKTA 4CFCA 4B3TK 3O5TB 2QL5B 3OFGA 3ZETB 1C0MA 3O6WA 3EPGA 1Q86T 4JYAF 4KHRA 2FGOA 3PYGA 1ZPVA 1T7PA 2XEXA 5IOLA 3TOQA 3R6LB 4PZVA 5M2PA 4B1YB 1WKJA 2EBGA 3HO1A 2IBOA 3VVTA 4H0VB 5KG5A 4KGKA 5HN0A 3C6HA 1Q8IA 2HQIA 3T1YJ 2MKKA 4BG8A 3DM2A 5CH7B 3W5ZA 4H0OA 5K8MA 2IMOA 4I6YA 3I55N 2QKKA 2DCLA 4M5DA 4H4OB 2OZMA 1X31C 1DBDA 1JCGA 2PT0A 3PW2A 3KDNA 4MFBB 5A6PA 3CETA 1VMBA 2IIHA 1WELA 1VRTA 4FJ9A 4ECRA 1JLFA 3OYNA 2XNRA 4M7XA 2V2KA 4FWPA 3MX5A 4CERA 4J9UE 2MLZA 1FA0A 1WSHA 5KFSA 3Q8VA 2E1YA 1IBMF 1WNSA 3DC2A 4A57A 3J7Z5 4JRQA 2HS4A 3K9JA 1RGIA 2YKNB 2DNGA 3MTKA 4C48A 2H4YB 5FDLA 3DOMB 1Y3KA 1RT1B 4X4QA 2YPZA 1H72C 1IO2A 1CC8A 4H4MA 1S48A 2BVZA 3BKFA 1FXXA 1CS4A 1BDGA 2B4PA 3OTDA 3G86A 3MD1A 2KVQE 1N5YB 5EOYA 4DR1J 4U7BA 1QVGR 1SJRA 3A5MC 1NCLA 4WFAL 1WACA 3VWSA 4CGJA 2YHYA 3LANA 4Y2IA 2FYXA 3LW5C 1U1PA 1NGHA 5AJ3F 1TUYA 4DWIA 3OS0A 4YOWA 3TANA 2P9LA 3BZQA 1LXNA 1Q18A 3T1HJ 5KPRA 3HD1A 5HSPA 1N33F 2YBVA 2BA9A 2KJWA 2XO6A 5IXUA 4WFZA 1RBRA 2YNHB 2DGTA 1XNRK 5D4LA 1N6QB 1RT4A 2C1EB 2MGZA 5B0FA 1BA1A 3FBBA 5HRPA 3ZTSA 4A2BA 2XMAA 2GNKA 1TK8A 2LQJA 3ET6A 3CQXA 3QNNA 1YIJS 3O3LA 3CCQS 2LXIA 5DM6Q 2O3DA 1K8AT 5BPMA 1B9DA 3DRPA 1N88A 1JL2A 4JV0A 2QSFA 1YF5L 1W0HA 2RHSB 5A8RA 1LOTB 2GVZB 4FF2A 2N3LA 1E6YA 4KHSA 1R31A 1R6YA 3CJSA 4DMZA 2KFZA 3VCDA 2OKQA 3P31A 5D78A 3US5A 1DZ5A 1ZBLA 3M6WA 4BACA 2FVRA 1NKCA 5DJBA 1QDUB 4XTTA 2B5JA 3I8DA 1QQOA 1SIZA 6FDRA 4DQRA 2UV8A 5LMUK 1DQAA 5AQMA 3EM1A 4F0MA 3MN5A 4YR3A 1D3WA 2F8TA 3I5BA 5D6GA 4F7VA 2B9XA 2QX0A 2VBYA 1X5OA 4FKXA 3OYAA 1B99A 1RDUA 3HZGA 2OTLS 1DTQA 2CPZA 1RZMA 1WOQA 3GIIA 3CCRS 2Q36A 2NUBA 1X3MA 3LZJA 1OYDA 3K89A 1NSQA 3QGGA 1EWQA 4RNOA 5BRHA 1E6VA 3J81U 4RPFA 2E1CA 4CZEA 3W2VB 1TL4A 3CJ8A 1KQGB 4TXSA 1Q8KA 1M1KO 1SB6A 4WU3A 4I6WA 2HPUA 4C0OC 4X64F 1FJGF 1VK0A 3KMQA 2QWPA 3N0VA 3WQTA 3KG4A 5DG8A 2CDRB 4ZLNA 3HD2A 5F8MA 2DFHA 3WIUA 4XAKA 3OBIA 1WI8A 4PCQA 2DNKA 5C42A 1CLFA 3GIRA 3FR0A 3EVWA 4MKVA 1KONA 5DRKA 3HSZA 4USJC 1WKLA 2ZNYA 4E0DA 1M1KT 5B7WA 5EX0A 4BE1A 1TL7A 