3KLEA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
560
structure length
560
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase/dna
source organism Human immunodeficiency virus type 1
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
total genus 142
structure length 560
sequence length 560
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kleA05
4O4GA 4CFBA 3KLGB 3DRRB 1KFSA 1S6QA 5F9NA 1N48A 4MKBA 1SKSA 3IG1A 3F9KA 5KFSA 2YNHB 4FJLA 4O3NA 3RB6A 4CCHA 5CY4A 4C8OA 3V6HA 1QSYA 3CJ4A 4KFBA 1KLNA 1Q8IA 3QNOA 4WFXA 5EWEA 4DFPA 3TANA 4Q0BA 3GV8B 2J6SA 1C1CB 4YR2A 4FLVA 4WXWA 5J2NA 3D0PA 4I2QB 1RTIB 4M3YA 3IGVA 3MEGA 4F4ZA 4O4RA 1NOZA 1XR5A 1KTQA 4KAIA 5HLFA 4NYZA 3CM6A 1LWCB 3GV5B 4CJUA 3TAMB 4LSLB 3K5OA 1BHLA 2W8KA 4F3OA 4J9MA 4WFYA 1SH3A 3HPGA 2GBZA 2C2EA 3HPOA 3NGIA 5KTQA 4J9OA 4CJ4A 4RW9A 3H5UA 3PW7A 2WB4A 1DLOB 4URSA 5L1IA 5FDLA 3SQ2A 4N41A 4CIEA 1WNSA 4TN2A 1HNVA 5C42A 3PW5A 5F8JA 1CZ9A 3O3GA 3V6DA 3V9ZA 5KFEA 2WRMA 3RB4A 3KNAA 1SV5A 2XO7A 2E9ZA 4BWMA 4HCCA 4KKOA 1JX4A 4K4VA 4AHRA 1SL2A 4O44B 1KHWA 4RW6A 1VSJA 2IC3B 3DLEB 4RNFA 2IAJB 1BI4B 3KLFA 4CESA 2DFFA 1TL1B 4H4MB 4QCLA 2C2RA 1WNEA 1R0AB 3H5XA 3JYTB 1WSHA 5SWMA 3V6KA 3QEXA 3L2VA 2VG5A 2OA8A 4B3OA 3RTVA 3QESA 4FJ9A 3KLEA 4ECTA 3T19A 4IH5A 4PA1A 4DSFA 4BACA 4DL5A 3HP6A 2W9BB 1S9FA 1ZBLA 3QGGA 5J2PB 3OL9A 4R5PA 2JLEA 4NZ0A 4KHSA 4O3OA 3MECA 1U04A 2DFHA 3S3NA 3PW2A 3SNNA 1Q9YA 4RW8A 4Z0UA 2OPPA 1EETB 3SFGA 3D45A 4W5RA 4U7CA 3KD1E 4AHUA 4IKFA 4FS1A 2ITGA 5KG6A 3AO4A 4B3OB 5DQIA 5KT3A 4DL3A 1RTHB 1UWBA 5C24B 2QV6A 3SV4A 2YV0X 1I6JA 2VG6A 3QYYA 1S10A 4CFAA 2P51A 2FBYA 4YNQA 4ED6A 4QW8A 4DTUA 5KG2A 5F8NA 1JL1A 1C0MA 3KK2B 4OLBA 3MEGB 1S9EB 3CYMA 3LP2B 4UQGA 5KGXA 2JEFA 4DQRA 2FLPA 3HPHA 2P5OA 3MR5A 4KV8B 4J9SA 3G6YA 3ZT1A 2JC0A 1UA1A 3TABA 4YFUA 3HK2A 3S3MA 3NH1A 3OL6A 5KG5A 2FVQA 5KFDA 1RAJA 1TVRB 2JEJA 1RBTA 4DS4A 1SV5B 4BWJA 3HHKA 3ZSRA 5KG1A 3HSTB 2HVHA 1NJXA 1S1XB 4MK7A 2W9CA 2AGQA 2ATQA 2WONA 1DTTA 3DM2A 4Y34A 3O4QA 3O3HA 4B8CA 5KFNA 1WN7A 3CQ8A 4WZQA 2OPRB 2YNGA 4I7FA 1Q9XA 3QETA 3RR7A 4K4SA 1JLFB 5L1KA 4IFVA 1FKPA 3K5NA 4HUGA 1U4BA 1C0TB 4ED3A 2IGIA 3NDKA 3C6TA 5KFWA 3V4IB 2FLLA 4ECVA 4FJHA 2GIRA 4OPJA 5DQHA 4ECZA 3ZCMA 4Z4IA 3MR6A 3ASMA 4KI4A 5J2QA 4ZHRB 2XWYA 3KLEB 5D3GA 3PV8A 3M9NB 4CF9A 1L5UA 2AJQA 3B6OA 4FZYA 2FBXA 4DTNA 4NLDA 3SPYA 1JKHA 4PWDB 2AGOA 3K5LA 4M45A 4HHTA 4Q45A 3OHBA 2RDIA 1WAJA 2A1RA 1ZTTA 4QAGA 1WAFA 3GIKA 1NJWA 2HHSA 1VSDA 3K57A 4IRCA 2RF2B 1NKEA 5KFCA 2ZE2B 1T03A 4CHPA 4F8RA 2YNHA 4KBIA 3MR3A 3D28A 4OKEA 3O4NA 2FBTA 3DLGA 4KFBB 4IQXA 4R8UA 4EBCA 4W5QA 5KFPA 5JUMA 3QIOA 4AHTA 5HRSA 1DLOA 3BGRA 1WSFA 1HRHA 1EETA 3H59A 1JLCB 4FJMA 4PQUA 4CHYA 5DMRA 5HLFB 4IRDA 3BR9A 4DSKA 3TAMA 3OYCA 3ZSVA 1IO2A 3KOAA 4Y2CA 3DMJA 1LV5A 1TKTB 4WE1A 3P1GA 2VG7A 1D9FA 3PO4A 3VQ4A 4TY8A 4CGGA 3KD5E 3QO9B 3RBEA 4PUOA 3CJ0A 1B9DA 4NLRA 1HPZA 3IS9B 4CJFA 4F2SA 4NLPA 4EBEA 5KT5A 1HNIB 1RBVA 4URGA 5KT2A 4EYIB 4ZVFA 3BSCA 3RMBA 3MFIA 3SYZA 3HVTB 5DQGA 1JLCA 1Z4UA 4K4WA 4GMJB 3DLEA 4F50A 4Q43A 1RYSA 3M9MB 1IH7A 3S3OA 4GVMA 3KLIB 