3KLEA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
560
structure length
560
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 142
structure length 560
sequence length 560
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kleA05
4K4SA 1U49A 5CZ2A 4YQWA 3SNNA 4LH5A 3SI6A 5CYMA 1T94A 1RTDB 4CEQA 3RR8A 1NK8A 1C0TB 1BQMB 2OPQB 1T03A 3D5MA 1HYVA 4TYBA 4JV2A 3N6NA 4ECZA 2P51A 3V81A 4IR1A 5E41A 1NJZA 3HJFA 1EETA 5F9LA 4RNNA 1T3NA 2F8SA 1IKXA 3QEXA 3KK3A 2FBYA 2OPPA 3QNNA 2RF2B 1VSFA 5L1IA 1S0MA 3SQ2A 4N76A 3DLHA 3FFIA 1L3SA 1S1WB 1VRUA 3DDKA 4CFCA 3CFPA 1JLBB 1T8EA 3EYZA 4ICLA 2UVUA 1RT2B 4DL2A 4NYNA 5DLFA 1UAXA 3BDPA 5KFFA 3Q8QB 2IA6A 3PX6A 5JS1A 4FW1A 2YHAA 3MAQA 3IN5A 3KHHA 4BACA 5HROA 4I7FB 1YVUA 4M94A 3HHKA 3RB6A 2HVHA 4BE1A 2PZSA 3O4NA 3LP1A 1EKEA 1KCFA 1SKSA 3VQCA 1FKPB 4QWBA 4IBNA 5KT7A 5CY4A 4MFBA 4FJ5A 1L3TA 2ILYA 3KLFA 1IKVA 2ASLA 2DTUA 4IOBA 3KKSA 5FDLB 3ICLA 3KMQA 2YHBA 2GIRA 3P83D 4AHUA 4TSXA 3G0ZA 4E7HA 1QAIA 3V6DA 3SV4A 1GX6A 4CCHA 1QE1B 2F8EX 5F8HA 2YNHA 4CHNA 2AGOA 2BANA 5J2MA 4GVMA 4FXDA 4NLXA 1N6QB 3O4QA 2XI3A 3HT3A 5DGAA 4DTSA 4PQUA 3L2QA 4DSLA 3PO4A 3PZPA 3ISND 2F96A 2QXFA 4PWDA 2IAJA 3AA3A 3HP9A 4OJRA 2OZMA 1W9HA 4CF1A 4RUAA 2YNIB 2IC3B 1CLQA 4CHOA 1L3VA 1D1UA 1RNHA 3MTKA 3PJWA 5J1EB 3QLHB 3HVTB 1TKZB 3MF5A 4B9UA 4IFVA 3GQCA 4E3SA 1IKWB 3NBPA 2EX3A 4FM0A 1JLQB 4RNOA 1HYSA 1XHXA 5EUHA 5K14B 5KG2A 1Q8IA 3M8PA 1C0MA 4DSKA 2HWHA 3Q8RB 3SFUA 4K8ZA 1NK7A 2HNYB 1S9FA 4IKFA 1JLAA 4DL7A 4ED0A 4F3TA 2D0CA 4M3ZA 3PHEA 1JL1A 5C25B 2BQRA 4J9SA 4Q0BB 4CGGA 4ZTFA 3PW0A 3H5SA 3EZ5A 3ZSOA 3MEEA 1S1XA 4J2AA 3LPTA 4WFZA 3ULDA 4DLGA 4FLTA 4Y1DA 5KT5A 2B6AB 3MEGA 3VQ6A 3OYGA 5KFPA 1NJWA 3FQLA 3N6LA 3V4IB 2HHQA 1RDAA 1JLGA 1HMVB 1NKBA 3NGDA 1W0HA 1T7PA 1Z4UA 3VQAA 1SUQB 4OKKA 3SPZA 1JLFA 2QKKA 3V1RA 1KLMB 1RA6A 3IG1A 3UPFA 3VQEA 1WLJA 2X74A 4FJLA 1YT3A 4NLUA 2WONB 4NLRA 4QW9A 3RBEA 3TARA 1FKOA 4I9QA 1NJYA 4YR0A 2GUIA 4DTOA 2C22A 4O0IA 4K4WA 5D3GB 3NKYA 3KOAA 2LSNA 3MFHA 3U3GA 5C42B 3U6FA 4FK0A 2R8GA 3H40A 3N6MA 3KLEA 1VRTB 1IG9A 1RBSA 4Y2AA 2FJVA 5JXSA 5DMRA 1XI1A 3DI6B 2VG7B 4WXOA 3ZCMA 5EU7A 3PW7A 1RTDA 3PW4A 2HNDB 4EP5A 2QV6A 3BGRB 1BQMA 3H5XA 1NHVA 3AVAA 3OYMA 4CIEA 3DLBA 1BCMA 5KFUA 4ELUA 3L2WA 3T19A 4FJNA 3WNGA 3NAHA 3QGIA 4IQXA 3PY8A 1QSYA 3CDEA 3CDWA 4K4ZA 2B5JB 5KG6A 2IOCA 1LV5A 1UWBA 2WOMB 4YR3A 4PUOA 2GC8A 2BQUA 4WFYA 5JS2A 1JXEA 2RF2A 5CYMB 1CXQA 1NKCA 1LW2B 2YNFB 2E9RX 1T03B 4ZP9A 3DM2A 4ECRA 5DQGA 4RNMA 4RW7B 3LZIA 3H5YA 1RT6A 4E1NA 5L1JA 3G6YA 4BDYA 3CQ8A 2JEIA 4O3PA 3QETA 1X9MA 5KT2A 3OL6A 2AU0A 2QE5A 1S97A 4QWEA 5F8MA 1SH2A 1GX5A 4ZP7A 1IKXB 4JS4A 3NAEA 1GOAA 2OPPB 4IFYA 3DRSB 2O4GA 2R2UA 3LDSA 2G8HA 3RMCA 4EZ6A 3Q8SB 1NNDA 3UR0A 5F8NA 5DQIA 1GOCA 2IGIA 1FKPA 1VRUB 4CJPA 1Z25A 4ICLB 3P1GA 4KO0A 2YNGB 5KFTA 1JIHA 4F2RA 2R7YA 5FDLA 3EY1A 5C5JA 4G1QA 4IG3B 3VQSA 2FLNA 5F8GA 5HROB 4CJEA 3O3GA 4HCCA 1VSJA 4E1MA 1Q9XA 1JKHB 3VQ4A 3DOKA 4CIGA 5KFMA 2IJFA 3TI0A 4B3OA 3AO5A 4DL6A 1WSGA 1S49A 1U45A 1XR7A 3LP1B 3M9MB 5KFVA 4CFBA 4J9QA 3AVMA 4ECSA 4C8LA 3ITHB 4CEFA 2D0BA 2VWJA 4WZMA 4KI6A 4PA1A 4J2EA 3KLFB 1IKVB 1RA7A 4OLAA 4HUFA 4TQSA 3QO9A 4LSNA 3I0RB 2B43A 4CF8A 4Y34A 4O4GA 3KJVB 3V6DB 1S48A 1NKEA 4FVMA 3HK2A 4J9RA 2YNHB 1XHZA 1TKXA 2BANB 1JLQA 5J2MB 3BSOA 5KFHA 1C2PA 3NH1A 4I2PA 4XIUA 3QEPA 3MR6A 1KVBA 1JX4A 2J6TA 4PQUB 5T14A 3KHGA 1S0OA 2RKIB 3NL0A 5T7BA 4FJJA 4YMEA 1QTMA 3Q8PB 4PWDB 2IAJB 4CHQA 4HCBA 1D9DA 2ZD1A 5KGWA 1VSDA 2XY5A 3L3VA 5KFYA 1S1TA 4Q0BA 3HPHA 1W25A 3KD1E 2FBTA 4FJGA 2IJNA 3S3NA 3NBPB 5KG5A 1BISA 4NLGA 4KFBA 3NCIA 1WN7A 4ECTA 4CIFA 5KFEA 3AO3A 1BL3A 1REVB 3M8PB 5FROA 5DLGA 4ZPDA 5KFAA 4RW4A 3NGYA 3V4IA 2X6SA 4IH5A 3DLGA 1JLAB 2VWKA 4DTMA 2GIQA 3OYIA 4ED7A 4AHTA 1SUQA 4OKEA 2FLPA 5KFCA 3JSMA 3MEEB 1KLMA 2P5GA 1HARA 3MEGB 1S6PB 2I1RA 1HQEA 2D5RA 2IS3A 4LY7A 3M8QB 4DF8A 2Q3SA 1C1BA 5HRPA 5KFGA 4KB1A 3M9OB 5HRNA 3SQ1A 1JLGB 3T5JA 2BDPA 3C6TA 3JYTA 4K4UA 1TK5A 2P5OA 4CHZA 4DTNA 4O3QA 3VN5A 1D0EA 3V6HA 3UDLA 3HL8A 4C8KA 3V9WA 2R8KA 4TY8B 3MEDA 1SL1A 5KFWA 3DRRA 2OPRA 2WTFA 3IG1B 2FJWA 4F4ZA 3KLVA 4CJ3A 2ZE2A 3DI6A 4DSFA 4Y2CA 1TV6A 2OH2A 1FKOB 1KSPA 4KHUA 3K58A 3KKRA 4MKAA 1LWFA 2W9CA 1WNEA 4ZPAA 3ZSXA 4DFMA 4F4WA 1N48A 4DL5A 3RB3A 2KFZA 4KI4A 4M3XA 4DSEA 2WOMA 3KLEB 3KK2A 1RBRA 5J2QA 3HPGA 3OS0A 2E9TA 1N5YA 2G8IA 1LW2A 1S4FA 2YNFA 2UVRA 4RW7A 2QKBA 2XHBA 4CJVA 4CF0A 3SJJA 2JLEA 4O3SA 3MR2A 4RUCA 4EEYA 4R5PA 4NCAA 3QGGA 4HUEA 3CFRA 3ZT2A 5J2PA 1UWBB 2IDOA 3QERA 1U04A 4PUOB 4LQ9A 3MXJA 3DRSA 5KFBA 2J6SA 1BQNA 3OJSA 2DFHA 4KV8B 3CYMA 3OHBA 3C6UA 3DM2B 4RW8A 3OLBA 4JV0A 2RPIA 4ZTJA 1RT6B 1JLEA 3L2VA 4JRQA 4KRFA 2FVSA 3OYLA 4KB0A 2YNGA 3E51A 3RMAA 1DTQA 2G8VA 4IG3A 4RNFA 3KK1A 2HHTA 4RNHA 3PW5A 1T05B 4FBTA 1JKHA 4IFYB 3DOLB 4Q5VA 4W5RA 4LSLA 4WE1A 2GV9A 2R2RA 3ITHA 4KE5A 3AVGA 4KO0B 4MK8A 3OL9A 2BGGA 4W5OA 3H2LA 4Z4IA 3SUPA 1RBVA 1HNVA 3I0RA 4G1QB 3LWMA 4I2QB 2UUTA 2W7OA 4EP4A 3QESA 2BE2A 3DOKB 3RBDA 3KJVA 1NK4A 4DSJA 2Z1HA 2R2TA 4B3OB 3H4BA 4R8UB 