3QT8A 3UD5A 4PG4A 4DTJA 3S3OA 2R7SA 3W8GA 2HHWA 2NYHA 5J2NB 2VJUA 1FDBA 3NOCA 2KL8A 1GLAG 2CPXA 1FI4A 4Q0BB 2DNRA 4B3RK 2B9YA 4FNIA 4C8NA 4FPBA 3D6TB 5HLFA 1HNZK 3KWMA 2ETJA 1PBUA 4CLWA 1BA0A 4NLPA 2OPRB 3ITHB 4O3PA 1O13A 4M5HA 1VSIA 4K41A 4RUHA 3V9ZA 1GMVA 1GTHA 4DCOB 3ZX0A 4J9LA 1SKSA 2VDIA 4CEDA 3WT0A 3DLKB 2WW8A 2HNYA 4KREA 3U1LA 3I9V9 5JS1A 4A2AA 5I42B 1NBEB 1FWPA 4OI2A 2QK9A 4AL6A 2F8EX 1JQGA 4KHPJ 2OPSA 4C3MA 4OI0A 3OYCA 2AYBA 1RAIB 2XG8A 4OYXA 1FCAA 1ASVA 1RA6A 3I82A 2GV1A 1KAYA 4RW6B 2CVIA 3G8QA 1KCFA 3VF6A 2WONB 1QVGM 3OYFA 3U7JA 3MXHP 2VA3A 5KI6A 1WAFA 4B9MA 2G13A 3R7NB 4K5RA 2X3GA 3FQKA 2OD4A 1FW6A 3CO9A 1WTFA 1WG1A 2VPXB 1SJQA 3ENOA 2B4VA 2KM8B 1TL7B 3ET6B 1QTMA 1KNZA 4RJVA 1UPMB 2HHTA 4K25A 1VC6A 3FCWA 2R8HA 1UEVA 4DV6F 3C6TB 1HKAA 1V9OA 3ZTPA 1RWKB 2EG1A 4EEYA 2YHXA 4CFDA 3HHLB 3JXUA 2OP5A 4X4PA 1X9WA 1S0OA 1WORA 2ZDOA 4KGXB 1HBUB 3AO3A 3OL8A 2BW2A 3R8EA 2XLIA 4DV6K 2J8AA 1HFEL 5KFTA 3RB4A 1DLOA 2NNWA 4Q0BA 4OLOA 2AP1A 4KHQA 3V1OA 3BO2A 2J76E 4CFBA 1Q7LB 4YB5A 2ALYB 1Z25A 1WTBA 4FYWB 3NGRA 2F4VJ 1RLCL 4CJEA 1TUVA 4DU3A 1VQ6N 3NH0A 2R42A 3GU0A 2P9IB 1SKRA 5IWAJ 5AQTA 2XMUA 5KG1A 1RKIA 3LOUA 4NYOA 3WNHA 4FJJA 4ZOSA 4PQUA 1IV0A 1S77D 3VERA 1NG9A 3H7HB 5C2GA 5FDLB 3DOMA 4XPEA 4DZDA 4BRDA 4DV4K 1G6BA 3SCIE 2GZOA 3G71N 1N52B 1KC8O 3CCZA 3QICA 4OJRA 4B3SK 4EBDA 2PMWA 1RBVA 1B7YB 1WJ9A 3MR5A 1V4SA 3LDOA 3PRVA 3QPIA 4JUZA 2VQEK 4OZNA 4FOIA 1TELA 2V8HA 1J2VA 1BWFO 2EPIA 2QTWA 2C2RA 1FVSA 4J2EA 2ZUGA 5T41A 3W66A 1TV6B 3DLBA 4DBQA 3FZ2A 4V19S 1UFLA 3EMTA 1T3OA 1M1GA 4NLBA 4DI6A 4HL9A 3PIOQ 2XO7A 1TVRB 1SQGA 1NZAA 3SUQA 4B9QA 3TQEA 4KV8A 1NM1A 1XHZA 4HT5A 4ES1A 2HHSA 2A40A 1V5VA 4ZVEA 2IRYA 1CEZA 2D3O1 3VMFB 3D0HE 2W2PP 3DOKB 2FPHX 2L9WA 2E20A 2VBXA 4EUVA 1WOOA 4F26A 1HMVB 3EYZA 3D9BA 4KKOB 1X4EA 5CHIA 2ASPA 5H9FJ 2VQFF 1ASWA 2DR9A 4C3KA 4QS9A 4RW4B 1HR0F 3VEZA 2LDIA 4I6AA 4USIA 4CRJA 4A8OA 2J9DE 1UMJA 3P4UB 4X62J 1NJYA 3FUYA 1VQON 3CJAA 3CFRA 3NDKA 2F4FA 1IJJA 3LDNA 3VN5A 2E4LA 3EUNA 5I3QA 1NK4A 