1GOCA 4CJEA 4DFJA 4O4GB 1L3VA 2HHUA 4IG3A 4F4KA 3H08A 2OPSB 1R0AA 4CJSA 1UA0A 3KK1B 4CHZA 1T3NA 2R2TA 5DLGA 3HVRA 4NLWA 1JXEA 1T8EA 3MFHA 4EEYA 5FRMA 1A5WA 3ZSZA 3U3GA 4CEEA 5F8LA 3PR4A 2J6TA 3UQSA 2ALZA 3OYDA 3KLHA 3ZSWA 2IMWP 4IG0B 4I9QA 5I42B 1RT6A 1LW0A 5K14A 5L9XA 3NGZA 1RT3B 3KIOA 2R2UA 1K1QA 1B9FA 3I0SB 2R2SA 4YMEA 2GV9A 4I2QA 3QEVA 2PYLA 2VG6B 4FLYA 5EUHA 4KHRA 4ED0A 1UOCA 1EP4B 3WNHA 3NBPB 1W25A 2HNDA 1LWCA 4RW7B 4Y1CA 4AHCA 3DI6A 3A2FA 3QLHA 1T03B 2UUWA 4DWIA 2D3UA 3NH2A 3FFIA 4CGIA 2RF2A 1QQCA 1A5XA 2F8EX 4ZMMA 3UR0A 1IG9A 4IR1A 2GUIA 1RT6B 4BDPA 4DLEA 1LW2B 1KFDA 4B9MA 4CE9A 3MF5A 3TR8A 3RRHA 3G86A 2FBVA 3BQ0A 3UDLA 3OS2A 3SQ0A 4NCAA 4IFYB 3SUOA 2FVRA 1TP7A 2BE2A 3L3UA 4OKJA 5KI6A 2D0CA 3MR2A 4CF0A 3AVCA 3VQPA 2KZMA 1ZBHA 1HJRA 1T05B 1NK8A 1UAXA 1TKZA 1RBSA 5KFRA 1EXQA 3DDKA 1RILA 4M3UA 2KFZA 1XHXA 4HVJA 1VSMA 3OYKA 3HL8A 1HYSB 3EZUA 3IAYA 4AHVA 5JS1A 2QE5A 2OPQA 2KTQA 1S1XA 4TQSA 4URQU 4K4YA 1ZYQA 4IFYA 3LAKA 1JLEB 5KFLA 3CM5A 1DTTB 3DLRA 4DTRA 1XR6A 2JGUA 2OPRA 2YNGB 4I7FB 1FK9A 4FLTA 3AVNA 3NHGA 2EHGA 3SV3A 1NJZA 1TKDA 3KLIA 2XCAA 4J2DA 1RYRA 1OS5A 1HNIA 4NRTA 3V81B 3D5MA 3NE6A 1U48A 1RT7A 4CHNA 1S9GB 3T5LA 3IRXA 2IDOA 1HQEB 1LW0B 4OKKA 1IKYA 1QSLA 4CJRA 3AVHA 2D0BA 2DTUA 5KFJA 1S9EA 4E89A 3VA0A 3LP2A 4H8KA 3PVXA 4IH6A 4FLXA 1HQUB 1VSLA 1ITGA 5I3UA 4DL7A 4KHUA 5HBMB 2D5RA 4M41A 1HYVA 4B9LA 3MAQA 4CEQA 4NCGB 1C1BA 3AA5X 4RW7A 1LWEB 4RZRA 3V81A 4HCBA 2NUBA 4CJ3A 4YP3A 5L1JA 4NLXA 1TK8A 4LH5A 5K14B 4ZP8A 4M94A 4R8UB 3QERA 2HNZA 3M8QA 3RB0A 2VA2A 3N6NA 3DYAB 3FQKA 4Z4FA 4DL6A 2HHWA 4HTUA 1TL3B 5KG7A 3BGRB 4KTQA 4OGEA 4Q0BB 1HPZB 3NAIA 3OS0A 1VRUB 3ZSOA 2YNIB 5L1LA 1A5VA 3HM9A 1J5OA 2AWZA 3ITHA 3HJFA 3MECB 2W7OA 5CYQB 1S0MA 3CDWA 2G8WA 1MMLA 1XR7A 4IDKB 4R0EA 4DQQA 2IM1A 4NLQA 1L3TA 3DM2B 1RTIA 3Q8QB 1X1PA 1X9MA 3NGDA 2G8VA 4QWBA 4B9NA 4ZVEA 3QO9A 1TKTA 3UIQA 5KT7A 1TGOA 1NK5A 4FJ5A 2D0AA 3H2LA 4CK2A 3L2QA 4NLGA 5DG9A 3LWMA 4DG1A 3PZPA 3F73A 3V6DB 3RAXA 3L2WA 3TAQA 1TAUA 3UPFA 1RTJB 1HYSA 4KKOB 2O5DA 4DTXA 4C8KA 4ID1A 5F8HA 2C22A 1NK0A 2G8HA 4ED8A 3LDSA 2EX3A 4O5BA 1D1UA 2B6AA 4DEZA 4I2PA 1GX6A 2E9TA 2HNYB 4ED1A 2B4JA 4RNHA 3KLFB 3QIPA 3QEPA 1QAJA 1BQNB 1S1TA 3CFRA 4E1NA 4FS2A 1TQLA 3E01B 5HROA 4CFCA 3AV9A 4CGJA 1SH2A 4FM0A 4K4ZA 2X78A 2DY4A 4O0JA 5C5JA 5DLFA 3BREA 1T7PA 4TSXA 3H4BA 4KHNA 1KLMA 4RNNA 4BE2A 3LP0A 4ZPDA 1RT2A 2BRLA 4G1QA 1KSPA 2JC1A 1QE1B 4F4XA 1CSJA 4ZTJA 3DOKA 3I0SA 4J9LA 3NBPA 4I2PB 3VQDA 4FJ7A 1NNDA 4TYBA 4O3PA 4U6PA 3NAHA 5KG4A 1BIZA 4FZXC 1NHUA 4ID5B 3N6LA 2IM0A 4HUEA 4G3IA 1QTMA 2QKKA 2XY5A 5KFVA 5I3UB 4EP4A 4F3TA 4J9NA 5KFKA 1C1BB 1C1CA 1TAQA 1CLQA 4WFZA 2QK9A 2HAIA 5D3GB 1L3SA 4DFMA 1WSGA 3G6VA 4H54A 3K5MA 3AVKA 3OYMA 2ASJA 4JV1A 3OYLA 4FLZA 1FKOA 3NAEA 3ITHB 1S1UB 3HXMA 4O44A 5F8IA 3RAQA 2QKBA 3I0RB 2E6MA 4IG3B 5EWGA 1JXBA 2AU0A 1ZBUA 2X6NA 1S4FA 3TQ1A 3I5AA 4TY9A 3CVKA 4CJKA 1EX4A 4DQPA 4Z4EA 1TL1A 1RTDA 2VA3A 2EC0A 1FK9B 1RNHA 2WTFA 3JYTA 2XI3A 4WYWA 3MXJA 4QWCA 2OPQB 3OL7A 4DU1A 4XO0A 5T14A 3OYJA 3U3YA 4CF1A 3GILA 3ISND 3L3VA 4I9LA 4K8XA 3N6MA 3OYGA 4FZZA 1ZETA 