4JS5A 1DLOA 2FLLA 3MECA 4B9LA 3I0SA 3NF7A 1TKDA 1WSJA 4FLUA 2RKIA 3SI8A 2VA2A 4QAGA 4N5SA 3K59A 3DLEB 1EP4A 4DMNA 3QO9B 4LSNB 4M3YA 1KHVA 4AHRA 3T1AA 4ID1A 4CERA 3KHLA 3TANA 4O4GB 4ZMMA 3THVA 4H54A 3NAIA 4ZVGA 1KVAA 1TKXB 4ED8A 3LPUA 4NYFA 4J9PA 4DEZA 2XWYA 2FVQA 4F8RA 4I2PB 4DQPA 4F3OA 2ATQA 1REVA 4DU4A 4ZVHA 1RBUA 2WHOA 4EBCA 2JEGA 3BSNA 5J2NA 3B6PA 4KBIA 3RR7A 4B9VA 1TL3A 1UOCA 2V0NA 2ZD1B 1QSSA 2KQ2A 1VSIA 3P5JA 4FJHA 3BJYA 1S1TB 2RDIA 1NOZA 4KSEB 3I8DA 3NF6A 4DSIA 2HB5A 4NLPA 5SWMA 4KFBB 4J9MA 3GIJA 3TAMA 1S6PA 4H4OB 2O4IA 5EWGA 3M8QA 2WK4A 4IRCA 4RW4B 1TAUA 2OYQA 5KGXA 4NLDA 3DLGB 2WB4A 3MR3A 3G86A 2KZMA 2XC9A 4YR2A 3QGHA 3IS9A 1F21A 1XWLA 1ASUA 1S0NA 4LH4A 2HHWA 4FLVA 4OPKA 1U4BA 1U48A 1BGXT 4TY8A 2W8KA 3JSMB 4KREA 4O3NA 1ZBFA 1RTIA 4OKJA 4K50A 1S1VB 1HQEB 4FJMA 3QEVA 4W5TA 4M3RA 5HRSA 5KTQA 5KG0A 4LQ3A 4BDZA 4AILC 3NH0A 3VQPA 1RTJA 1C1BB 3AO1A 2VG5B 3VQ9A 3VQQA 5EWFA 4IR9A 1HNIB 1RT4A 1LWCB 4RW9A 3I5CA 3C6TB 3JYTB 4EO8A 4N56A 4C8MA 2Z1IA 4HTUA 1QUVA 1FXXA 3LP0A 3NF9A 4FLWA 4QPXA 3OS2A 3LANA 3MEDB 3DRRB 3QIOA 2OPRB 1R0AB 2JEFA 4J9LA 3AVHA 5KFRA 3OYHA 1ASWA 2CKWA 3AVBA 3FSIA 2ZE2B 5KFSA 1Q9YA 1TV6B 4XPCA 4E7KA 4CGDA 3HO1A 3PVXA 1VK0A 1ZBUA 4DL4A 4Z4EA 4ED3A 4J2BA 1VSEA 4WFXA 2HAIA 1Z26A 3ZSWA 1LWFB 2W9CB 3ZSRA 4EO6A 3RTVA 1QAJA 1FK9B 4Z4GA 2XCPA 4BWJA 3HPOA 1MMLA 1OS5A 3KK2B 5J2QB 1RDBA 3AVKA 3LWLA 4WYWA 1N5YB 2BR0A 4KV8A 4ZHRA 4KHNA 4ZP6A 1RTHB 2V9WA 3VA3A 3OVNA 2JEJA 1QQCA 4J9OA 2VG6A 4NCBA 3VA0A 1JLCA 1SH3A 1LAVA 4KKOA 4R5PB 4AHVA 1NOYA 2C2EA 4ZP8A 5J2PB 2G8FA 1A5VA 3NE6A 2C28A 3VQ7A 3VQ8A 4CEZA 2V4RA 1T05A 4FZYA 1X9SA 3M9NB 1YVFA 1CSJA 3DOLA 4IH6A 1BQNB 4DL3A 3TWHA 3F9KA 2UUWA 3C6UB 4RW8B 3RMBA 2B4JA 3DRPA 3CIZA 3IRXA 4NLOA 4CJFA 2X6NA 1XR5A 1JLEB 3MXMA 3ZSZA 5KFIA 3BQ0A 2C2DA 1XR6A 1DTQB 4DU3A 3CVKA 2E6MA 3KIOA 3OYFA 4WXWA 4I2QA 3RB0A 4DTPA 3KK1B 3KLGA 3TAFA 3SPYA 4JV1A 3KLHA 1VSKA 3S3MA 1O1WA 4R8UA 1LWEA 5HBMA 3SFGA 4ED2A 1RDCA 2EC0A 4IKAA 1S10A 3HVWA 4FS2A 5KG1A 3OSNA 4LSLB 4WE1B 4O4RA 1X9WA 1D8YA 3LAKA 4B08A 4M3UA 5HP1A 4CK3A 1C1CA 4DFJA 3CJ0A 3DLEA 5F8LA 1TP7A 4ZPCA 2BRKA 1HNVB 4CHPA 2OPSB 4RU9A 3LP2A 4ECXA 3M8SA 2BE2B 3BR9A 4Q8FA 1RT5A 2XI2A 4DFKA 4HYKA 4CJUA 3WNEA 1DLOB 3MECB 3I0SB 2KW4A 4M95A 4K4VA 2DPIA 3K5LA 2O5DA 1TVRB 4CEDA 1G15A 4ECQA 4Y3CA 2XY7A 3AA4A 1EP4B 3NHGA 4O5BA 1WSIA 1J5OA 1NK6A 3TVKA 1K1SA 1ZETA 2I5JA 1SL2A 4K4YA 2W9BB 1LW0B 1NK9A 3QIPB 3GIIA 4M41A 2Z1JA 5EWEA 2ASJA 2R8JA 2FVCA 3NMAA 2ITGA 3CFOA 3DLRA 4H4OA 2G8UA 4FBUA 1HQUB 4ECVA 1IH7A 3NF8A 1SL0A 3I5BA 2HHUA 4DF4A 3HKWA 5J2NB 2BRLA 1TL3B 2XGQA 3AVNA 2R8HA 1RILA 4K4TA 4KHRA 3QINA 2Y1IA 1S6QA 5KFDA 3G10A 4O44B 5KRSA 4CGHA 4KHYA 4BE0A 4NCGB 1WNSA 4DQSA 2ETJA 2GBZA 2FVRA 3QIDA 1S9GA 3D45A 1WSHA 1TGOA 3IGVA 4OVLA 3EPIA 3TAMB 1S1UB 1S1VA 4DTXA 3GIMA 3WNFA 2XO7A 4EBEA 2AQ4A 4QCLA 2VG5A 3H4DA 2WCXA 3OS1A 4KHQA 3KHRA 1HNIA 1BCOA 3OY9A 1LWCA 3IS9B 3PO5A 4B8AB 4M3WA 3RRGA 3BSAA 2AX1A 3NGIA 3OSPA 3ALYA 3CG7A 4CJTA 2R8IA 2XRIA 4CHYA 1R0AA 1RTIB 4FJ8A 3T5LA 2W7PA 4E7JA 2XGPA 1RTJB 3GILA 3D28A 4J9NA 1NK0A 4EBDA 4FM2A 1RT4B 4RW9B 3GV8B 3UQSA 2XCAA 1NJXA 3AVLA 4CEBA 1D9FA 1J9AA 2C2RA 3HVRA 3LP0B 3PX4A 3NGZA 1FK9A 4NYZA 1S5JA 4R0EA 1ZBIA 1K6YA 4I9LA 3AV9A 1BIZA 2A1SA 4DS4A 2ZKUA 3QEWA 3RAQA 1S9EA 4DS5A 5EDWA 4Z4CA 4DQRA 3OYEA 2YKNA 3ZSYA 4FJXA 5KT6A 3GV5B 3WNHA 4FW2A 1RTHA 4OL8A 4E89A 4DQIA 3SQ0A 4GC6A 4KTZA 1KLNA 3V9SA 3TQ1A 2KTQA 2XY6A 4CJLA 1U47A 4FJ9A 3EZUA 4BWMA 2IM3A 4PY5A 3GIKA 3TAEA 3RMDA 4CFAA 1HPZB 2IM1A 1L3UA 1VSLA 2BQ3A 3DLKB 4O0JA 1CZBA 4FCYA 3QNOA 4EYIB 4DFPA 4TLRA 4ZHRB 2DFEA 3QZ8A 4J9KA 2ASDA 2IM0A 2FVPA 5KFZA 4MIAA 1N4LA 4CJ5A 3K5MA 3RB4A 4FZZA 4MIBA 2VG6B 5HLFA 1JLCB 1C1AA 4MQ3A 4KKOB 5DG8A 3V6JA 4CGIA 4O3RA 3D0PA 1SV5B 2WRMA 4KHSA 3MXIA 3KTQA 3FRZA 1N56A 1IM4A 3H08A 4IRKA 4TYAA 2FJXA 2DPJA 3E01A 5CYQB 4FLXA 1BI4A 3CJ2A 3DRPB 3IRXB 3L2RA 3QYYA 3OYCA 3NDKA 4DTRA 2HMIB 2YKMA 5L1LA 5F9NA 2W9AA 3OLAA 1KFDA 4KB7A 2OPSA 3CJ4A 4FK2A 4ZPBA 3KLGB 1DTTB 4CEAA 2PY5A 4C8OA 2HWIA 1C0UB 4FLZA 4Q44A 3TAPA 3KLHB 3DMJB 3SYZA 5KFJA 1LWEB 1GOBA 2RDJA 5HBMB 2D7SA 4H4MB 2D3ZA 3IGNA 2FBXA 2ATLA 1MU2A 4EYHB 1QHTA 4KAIA 1TVRA 3L2UA 1TAQA 5HP1B 1C1CB 5FRMA 4CF9A 4CECA 4K4XA 1TL1A 2R2SA 3LALA 4B9SA 4TQRA 3LP2B 1RT5B 1UA0A 3UIQA 3BREA 2W9BA 1LW0A 4CK2A 3QIPA 4F4KA 2JC1A 2HHSA 1TKTB 2KFNA 1LAWA 1J53A 1WAFA 4DQQA 3OHAA 5DGBA 4CGJA 2HNZA 5KRTA 1D5AA 1HQUA 3DYAA 4JUZA 3VQBA 1I3AA 3NFAA 3HM9A 3OL7A 3BQ1A 3OYBA 2YV0X 4H8KA 4E19A 4CJKA 4JRPA 1J5OB 2HVIA 4XO0A 4C8NA 4F50A 2I5JB 3ZT4A 4O44A 1RT1A 3G6XA 4NCGA 4LD0A 4CK1A 3VQ5A 4B9NA 5I42A 2OZSA 3ZT3A 4W5NA 2E6LA 3QZ7A 4DLEA 1XC9A 4DTUA 1RT3B 1S1UA 4HKQA 4Z0UA 3TAQA 4KTQA 4FJKA 3BSCA 4CJRA 3HP6A 4Q43A 2AGPA 4CJSA 4NLVA 3SUQA 5KG7A 1HRHA 3K5OA 4FK4A 2QK9A 4AHSA 1S6QB 1S9GB 2J6UA 1UA1A 4TXSA 3C95A 4OGEA 4IG0A 5F8IA 3C94A 4L8RB 1ZYQA 3T5HA 1TK8A 5KFKA 1X1PA 3GYNA 1QS4A 2VA3A 4CF2A 2FBVA 4RG8A 3V1OA 4CFDA 1YTUA 1RT7A 2UVVA 2PYLA 4N47A 1WSFA 4KTWA 4CGFA 4ED6A 2D0AA 1EXQA 4AH9A 4IDKA 