2KZMA 3T1AA 2Z2ZA 3PUFA 1IH7A 2D7SA 4K0KJ 2FSJA 3K59A 4Z4EA 5AE1A 3HX9A 2RQCA 1HR0K 2V9WA 3SI6A 3PO5A 4XO0A 3CM6A 3VQPA 1OMSA 1WEZA 4BWMA 4CJFA 2MGZB 5BPNA 4OO1J 1JLGB 4CCHA 2HHPA 3CI5A 5HOOA 2KT2A 1VIOA 4DTNA 2W9CB 2DK2A 3R7SB 1BI4B 1EWRA 3ENVA 1ASUA 1TYQA 2CWKA 3SSQA 2R7TA 1V3SA 3ATUA 1RAGB 4E8UA 3MMBB 4GKKJ 3WNGA 3LDSA 2UV8G 1XMBA 4XEIA 3FBCA 1R0BG 3OVBA 3QIPA 3MDFA 2BE7D 4ZIVA 1ZETA 1CJTA 2P5OA 5CYJA 4BLGA 3G25A 2DR5A 4ED0A 4CJVA 3ISZA 3NNHA 1RDRA 1HBMA 2V4JA 3PW5A 4CEBA 5KG6A 3SSRA 4DV3J 4TLQA 4MH8A 4LF8F 3EDRB 3M8QB 1X4BA 2OD6A 1YTYA 4CDIA 1K44A 3RB0A 4ZJOA 4GNIA 2I38A 4U8VA 2RIJA 2MMYA 1WSJA 4YR0A 4BC5A 4ZITA 1IKWA 3DYAB 3T9NA 2WSEC 3AB2B 1BCOA 1YJWS 4DEZA 2QGFB 4KHUA 4TY9A 4O55A 4FJMA 2E2QA 3I4HX 4ZPBA 1VRTB 2RQMA 5DQHA 3DJCA 3V6JA 4JHDA 2J0SD 1JJ2M 3KLHB 4Z0UA 3P3DA 4YY3J 3GR1A 1HNIA 3ICLA 4WZMA 5AZJA 2H3GX 4ECYA 2F4VK 4QOTA 3EXYA 1YITN 3TRGA 3ENHA 2YWGA 4FBUA 4CZIA 2NRHA 4F3TA 2KXFA 3VHQA 5KFZA 2CJAA 5HROB 2E9TA 2DHGA 3OVAA 2GO8A 2I5JA 5DK5A 3UDCA 2UUCJ 5B09A 1WC0A 1MN9A 3NGZA 2KG1A 3QBWA 3L9ZA 1XR5A 3FMWA 1ZA2B 4HHJA 1WSFA 4DG1A 4C4WA 1SQFA 1N0UA 2ASLA 3DLHA 4JV5F 2GQCA 2UXBK 4OYWA 1UVMA 4IBNA 5HQ8A 4ILGB 2L41A 3FEXB 3EWGA 1OQ6A 2M88A 1OKJA 1NNDA 2CXEA 5JLFA 3UR0A 1B3TA 3AO1A 5KQ8A 3G8SA 4OLPA 2C2DA 3DRSB 2FHKA 1HWJA 3TJ9A 3ZETA 3PZPA 3L4IA 3LWMA 4AT1B 3CCSS 2E5JA 5CZVA 3UN3A 4PUOA 1DEJA 3T19A 1BMQB 3ILIA 3P49B 5TKWA 4F4XA 2EHGA 4AM7A 5FPDA 1WOPA 3LH2S 3CCJS 3E66A 1RK8A 1C0UB 1ZA1B 4R0JA 3PYDA 1B9FA 3OJUA 1LK5A 3IAYA 4C97A 2XYGB 4IR1A 4K2XA 3TVZA 5AXNA 2HFOA 5SZTA 1XIQA 2YNIA 1WB9A 2FHJD 5LJVA 2A41A 4ZVQB 5HMWA 1CSJA 1RE1B 3PXGa 3I96A 3MCMA 4ZVSB 5F8IA 1MMDA 5F3ZA 1BD6A 3ZSXA 4OYAA 1I51B 3V6KA 4DV2J 4YDDB 3I0RB 4DUYF 2W40A 1D9FA 4X65F 4JYAK 5EGYA 1UKUA 4ITSA 4BG9A 1R8CA 2RB7A 4NLTA 1CJKA 1GLBG 2E5LK 3OYGA 4F3OA 4DFPA 1JJHA 1H98A 2JHEA 3SUNA 4TY8B 4CH7A 2D9OA 4RR5A 1RT2B 2XS7A 5HVFA 3BGFA 5J2QB 2KDOA 2X78A 1F5BA 3GPAA 4FJKA 5J2NA 2P9CA 2XLKA 3VF0B 3M32A 3EZUA 2QL7B 5B0BA 4CI0B 1K8KA 3KJVB 3G6XA 