1J54A 2HW3A 3OYNA 1VSHA 4E1MA 1S1VB 1NJYA 2FJXA 4WZMA 3E51A 3LZIA 4EP5A 3TAFA 3H40A 3OJSA 1SUQA 5DGBA 1B92A 3RRGA 3EPGA 4MIBA 3M8SA 5HRRA 4CJPA 2Z1GA 3FFIB 2FLNA 4M42A 2W9BA 3VQCA 3VQ9A 4KHQA 4JLHA 4OGCA 1FXXA 4RW4A 4Z4CA 3AA4A 4CGFA 4ZVGA 1HQEA 4RU9A 3SUNA 3DOKB 4L8RB 4RW8B 1IM4A 5CYMB 4FBTA 3QZ8A 2XRIA 2R8JA 2ILZA 4HUFA 1BGXT 2X6SA 4OJRA 4JRQA 2HVIA 3V9XA 4IFVB 1J53A 4Z4HA 4IBNA 2R8IA 1RA7A 4FM1A 4M3WA 2XHBA 4DF4A 4WYLA 1RT1A 2UUTA 2CKWA 2BQUA 3CIZA 3PJWA 4DSIA 4ZTFA 3OL8A 4KB1A 2BRKA 3IN5A 4Q8EA 3HO1A 3GQCA 4CGDA 1REVB 1KVCA 5KFHA 4F2RA 5KFTA 4ZPBA 3U6FA 2BR0A 3MEEA 2DPIA 4FJKA 3ZT4A 2ILYA 3VQSA 1HMVA 4CK3A 1CZBA 2RKIB 5JXSA 1S97A 1D5AA 3C6UA 3AO5A 3AVLA 3PW4A 4DSEA 4J2EA 2W9CB 1K6YA 3C95A 1JLGA 2C28A 2R8GA 3AA3A 3OHAA 5EDWA 1DTQA 3OYFA 3TI0A 4KTWA 4LH4A 2UVRA 4B9TA 2WCXA 4RUCA 4ECXA 3ZT3A 2HWIA 2P5GA 3M8PB 4CFDA 4CJTA 3DMJB 1MU2A 2E9RX 5KFGA 3ZSYA 4ECYA 3CDEA 3HVAA 2R8HA 4FW2A 1ASUA 4E7IA 1G15A 3KHLA 3DLHA 3QGHA 4NLSA 3VQ5A 2R2RA 4IKAA 5KRTA 1LW2A 1JLQA 4KRFA 2I1RA 2I5JA 4MFBB 1KVBA 3QINA 2OZMA 4Y3CA 2YKMA 3OYHA 3BDPA 3NF9A 2D3ZA 3H4DA 5J1EA 3VQQA 2BGGA 4GC6A 4J2BA 4O0IA 4DL2A 4FK2A 3KLVA 2G8UA 4TY8B 4LQ3A 3KHHA 5HBMA 3KTQA 1VRTA 3GIJA 1SUQB 4NCGA 4NYFA 4IOBA 1XC9A 2HB5A 4KHYA 4N5SA 2AGPA 3OSNA 3HYFA 2IA6A 1RTHA 1MU2B 3MTKA 1LWFA 3MXIA 1UWBB 2ZE2A 2XY8A 5CZ1A 3CJ2A 3TAGA 3DLBA 5DGAA 4HKQA 5KT6A 3M9OB 1C1AA 2G8KA 4MKAA 4IG0A 4AH9A 3H98A 3QNNA 1NKBA 4F4YA 3K58A 4ECRA 2J6UA 4DLGA 1WSIA 1JLBA 3KMQA 1W9HA 2QXFA 4AILC 4CJQA 3KK2A 4Q44A 3AA2A 3CFOA 2FVPA 4E19A 3RR8A 2AQ4A 2ZD1A 1EP4A 4FK4A 2G8IA 1QSSA 5KFUA 1NK7A 3TVKA 3KLHB 3VQ6A 3DOLA 3PR5B 5J2MB 2OH2A 4Q8FA 1ZTWA 1TK5A 1S48A 2GIQA 4J9KA 4LSNB 1T94A 4MIAA 2Z1HA 1TVRA 3KKRA 5HRNA 1QS4A 4KHWA 3LP3A 3V1QA 5JS2A 3JSMA 1BCOA 1RT5B 2DPJA 3OLBA 3T5KA 3GYNA 4DTSA 5KFXA 1YTUA 3VQBA 3EY1A 2ZD1B 2IJNA 1RBUA 2UVVA 2KW4A 3WNFA 2Y1IA 4JV0A 4DSLA 3KHRA 4WE1B 1JIHA 4BDZA 3L2RA 2R7YA 4NCBA 3PY8A 4ZP7A 3DOLB 4ZPCA 1N6QB 1S1WA 4J9QA 4C8NA 4FXDA 1DTQB 5C24A 3OJUA 3FDSA 1HNVB 5C42B 4J2AA 5DG7A 3T3FA 2VWJA 2XGPA 2IBKA 4KE5A 4TXSA 1IKWB 5C25A 3DRSA 3RMCA 3AVBA 1I39A 5FROA 4FJJA 1D0EA 2ASLA 2WK4A 1JL2A 3BSOA 4FLUA 4FVMA 1YT3A 1YTAA 5SZTA 3DRPB 4O3SA 4OLAA 4IDKA 5KFYA 4CEAA 4DFKA 1C2PA 3FSIA 4CHOA 2PYJA 3PJXA 3CO9A 2JEGA 4H4OA 4O3QA 4QPXA 2XGQA 4Q5VA 2LSNA 1BL3A 4DQIA 1N6QA 1BQMA 3AO2A 2FVSA 4QW9A 4FJGA 3LPTA 3NKYA 1S9GA 4CEBA 4KREA 5EU7A 1RA6A 2RDJA 4FLWA 3AVJA 3DRRA 1NK9A 2WOMB 2WHOA 2GC8A 3VN5A 4FJXA 4NLOA 3MEEB 3ZSXA 4JUZA 5J2PA 3QIPB 3DI6B 4B08A 1BQNA 3V9UA 3V9SA 2W8LA 4MK9A 4DU3A 4CJWA 5FRNA 3T5JA 2V9WA 4NLUA 3S9HA 4GC7A 5F9LA 3NGYA 2VG7B 4JRPA 4X2BA 1RDAA 2X74A 4PUOB 4CECA 1T05A 3DYAA 2FVCA 4RW9B 3LZJA 2YNFB 3KK3B 3EYZA 3I8DA 3VQEA 2HHQA 4LSNA 1N5YA 2ATLA 5KFBA 4ECUA 1HMVB 1KRPA 2RKIA 3OYEA 3CG7A 3GV7B 4IR9A 1YVFA 4FYDA 5J2MA 4OL8A 2B5JA 2IAJA 5FDLB 1NK6A 5KG0A 3BQ1A 1WLJA 4RG8A 5KT4A 4ED7A 3CFPA 3NFAA 1RT5A 1BCMA 4RUAA 2ASDA 4EZ9A 4QWDA 4CK1A 3WNEA 1TV6A 3TAEA 3ZT2A 4NRUA 4J9RA 4CEDA 4E7HA 1IKWA 3KMSA 1IKXA 4M3ZA 2JEIA 4JS5A 3NCIA 4KO0B 4KB0A 1VSIA 1VK0A 3IRXB 2IC3A 