3KLIA 2IBKA 3OYAA 4RW6A 1IKYA 3HVAA 4RZRA 1NHUA 2DFFA 4EZ9A 3HSTB 2AGQA 4NZ0A 2E9ZA 4ID5A 1KTQA 4WZQA 4G3IA 3KD5E 4FJIA 2ALZA 5C24A 3LZJA 4UQGA 5I3UA 4HVJA 4CE9A 2RN2A 4DG1B 3A2FA 4QOZB 1HYZA 4E0DA 3AA5X 4NLTA 2DY4A 2G8KA 5KT3A 1C0TA 4X2BA 2OPQA 1TK0A 1HPZA 3PR4A 1S9EB 4YNQA 1K1QA 1YTAA 3DLKA 4U7CA 3PV8A 2YKNB 4YFUA 3OYDA 4NLYA 3T5KA 4Y1CA 3TABA 3ZT1A 3HXMA 2IM2A 4F4YA 3FQKA 2UVWA 2AX0A 4B9TA 3AO4A 4NLQA 2NUBA 3AO2A 4FLYA 4FS1A 4GMJB 2X78A 1CXUA 1SV5A 4KHMA 1S1WA 4QW8A 1JLBA 3TAGA 3V81B 1RT2A 1SKRA 4BDPA 1KFSA 1JL2A 3OL8A 5CYQA 1U09A 3CM5A 1EETB 4F4XA 2AWZA 4K8XA 3SQ4A 4QWCA 3PR5B 4QWAA 3V9UA 2HHVA 4CEEA 2HMIA 2D41A 2OA8A 4I7FA 3SUOA 2IMWP 5HLFB 2E4LA 3H98A 3KK3B 1RYRA 4OLBA 4GW6A 4ECWA 3LP3A 1J54A 3CWJA 3MR5A 2V4QA 1DTTA 3FFIB 3L8BA 4Z4FA 3RRHA 1C0UA 5L1KA 3DMJA 3SCXA 3I5AA 2W8LA 5KT4A 4H4MA 3E01B 1ASVA 5F8JA 1BI4B 3LAMA 4O55A 1IO2A 3AVCA 1KRPA 3K57A 4M42A 4IH7A 1RAJA 5JUMA 4FJ7A 3L3UA 2A1RA 2YKMB 1A5WA 4TY9A 4MK7A 4ECUA 2EHGA 2ZQBA 1TQLA 3GV7B 3KMSA 4ECYA 3S3OA 1QE1A 3ASMA 1I6JA 3QEIA 3H59A 2AJQA 3PJXA 4URQU 3BQ2A 4XPEA 1B92A 1VSHA 1N6QA 5KFLA 3V9XA 2HHXA 1SH0A 3CJ3A 4IRDA 3VQDA 4MFBB 1TKTA 3FDSA 2JC0A 4B9MA 4YP3A 2FC0A 1BIUA 2D3UA 1MU2B 4CJQA 4ZVEA 3PW2A 3F73A 3RWUA 2YNIA 2IC3A 3AVFA 5KI6A 4FM1A 1KVCA 1JXBA 3TR8A 4W5QA 5J1EA 3QLHA 2P1JA 4GC7A 1TL1B 3HVTA 3M8RA 4E7IA 1TKZA 4MH8A 4KPYA 1VSMA 2Z1GA 5KG3A 1IKWA 3CO9A 4E7LA 1A5XA 4FYDA 3S9HA 3V1QA 1RCHA 5K14A 5KFQA 5KFNA 2PYJA 2W42A 3KNAA 1RT3A 2HNYA 4URGA 2HNZB 4Q8EA 5KFOA 3DYAB 3K2PA 5C25A 1KHWA 3U3YA 1CZ9A 3AVIA 4U6PA 4ELTA 3T3FA 1ZBLA 4WYLA 3EPGA 4Q45A 1I39A 1RYSA 4IFVB 2CJQA 3CJ5A 2XY8A 4MKBA 3SUNA 1NK5A 4HHTA 1ITGA 2B6AA 1HYSB 3MFIA 5DK5A 3OYKA 1RT1B 2KZZA 4NRTA 5I42B 4ED1A 3AA2A 3H5UA 5KG4A 4NRUA 3NH2A 4KAZA 4O3OA 1HMVA 4KHWA 3ZSVA 4MK9A 3SZ2A 3V9ZA 2ILZA 1BHLA 4CEOA 3ZSQA 1S1XB 3OYJA 4CJWA 1B9FA 4HUGA 4DWIA 5DG7A 4N41A 3HYFA 4BE2A 2WONA 3V6KA 3B6OA 1HJRA 3ZT0A 4FZXC 2JGUA 3OJUA 1WSEA 3ISNC 5L9XA 5DQHA 1RDDA 5DG9A 4IG0B 4QWDA 4F2SA 1EX4A 3O3FA 5D3GA 4TN2A 4NLWA 4JLHA 4DTJA 1ZTWA 1C6VA 3PX0A 5C42A 2Y1JA 1L5UA 5FRNA 1ZBHA 3RAXA 1JLFB 1B9DA 3O3HA 3G6VA 1RT7B 4ELVA 4DG1A 5SZTA 4J2DA 1VRTA 4OGCA 3CM6A 2VG7A 5CZ1A 5HRRA 4IDKB 1RDRA 3KLIB 4RW6B 1IKYB 4B8CA 2HNDA 3OYNA 3BGRA 3PUFA 1Y97A 4CESA 4M45A 4CJ4A 4URSA 2HW3A 4ZVFA 4ID5B 4OPJA 3IAYA 1JXLA 3CDUA 5KFXA 1QSLA 3K5NA 4M3TA 4NLSA 2F8TA 3SV3A 5C24B 2G8WA 4DU1A 1WAJA 4Z4HA 5I3UB 4AHCA 1RBTA 2B5JA 1ZTTA 3AVJA 1SKWA
chains in the Genus database with same CATH superfamily
3TUZC 2GA7A 2A2DA 2Z8QA 2VJUA 1MA9B 3SI6A 2UXDJ 1T94A 1RTDB 4B3RF 4CEQA 1NK8A 1EKSA 1CBKA 3UNGC 4EWTA 5DZ6A 3N6NA 4ECZA 5IXUA 4I6AA 4H0YB 2B7CB 2XULA 4IR1A 4H0PA 4GKJJ 2RS2A 5CHCB 5E41A 2YH1A 1NJZA 2PFFB 3HJFA 2FJAB 4RNNA 3I55N 4C9DA 3J7YP 2F8SA 3FFKB 5LMUK 1IKXA 1RWMB 2MSSA 2XTJP 1CQNA 2ZBQA 3ENWA 1VSFA 1VRQC 2QZ8A 3TP2A 2B8PA 3SQ2A 4CO5A 4QIWD 3JQJA 3DLHA 2HG4A 5CE3A 3MM9B 5M2PA 4CFCA 1FJ7A 3GIRA 3EYZA 1RT2B 1FNMA 4LR7A 2QSWA 1P27B 3QPIA 5KFFA 3VEXA 4JI6J 2BXJA 4FW1A 4Y6IA 2FGOA 2JFKA 1GEHA 4BACA 5HROA 4I7FB 1GXUA 3MCAB 3C6HA 1RDUA 1NB7A 3NEKA 2HVHA 4PWUA 3W60A 1F5BA 2C3MA 2VZ9A 2QT7A 1M1HA 3CC2N 2C2MB 2LYVA 3M8YA 4CLWA 2XMTA 1VQLS 3O4NA 3K8VA 1Y5NB 1SKSA 4IBNA 5KT7A 2DY1A 4MFBA 4DX8H 4FJ5A 1L3TA 2LECA 5B7WA 2ASLA 2DTUA 5LMNJ 2IA0A 1T9WA 2YKPA 3SMZA 3RBZA 2Y1LB 2I2YA 3G0ZA 4E7HA 3R9LA 3M2UB 1QAIA 3V6DA 3VEWA 1OPIA 2YNHA 2AGOA 2F7VA 2UV8A 3O4QA 5M2RA 3L2QA 5JLFA 3VGKA 1Q86T 3PO4A 2DNOA 3AA3A 4RBVA 4OJRA 2E7WA 5HQMA 1W9HA 4RUAA 2IC3B 3L4QA 2ZNZA 1CLQA 3OHRA 4LVNP 3PJWA 3SK3A 3E8OA 1RCXB 2VFSA 4B9UA 4E3SA 3NBPA 3EVWA 4UZCA 4G1PA 3MUMP 2EX3A 2AF6A 3FZ2A 1JLQB 4BR5A 1IN0A 5EUHA 1DBDA 5KG2A 1Q8IA 1N54B 4DSKA 2HWHA 3THWB 3Q8RB 1B4SA 4ED0A 5MLCQ 1OVYA 1XC3A 1QVGM 3PHEA 2J7KA 2KLAA 3TSPA 2FZGB 4ZTFA 4OHYA 3EE8A 1VFJA 2V2VA 1NWKA 3BBBA 2VPZB 3CC7N 1S1XA 3OUYB 1WC1A 3ZEUA 3ULDA 4DLGA 4Y1DA 3MEGA 3VQ6A 4WQ4C 3H2VE 5KFPA 1M0SA 3FQLA 2YQ1A 4YOXA 4X66F 2VWBA 2NYIA 1WC6A 3NG8A 1CULB 2MDAA 1QAXA 3GFYA 3IFEA 1HD1A 3NGDA 1W0HA 1A9NB 3D6MB 4QIFA 1JJ2M 3AY0A 2YPYA 3SPZA 3CJKB 1UJ4A 3R7NB 3IG1A 4DPYA 3B78A 1M5VC 1TMJA 4K5RA 4FJLA 4NLUA 4WP8A 4QW9A 4ENOA 1HNXF 1FKOA 5CCMA 4I9QA 1NJYA 3E66A 3EDQB 2GUIA 1WBBA 2HFNA 1OH7A 4LF8F 4K4WA 3OTEA 2O8CA 2AV5A 4HDGA 3KOAA 3K0SA 5AZJA 3MFHA 1Z6RA 3U6FA 4C7QA 5BYSA 5C10A 1XQSC 1IBLJ 4WU2A 3QT8A 4QIEA 4F0HA 4C0OC 3T9NA 1WEYA 4X62K 1IG9A 1B7YB 1NRKA 5JXSA 1U1QA 4WXOA 3DOMA 1RTDA 3KDNA 2HNDB 4A8XA 3OXGA 2WB1D 2YWFA 1NHVA 5AXKA 4CIEA 3VAKA 2ERRA 1MROB 1FW6A 1GT8A 4ZVRB 1WUUA 1YZ6A 4ELUA 3MN7A 3L2WA 4FJNA 3QGIA 2IRYA 3DFEA 3Q8YA 1NG9A 4GKKF 1KN6A 1LV5A 5KG6A 5B0DA 2WOMB 2J5AA 2LQJA 3NP5A 2UUCK 4WFYA 2ZJQQ 4H0VB 1LW2B 3MOZA 2E9RX 1T03B 5DQGA 4RNMA 1WC3A 3LZIA 3NXZA 4OYAA 2FIUA 5ETNA 3G6YA 5L1JA 1FRIA 3MEKA 3D68A 4RR5A 4M5MA 3JTOA 5GAEI 2DISA 3M32B 4QWEA 1G2EA 3OTDA 1SH2A 2P9PA 4ZP7A 3M2VA 1N5SA 2FSKA 2OPPB 2O4GA 3DRSB 4EZ6A 2PDAA 3LDPA 4PYDA 5DQIA 5F8NA 1GOCA 2GQCA 1KD1T 1Y11A 2LA4A 2N82B 1Q16B 4G6VB 