1YBTA 4OHZA 2EWSA 2Z8QA 3SCJE 1RBLA 2AEMA 3K5NA 4ZVTB 2JLGA 2BW7A 1NK9A 2YX7A 4LT6A 2HRYA 4FWMA 2ZBPA 4YS2A 4E19A 3KOAA 4U67L 2V50A 4DPUA 3U6FA 4DU8A 4DL0C 3N4WA 1NGIA 3VAIA 4YORA 1QTNB 1S1VB 1RT4B 4FWLA 4CNZA 3D67A 1T03B 1XBWA 3UO0A 2AA4A 4QS8A 4HHUA 1VI7A 3RWUA 2YV0X 1D9AA 2LEBA 2YPYA 1HARA 2ROEA 4U7UK 3VZIA 3C46A 4DPTA 2J8SA 2ZHBA 4ZS6A 4DQQA 2W25A 4ZVHA 4LF1A 2LA4A 3Q8RB 3TWZA 4EAHD 3FBFA 2WONA 4X66J 5LSRA 3BGLA 5BR8J 4DV5F 4LFBJ 3TUJC 3QMQA 1ZOTA 1B4SA 2UXCJ 3MM5B 4GC6A 1KEKA 3GR0A 4DX6A 1VRQC 1Q81O 1UVIA 1WSIA 1NO8A 2UYTA 1NK5A 4TY8A 4CLPA 1WUAA 1LFPA 2HFZA 4F8RA 2N7CA 1WHYA 2FZKB 2WCXA 1YAGA 4OJGA 4WF9Q 2N7YA 5ADXA 4RW9A 3JAMU 1S1UA 2KN4A 4ECWA 2Z1JA 3K5MA 1SIWB 4CEZA 4LF6J 2VYPA 4V19X 2LYVA 5E3AA 3A5OC 4FW2A 3PHEA 3IN5A 3F2KA 2DB1A 2P5GA 3H90A 3IXQA 4K4SA 2UVRA 1A5VA 4IRKA 3UE2A 4C6AA 3SQGB 1W9HA 2F9WA 2ASJA 1UOCA 1XMOF 5L9NA 2HS3A 2XS2A 3CVKA 1WF1A 4FJXA 3LGHA 4R5PB 4U7CA 2QA4N 3DLLQ 4B8AB 2P9KA 4WU2A 1WOSA 2HVEA 3ULEA 1Y5IB 2XI2A 4J9RA 2NQPA 2UUAF 1T95A 2ASMA 4BY9C 1D8ZA 2GTDA 2GQ2A 2B3TB 3HP6A 2KU7A 5F8NA 5L9XA 2M52A 3W63A 1RSCA 2Q3PA 4BRLA 2Q79A 5GAHP 3MXJA 2WUSA 2WVCA 1FWLA 4DPYA 3LDQA 2V4JB 3H1QA 3KHYA 1U2RA 2GA7A 1E6VB 2RDIA 4KRWA 1M5OC 2ZZMA 1FNMA 2ZOFA 4CVNE 3H5SA 3OPKA 3W3SA 3P4IA 4Q43A 3KK7A 1J5EJ 2C3UA 2E2NA 4AQYJ 1RTJA 2HW3A 1BLUA 2AKWB 1HHTP 1WNEA 4KRFA 3WNFA 1ZC6A 5JS2A 4TQRA 2RVJA 3BGOP 4M45A 2P2CB 3ZTRA 4O4RA 2C28A 2UUBK 4E7IA 3DMJA 2PFFB 1BU6O 2LXFA 3TAQA 5ADXH 4IH6A 5DM6L 2NSBA 1UVLA 2KXNB 3EKSA 1TAUA 2XMWA 2MQMA 5JVGQ 5AE3A 3CUNA 1G4CA 3Q0AA 3DLGB 3SQ0A 2VBWA 3G0ZA 3H40A 4KPCA 3D3BJ 1HNIB 3Q7BA 2QA1A 2BXJA 1VLYA 5HP1A 4NXMK 4KH5A 2AJ4A 1S79A 2F8SA 5J2MB 1RDCA 5KFYA 2XCAA 3IR7B 2NUHA 3RBZA 2ZM6J 4CEFA 2E29A 5KFAA 2BR0A 3K57A 5E33A 5ETOA 3DLLL 4D3GA 2GAHC 4CTAB 4L3QA 3QERA 1S5JA 5C15A 1RCOB 2JDJA 4PXEA 3TZZA 3AH6A 1IKXA 3CO0P 3J80U 1WUUA 2CQPA 2LP4A 1EKSA 2V0NA 5HANA 1YVFA 4TLRA 4F67A 3NGSA 3WEEB 3QBXA 4AF1A 5LT5A 3UCZP 4LQ3A 4FJ7A 1FWKA 1JK9B 2GWJA 1KSPA 3HHNB 5KFOA 5DQGA 