2BQRA 3Q8RB 4DQSA 2C2DA 3PX0A 4CF8A 3E01A 3ZSQA 4EZ6A 1RDDA 3HKWA 2HHXA 2IM2A 3C94A 4YR0A 1RTDB 2HHTA 2BQ3A 5HROB 3NL0A 3G10A 3DRSB 4BE0A 1KLMB 1TV6B 2R8KA 1BQMB 1QUVA 1C0TA 3KKSA 3HT3A 4ZHRA 3V4IA 1XWLA 3LP0B 1L3UA 4R5PB 2FJVA 1KHVA 3TAPA 4FCYA 3K2PA 3MEDB 2OPPB 4IH7A 4Y2AA 4ZP6A 1J9AA 3H5SA 5KFZA 2V4QA 2F8TA 4B9UA 3C6UB 3OS1A 4KHMA 2OPSA 2FJWA 1JLGB 3HVWA 3PHEA 3PW0A 4KTZA 4E7KA 5CYQA 4PY5A 1CXQA 1U49A 3AO3A 1SH0A 1S6PB 3LP1B 4E0DA 3SQ1A 3M8QB 1Z25A 3ALYA 4ID5A 3M8PA 3RWUA 2IM3A 3JSMB 2A1SA 1F21A 1S0NA 2YNIA 5CZ2A 3SUPA 3V1OA 3VA3A 1SL1A 5KGWA 4OPKA 3HP9A 1TL3A 3DLGB 3SUQA 1VSEA 3P83D 1S49A 1U09A 1Z26A 1BIUA 4FJIA 5KFQA 4OVLA 5CYMA 4ECWA 2UVWA 5KFIA 4CEZA 1J5OB 4C8LA 2ZQBA 4WXOA 4BE1A 1JXLA 3SI8A 4AHSA 3ISNC 4GW6A 2W9AA 3CJ3A 5E41A 2YKNB 1RT1B 4N76A 1S1UA 2RN2A 2PZSA 4KV8A 1NKCA 3QGIA 1WSJA 1VRTB 1W0HA 2XI2A 1ASVA 1S1WB 4Z4GA 5KRSA 2IS3A 3OYAA 2F96A 4CHQA 3LALA 1ASWA 4H4OB 4JS4A 4DS5A 3BSAA 5HP1B 4FK0A 4DSJA 4FM2A 2B6AB 2E6LA 2Z1IA 2KZZA 1S5JA 1WSEA 4QOZB 4DMNA 1IKVA 4M3XA 2B5JB 3DRPA 1RT4B 1IKXB 3BJYA 3K59A 3QIDA 2HNYA 1QE1A 3SFUA 3HVTA 4JV2A 4F4WA 3TARA 2O4GA 1QHTA 4HYKA 3VQ7A 4KPYA 3QEWA 3OSPA 2E4LA 2D41A 2UVUA 1RBRA 5T7BA 2XC9A 3CWJA 3AO1A 1GX5A 4B8AB 1LWEA 3C6TB 2AX0A 4ECSA 2O4IA 2VWKA 4ICLA 2BDPA 5J2QB 3EZ5A 4DF8A 3CDUA 2XY7A 1VRUA 4YR3A 2BANA 4E3SA 1JKHB 3L2UA 3KJVB 2WOMA 4LY7A 1BI4A 4CJ5A 2OYQA 1VSKA 3MEDA 1RDRA 2YHBA 4H4MA 4Y1DA 4N56A 1ZBFA 3KLGA 4ZPAA 3OY9A 4YQWA 2HMIA 4N47A 3NF6A 1HYZA 4ELVA 3NMAA 4IRKA 1KVAA 3V6JA 4EYHB 1S6PA 3LP1A 3V1RA 2D7SA 1U45A 4RNOA 1I3AA 1K1SA 3I0RA 1RCHA 3BSNA 2W7PA 4W5TA 4K8ZA 1S0OA 3H5YA 4ICLB 2KFNA 4B9VA 1FKOB 4PQUB 4CGHA 4M3RA 3ULDA 3QZ7A 1REVA 1XHZA 3OLAA 3IS9A 4TLRA 3LANA 3SJJA 3KJVA 3TWHA 3SZ2A 4CIGA 2DFEA 3B6PA 2WONB 1JLAB 3QLHB 3PUFA 1C6VA 2ETJA 2CJQA 3NF8A 2XY6A 3VQ8A 4K4TA 1C0UA 3DLKB 4DTPA 1S1VA 2HHVA 5KFMA 1RDCA 4ELTA 3GIMA 5DK5A 4DTMA 4CJLA 1X9WA 1EKEA 1SL0A 3AVGA 1N56A 2OZSA 4CEOA 3EPIA 1RT2B 3T5HA 4G1QB 3OYBA 2BE2B 3G6XA 4LD0A 4K50A 4BDYA 2V0NA 4FW1A 4XIUA 5EWFA 4RW4B 3AVFA 4PWDA 5J1EB 4FBUA 3KK1A 3THVA 2I5JB 4MFBA 2V4RA 2ZKUA 3O3FA 3RBDA 3DLKA 1LAVA 4CF2A 3OYIA 4KB7A 3RMDA 1TKXB 4W5NA 1S6QB 2FC0A 5DG8A 3M8RA 2KQ2A 3NF7A 1RT3A 4K4UA 4RW6B 2F8SA 1NHVA 4RNMA 2PY5A 1RTJA 4DTOA 1N4LA 3V9WA 2YNFA 3KK3A 1JLEA 5KFOA 1NOYA 2YHAA 3VQAA 3GIIA 4MH8A 4C8MA 3QEIA 5HRPA 1N5YB 3LPUA 1KCFA 3G0ZA 4O55A 1CXUA 4ECQA 2XCPA 3T1AA 1XI1A 3LAMA 3L8BA 2BANB 4QWEA 3IG1B 5KFAA 4KAZA 4CEFA 1JLFA 4EBDA 2B43A 4K4XA 4W5OA 3PX6A 1Y97A 4ELUA 3WNGA 1TKXA 4LSLA 3PO5A 3BQ2A 1QAIA 3SI6A 5F8GA 2P1JA 4FJNA 1TKZB 4KSEB 5J2NB 1SKWA 1GOBA 3FQLA 5F8MA 5KG3A 1X9SA 4XPCA 4KO0A 3FRZA 5HP1A 3PX4A 3ICLA 4DU4A 2YKNA 2Q3SA 4KI6A 4TYAA 4NLTA 4NLVA 1VSFA 4E7JA 1TK0A 4EO8A 4CJVA 1RT4A 1BISA 1D9DA 4MQ3A 2HNZB 4O3RA 4NYNA 3SCXA 1C0UB 4ED2A 3RB3A 1YVUA 4EO6A 2RPIA 3I5BA 4ZVHA 2IJFA 2G8FA 4DG1B 4QWAA 1IKVB 4J9PA 3OVNA 3IGNA 4CERA 1ZBIA 5I42A 1JLQB 1LWFB 1JLAA 4DL4A 3NH0A 3SPZA 2AX1A 2YKMB 2IOCA 2Y1JA 1D8YA 1RDBA 1NK4A 5C25B 4E7LA 5KFFA 4MK8A 4B9SA 2Z1JA 4XPEA 4FJ8A 4DTJA 3AVIA 1HARA 3P5JA 1IKYB 2HWHA 3SQ4A 2HNDB 3Q8SB 3I5CA 3CJ5A 3RMAA 3AVMA 1FKPB 1RT7B 4M3TA 2VG5B 1S1TB 3MXMA 3Q8PB 4TQRA 1LAWA 3ZT0A 1SKRA 2HMIB 4M95A 4NLYA 2W42A 4CIFA 3LWLA 4LQ9A 3KHGA 1JLBB 1GOAA 1O1WA 4ZP9A 3AVAA 1U47A 1HQUA