4LIRA 3VF2A 2ZJPQ 3P1GA 7FDRA 4KO0A 2MLZA 2ZH7A 4CLPA 3A1YG 3H1VX 1BUXA 2KRBA 4G1QA 4IG3B 5A0YB 4I0WA 4JV5F 3CUNA 4BR2A 1YKWA 4DV7K 2L48A 3TI0A 4B3OA 3AO5A 1S49A 1XR7A 2BX6A 2QO3A 3M9MB 3NCPA 3GR0A 1JK9B 3W5XA 3J7YU 1Q82O 3ITHB 1APSA 2A41A 2D0BA 4P52A 2DD8S 3A3OB 1IKVB 1RA7A 5E33A 3I4PA 2QFJA 2ZNYA 5E3AA 3TUJC 1N52B 4O4GA 4RWTA 1S48A 5HOOA 3VAIA 4OFZA 4FVMA 1YJTA 3NMUA 3HK2A 1SXLA 3EMTA 1K0VA 3WXLA 1IBKK 5B09A 2OLWA 1JLQA 5J2MB 2EKNA 5KFHA 5FLXU 3NH1A 4XIUA 4OYPA 3D6RA 1MN7A 3G8TA 5T14A 3BH6B 1CPZA 2PMZD 4LF6J 2CQBA 3QDKA 5BRHA 2PD1A 1LFWA 1VBXA 4JI8J 5KGWA 3V5RA 1U6BA 1EQ0A 5KFYA 1UVIA 3R2CJ 1ZAWA 2PN6A 3HPHA 3KD1E 4RBUA 4ZN3A 5BPLA 3S3NA 3IAM9 1BISA 2VBXA 1NAQA 4NLGA 5CD4H 4ILJA 1YGYA 2N7CA 1FWPA 1REVB 3PIPL 2YVSA 3I6PA 2HFSA 3AGKA 2P6TA 4IH5A 2ZH4A 2KT3A 4DTMA 4OV6A 3WX8A 3VF0B 3PLAA 3O1LA 4TU9A 3QATA 4C11A 2E1RA 3MEEB 2C42A 4NI2A 1DT9A 1FDBA 1HARA 2VC1A 3AA8A 3DGPA 2IS3A 2Q79A 3M8QB 2Q3SA 5LXYA 2KU7A 2VQEK 4PG6A 2VPXB 2L41A 2BDPA 4YOWA 4J9VA 4K4UA 3JYTA 4B3MF 1AFJA 3B6BA 1BUPA 5BRDA 3EUNA 3V9WA 4TY8B 2Q36A 1UPPA 4UQTA 2VHGA 1SL1A 5AJ3F 2OPRA 1JCGA 3CXCR 3QGPA 2ZF5O 2OH2A 4YUDA 1KSPA 2DIVA 2BJ8A 4NYOA 4HHJA 3ZZRA 2J76E 3W64A 2XS2A 4ZPAA 2QJ3A 4F4WA 1N48A 4D3GA 4J90A 4JYAF 3RB3A 2ZVIA 3BY5A 2FY1A 1QVFM 2KFZA 4KI4A 2V6AA 4X4TA 2EBGA 2E2QA 2MZJA 2WOMA 2OTLN 5J2QA 2YQ0A 1WACA 3HPGA 4FPAA 1AB8A 1OPZA 2VQFF 2BW7A 2W25A 1LW2A 4ID8A 1REGX 2KHDA 3ZZUA 4O8UA 1N33F 4EHTA 4HHHA 4DV6K 1Y5LB 3JXOA 3D3CJ 3MR2A 2EEYA 1RE1B 4X4PA 4PHTX 1UWBB 3RUBL 2IDOA 4JKFA 5GADI 1U04A 4PUOB 5HN0A 1KAZA 1VGYA 4KPCA 4HI2A 3MXJA 3DRSA 2J6SA 4BQLA 3DM2B 4QU7A 4NLBA 3BO3A 4JV0A 2ZDOA 1T9VA 4ZTJA 2U2FA 1W26A 4WFNL 1JLEA 3H3OB 1QM9A 2XS7A 3O8MA 1AFIA 3FBEA 2F7TA 2A10A 4BG9A 2W6KA 2YX1A 4I56A 1KQSR 4C23A 2G8VA 3PSFA 4IG3A 4WJBA 2W2OP 3ZZZA 5HO4A 3KK1A 2P9NB 5E5NA 1VHIA 1UJ5A 3G96A 3DC2A 1H98A 4DR1K 1H73A 4MYTA 3N4PA 4LSLA 3ITHA 3UN2A 2QLXA 4BY9C 4MK8A 4YS2A 1VLYA 4JI4K 4Z4IA 4YHHK 2MKSA 1RBVA 1HNVA 1TL4A 2MZSA 3LWMA 4I2QB 4EP4A 4DSJA 2EWHA 1Q0NA 1R89A 3QICA 3H4BA 4JS5A 1DLOA 2AD9A 1BA1A 3MECA 2P9IB 3J7Z5 2G9OA 2GHVC 2HBLA 3P31A 4CT8A 4WCEQ 1WSJA 3GFHA 4BRDA 3CCWA 4N5SA 3K59A 3K0JA 1Z1ZA 1EP4A 5GAHP 3A5NC 4DR5K 4K2XA 4UTGA 3AGRA 5IZHA 3U27A 4DX5A 4H54A 5ETRA 2UUCJ 4DCOB 5EOYA 3FBFA 2AT1B 3LPUA 2H5JB 4PXDA 2YWWA 5GAGP 3MGJA 3GOIA 4PKDB 3O5TB 1RHUB 3ENHA 1REVA 4DU4A 4ZVHA 2GMHA 1FX2A 2DBBA 4DR7K 4QPTA 1QSSA 4OX6A 4Y0WA 1VSIA 2RDIA 5FD1A 3X3UA 2HFVA 1X4BA 2H4WB 2KM8B 3N4WA 2O8FB 2ASMA 1SJ3P 2O4IA 5EWGA 3M8QA 3QWUA 3JSYA 2VOPA 1EX8A 2OYQA 5KGXA 3DLGB 2WB4A 2QC3A 1W7WA 3H2UB 1JNRB 3MR3A 4CVNE 2XC9A 5AXMA 1N32F 1PBAA 3HDSA 3GPAA 1ASUA 2FLOA 2HHWA 4LH4A 1PYTA 4ES2A 1U4BA 1BGXT 4TY8A 2W8KA 3JSMB 3CIPA 2YWHA 4O3NA 4B02A 2UU9K 1ZBFA 4P71A 1F0XA 2KJWA 1MN9A 3R8EA 4FJMA 3QEVA 4W5TA 3DCAA 2IDEA 2MGZA 3NH0A 4LF4K 1C1BB 1U2RA 2BMBA 3FKBA 3VQQA 1ZBTA 5AQYA 4ANCA 3IR5B 1KQKA 1X4CA 2G1DA 5E7OB 3R9PA 1F2HA 4U8VA 4CYUB 2LQBA 3I5CA 1OQ6A 4N56A 3F44A 4DUYK 4JOUA 1YK9A 4IFEA 3M2RB 3NF9A 4QPXA 3OS2A 1WOSA 1Y9OA 2CNOB 3MEDB 3CCLS 1HHSA 3DRRB 2CUYA 1B0VA 1R0AB 2ZKTA 3EN9A 1VQSA 4J5OA 4J9LA 3OYHA 1IBKJ 1ASWA 1EO1A 3MCMA 3FSIA 2YHXA 1TV6B 4E7KA 2MZQA 1VQKN 2KKZA 3P4UB 4F26A 1K8KB 3OA9A 1VSEA 3GJSB 4WFXA 1HNWJ 1LWFB 3ZSRA 3S01A 3QRRA 2PT0A 1W2BM 2HGLA 3RTVA 2KM8C 2Q1NA 4ISFA 3HMJG 1OY6A 3QT6A 2O3DA 3OQ2A 2UXCF 5BR8K 1D3WA 1GFWB 4ZCLA 4WYWA 3THTA 2F8MA 2MY8A 3CCMN 2JDJA 4NASA 3VAMA 4KHNA 3AD8C 3BGUA 4ZP6A 1RTHB 3U1NA 2V9WA 2VONA 1YTYA 2A1BA 4NCBA 3VA0A 4LFAK 3PKMA 1Q78A 1SH3A 2CQCA 4R5PB 4AHVA 3LA0A 3G82B 4OHXA 2CQ4A 2E8AA 2CJBA 3H90A 1URRA 2P9NA 4CEZA 2HAFA 3HCXA 4FZYA 3M9NB 4DCPB 1YVFA 3A12A 1BQNB 3W8GA 3BKUA 2DNLA 4KC5A 4B3SF 2VQEJ 2VKZG 3A13A 3A8YA 4MJKA 3CC2S 3F41A 2ZBCA 1DTQB 2ZHAA 1T95A 1ILYA 1RABB 1UKUA 3MN5A 1KC8T 4I2QA 3T1YJ 3KLGA 4YN3B 1X0FA 2EG1A 1TMMA 1VQ6S 1U8SA 2D9PA 5HBMA 3SFGA 1FT8A 4M63C 3MK6A 2QL5B 5KG1A 2R7XA 4O4RA 1EARA 5I3PA 4B08A 4M3UA 2M0GB 4DFJA 3CJ0A 3HSDA 2CVIA 1ICEB 1TP7A 2E1YA 3KZBA 2FHKA 2QWNA 3IR7B 4F9OA 4YB7A 3KG1A 3WNEA 2MSTA 3T69A 3CJ9A 3LTOA 3QBWA 2DPIA 2IPOB 2RQMA 3SCJE 5BYQA 3O3LA 2V8VA 1TVRB 2J9DE 1WKJA 4ITSA 3FGVA 4DV6J 2XY7A 1LK7A 4D3HA 3AA4A 3JAMY 4O5BA 6FDRA 1NK6A 3PHTA 1K1SA 3QBCA 2I5JA 1SL2A 4K4YA 3SQOP 2RT3A 4FSVA 1LW0B 3SAFA 3L09A 2Z1JA 3MMCB 4AXJA 2O8FA 1VQOS 4P7VA 4IO1A 2CVEA 2KXHA 3MUVP 2H1YA 4ECVA 2QWRA 3CC7S 1SL0A 5AQJA 4PCQA 2WZ1A 1TL3B 3AVNA 4BC3A 1XNQF 4CGHA 2M8HA 4LT6A 4HL9A 2GBZA 1SQKA 1S9GA 3IUCA 1TGOA 3IGVA 2NRZA 2CNKB 4DX7A 2FHJD 5GAHU 2XO7A 3AXMA 1Q8LA 2Y0BB 3H4DA 2F9WA 2VPYB 2H51B 3JS9A 3UNYA 1R8CA 4B8AB 1B64A 1T9TA 3NGIA 4B3TJ 2PEHA 3M2RA 2CQ2A 1RWKB 2XMVA 1YVNA 3G9CA 1R0AA 2QWLA 1PYSB 5K8MA 4B17A 1IBMJ 2W7PA 2HZVA 4E7JA 1KOOA 3BF4A 2BJ1A 3D7SB 2HLTA 5D78A 2BE7D 3MWTA 4DV5J 3CQXA 4EBDA 4JKDA 2PIIA 5CZXA 1WELA 5D77A 2AA4A 4E98A 4DUZJ 2HOEA 1FRMA 4NYZA 2GVDB 3US5A 2FPHX 1ZBIA 4I9LA 3AV9A 3MX2A 2ZKUA 3RAQA 5K20B 4DS5A 4M5IA 4GVBA 2VB6A 2YKNA 2LVWA 4EIAA 1BY9A 1RLCL 3GV5B 1RTHA 