5AQSA 5BR8K 3ZZTA 5FLXY 2O5DA 2ZH2A 2EFOA 3IBWA 4N56A 5GAHU 3SQ2A 4PYDA 1K47A 3V6HA 4NZ7A 3QJPA 3TAMA 2X1BA 3DNCA 3AVCA 4FW1A 4DFKA 3IFRA 4IG3B 1UWAA 2PDAA 2OAUA 4JI1K 3KK1B 1QM9A 2XZTB 4DMNA 4OYOA 2DISA 2LDYA 4QPXA 5BN8A 4KIAA 2AW0A 3M2RA 1NSKL 1KVJA 4PQUB 3O8MA 5HLFB 1N56A 5F0XA 2AX1A 4EYIB 1CXUA 4OFZA 4DXLA 2Z2YB 1RDAA 2P9PA 1XNQF 2R7XA 1RAAB 3D6MB 2YNIB 1LK7A 2GO9A 1F5CA 2R2TA 4PG6A 5KGXA 3ILOA 3MMAB 3NL0A 2UUAJ 4KGMA 2UUTA 2LEPA 2PYJA 1Y97A 1BY9A 2FLOA 1RBOB 4ANCA 4DSJA 4NO7A 3M8WA 2NRXA 4OLAA 1FDAA 1SPBP 4CJPA 4LF4J 1Y10A 2JEGA 4JD2A 5GAEP 4TKTA 4ENOA 3OTOK 4PUOB 3MM8B 5JJBA 4CJQA 3TAFA 3R3LA 5CYQA 3GOIA 4ELVA 4B1ZA 3I31A 2J9DA 2NLWA 2K7KA 5A2QU 1YVNA 2OCEA 3NGIA 5AXLA 3GB0A 3QZ8A 2ZGZA 3PW0A 1ROFA 2DH7A 3RSEB 3J7ZT 3Q23A 4J37A 4F3QA 1UWBB 3T69A 2WBNA 1UCNA 3SBMA 5MAOA 3CCUN 3RUBL 1I5OB 1AFJA 3J7ZO 4C7QA 3M7VA 5CR4A 1X4HA 1XUPO 4I69A 2CIMA 2MXYA 3CW2C 1TMJA 2OIHA 3I33A 1LKZA 2B8PA 3NWRA 2PGCA 1U6BA 3SK3A 1HPMA 5A8KA 3SCLE 1NZ8A 3HPOA 3M6GA 4B08A 4ES2A 2BQ3A 1VRUA 3B6OA 2E1PA 4NOHA 3GJRB 5E3RA 3GG0A 3MOZA 3FSIA 2F1FA 3ZX2A 5DGAA 3CD5A 1T11A 5BREA 5HQMA 4X66F 3HDSA 2DRBA 3GBTA 5AZJB 3G4SN 2G8UA 1GXLA 2CQ4A 3ZEUB 3J8AA 4BRHA 2E7XA 4U67Q 4AUKA 4NMXA 2QV6A 3CCTA 1FERA 3S01A 4HVJA 2AF6A 2JJ4D 3C15A 3JQKA 3TEGA 5B0DA 5KFBA 4JI5K 3UVJB 3DRYA 4URGA 2HHQA 4ISGA 3F0NA 2HK3A 5L8RC 1F60B 1CZBA 1NMEB 3MEGA 1X60A 1Y9OA 4U6PA 2AD9A 4L76A 4JI0K 4DPWA 4QU6A 3G82A 4JK8A 3IBCB 4DX5A 3THVA 4LY7A 3GE9A 2W2MP 4DS4A 4CF8A 3EKUA 4LFAK 4OI6A 3THXA 3V81A 3P45B 3M8QA 3K0JA 5BR9A 2DEIA 4OI4A 2BJ9A 1AB8A 3C7NB 2F40A 1JB0C 5IQQA 1NB2A 3W2WB 3NNCA 3P8BB 3ZSQA 2N82B 3M9NB 1JLEB 4E1JA 4ECTA 4YHHK 1TU0B 4IJNA 4P7VA 3QWPA 3KLFB 2BJDA 3CQ8A 4NLGA 2LA6A 1LFWA 4BR2A 4FZVA 3VGMA 5JMVA 2ATCB 1Q5VA 2V6AA 3AD7C 3H3NO 2ZH3A 2J4RA 3NF8A 3FZBA 3BKUA 4B3SF 4JI3F 1E4FT 1VHXA 1CG2A 3ISNC 1F6TA 2VKZG 3FRYA 1S6QB 1QVFM 3P5BP 4JI4J 2AGQA 4C8KA 3CF5L 2PIIA 3OTOF 1U1QA 4V19J 4BR9A 2VZ9A 4JI5J 5DS7A 3LM2A 4KB0A 4UOFA 2CPEA 5ETSA 3TA2A 4IOXA 4LF7J 2G0CA 