chains in the Genus database with same CATH superfamily
2KT3A 1WOOA 4HHJA 2X51A 1BE4A 1KFSA 1S6QA 3SDEA 2DNPA 1RWPB 3F9MA 3HD2A 3IG1A 4C3MA 2EBEA 4YOTA 4FJLA 4O3NA 5C12A 4C8OA 2FZKB 1QSYA 2ZVIA 4JI6F 1RGIA 1Q8IA 3QNOA 3AOAA 3NGUA 5EWEA 5ETPA 3TANA 1C1CB 4NA3A 4BRQA 4WQ4A 1NOZA 2L41A 1KTQA 4DQ8A 5AFUH 3ENAA 4PYDA 4CJUA 3TAMB 3PSIA 1W97L 4DR1F 1BHLA 1Q5YA 2FSNA 5DJBA 1CULA 2C2EA 1Q8BA 5KTQA 4J9OA 4RW9A 3NGKA 3GFZA 4AQYJ 3PW7A 1V5IB 2KXHA 5F8JA 5C42A 3SCLE 3O3GA 2I0XA 2MQLA 2WRMA 3RB4A 3KNAA 2ZITA 3IUCA 2E9ZA 2HIQA 4HCCA 2GGPB 2G4BA 4K4VA 1NLVA 5GAEU 1YAGA 4OHVA 1Q7YO 2IAJB 2P2CB 2B4UA 2R7VA 1PCAA 3I55S 3KLFA 2WB1D 4CO3A 4QR0A 5M1OA 3PKYA 2NXEA 4B3MJ 4BRPA 2ZZMA 2C2RA 1IWGA 1R0AB 3H5XA 3FCWA 1OPIA 3D7SB 2ASPA 2F4VF 2VG5A 2F65A 1HBOA 5DZ7A 3J81U 3QESA 2AKWB 4FJ9A 3HX9A 1H38A 2V50A 2XG8A 1X5TA 2BW2A 4PG7A 1VQPS 5F3TA 1U26A 3HP6A 4LFBK 2VBXA 1S9FA 1ZBLA 1U1MA 5J2PB 4LF7J 3HI9A 3O2IA 4KHSA 2MKCA 4A8YA 4YOVA 3S3NA 4TU9A 4YDUA 1EETB 3OVAA 2MKSA 3D2WA 3BZCA 4FS1A 4AQYF 5BRHA 1P9QC 3Q2SC 3AO4A 1IBKK 5MLCQ 4P2SA 4A5AA 1UWBA 3MXHP 1GLDG 4H4KA 1Q82T 4A46A 3MM7A 2GNKA 1KVJA 3PXGa 1OH8A 2BOPA 3TZWA 4KGZB 4ZPVR 2HK3A 2CGLA 4WFNL 1C0MA 4OLBA 4NPOA 1S9EB 2CPEA 2DGOA 5HVGA 5A2QY 1UKUA 3CC7N 4X4RA 1Z05A 4UOFA 2FLPA 2GIFA 3MR5A 1NM1A 2OKQA 4KV8B 4J9SA 4F0MA 4PEOA 1U7LA 3ZT1A 2UUAJ 3LA0A 2Q36A 5KG5A 4CM2A 1RAJA 2AEJA 1KS2A 5EXWA 2K7KA 4K42A 2JEJA 1N0VC 4LJMA 3LDNA 3QRQA 2JNJA 3O9SA 4OZLA 3U02A 4MK7A 4LR7A 4ALZA 1DTTA 3DM2A 3OT9A 4P72A 3L9ZA 4BC9A 1N33F 4WZQA 3BF1A 3QMLA 4I6YA 3QJPA 5LMNK 4CYUB 5L1KA 2CDQA 4K7QA 3K5NA 1U4BA 1AUDA 3ONQA 2IGIA 3C6TA 1WB9A 1QZ6A 3VAGA 5HL7L 3MAAA 3BF4A 3UD3P 2GIRA 3ZCMA 4Z4IA 2V7YA 4ETZA 3MR6A 3ASMA 5J2QA 2XWYA 4DX7A 5ADZA 4JYAJ 2IIRA 2FBXA 4GVBA 3SPYA 4JI5F 1PYOB 1JKHA 3CCLN 4M45A 1I94J 2J4RA 3PYDA 4HHTA 2O8CB 3QNWB 2H51B 1HNZF 1VLYA 1ZTTA 3GIKA 1NJWA 3CMQA 1QVGM 1YRUA 1WC4A 1IXKA 2OEJA 3MMBA 4IRCA 2Q2RA 2NXJA 4DN9A 3CPEA 3ZZZA 1EKRA 4AL6A 2H4WB 3FZMA 2FBTA 4F0KA 4IQXA 1M5VC 4R8UA 2OTJS 5C2FA 2UU9J 4JI2K 3QIOA 2E1CA 3VAFA 3LGNA 1DLOA 3VF0B 1IUJA 4V19S 3VOVA 5JJBA 3H59A 1JLCB 3C14A 4PQUA 5DMRA 4LF8J 2GWKA 4JI7F 4DSKA 2V2KA 2HZVA 2W4CA 3DMJA 1TMMA 3P1GA 1NSKL 1UJ4A 3AD7C 2BEFA 2CQBA 2E1MC 3W8GA 3JQKA 3KJQB 4CGGA 1U6FA 3KD5E 1PIEA 4PUOA 4CM0A 1HPZA 1O5JA 2RUGA 4URGA 5KT2A 2NXNA 3BSCA 1X0PA 3D6FB 2HQDA 3MFIA 1N32K 1MWYA 2MLZA 1HWJA 1X7VA 5A8KA 1SAZA 4UUXA 4OMFG 2DPNA 4L3KA 4GMJB 4OI6A 3LPYA 3US5A 3KLIB 2A18A 2VD3A 1TR0A 5CCMA 5IT4A 3VF2A 4OYOA 2CQ1A 4TKTA 1R0AA 4CJSA 3KK1B 3KWGA 3MGJA 5DLGA 4NLWA 1JXEA 4XTTA 3ZX0A 4WF9Q 3ZSZA 3SQGA 3CCEN 5E5NA 4CD3A 2ZF5O 3VETA 4Z94A 4M8LA 3D1OA 4KJIA 2QA4G 2IMWP 3AARA 1IBMK 1FI4A 3AJDA 2Z2ZA 5L9XA 1WF0A 2R2UA 2ERRA 3P38A 1G3OA 2GV9A 2VG6B 3Q8UA 2HPUA 4MMOA 1UOCA 3NBPB 1LWCA 3NGRA 2NZ4A 2LKZA 1A0OB 3HRGA 1T03B 3ETMA 3W5XA 2EFPA 4OYWA 1EARA 1RDUA 2D3UA 1UJ6A 3NH2A 