4DQIA 1KLNA 4KTZA 4DR7J 3ATVA 2ACMA 2EK1A 3G82A 3GIKA 4PG5A 4PQAA 2ZH8A 1HPZB 1VQMS 2HQIA 2IVNA 2BQ3A 3DLKB 4USJC 1TL7B 4FCYA 4KH0B 3MM6B 2ASDA 5LY3A 1WTFA 1N4LA 4RL1A 2HBJA 3TJ8A 3NRBA 1C1AA 3V6JA 4CGIA 4USKA 4C6AA 3W3SA 2WRMA 2Z2LA 2UU9J 4AE5A 3AAQA 2P6SA 1WTBA 2GGPB 5F2RA 3CJRA 2FJXA 4FLXA 3CJ2A 3MWBA 2ABYA 3OYCA 4V19S 3MM8B 2GCFA 3VHQA 4O23A 4MMOA 2NRHA 2HMIB 3BUZB 5F9NA 2MZ1A 3OLAA 4DUYJ 2GV1A 4AM6A 2OTJN 3GSDA 2UV8G 1AUDA 3WQUA 4BRLA 4QS9A 3AB4B 1DTTB 2CZVC 2WBMA 2ZJQL 4CEAA 2F4VK 4C8OA 2HWIA 3KLHB 3SYZA 4JI6F 3MN9A 4FWRA 2AEJA 2CPIA 4ZS6A 3W9JA 3SAGA 5B0FA 2RDJA 2D7SA 3M3ZA 4PKIA 4ZJQA 3VF6A 4JI3J 1QHAA 1NPPA 5F0WA 4EYHB 1QHTA 1CJTA 1TVRA 2LDIA 2V2ZA 1TAQA 5HP1B 3UKUA 1C1CB 5FRMA 4CF9A 3M6VA 1TU0B 1TL1A 3PJ9A 3OD2A 2GJFA 4B9SA 2JOQA 4TQRA 3W63A 2XZDB 1LW0A 2GW8A 4JK9A 5BR8J 4F4KA 2JC1A 3MMCA 1IUJA 1T6CA 2KFNA 4BRMA 4DQQA 1UZDA 1J53A 1LAWA 1S5ZA 3RW7A 4A2BA 4CGJA 2HNZA 2EFGA 2P5VA 2ZJPL 2DNHA 1KAYA 3R97A 4JUZA 1WEXA 4YY3K 1QQNA 3OL7A 3SSSA 1SB6A 2ZWHA 5C7PA 3VQ5A 4B9NA 2OZSA 3L4IA 4WF9Q 2HBZB 1F3VA 3BGOP 4OIXA 4FJKA 3BSCA 3KXDA 1FJGF 4Q43A 4CJSA 4RX6A 4NLVA 4RCHA 3A8EA 5KG7A 1M5SA 5C2GA 1HRHA 2CDQA 5A6WA 4FK4A 4HTIA 3H8YA 3W62A 1S6QB 4YEAA 2MPUA 3FCVA 3C7NA 1VHFA 1RU1A 2H5EA 4TXSA 1YIJN 3CNQP 1N8RO 2VDIA 4N8NA 1SPBP 4Y00A 3EE3A 1F1BB 2PMWA 2V69A 1ULRA 3TZXA 3TZZA 1X1PA 2DH7A 1QS4A 2VA3A 3G87A 3THYB 4CFDA 1QLNA 4N47A 2PYLA 3BN7A 3OBYA 5HL7Q 4KRWA 4ED6A 1OH5A 1EXQA 2HYIB 4AH9A 2GVDA 1I3OB 2GELA 3KLIA 4JP8A 3OYAA 1IKYA 1NHUA 4CBXA 1GK8A 4EZ9A 3HSTB 2P9KA 4DB3A 3QFHA 3PYGA 4WZQA 2XMWA 3KD5E 4EMDA 5GINA 4L76A 1FF2A 4HVJA 3D2WA 2RN2A 3BKTA 3UFCX 4DV1F 3IM9A 1ZM3A 1Y3KA 3AA5X 4JI1K 1CS4A 1F9HA 1F5CA 2QA2A 2G8KA 4KGMA 4U9RA 4X2BA 2OPQA 1PIEA 1Y0HA 1HPZA 3G25A 2E7XA 1SJ1A 5H9FJ 3Q24A 3UD5A 1RZMA 5IQQA 3P49B 1IBLF 3DLKA 3C15A 4YDUA 3ULEB 4YFUA 1S76D 3MM6A 1UEKA 2K3IA 4NLYA 3T5KA 4Y1CA 2QYGA 3AD9C 3ZT1A 4UW2A 4CO3A 1EIYB 2M52A 1XMOJ 5BR9A 2UVWA 3SXLA 2WTUA 3QRPA 2P9SB 3TYTA 3AO2A 2W01A 2X78A 3I33A 1VCTA 1O13A 4QW8A 4ANDA 2IVOA 3V81B 4ILHA 4DV0K 3RSEA 4DV4F 1U09A 1EETB 3MM8A 4K8XA 4QWCA 3PR5B 2EI5A 4CO1A 1EWQA 4CEEA 2HMIA 1VBZA 2LFVA 1BU6O 2B9YA 2YPZA 7AT1B 2HRYA 1RYRA 4ECWA 1ZA1B 5D0HA 4DR3J 1J54A 2BACA 2XHWA 1DTTA 3FFIB 3L8BA 1VQ9S 1S99A 3J7ZO 2FJBB 3E01B 1ASVA 1BI4B 3LAMA 4RTFD 1KRPA 5B0CA 4B1XB 4HH0A 4DZ6A 1Z05A 2B4PA 1VQPN 2AP1A 3ZTOA 2A1RA 4TY9A 2ZQBA 1TQLA 3GV7B 3QJPA 4ECYA 4XEIA 4XTTA 4LBPA 1WF1A 1D9AA 3QEIA 3H59A 3PJXA 4URQU 5KQ8A 4XPEA 4JI5K 2DEJA 1VSHA 5KFLA 3V9XA 1KQGB 1HI8A 1YZ7A 1VAZA 3VQDA 1TUVA 3CHWA 4NO7A 4B9MA 3BGLA 2B51A 5HATA 3PW2A 1ZZFA 5KI6A 3VF4A 1RGVA 3HSZA 4FM1A 1UAWA 4LF9K 2XO6A 4OI2A 4X64F 3QLHA 1Q7LB 2J8AA 1UEVA 2D0PA 2ZWOA 1E3MA 1TYQA 5KG3A 4LC9B 2ADBA 1UFLA 3I82A 2D3O1 2IYIA 5K14A 4JI2K 2CGLA 2M3DA 3EZWA 4BR9A 3CC4N 1FKAF 2W42A 1EJ7L 3QT7A 2Z30B 2ZH1A 3VERA 2Z58B 5IWAK 5KFOA 3DYAB 1X3NA 1U2FA 3DU6A 1B0TA 4ELTA 3T3FA 3EPGA 1E6YA 4Q45A 4CLYA 4IFVB 2CJQA 3R1LA 4IWVA 4MKBA 3SUNA 2MQPA 2B6AA 1HYSB 3MFIA 2V68A 5DK5A 1FRJA 3EZOA 2A2CA 3AA2A 3H5UA 5KG4A 3D2EA 4DR2K 1VQ4N 4QIVA 5A6PA 1HMVA 4WCEL 2QEXS 5IM0A 5ADXA 5LMUF 3V9ZA 4OJ3A 5K5MA 3ID6A 4BR0A 1ZH5A 4FF1A 1N34K 4PG7A 1YI2N 1UL3A 3LOUA 4DCJB 3CJSA 1XMQK 4DWIA 2PA8D 1H74A 1JCEA 4BE2A 3WEEB 3U02A 4CZGA 2F4VJ 3UE5A 4I6YA 2NR0A 4F3MA 4Q2MA 4ZVUB 3NCRA 2GO9A 3DRXA 4WIQA 5D3GA 4FWQA 4OX9J 1FVQA 2GMLA 3CCRN 2DNPA 4JLHA 3UB5A 2XSJB 2QW9A 1ZTWA 1SC6A 2QA4G 2JWLA 5C42A 1ZBHA 1JLFB 1B9DA 4ED4A 2EXUA 3HSCA 5JMVA 2GX9A 3JQMA 2NRVA 2COLA 1ZC6A 1IWGA 2A0FB 3OFGA 5HRRA 3D1QA 3E9PA 3IKMA 3G4SS 4UOGA 1UTAA 4ETXA 3K9JA 1FRKA 3W0LA 4CJ4A 3I9V9 4IYQA 4OPJA 3IAYA 1NUEA 1C0FA 4ZVSB 3K5NA 3UVJA 4M3TA 4NLSA 1RBTA 3FUYA 3VVTA 1SKWA 3VGLA 5CZ2A 3SNNA 4LH5A 1NGJA 3O1WA 4KH5A 1CJKB 3CMQA 3EJMA 1C0TB 2GJIA 5M1PA 1E4FT 4QOTA 3O80A 1K47A 4BC9A 3V81A 1HBOB 3F56A 3R2DJ 1EETA 5F9LA 3EE9A 1T3NA 2D1KA 2DHXA 2HSEB 4TU8A 2CPEA 1DY3A 3QNNA 4ZA1A 3M6XA 1P1TA 2B9EA 5L1IA 5JMNA 3EO3A 3I56N 3FFIA 5IT9O 1S1WB 3DDKA 4F25A 3CFPA 1JLBB 1V5VA 4ICLA 3L4BC 1WC4A 5DLFA 3Q23A 1QVGR 3Q8QB 3PRVA 1HIYA 3MAQA 1C4CA 1H0HB 2NNWA 4H5VA 5AQGA 4M94A 4BE1A 2QSFA 9ATCB 3D66A 1UCNA 4QYZJ 3KWIA 2VU5A 5AQTA 1EKEA 3PYFA 1UMJA 4HACB 2B3TB 5CY4A 1Q7YO 2KO1A 4YORA 3NNAA 4IOBA 3ZFVA 1FWLA 4TSXA 2FHMA 1WD6A 4X4SA 1FERA 1VJQA 2GAGC 2XYHB 2V51B 1YITN 4CCHA 1QE1B 2F8EX 4FPIA 4JEPA 3KG4A 3JAMU 3CD6N 4GVMA 4NLXA 4EHUA 1N6QB 2XI3A 3TR5A 4CZCA 4LBIA 1HI1A 3T1HK 4PQUA 2OANA 1G1XA 4B1ZA 3PZPA 3ISND 2F96A 2QXFA 4PWDA 2IAJA 2OZMA 5B0GA 4CF1A 5AXNA 3D6HB 5HMWA 4X62F 2VIHA 2V50A 3O6WA 5J1EB 3HVTB 1RCOB 3AOBA 4IFVA 1Q81T 1IKWB 4FM0A 3MMJA 3O44A 3W7BA 1HYSA 2YCHA 4OI1A 3HHLA 2OFGX 3M8PA 3P3DA 4OYXA 5A8WB 1NZ8A 2ZFHA 3PCOB 1NK7A 5IOLA 4IKFA 3QWPA 1JLAA 2AMCB 3C14B 4ZVPB 1JL1A 2DNKA 4J9SA 1HHQA 4Q0BB 4CGGA 2UUCF 1ZPWX 3HD2A 3PW0A 1MWYA 3H5SA 4HHUA 1SKUB 4BRKA 3M5RA 4FWSA 3ZSOA 4J2AA 3LPTA 4NZ7A 3AT1B 4FLTA 1MWMA 1Q79A 3OYGA 4PG8A 2E1AA 2PEBA 3EGZA 2YX4A 2E29A 1JLGA 3SQGB 5HVFA 2ZZMA 2HQCA 3AJ1A 