1KVIA 4J5OA 5KG0A 3DLGA 4LR9A 3IRXB 5A76A 1OWXA 4CJKA 4HLBA 1WHXA 4HCBA 3AD9C 2MQ8A 1Z2LA 3VQQA 3AGRA 4OPAA 1FK9A 1SXLA 4QYRA 4DSKA 2FD2A 3DLEA 4KHWA 2HSEB 3HF5A 2E9RX 1YSJA 3VGVA 4FJGA 1ZS6A 1ZM4A 4OHYA 4G1QA 2OEMA 1RT7B 3GCWP 1HHSA 2AWZA 3CM5A 2HMIB 1XMOK 2V7ZA 5HRNA 1NAQA 4PYAA 2HSTA 1FXRA 3OXFA 3M8SA 2OFHX 3K5LA 1QSLA 3QMLA 2ZH6A 2HURA 4ELTA 3MF5A 3GTYX 4O0IA 4Y65A 4WFXA 3DRXA 4RKUC 4CM0A 1CBKA 1S12A 1Z4UA 2Z4PA 3P96A 5BN9A 1HR0J 1WN7A 2HYIB 4J9MA 2XY5A 2R2RA 3PJXA 2ZM6F 2PZSA 4C0HA 4R0EA 3OR1A 4NCGA 5KFEA 2LQBA 4FZXC 2E66A 4N77A 4F04B 1V3ZA 1T05B 2EFGA 2CWXA 1VLOA 3NHGA 5IT0A 1ILYA 2DY1A 4IRCA 4MK7A 3NGTA 3BGUA 1HBNA 4FXVA 1RAJA 5FLXU 4JI7K 3LP0A 1CJUA 2FJAB 3UKRB 3ZSWA 5AFUA 3MWBA 2BJ1A 3ZX3A 1J5OB 3BDPA 2KHDA 1H73A 1KN6A 3DLEB 2QG9B 2F65A 2FLPA 2I1RA 2CADA 1IWAA 2Y1RI 4ZPDA 3D2FA 4JKGB 4CHQA 4BDYA 1ACMB 2M8DB 1YJTA 5FPMA 4QIVA 2XMKA 3MPUB 3UNYA 3ULHA 1SKWA 2C3PA 4JS4A 1RT2A 4Q45A 1U1MA 2VQEJ 2W9AA 4MIAA 2X6NA 1R43A 2OMOA 2L08A 4RWXA 3QRPA 2ZJQL 2RHQB 1XC3A 4B3SJ 4NWBA 2R8KA 1HNVA 3I32A 2AEFA 3OXLA 3JSRA 4CTAA 2P9UA 4BE0A 7AT1B 1YRXA 1LWEA 1VFJA 3AD8C 2B4OA 2L9NA 1FKPB 5KFKA 3A13A 1TV6A 2EX3A 2IAJB 4USMA 3PRDA 2HB5A 3CMEN 2BUNA 1DT9A 5DM7L 1G99A 1NPKA 1CQNA 2M7SA 1W7AA 3RMDA 3GQCA 3NMRA 1VQ5S 4USKA 3ALYA 4AHTA 1SH3A 2HGNA 3QLHB 4CF9A 3TX0A 2A2CA 3K5OA 3LP0B 3O9SA 4AM6A 3TUIC 1K1QA 3AB4B 3EO3A 3DGVA 3MAAA 5ETPA 1N32F 3AVNA 1TL3A 4YP3A 4JNEA 5BRFA 3NCPA 3RR8A 3ID6A 1S0NA 4I0WA 1AW0A 2X74A 4WIIA 3NGDA 3ZNUA 3VAHA 3HCXA 4DTSA 2F7VA 3KDOA 3DRSA 3HLUA 1U7LA 4NYNA 4RL1A 1WSVA 2JVRA 2ZNZA 5LJWA 1NDCA 1RACB 1YRTA 1S49A 2G1HA 2RU9A 3C14A 2YKQA 1GT8A 3R5BA 4RLEA 2F8HA 2LEAA 1IQZA 2MKIA 2XRIA 4NLYA 2GUIA 5C25A 1N0VC 1LXJA 3G6YA 1WWHA 4M95A 2AZ3A 5EVZA 5JVHL 1KXPA 4CYUB 1RDWX 1XR6A 1RADB 3PY8A 4RCHA 1HQEB 4AQYK 4UW2A 1EXQA 4DQSA 2KTQA 2RD5C 2G2OA 5GIOA 2MPUA 1F1BB 3QLHA 3DU6A 2I8EA 3VOVA 3TU5A 3OW2R 4M5JA 4ZCKA 2BKNA 2HVZA 1M5SA 5KFJA 3W62A 4Q8FA 1L3TA 4WFBL 1PYOB 3CDEA 4CF2A 2ZWPA 3M8YA 5KQDA 3SAGA 3UI3A 