3FFIA 1SS6A 3HSCA 2PAVA 2NRXA 4GV6A 3BEGB 4LBPA 4IR1A 2RMLA 4C11B 1JJ2R 1KQFB 3R7BB 3MF5A 3VGVA 3G86A 3EVWA 3UDLA 3BO4A 1RU1A 2IVMA 4I68A 2FVRA 4OLOA 2WC9A 1OO0B 3PYEA 3TU5A 1YJWN 4K0KF 3HMJG 2KZMA 4PKIA 4JD2B 4O8KA 1UAXA 1TKZA 1RBSA 2HLUA 1OVQA 3M1VB 3CUNA 5K8PA 1RILA 3IR7B 4M5IA 2F63A 3EE9A 2KFZA 1FX2A 4USVA 3TTCA 3HHLA 1NO8A 4UOGA 1VSMA 2CQHA 3HL8A 4PG8A 2QE5A 4TQSA 4URQU 2DGWA 4K4YA 4NXMF 3MD1A 1Y0HA 1ZYQA 1CJUA 4KC5A 5DM7L 3DLRA 4K25A 1VQ5N 2CVIA 4DTRA 2OPRA 2YNGB 4I7FB 4DUZK 1FK9A 5KQDA 2FIUA 2EHGA 1TKDA 1OS5A 3A8JA 1AFIA 5IM0B 4CLPA 3NE6A 4IOCL 1HQ2A 2H48B 4X4NA 3T5LA 3W8PA 3RJMB 1LW0B 1P8ZA 3AVHA 2D0BA 2DTUA 1S72S 1LFPA 3G2XA 1V5VA 3NWRA 2XM3A 3VA0A 2DNNA 4FLXA 1AT1B 1VSLA 3EKSA 1HYVA 1XN9A 3E8OA 2E66A 4NCGB 5LL6d 1OVYA 3JQJA 4RZRA 4HCBA 2QWMA 3LGHA 1FXRA 2BJ7A 1YI2S 4C9DA 2HNZA 2AYEA 4ATNA 1F0XA 3N6NA 1IV0A 4B1YB 2W24A 4OGEA 5L39A 2W25A 1HPZB 1JCEA 3ZSOA 4WFBL 2YNIB 1A5VA 2ADCA 2XMKA 1XNQJ 3NS5A 3MECB 4UY8O 3ZYYX 1XR7A 4R0EA 1R89A 1RTIA 1X9MA 3JTNA 3QO9A 3W65A 1RWVB 1FDAA 5D78A 1NK5A 4FJ5A 2D0AA 4CK2A 1N32J 2NNWA 4OYAA 3UCUP 4FWNA 3P5TL 4BVOA 1LKZA 1SJ1A 3ULEB 1YJ9N 1X3NA 1QM9A 1RTJB 1UEKA 4KKOB 2O5DA 1EIYB 4Y0FA 5THWA 5L9NA 1NK0A 2G8HA 2GVDB 5HAOA 3M2UA 4O5BA 4HDHA 3M30A 1EQMA 4S0MA 1GX6A 2ZUGA 3KUEA 4JI0F 2E9TA 2HNYB 3K0JA 1O0PA 5EX3A 2AEFA 2QLFB 1QAJA 1MLAA 1S1TA 4ZN3A 3E01B 1OYDA 2UUAK 4DV5F 4RCHA 4OYIA 1GLJO 4TSXA 1YHQN 4ZPDA 5A8WB 1RT2A 4KPCA 4PG5A 4G1QA 2JC1A 4YDDB 4OZ5A 3J7YI 3DOKA 3NBPA 1H98A 1I3OB 2DKOB 4FJ7A 4HI1A 1WI6A 4U6PA 3AJ2A 1BIZA 3LDQA 4OPHA 2ZDOA 1SJRA 3N6LA 2PIIA 1S57A 4BQZA 1GLFO 4FL9A 3D6HB 2XY5A 2F9WA 4QIFA 4NXNJ 3Q8VA 4WFZA 2HAIA 1WUAA 3C7NA 1VQYA 1REGX 2GA7A 3R8EA 1RAHB 3P4IA 3O9QA 3FEXB 3SQOP 1FKOA 5HJXA 1AXQA 3NOGA 1DZ5A 4X4PA 3IM9A 1Q79A 5H9FJ 4X62F 4CLFA 3MWBA 2OANA 4BR7A 2EG2A 2HWTA 1ZM4A 3WT0A 4B3TJ 3VERA 4TY9A 3I56S 2XSJA 5D15A 3V4MA 4I6WA 4JI8F 1TELA 3T9NA 2WTFA 4CRJA 2OPQB 4DU1A 4GKJJ 3CCSS 3MMAB 1KDNA 3MPDA 3U3YA 4CF1A 8AT1B 1U1QA 4I9LA 7AT1B 4K8XA 4UF4A 2P9SA 1R7IA 3OYNA 3MM5A 1S1VB 4E1MA 1PKUA 3FZBA 2JLFA 1FDNA 2GQCA 4WZMA 3RW6A 2VOOA 3UDCA 3KK7A 2HBJA 3CJCA 5DGBA 2HS3A 5FPMA 3D1HA 2ZJPL 4U67L 4IEIA 1MN9A 2BJ9A 4MIBA 1KTVA 3M8SA 5HRRA 4JI5J 2PI4A 4RL1A 3A8KA 5GIOA 4JLHA 5DO2A 4OGCA 2W7AA 4CH0S 1OWXA 3S7RA 4DR7K 1PILA 2NXUA 5M2UA 3DOKB 1UVJA 2M7SA 4IJNA 4HUFA 2X6SA 4HL9A 2HVIA 5M1QA 1J53A 2CH5A 2XHBA 1AYEA 2G2OA 3W2WB 1E6YB 2UXCJ 2YBVA 2CKWA 3ZZYA 2BQUA 3CIZA 3PJWA 4ZTFA 2MY8A 1H2VZ 3OL8A 4A8SA 2HF3A 1SC6A 3GQCA 4PKDB 1REVB 4JI2F 2FJDB 1YJNN 4C3KA 1HX1A 1ZM9A 3EXCX 2EFNA 2A0FB 3MEEA 4TLQA 4L72B 3N28A 1HJOA 1URRA 2RS2A 3PDNA 4JI7K 2DNKA 2FF6A 2XYHB 3HHNB 3C6UA 2U1AA 1NWKA 4ZDNA 4J2EA 1KEKA 3HBTA 1LFWA 2R8GA 1WACA 3OHAA 4GKKJ 1DTQA 2YJFA 3OYFA 3VAJA 1NPPA 3DHWC 1YJUA 2P5GA 4CJTA 1HI0P 1MU2A 2KHDA 1YHQS 3ZSYA 3KHLA 3DLHA 3QGHA 3VQ5A 1WC6A 5KRTA 4WBFA 1N36K 2Q43A 2WVFA 4KRFA 2I1RA 4LFCJ 3OYHA 5J1EA 3R5JB 3D3CJ 1XC3A 3FLCO 3MPUB 1NPRA 4DL2A 4FK2A 2G8UA 4TY8B 4LQ3A 2DNYA 3E3XA 1R8PA 4NCGA 4IOBA 4LF7K 2HB5A 1RAAB 3K17A 5EX5A 1WD6A 3OSNA 5F0UA 3MTKA 3PFOA 