3OV7A 1X4AA 4OKKA 1JLFA 2JZ5A 3V1RA 2OJ3A 2GJ2A 1J5EK 1KLMB 3IDHA 3N79A 4RBTA 1RWWB 1WLJA 3JXUA 2DJWA 2WONB 5ETLA 4YR0A 2HVEA 4GVLA 4DTOA 1HR0J 4O0IA 3N01A 3NKYA 2GWJA 3CD0A 5CCLA 3B8AX 4DV7F 3CJBA 2R8GA 4LF9J 1XNRK 2CG8A 3Q8UA 1IBCB 2QA4N 3THXA 3GR1A 1FHTA 3N6MA 3KLEA 2I38A 3JTNA 2FJVA 5IS2A 3OXFA 1XI1A 3DI6B 4JI0K 2VG7B 3AQOA 1S6UA 2Q97A 4JI2J 3PW4A 3LW5C 3K2YA 3OTOK 3BGRB 2E1ZA 5B0EA 1BD6A 5HANA 3EGNA 3OYMA 4F0MA 1LEOA 1Y7PA 4WU3A 2BA9A 4AQYJ 4GMKA 1ZBSA 3WNGA 4G1IA 1QSYA 1IBKF 3CDWA 4K4ZA 1PYOB 3I96A 4YR3A 2GC8A 4CTAB 5JS2A 1JXEA 5CYMB 3DRYA 4Z94A 4ZN1A 4QS7A 4ECRA 2AIRB 1KVKA 3H5YA 2PI4A 1WI8A 4BDYA 3CQ8A 4DR2J 3M6WA 2JEIA 4WYBA 2WVCA 4CNZA 3C66A 2AU0A 4OLOA 4YOTA 2CFXA 4LF5K 2E1CA 1PJ6A 1URNA 1H7XA 2DGOA 3U1LA 2E5LK 2NPIA 1FJEB 2R2UA 2G8HA 1UWAA 3IBWA 1XMQJ 3WC2A 2G4BA 1DGKN 3UR0A 1VRUB 4B1VA 4CJPA 4GO5X 5JLHA 2YNGB 1B7FA 3GLJA 2FLNA 1LWXA 4P6QA 1HNZK 4BGBA 3CPWM 1VSJA 2VL1A 3LPYA 3VQ4A 4CIGA 5KFMA 2IJFA 4X4QA 2VQEF 3LP1B 1HBUA 1HJOA 4NXMK 2AYBA 1GH8A 4FYXB 4KHPK 5ADZA 3PM9A 5D15A 1VQLN 1NMDA 3CCTA 4KI6A 4C48A 4PA1A 3KLFB 2O8BA 4OLAA 2NREA 2MY7A 4HUFA 4ATNA 3TWZA 2B43A 4CF8A 4Y34A 2WBNA 4DZDA 3KJVB 3M6GA 1WOQA 1YG0A 1XHZA 2BANB 4FXWA 1FESA 3J80O 4FP9A 4I2PA 1JX4A 1VBKA 4ES1A 3NL0A 3DU5A 5AZIB 3Q8PB 4KGZB 2X7IA 5L8RC 2XY5A 3L3VA 2W24A 1S1TA 4Q0BA 2JWKA 2H3GX 4FJGA 5L38A 3BB5A 1ZM4A 4KFBA 3QAEA 1FDAA 5KFEA 3AO3A 1BL3A 4DV6F 1NGFA 5DLGA 4ZPDA 3ZZTA 4RW4A 3NGYA 4BQZA 1UEUA 2GVZB 1G99A 1X4GA 3D2FB 3EGVA 4IJNA 2L9DA 1T0TV 3HFVA 3C0BA 3WXJA 1YIJS 4AHTA 2IFXA 3C46A 2RD5C 2LA6A 2ADCA 2PGCA 2LEPA 1KLMA 4KR0B 3H0PA 2P5GA 2DVIA 2KXFA 2HFZA 2MQMA 4IO8A 2QLWA 3RBXA 1GLAG 3DLLQ 1TZ0A 3GZ7A 4PYAA 2VOOA 3C6TA 2O8DA 1TK5A 1MG7A 2YH0A 1FJCA 4UT4A 2P5OA 4DTNA 3PYEA 3VTHA 4C8KA 3D1HA 2KB2A 4DR1F 4CLUA 2WTFA 4JK8A 2FJWA 3NOGA 1EQMA 2PI5A 3HD1A 2ZE2A 4FN5A 3DI6A 4DSFA 5D4NA 2H4YB 4CD3A 4WF9L 3K58A 4JI4F 4YHHF 3KKRA 2QRRA 1FFSB 2RHQB 2W9CA 3CGIA 1OYDA 3ZSXA 1NNEA 2VD3A 4DR6K 4QJVA 2IMOA 2HBMA 2D9OA 2B4VA 4M3XA 4HR2A 1P9YA 5IV3A 4CTAA 3FK4A 2E9TA 2BM1A 4CO2A 4NXNK 1NJIT 4ZK7M 4DR5F 2QKBA 2XHBA 3F9MA 3M1FA 1KEKA 4X4VA 1ROFA 4CF0A 2PMHA 2JLEA 4LFBJ 2MJUA 4O3SA 4U95A 4NCAA 3UD3P 4ILGB 2ZM6K 3QGGA 3ZT2A 5J2PA 2VDHA 2XLKA 5HL7L 2RE2A 4LQ9A 4CBWA 3GB0A 3AXKA 2VF3A 5AE1A 1VQ8S 3FCWA 4KV8B 1AT1B 3OHBA 3C6UA 4RW8A 3C65A 1GLBG 2RPIA 4Z37A 3DXBA 1TUWA 2BABA 1RT6B 4LFCJ 1DHMA 4USWA 4KB0A 2YNGA 3FBBA 3OW2R 2IIRA 5MAOA 3RMAA 2DCLA 1HBNA 3Q0AA 1Y3JA 4RNHA 3PW5A 1T05B 4IFYB 1X3MA 3VGUA 5GAHI 3DOLB 3MM5B 1DQAA 4Q2LA 4FYVB 3CMES 3HHDA 2AKWB 1VQPS 4OI0A 5MLCV 4V1Ak 1TUGB 1UVKA 2R2RA 4A46A 4P10A 1IR1A 2W4PA 4PRFA 3Q7CA 3UWTA 2Z2ZA 4ILMA 1PJ5A 3H2LA 2W2PP 1SQFA 2YJEA 4OJHA 2UU9F 2CQDA 3ID8A 5RUBA 3QESA 1HBMA 2BE2A 1F5AA 5HMZA 3DOKB 3HX9A 3KJVA 3RBDA 1NK4A 4LF4F 1DARA 2N4CA 2Z1HA 3AA9A 3BKFA 4R8UB 4JI0J 2NZTA 5IFMA 3NF7A 1HKGA 4F67A 5DRKA 3H42A 1KXPA 4DUYF 3A5OC 3WXIA 4DX6A 3LDOA 2M7SA 3SI8A 2VA2A 4QAGA 5AZIA 1YJWN 4UUXA 3QO9B 4B1WB 4LSNB 4M3YA 1QUPA 1TFYA 4X65K 4AHRA 3L7UA 2ZH3A 2B0GA 1FNOA 3CC4S 4CERA 2BBEA 4WFBQ 1G3OA 1TKXB 2ALYB 1RHMB 4KH6A 1OO0B 2E20A 4DQPA 2YI1A 1RBUA 2WHOA 3CCUS 3C2PA 4ZVQB 3Q89A 3ZZOA 4CO0A 3D2FA 3RR7A 4B9VA 1UOCA 2V0NA 2ZD1B 4USMA 1U1NA 4FJHA 5BR8F 2UXDK 1NOZA 4KSEB 4AUKA 3ET6B 3AAWB 2C1EB 4DSIA 2HB5A 2YWEA 2XYPB 2OEKA 2E5LJ 2KN4A 4K8RA 4J9MA 2BTFA 2LU1A 4H4OB 2KT5A 3P96A 4GKJK 2MXYA 1VOMA 4L75A 4LFAF 4HVZA 4CLKA 2KZMA 1ZS6A 4YR2A 5D0GA 3QGHA 5BXIA 3J7AN 1XWLA 3D0GE 1S0NA 4BC7A 4OPKA 4RO0A 2CJYB 3KUEA 3CCQN 2IJRA 3S41A 1BDGA 2AEFA 4KREA 3VAGA 3UR3C 2KL8A 3EL2A 4FWMA 4OKJA 1HQEB 2EW9A 3VQPA 1RTJA 4WPAA 3AO1A 2VG5B 3VQ9A 4F02A 4KHPJ 3TQEA 4I64A 1LWCB 1RU2A 2KDOA 2FDNA 4EO8A 1FE4A 4C8MA 2DGUA 2Z1IA 5C15A 1QUVA 4I6MB 3LANA 5T7LB 2UZAA 4FO0A 5KFRA 2QXLA 3D0HE 2NXEA 5JVGQ 3PVXA 2J9EA 5LMNK 1VK0A 1ZBUA 2ZOFA 2ZOGA 4YB1P 4ED3A 4J2BA 2VYPA 1Z26A 2X1AA 1K8AO 2DO4A 2HHHK 1QAJA 2UXBJ 4PPZA 4RLEA 4Z4GA 1R8PA 1MMLA 5ETTA 3VEZA 3KK2B 2AYEA 3AVKA 1N5YB 4PXBA 1R31A 4KV8A 3ZC4A 5LSLA 3DDIA 2LEBA 1PAUB 2RRBA 1I51B 2MLYA 3VA3A 1SC3B 2YJFA 4J9OA 3HHEA 2ZVSA 1JLCA 4TU7A 4KKOA 3P45B 5K8OA 1X4EA 1E6VA 2XSFA 3BN4A 2C2EA 3DXKA 1NOYA 4FF2A 2G8FA 1A5VA 2B7BB 2E5JA 3VQ8A 4OQJA 2V4RA 1T05A 3HFZB 3L95X 1V4TA 3OXLA 3DOLA 4IH6A 3TWHA 3QJLA 3F9KA 2HBYB 2UUWA 1VI7A 2CJ9A 4ZCKA 3DRPA 1DURA 4DOZA 3IRXA 4NLOA 4CJFA 2R7RA 3S8SA 1XR5A 1PG5B 2ZUAA 1A0OB 5KFIA 1XR6A 4BVOA 3CVKA 1N0UA 3OFFA 4DTPA 1FCAA 3S3MA 1AW0A 4FNHA 4R8UA 4ED2A 1RDCA 1VQ5S 2C3UA 2QN6B 3HVWA 5GAEP 4FS2A 3OSNA 1Q18A 4WE1B 1R27B 1VBYA 4FF4A 1D8YA 3LAKA 3BBFA 3CD6S 4CHPA 2OPSB 3LP2A 4ECXA 5GMEA 3BR9A 3BV8A 1ITPA 4OI3A 3M8WA 1LQ9A 3A8JA 4RUBA 3I0SB 2YWGA 1Y64A 3CJCA 2H65B 4NXNJ 5THWA 1D09B 2DH9A 3K5LA 3K89A 2HQDA 2NUHA 4LMZA 4Y3CA 3EXYA 4RWXA 1OH6A 4IJAA 2RJZA 3DJCA 1LKZA 4I1TA 4IUFA 3QT5A 4CJ7A 5DM6Q 3NHGA 2VBYA 3PFOA 3TVKA 3GFZA 1DZ5A 3ET6A 1AXQA 3QIPB 3GIIA 4M41A 4OI6A 2QLFB 2FVCA 3HRGA 1IVZA 5AFUH 1XUPO 2ITGA 3CFOA 1VR6A 4H4OA 3CJAA 1HQUB 3OR1A 1BLUA 4DF4A 1R0BG 