2PBDA 2J0QD 2KI2A 1VBKA 3V9UA 3DI6A 3GFHA 3WHIA 4DR4K 3DYAA 3HZ6A 2OTLN 3IM9A 4OLBA 3AT1B 2OGUA 4B3MJ 2OHDA 1RTHA 1WG5A 1IBKF 3OHBA 1UEUA 3R5CA 1U1RA 4O3SA 4DV0F 1FVQA 2W4CA 2RRAA 1VQNS 4B3MF 4JD2B 3D0IE 1SV5B 2BH1A 2B8QA 4DCPB 1UJ4A 3MK6A 3GE1A 2DH8A 2VIHA 4HT7A 2ZH1A 1R7IA 3RSEA 4MIWA 4P9SA 1K1SA 1IKYA 4U7UD 4MDAA 3G10A 2DY4A 4DR7K 4EZ9A 4JI4F 2CGKA 3VQSA 4ISFA 1GLJO 4RG8A 3BF4A 4HACA 1S6PA 4IRDA 4M42A 4TSXA 2LXUA 2CPIA 2WBMA 1JL1A 4JI3K 4EK2A 1PG5B 1CULA 4QWAA 4ZK7M 1R27B 1BG3A 3V2UC 3CJ2A 2ZDPA 2ZQBA 4CH1A 1CQMA 3JQMA 3D45A 2DEJA 3QAUA 4DR6F 4CF0A 2A5XA 2K06A 2EC2A 4WCEL 3KKFA 5J1PA 4ECZA 2UXCK 1RU2A 2C42A 1TUGB 4QR1A 2RQKA 2J6SA 2YX4A 5KG7A 2YY3A 5JVHQ 1BCMA 1ICEB 4F4KA 2D1KA 5KT6A 3NG8A 2D1CA 3AO4A 1IKYB 2EFQA 3V4IA 3R1LA 3D7EO 4BC9A 2O8FB 1NEEA 1LWFA 4O3QA 4ZLJA 4CJLA 2HWHA 3W0LA 3HVTA 2IDLA 3QEPA 3DXSX 4OKKA 5JXSA 2CPDA 4FBTA 1JXLA 3MCSA 2VG6B 2UUBF 4M1KA 4AYBD 3R1XA 4M63C 2ZJQQ 1Z1ZA 4H4KA 1HNVB 4DF4A 4H4MB 4C11B 3O2IA 4K8ZA 5AQHA 1TKXB 3M1VB 5F0UA 5KT7A 4PY5A 5CYMA 3HT3A 4M5GA 2OPQB 4ECVA 1GOCA 2CQ3A 1HRHA 2Q97A 1KVAA 4FWRA 4X62F 4XIUA 2E6LA 3CC7S 1UJ6A 3B82A 5EWFA 2KVIA 3L4BC 4ZJQA 4QCLA 1U26A 4BC2A 3KNGA 3GZ7A 2CFXA 2HQDA 3OYDA 2OPPA 1OVQA 1X1PA 5U47A 4MLEA 2VPZB 2QEXN 2DGVA 4B3MK 1RT3B 3J7YU 1Y5NB 5EU7A 2CJYB 4JYAJ 3JSYA 5HMYA 1FRMA 1FT8A 2IVPA 3HSJA 2WHOA 2ADCA 4ZIWA 3K8VA 2YI1A 1RDBA 2R7UA 1C2PA 5E3PA 2NLXA 4KFBB 4IFVB 4JK7A 4K43A 4OYIA 3MM6B 3P6YC 3HKWA 1WEYA 1F2HA 1RU1A 5K5MA 1YJWN 4UUXA 2G4BA 2CRLA 2HZAA 4M7YA 1NU0A 4U8YA 5C2DA 3ZSZA 4ZPCA 1ATRA 1SC6A 4UQGA 4E7HA 2QYGA 4M3UA 4DPOA 5BYSA 3AVAA 4J7CA 3R27A 4EBEA 1N5YA 1X4AA 3MEDB 4CIGA 3RBEA 2DBBA 3KD1E 3NF6A 4CO2A 1RCXB 3MM6A 1CXQA 1QSSA 1WEXA 5GADI 1YJUA 3RB3A 2DKOB 1RT7A 4NCBA 1NOZA 3J81j 4HTUA 1U8WA 1CJVA 5I3UB 4FS2A 4DTUA 3CJ3A 3Q8UA 5A8KB 2FBVA 1Q5YA 2EEYA 3VALA 3KWIA 2ALZA 3UB5A 1E3MA 2ITGA 4QIEA 1M90T 2D74B 1TK0A 2UXBJ 2A42A 4ED2A 4KBOA 3CEDA 2Z1IA 3T6BA 4DL4A 2GWKA 3PDNA 4QR2A 2OPSB 1K9MO 5M1FA 2DYAA 1KAXA 4OZ1A 3AFGA 4M5DB 