2YHYA 2HGLA 4JKGB 2VOPA 3DLBA 2YY3A 2QFJA 2OSRA 1SJQA 4MKAA 4V19X 1HWKA 4H5VA 2F9DA 2J6UA 3O9TA 1WUUA 1JLBA 1W9HA 2QXFA 4CJQA 3OR1B 2G0IA 2E2QA 1U6ZA 2GAGC 4E19A 3QICA 1DQ9A 1FT8A 1EP4A 1FWKA 5BPNA 5IQQA 9RUBA 5KFUA 4M1KA 1NK7A 2CG4A 3DOLA 3PR5B 5J2MB 5IM0A 2GIQA 3L7UA 4J9KA 2HBMA 4BG9A 3L4IA 4WFBQ 3DXMB 3MM8B 1FE4A 3MM9A 4MIAA 1O13A 2Z1HA 4FXWA 3CPWM 3PFEA 3KKRA 2DHXA 3BO3A 3V1QA 1BCOA 2Y0BB 1KN6A 2DPJA 4CTAB 4CO2A 3GE9A 3VQBA 4U96A 3EY1A 2ZH7A 1FEHA 2KW4A 3M32B 2Y1IA 3HKZD 3QATA 3WIVA 3KHRA 1V6HA 4CZCA 1N0UA 1Y4ZB 2GO9A 2RU3A 4NCBA 4ZPCA 1S1WA 3CJSA 2DK2A 3E66A 3BN4A 2PFUA 5C24A 3OJUA 4J2AA 3MM8A 1TL7B 3T3FA 2IBKA 1IKWB 1U2VA 4RTFD 2WFBA 5FROA 2W2MP 1D0EA 2B7CB 1TL5A 2WK4A 3BSOA 1YT3A 5KPTA 5RUBA 4DV5J 4O3SA 5C2CA 4OLAA 4IDKA 3R97A 4CEAA 2J0SD 2PYJA 2R7QA 4YOUA 4RWTA 2M0GB 3CO9A 3MM6A 2JEGA 4Q5VA 1N6QA 3WZ0A 3SQGB 2FVSA 2DR5A 2A6AA 4F3QA 1AFJA 2O8FA 4FJGA 2VPXB 2K7JA 2Q0UA 3NKYA 3OTOF 2XS2A 1CJVA 3B54A 4LF5F 3W5ZA 3U7JA 5EU7A 2RDJA 2ZOFA 1VQ8N 2WHOA 2RRAA 4O0NA 1QVFR 4JUZA 5D0EA 4B08A 1BQNA 2GWJA 3ZX3A 4DU3A 1NDKA 4NLUA 3HSDA 1HNWF 4YUDA 3EGWB 3FZHA 4CLUA 3CQXA 3FEZA 2LLZA 4PUOB 4CECA 5JMVA 4RR5A 3EYZA 3I8DA 1U0SA 4LSNA 1CVJA 3AY0A 4NA1A 3UKUB 2RKIA 4OZ2A 2RQ4A 4P2MA 1YZ7A 3GCXP 5B0DA 2VL1A 3RG6A 2HHHF 1S22A 3OFHA 2DNRA 4OL8A 3CIMA 5FLXU 3OTEA 3QSIA 5KG0A 1WLJA 4ZJOA 4RG8A 3GFXA 3P8BB 1ZS6A 4MDBA 4G1IA 4LF6F 2ASDA 4EZ9A 4AM7A 4QWDA 1S79A 2EC2A 1VI7A 5BRDA 3OUYB 3G8QA 4E7HA 1IKXA 2FB0A 4KO0B 4KB0A 2APOA 2V94A 1VK0A 2YWWA 4LR9A 2G0CA 2IC3A 1WG1A 1VGYA 4OI0A 3WXJA 2OHDA 2BQRA 1VBKA 5BN9A 2VONA 4DQSA 1APSA 4CD1A 4MO4A 5HN0A 3PX0A 1TUGB 4CLKA 4CF8A 2IYGA 1VQ6N 3ZSQA 3UKRB 2W6LA 3D68A 3QJJA 2U2FA 3KJFB 2HHTA 1UVLA 4OHYA 5M2RA 2B9YA 2IBOA 2VCPA 1X3MA 3D4JA 2R8KA 4GKJK 2YWEA 2POKA 2LEPA 1OY9A 1HPMA 1N34F 1PO6A 3D66A 2XNQA 1WI8A 4ZP6A 4IH7A 4Y2AA 2YQ1A 1G2EA 3VAIA 2YKAA 1WKLA 4AE5A 4WKRA 4TU7A 3ZEUA 3C6UB 2NUHA 4KHMA 2H54B 2OPSA 4E7KA 3PW0A 5CYQA 1CXQA 5JLHA 1ITPA 2F4VJ 4DV2F 5LXRA 2VU5A 4JI1F 3PLAA 3UN2A 2V4JA 3HD1A 1YVNA 2YNIA 5CZ2A 3TUPA 3VA3A 1SL1A 5KGWA 3MUMP 3DLGB 3SUQA 3WQPA 3TVZA 5KFQA 5CYMA 4ECWA 4J91A 5U47A 1J5OB 2CAJA 3ULEA 5D4PA 2ZQBA 2AZ1A 4DR6F 2BYCA 2HQCA 4CT8A 2W9AA 2C2OB 2RN2A 5D0HA 4KV8A 2ZOMA 1VRTB 3EICA 1FJGK 1W0HA 4LF4J 4JI8K 2UUBJ 2YXLA 1X31C 2QLJB 2NSCA 3BSAA 1N5VA 4C3LA 4FM2A 3ZTSA 1FRHA 2E6LA 2GFFA 2JVOA 2FJEB 3M6UA 4JI7J 2GQQA 1WSEA 3CCVN 3W9HA 3Q22A 2B5JB 5EN1A 2KJVA 1G1XA 1IKXB 3VTHA 3R6LB 2HNYA 1N5QA 1QE1A 4FWOA 1G99A 2GCFA 5IS2A 3MMVA 1ELOA 1HBUB 4H0XB 2O4GA 4CLYA 1RKIA 4ENOA 2E4LA 2D41A 1RADB 1J6ZA 2OFHX 5T7BA 5AQLA 3CWJA 1GX5A 2IRYA 3OUYA 5H9EK 4BR9A 4PWWA 3HLUA 1FESA 4ECSA 3O5TB 4ZPWR 3Q86A 4ZN1A 4DR7F 3TRGA 2AJFE 3MX2A 3CDUA 3BGOP 3CXCR 2XY7A 4E3SA 3KJVB 4LY7A 5CYJA 2ZJRQ 2VFUA 1B99A 4DR6J 1VSKA 4CBWA 1RDRA 5LT5A 1IWAA 1V9OA 3KLGA 4ZPAA 3OY9A 4ES3A 4TVAB 3NF6A 1HYZA 1KVAA 2ZH3A 2RE2A 3H8YA 5E3QA 3V6JA 6FDRA 3V1RA 3IFRA 2D7SA 4RNOA 1I3AA 1K1SA 2OUGA 2W7PA 3G71N 1ZBTA 3ENQA 4K8ZA 2MGZB 4PR6A 4YS2A 4ICLB 2KFNA 1F2GA 2EI5A 2N3LA 4YHHJ 4F26A 5I9EB 3OLAA 5C0YA 1CQNA 3IS9A 1A9NB 