2HHUA 3WXKA 5J2NB 2JX2A 4NLCA 2LKZA 3ZXWA 2R8HA 4OZNA 4Y2MA 4K4TA 2MKKA 2KKHA 3QINA 4Y65A 5KRSA 3CJ7A 3OTCA 3P5TL 1WNSA 2F63A 4ANEA 2ETJA 1NLVA 1Q7YT 3QIDA 2HQGA 2Q3PA 3D45A 1WSHA 4OVLA 3TAMB 1S1UB 4K0KJ 1R6VA 2AQ4A 1S59A 4QCLA 2VG5A 2J9DA 2WCXA 2B4OA 3FCHA 3AJDA 1LWCA 3IS9B 3PO5A 4BVPA 2FQQB 2E5GA 3BSAA 2AX1A 4YB5A 4I6MA 1RP5A 3CG7A 4C97A 3R27A 2Y9HA 2ZBRA 4DPUA 4RUHA 1WHXA 2OEMA 5LSOA 1RTIB 1HKAA 4FJ8A 2GFFA 3MM7B 4JKAA 4LR9A 2HPUA 3D28A 1NK0A 4K25A 1FE0A 2IRXA 4B3RJ 1RT4B 4RW9B 2BH1A 4CEBA 5IT9Y 3O08A 1D9FA 4LF2A 3HVRA 2F4VF 4BC2A 3LP0B 1JXVA 3PX4A 2R7SA 2RUSA 2CZ9A 3FEXB 1VMBA 1U1LA 4LBHA 4BRQA 2Y1RI 1SBRA 1ESVA 3K7RA 3IMQJ 4Z4CA 3FSXA 4C3KA 3OYEA 4CLTA 2NRRA 4XDCA 2FZCB 3WT0A 3GJTB 3GYXB 2KTQA 2XY6A 5AR0A 1U47A 1T9UA 2IM3A 2ZUGA 2QGFB 5A8KA 3DWLA 3TAEA 1I5OB 3QNWB 2LMIA 5B0AA 4BROA 5D0RA 1VSLA 1T11A 3SDEB 4LF6K 2AYMA 1NM2A 1CZBA 4EYIB 4YY3F 4TLRA 4ZHRB 4J9KA 4JI8K 2IM0A 2FVPA 2BJDA 1CJVA 2WVDA 3K5MA 1U26A 2KVQE 3NS7B 3A0IX 1DEJA 4FZZA 2VG6B 4NPOA 3LUYA 4MQ3A 5DG8A 1VS3A 1NGCA 2XB2D 4O3RA 3UE2A 3CJTA 1X9JA 4C4WA 1SV5B 1R0CB 2VICA 3EKUA 1WOPA 3MXIA 1A7GE 3CXCM 1N56A 1IM4A 2LEAA 3FZHA 4KJIA 1LOTB 2YKMA 3GJRB 5GADP 1RWXB 2RE1A 5EGYA 4NYPA 2FUG9 5A2QO 1KFDA 4KB7A 1HPMA 2OPSA 4FK2A 1V3SA 3HULA 3M30B 4PZVA 2PY5A 4FLZA 1MNEA 4Q44A 1PAEX 5KFJA 3N9UC 2O67A 1LWEB 1FFGB 2QA1A 2RHSB 4CW7B 5HJXA 1VQ6N 1PCAA 2JLGA 3R5AA 3IWXA 3ZTSA 2EFVA 5AQZA 1S7IA 2VUGA 3M1VA 2HHHJ 3H6EA 4ZPWR 4A8OA 2DO0A 1X4HA 2Q6BA 5AQPA 1RT5B 3BREA 4CK2A 3QIPA 1GMWD 4A8SA 2C2NA 1F2GA 2HHSA 3N28A 1LOUA 3FC9A 2EKYA 5ADXH 5DGBA 4UY85 5KRTA 1HQUA 4ISGA 2HZCA 3NFAA 4LJMA 4DBQA 3HM9A 3SAHA 4JI1F 3OYBA 2YV0X 4H8KA 4X66J 2N3OA 1QAYA 2ROPA 4CM0A 1NMNA 3QBXA 4CJKA 4JRPA 1J5OB 4U7BA 1PILA 3MD3A 4PAAA 4CZEA 4XO0A 1JCFA 4F50A 1KQSM 5GAEU 3ZT4A 5M1KA 2W4DA 4JAXA 3CMAS 3ZT3A 4W5NA 2E6LA 1RT3B 5GIOA 1S1UA 3W9IA 3K17A 4CJRA 3MX5A 5AE3A 1VQON 5FIIA 5LJVA 3O5BA 2FB0A 3SUQA 4AFFA 3K5OA 4LF8J 1HW9A 3R8YA 2P9UB 3AAPA 9RUBA 4IO9Q 4DV0F 5I9EB 1UA1A 2M8DB 3C95A 4OGEA 4IG0A 4L8RB 3R1HA 3CD7A 4UOCA 3Q83A 1CEZA 5KFKA 2FJDB 1VK3A 3GYNA 1RAHB 1YJNS 2XZTB 1ZXOA 4CF2A 4FYWB 1YDLA 3V1OA 4EAHD 3BDEA 2UVVA 5AQWA 1WSFA 1SQGA 2DXDA 2CQIA 2D0AA 2K8GA 4BC5A 1OH8A 4IDKA 4ILLA 1Q1KA 1ZPVA 2DFFA 2P9LA 3M05A 4U7UD 3MPVA 4NX9A 4GKKJ 3BYPA 1RADB 1C0GA 5AXLA 3W66A 3KG0A 2V8PA 3DXMB 1K73T 4BC4A 2XBPA 1BWFO 1NSPA 1NBEB 2ALZA 1IQTA 3VAHA 4HEA9 3LZJA 5I3UA 4CE9A 5DDRC 1TUYA 1NGBA 1HYZA 2HK3A 4E0DA 4JI5F 3HLUA 4NEYA 2IYGA 2J7UA 4GRSA 4NLTA 1ZM2A 2XHCA 2DY4A 1UFKA 2ZBPA 3NGSA 1Y5IB 1TK0A 2GAHC 1S9EB 1VDHA 2YX6A 4B1YB 4M5GA 1K1QA 4LF9F 4YOVA 5HMXA 1RHQB 3VGTA 3PV8A 5AE2A 3DLLL 3F2KA 3EICA 3HXMA 1JJCB 1SJQA 4F4YA 4JI2F 2CXEA 2V67A 1SVDA 2AX0A 4B9TA 2XYGB 3IWNC 4NLQA 3AO4A 4WIIA 1Q86O 2DR9A 4FLYA 4PPDA 1SV5A 4KHMA 2WVEA 5IWAF 1WB9A 3MM9A 4JV5J 1RT2A 2CG4A 3OL8A 1VQMN 2AZ1A 2A40A 3SQ4A 3J80Y 4QWAA 1SJRA 2HHVA 2D41A 2OA8A 4I7FA 1R7IA 5HLFB 1YHQS 2E4LA 1HUXA 3KK3B 4Z7CA 1X5OA 3MURP 3LP3A 1DFDA 3CWJA 2WW4A 3MR5A 3VTIA 3R6GB 4F3QA 3RRHA 1QD1A 4WQ4A 4KH4A 3SCXA 3FGUA 1NEEA 4O55A 3O9QA 2BVZA 3AVCA 5AQMA 3K57A 5LXRA 4IH7A 1RAJA 1N34F 5JUMA 1MSWD 3L3UA 4FJ7A 2RVJA 4KY3A 4ECUA 3IWLA 3TTFA 3KJFB 1FX4A 2DXFA 5KAKA 3M2UA 2RQCA 3ASMA 4JI7K 2ZITA 1PO6A 1IJJA 3W3DA 3FJ2A 1B92A 1YJWS 5E0OA 1PJ7A 1MMDA 3BZKA 4C3MA 2F5GA 3CJQA 1KP6A 4YP3A 3VGVA 3TO8A 2D3UA 1MU2B 2FGCA 4CNYA 4FWPA 1AYEA 2YQ3A 2IC3A 3AVFA 1WC5A 3TR8A 2RH3A 4FDFA 1D4XA 2P1JA 4GC7A 3M8RA 1UETA 1WF2A 3S9HA 4LR8A 1U0HB 4CZLA 3FEYB 5KFNA 1EKRA 3C19A 3MUTP 2PYJA 1T6DA 5GADU 1BHNA 1HNWK 3THWA 1RT3A 4Q8EA 1VIXA 1CZ9A 1ZBLA 1N5TA 1QDUB 4WQ5C 3LGHA 3CJ5A 3OUYA 1NK5A 3GL1A 4ZJLA 2HEKA 1ITGA 5KPTA 2B56A 3G8SA 2FHJA 2QLBB 2P9UA 2CPZA 2WVBA 4J91A 4IZ9A 1RT1B 4B3MJ 5I42B 4BGAA 4X4UA 1HL6A 3S6EA 3NH2A 4OO1J 1CULA 3ZLJA 4O3OA 2G0JA 5AJ3J 2OUGA 4MK9A 3SZ2A 3CCQS 1M5OC 3I87A 4WTYA 4BRGA 1VLOA 1K9MT 2MKCA 3ZSQA 2F8HA 3CJKA 2PE8A 3OYJA 4TKTA 1GLCG 4WFBL 3HYFA 3V6KA 1HJRA 5L9XA 2F3JA 4BRCA 1HWLA 3UKRB 4NE9C 2DY9A 4DTJA 4PXEA 5EX0A 2AJ4A 3PX0A 2FF3B 1VC6A 1V4SA 2VQFJ 5FRNA 3T1YK 3O3HA 3G6VA 1FDNA 1KD1O 1RT7B 2C2KB 3TEHB 2XMKA 1QY7A 1YJUA 1SCJB 3CM6A 3ZTPA 1RDRA 3R5CA 4RW6B 1FTCA 2JHEA 2HNDA 4DMZA 1GXLA 2GX8A 2QMUB 4M45A 2HW3A 1MROA 4ID5B 3WUHA 4FYYB 3VENA 5KFXA 1QSLA 1SQEA 3SV3A 5C24B 2G8WA 2JVOA 3JTPA 1IG8A 2CJAA 2CQHA 5BN8A 3BBCA 5G0RB 1ZTTA 3AVJA 4GNIA 1U2VB 4K4SA 1BG3A 3E3XA 4YQWA 3RR8A 3T1HF 4OX7A 1BQMB 1T03A 4R25A 4JV2A 4AXIA 2CGJA 2P51A 2NCKL 2NXJA 3VZIA 3M32A 2C3YA 4DJBA 3GU0A 1EAYC 2IVMA 3QEXA 3GG1A 3J7A1 3KK3A 3Q2TC 2OPPA 1JB0C 1U1RA 4F7VA 3H46O 1H2UX 4CLFA 4EFAC 1PSDA 2A5XA 1T8EA 2YX7A 3HI9A 5JVGL 1NH8A 2UVUA 2FC8A 5DM7Q 2GIFA 2O8EB 2YHAA 3WQPA 2H48B 3IN5A 3O9UA 2RSQA 5A0YA 3EWGA 3GP9A 3SSRA 1YVUA 1G7CB 3RB6A 2MQOA 1KONA 2PC6A 3SCIE 1RBOB 1KCFA 3VQCA 5E84A 2YHWA 4CLLA 1K8AT 5F1XA 1VQ9N 4JKHA 2ILYA 2NSCA 1IKVA 1M1GA 3A5LC 3ICLA 1J5EF 3ENQA 2RU9A 3RW6A 4AHUA 4B3TK 2CNNB 2A6MA 3SV4A 5F8HA 1IBMK 4CHNA 1WBDA 4H0TB 5J2MA 2QL7B 4FXDA 