5I3UA 5C2CA 5AQUA 3SJHA 3T7ZA 3T1HF 4C1NI 2HMIA 2HZVA 2IFXA 2P9UB 4JRPA 1BE4A 5D0GA 2P9NB 4B3TJ 3KHGA 1Y4ZB 4A8QA 2C2EA 1N6QA 2VC1A 1IWGA 5B08A 3BF1A 3IA0A 4MKAA 1HKCA 1U1NA 3MEDA 2RDDA 1VIXA 2QYCA 1YZ7A 3H08A 1S9GB 1NGAA 3PIPQ 1M5VC 4N76A 2AJ1A 4FLYA 2MSSA 2RPIA 4FN5A 2LQ5A 2V4RA 2EK6A 1VQPS 2YKPA 1HUXA 1Q78A 4ANEA 2HQCA 1NPRA 4IOAL 2IM3A 4PWDB 2NRRA 3D1OA 2HWTA 1HYVA 1NGJA 1N34F 1B0VA 5GIPA 4ICLA 4LUBA 1RT5B 1HYSB 4K42A 4AXIA 2QC3A 1YJ7A 4RTFD 2DXEA 3S9HA 3OYIA 5GAGI 2GHWA 2YKNA 4IG0A 1Q82T 3MUMP 1QQMA 4FPIA 4CZFA 4YB7A 2H5JB 3BR8A 4YN3B 4CFAA 4FSVA 3U4LA 3U3YA 3N28A 1LWCA 2YNFA 2ZJRL 3WXIA 3T6JA 4GKKK 5J1NA 4C98A 2FY8A 1PC5A 3LUYA 3VTIA 2OEKA 2V69A 3QGHA 2WVDA 4MQ3A 2W6KA 1IR0A 1WDTA 3SZ2A 3D3CJ 1M1HA 1WC4A 1VCTA 4CO0A 4OYZA 1HQUA 2B0GA 2M4MA 3TAPA 1YDLA 2QI2A 4OZ5A 1O1WA 1PSDA 1D0EA 4P52A 2ASDA 4B1XB 5K14A 2PFDA 4LF5J 3D2WA 5ETQA 2WVBA 2M2BA 3LF0A 3JS9A 4LRDA 4DQIA 3VF2A 1K6YA 2XGPA 3VVUA 1PJ5A 4JKGA 1IBLF 3SUOA 3TJ8A 2ILZA 1VQ5N 2ZC4A 2FZCB 3QEVA 2RS8A 5A2QY 3IRXA 8AT1B 4O8KA 4QWEA 5KPTA 3PX4A 2DTJA 2VD3A 4DV7J 1MMLA 2AV5A 1LAVA 1VBXA 3GFZA 3Q8SB 4AFFA 3ZSYA 1XNQK 4M3RA 2Y0BB 3CD7A 4CO3A 5A2QO 1B70B 4CWBA 3C19A 1TUUA 2KJVA 4E1NA 2H9ZA 4BRIA 4HI1A 2HLTA 3CD0A 2FF6A 2GMLA 4EHTA 5F0WA 1JXEA 3TWHA 1U2CA 5KT5A 4OIXA 2F9JA 1SUQA 3BSCA 4LFBF 4CLLA 4OVLA 3UFCX 1XMQJ 2WB1D 4EO6A 1H6KX 4GY2B 3THPA 1T3NA 3CJRA 4J2BA 4DTXA 1KBRA 1RWXB 3D2EB 3GIMA 2RDJA 2I7NA 1ZYQA 1N5QA 2PY5A 2XMMA 1WC1A 2PFUA 4HDGA 3BKTA 3RB6A 3JTNA 2CQGA 2RQ4A 1YG0A 1VQYA 4KKOA 1EHWA 4DFJA 5AT1B 1CJVB 3V81B 3ENQA 2A1SA 1TL1B 3CJKB 1AT1B 5CZ1A 2DNMA 2C22A 2LECA 1P8ZA 3HK2A 4QWBA 3HPHA 3NGUA 2LU2A 2KQ2A 3KJVA 4I6MA 2B5JB 4CIFA 4JV1A 3SQ1A 2XI3A 3E51A 1YXQA 1ZXOA 4Z7YA 3I5AA 4CJTA 4AXJA 1HWKA 2DNYA 2YKAA 4M3YA 4WFBQ 2L3MA 3PM9A 1N36K 4KSEB 3VZHA 4LH4A 1E6YB 1F5AA 2C3MA 1SJFA 3GONA 1EETB 1O6XA 2CZ4A 2XSJA 3SBTA 4LFAJ 2I6WA 5K8OA 3EL2A 3WXLA 1O8BA 4USHA 2NZCA 1SUQB 3O9UA 4JP8A 3TTDA 2P5VA 3RW7A 1I3AA 4QPTA 3G6ES 3BN7A 1RTZA 1VGYA 4WP3A 1Q7YT 2IVYA