4UOFA 3E9OA 4DV5K 1FTRA 4DSLA 4WTOB 1AZSB 2BOPA 1XNRF 4ER8A 3BP8A 4M5DB 1SIZA 3PKYA 3UI3A 3T6JA 4DUZK 2YNIB 4CHOA 3B8HA 1L3VA 1D1UA 2NXNA 3JB9k 3MTKA 4N77A 4AL7A 4JI0F 1TKZB 4H4KC 4M5KA 3HKZD 3GQCA 3OTOF 1V9OA 3NMRA 1E4GT 4A57A 2ASYA 2CJKA 4RNOA 2ZH9A 1XHXA 2DEIA 2QI2A 1N32J 3TUPA 3P39A 1FRXA 3GJQB 1P90A 2VBZA 3GYGA 4K8ZA 2KFYA 2HNYB 1S9FA 5AQNA 2FF6A 4M5LA 4DL7A 4M3ZA 1U02A 5C25B 3GTYX 4A62A 4CD1A 2QX0A 1TFWA 2HURA 3WC0A 4DR4F 3AJ2A 3EZ5A 4BCAA 3MEEA 1HI0P 3AH6A 4B9QA 1GLLO 1NJWA 3IRWP 3R7BB 3UDCA 2HHQA 1CJUB 1RDAA 1S6OA 2XZWA 1BE4A 2IIHA 4LF5F 4C0BA 1NKBA 1IJEB 4AD6A 1T7PA 4C2MA 1RWNB 2M88A 3PRBA 2QEXN 2E5LF 1SUQB 4A4JA 4UY8T 5DM6L 4P2MA 1U2CA 1RA6A 3UPFA 2DGWA 1UJ6A 4JI7J 5IT9U 2WSFC 2X74A 4WKRA 3TZYA 4NLRA 3WZ0A 3DHWC 2MMYA 1IR0A 5ETKA 2OSRA 2ITMA 1O5JA 2C22A 4C1NK 2VV5A 5FJ4A 4W92B 4JKGB 4WKYA 1HNZF 2UXCJ 2LSNA 3H1QA 4X84A 3U3GA 2J9CA 4I67A 4JKBA 3VCDA 2W7AA 1RFQA 4FK0A 8AT1B 3H40A 2WC9A 3AQPA 4LRCA 1Y10A 4NXMF 1GTHA 1VRTB 4BREA 3MDFA 1RBSA 1X4DA 2X3GA 4KHPF 5IQ6A 3ZCMA 5EU7A 3PW7A 3NGUA 4K2JA 1VC5A 2QV6A 4M5HA 1BQMA 4JI3K 3LF0A 3VQTA 3DLBA 3G4SN 5KFUA 3X1LB 2UUBK 3T19A 1O0PA 3NAHA 4IQXA 4V19J 2DYAA 2MQNA 1U1MA 2B5JB 1KVJA 1UWBA 2DNNA 4S0MA 4PUOA 4NZ6A 2ZH6A 1CXQA 3DM2A 5C0YA 4RW7B 1S57A 3THPA 2O01C 4O3PA 5EXWA 4HT7A 2ZEJA 3BH7B 1X9MA 5KT2A 2BW2A 3ILJA 1S97A 5LL6Z 1M1KO 5F8MA 1GX5A 1IKXB 4JS4A 1GOAA 3TJAA 2QWOA 5LM7E 3VALA 2NZ4A 3LDSA 5EX3A 1EWRA 2IGIA 3LQVA 3QQCD 3H20A 4JHDB 3HM8A 1Z25A 1FXRA 1RHJB 4FOEA 2YKQA 4F2RA 2R7YA 1XEZA 2O1PA 5F8GA 5HROB 1HLUA 3O3GA 1Q9XA 2H9ZA 1JKHB 3EVOA 1HW8A 2B4UA 3P38A 2W2MP 3CIMA 4MKYA 3ONQA 4DUTA 3T6BA 3GWCA 1XK8A 2P9IA 5KFVA 4IEEA 4ECSA 2GZOA 4CM2A 4J2EA 1Q8KA 1LXNA 3I0RB 2HIYA 2DNZA 3V6DB 1DAXA 2G0CA 2YNHB 5AQRA 3BSOA 3KJNB 3FZKA 1C2PA 1XNQJ 3KWGA 4C8ZA 1KVBA 4DR6F 3CDBA 3AB2B 3C6AA 4YMEA 1EB0A 1QTMA 5K8NA 2CQ1A 4HCBA 1D9DA 4H5WA 3G2XA 5AQXA 3AHPA 1X7VA 3A4TA 3CW2C 1W25A 2FBTA 4X4RA 3NBPB 4NXNF 5KG5A 5H9FK 4FVCA 3NNHA 1YF5L 1WN7A 1U7LA 5D4LA 3R1XA 3ATUA 1JQGA 4ECTA 4CIFA 5B0BA 1NGIA 2ZHBA 3ZO7A 4BR4A 5KFAA 1NXIA 3DLGA 3B82A 1H3DA 2ZM6F 2VBWA 3GE9A 1TUUA 2VWKA 1XMOK 4DI6A 5ETSA 1T3VA 2GIQA 3OYIA 4ED7A 1Y00A 3VEOA 2H5IB 1SUQA 4OKEA 4QR1A 3ENBA 4C98A 3BPDA 5KFCA 3JSMA 5E3PA 2ROEA 1OWXA 3A8IA 3ZEUB 2DHGA 2KJVA 3MEGB 2L9NA 2I1RA 2D5RA 4J9UE 3ZTQA 2VPWB 3IC1A 4DF8A 1C1BA 2MKYA 3M8ZA 5DDOC 3FZBA 4KB1A 3M9OB 3OR2B 3SQ1A 4CYUA 4AM7A 3HOSA 2X3DA 1S12A 4JKCA 2F40A 2AHOB 4O3QA 5GAGU 3HL8A 4DR3K 2R8KA 3MEDA 3MCOA 3DRRA 1VQNS 1QZ5A 3IG1B 4ED5A 4F4ZA 4M7YA 3KLVA 1KQFB 3VESA 4DPWA 4X64K 2PAVA 4Y2CA 1TV6A 1FKOB 2G2OA 2ZJRQ 3UDEA 3CULA 1HHTP 1KC8O 1K44A 1K8KA 1NU4A 2OHDA 4M63A 4MKAA 1LWFA 3CF5Q 2RRNA 5AZJB 4U67Q 4DFMA 2C3PA 1ZZNA 5E3CA 2H3EB 3L3CA 4DSEA 4IOAQ 1RBRA 4IO9L 3J81O 3OS0A 3H3NO 2BKNA 3LDNA 3DOMB 2KH9A 2G8IA 5A2QY 4WWSA 4IOXA 5FPDA 3FBCA 2CAJA 1W2IA 1WDTA 3W2WB 4RW7A 4CO4A 4JBCA 4X65F 3HZGA 4CJVA 4C3LA 4R0JA 2NPFA 2D3OR 4RUCA 4R5PA 4CWBA 1RQ0A 3CFRA 3TVZA 1I94K 1P9QC 3LL3A 1J27A 3J80U 5AQKA 1T02A 3HZEA 3KUHA 1BQNA 3OJSA 2DFHA 3CYMA 2KRRA 5F0UA 4JHDA 1X31C 2HVZA 3BEXA 2UXDF 3L2VA 1N88A 4JRQA 4PR6A 1DTQA 1RI7A 4ZLLA 2P9PB 2V94A 2A3JA 3FNNA 1RDWX 4GV3A 3M2VB 4GKJF 1JKHA 3CJ8A 5HK4A 4Q5VA 3W2VB 4W5RA 3MN6A 4LVOP 1ZAXA 2CWXA 2GV9A 3BZCA 4KO0B 3OL9A 3F5TA 1A6LA 1WEZA 4XK8C 3SUPA 3I0RA 3D6FB 4G1QB 3JSBA 5IT4A 3HZ6A 2W7OA 3MOJB 1NHKL 1Q5YA 2D69A 1I1GA 1TELA 3UCUP 2R2TA 3TSQA 2BJ7A 3I4HX 3BO2A 8RUCA 1QQOA 2VODA 4B3OB 4QYRA 4KH1B 2FLLA 4OX9K 5H9EJ 4B9LA 4A8QA 3GSIA 3O2IA 1TKDA 3LO3A 1XTZA 2R4FA 1RBAA 2F4FA 4FLUA 4OZ3A 3DLEB 3SMPA 1X60A 2UUBJ 4USTA 1FVSA 1CZAN 3KHLA 3TANA 1S3XA 2XMUA 2MKHA 1UW9A 3FE1A 4O4GB 1FJGJ 4ZMMA 3THVA 3O1BA 5LMNF 4P75A 1KVAA 3O9RA 4J9PA 4DEZA 5EX5A 2FVQA 1LNQA 4F3OA 3L7OA 2HHHF 2OEJA 3FVYA 1KVIA 5LL6d 2R7OA 2JEGA 3OFHA 4OZJA 4DN9A 1TL3A 1FNXH 2L9WA 4C1NI 2DRDA 3VPZA 1H6KX 3P5JA 3BJYA 3ENAA 2EFQA 1FD8A 2NUUG 3I8DA 4EFHA 2YWKA 1GAOA 3GIJA 4H0OA 3RAMA 3UN5A 4EU0A 4IRCA 3H45C 1PC5A 2V34A 2J7WA 1OYEA 1U8WA 3AOCA 3OR2A 2CYYA 4BBYA 3CCJN 3G86A 4M5JA 3OTBA 1F21A 1IWAA 2WW8A 1Q82T 1KBRA 4C11B 4QU6A 1Q5VA 4M5NA 1WHWA 4NI2B 5CQGA 2CH5A 2XEXA 2M9KA 4M7XA 3G71S 3DGPB 4M3RA 3MAHA 5AFUA 4DV1J 2KI2A 4Y0FA 3CCSS 4H5RA 2MLXA 4IR9A 2W41A 3JYTB 2HRTA 4HTUA 4QYZK 4FLWA 2F9DA 2U1AA 4NWBA 2PBDA 2OPRB 4FPRA 1G4CA 4CLSA 5HAOA 2QFIA 4XH5A 2OAUA 3AVBA 2N7YA 3ZNJ1 3DGVA 5KFSA 2CZ4A 4XPCA 3JSRA 4CGDA 3HO1A 3T41A 2PA3A 4DV2K 2E44A 5TKWA 3J7AP 3W2WA 2E2OA 4I6WA 2QYCA 3LM2A 1RAIB 5ETMA 2AJ0A 3NGKA 3GCXP 2XCPA 4BWJA 3HPOA 1OS5A 1H7WA 4DV4J 5EN1A 2F9JA 5J2QB 2VFVA 1FEEA 3M7VA 1WJ9A 3LWLA 3UN3A 4PL8A 2BR0A 2FY8A 4W98A 1TL7A 2UUAK 2JSXA 1YUWA 3BEGB 2LU2A 3DNCA 5M1FA 2SXLA 4NOHA 2EG2A 2MEWA 5K9FA 2ZGYA 2ZH5A 4A8WA 2V7YA 4G65A 2K1RB 1RJJA 1LAVA 3W5ZA 2Y8YA 4ZP8A 3NE6A 1CG2A 2C28A 3VQ7A 5I4MA 3TEGA 4OLPA 5C2FA 1X9SA 1NGEA 2GGPA 3ILIA 1RHKB 3W2VA 4DL3A 2RQ4A 4LRAA 3RMBA 2OD4A 1WHVA 2B4JA 1VQ8N 2X51A 5GMKa 2X6NA 3KK7A 5GVQA 1JLEB 3P5BP 2J0WA 3MXMA 5AQIA 3ZSZA 1FFWB 2C2DA