4DBQA 3SJJA 4CZGA 1VHFA 3SZ2A 3UI3A 1HLWA 1NH8A 5LL6Z 2XY6A 2LQ9A 2V2QA 3V5RA 3DXSX 3DLKB 2O8DB 3KDOA 4UT4A 5DDQC 5CXTA 2G1HA 1NDPA 4ELTA 3AAQA 5DK5A 5DM6Q 4DTMA 1QLNA 1X9WA 4DL0C 2N7YA 1BUPA 4B3MF 4FDFA 3EPIA 1B7FA 1ICEB 1QDUB 3H7HB 3W9JA 4JKFA 4N8OA 1IBMF 2DISA 1GLAG 4BR4A 4ZVTB 4QYZJ 2HGNA 4FW1A 4MLHA 1FFWB 4XIUA 5EWFA 2CFXA 3CCQN 4PWDA 4RWXA 3AAWB 2CZ9A 4FBUA 5AZIA 2K1RB 1TU0B 1LAVA 3SSQA 2MEWA 1B4SA 2RB7A 5E7OB 5FLXY 1S6QB 5DG8A 3T1HJ 1MWMA 3M8RA 2KQ2A 3NF7A 3IRWP 4HR2A 4H4KC 3FKBA 1NHVA 3GP9A 4DV4F 4YDUC 2PY5A 4DTOA 4UOCA 3KK3A 2YHAA 2KO1A 5FPNA 4ZITA 3M6XA 3EVOA 2ITMA 2LU1A 4M5KA 1WHWA 3LAMA 1X4FA 4UQTA 1FRJA 2BANB 3SLCA 5KFAA 4ISEA 3R5DA 4NYPA 4JI6J 3HHEA 2QL9B 4W5OA 2KHOA 1UFKA 3SBTA 5K9FA 4JKEA 4LSLA 3PO5A 1D9AA 3DKDA 2DRBA 3OVSA 3CB4A 4KSEB 2UUBF 4WFAL 3EEQA 4EFHA 4GVLA 1GOBA 2I7PA 4RU2A 2DHSA 1X9SA 5HP1A 3ZETA 4DU4A 4FPBA 4A61A 4TYAA 1NAQA 2EXUA 4NLTA 2EFGA 2HBZB 4LUBA 4E7JA 2LECA 4EO8A 5IV3A 2DRDA 1YUWA 4P6QA 1FJGF 4H5WA 1U6BA 3DDNA 1X60A 5LMUF 1BMQB 1C0UB 4LR8A 4USMA 3RB3A 1YRTA 4LF2A 4B1ZA 3TA0A 2JSXA 2RPIA 3J7ZO 1JJCB 2AP6A 3S41A 1J5EK 2G8FA 3DU5A 3IGNA 3BZKA 1LWFB 2YQ0A 3VGTA 4Y0WA 2AX1A 1YGYA 3WXKA 1NK4A 1IR1A 4LFAK 1RU2A 4FJ8A 1HARA 2HWHA 2Z30B 1RZMA 2VFVA 3I5CA 3A5NC 4NMLA 1BY9A 2IYIA 1CJTA 2HSTA 3MXMA 3Q8PB 4TQRA 2QA4N 4JK9A 4M95A 4PWUA 3VENA 1YF5L 1QUPA 2UP1A 2ZH4A 3EXYA 3KHGA 1JLBB 4FZVA 2PMZD 3HOTA 1H0HB 1ZXOA 3BYPA 4USJC 4ZOSA 3ZO7A 3OBWA 3AAPA 2RT3A 2MZ1A 1PJ7A 2DO0A 1HQUA 2G9OA 1S7IA 4DR2F 4A8FA 3QBWA 1HA1A 3KLGB 2C3MA 3DRRB 4CLSA 4DX6A 3UKRA 4NEYA 1N48A 4MKBA 5EX0A 4QOTA 4YORA 3NVMA 3SIPB 2YNHB 5KPZA 1PYSB 3I82A 4LF1A 4CLTA 1MMNA 3TA1A 2CPDA 3ZZ0A 1WC1A 5HOOA 3C19A 1R43A 4EHTA 2KRRA 2J6SA 4YR2A 4I2QB 4M3YA 4YY3J 4O4RA 3JQMA 1KAYA 1HL6A 3I55N 5HLFA 4JI0K 4PL7A 2DNZA 3GV5B 1K8KA 3LF0A 3T1YF 3K5OA 2XMUA 4CZKA 5GMEA 1K0VA 3E2EA 2D4WA 4J9MA 4LFCK 1SH3A 2GBZA 3NGIA 3HPOA 4KIAA 4CJ4A 4CP5A 3HT0A 1E4FT 5BR9A 2WB4A 1DLOB 2M5YA 4N41A 4BGAA 1X4DA 1WNSA 1HNVA 2XZWA 3F56A 5JVGL 2H5EA 3BBBA 3FC9A 1VRQC 2CXEA 3D2EA 1JX4A 2GZOA 3GOIA 1KHWA 1VSJA 2J9CA 1M1GA 4CNYA 2LQ8A 5A8RB 4QIEA 3DLEB 1M90O 2BM1A 4CI0B 1XTZA 1VQ9N 3CJTA 1O8BA 2IVFB 1WNEA 4CYUA 3QFUA 5SWMA 2OA8A 4B3OA 3RTVA 4C23A 1QD1A 1DBDA 3Q0AA 3CQYA 2MY7A 4ECTA 3G82B 3FCHA 4IH5A 3CF5Q 3MCNA 2XMWA 3CMEN 2LXFA 1UEVA 4R5PA 2KJWA 4FSVA 5CQGA 3ZZTA 2AIRB 4F36A 2FHMA 2FHJA 2DR9A 4Z0UA 2IVOA 2JX2A 1ZC6A 4W5RA 2FHJD 1QJHA 1YIJS 2ZBQA 2QRRA 4IKFA 4DHVA 2ITGA 4I6MB 2C1EB 4B3SK 1FRIA 4B3OB 4OI2A 2ZBCA 5DQIA 4PPZA 2HAFA 4CZLA 2K3IA 4DL3A 1NUEA 3SBMA 3D2FB 1M5PC 2DBBA 4RJVA 3QYYA 3M1FA 4KGVB 4DUYK 1SJFA 4ED6A 3L4QA 3CNQP 2X1AA 3G25A 4DTUA 5KG2A 1WEYA 1PJ6A 5F8NA 4R79A 2XWXA 4RLEA 4BC5A 3CMAN 4B3RK 3CYMA 3LP2B 4A57A 1RI7A 4ZCKA 3J81j 2JEFA 1NM2A 2YX7A 2I9SA 3QJLA 3W9IA 3G6YA 1VQLS 2OMLA 2DH8A 3OL6A 2C2MB 4ZJQA 1OPZA 2XLKA 1TVRB 1T9XA 1N5SA 5KG1A 4ITSA 3HSTB 4JKBA 2HVHA 1RE1B 4J9VA 1S1XB 2W9CA 2HZCA 3ADAC 4YEAA 2WONA 1CULB 5LSLA 5KFNA 4U7UD 2XMTA 3EGVA 1K73T 4K4SA 1JLFB 5GADP 2E5GA 1YJRA 4NB4A 5LJ5Y 2FUG9 4L73A 2FLLA 3TWZA 4OPJA 5DQHA 4ECZA 2PE8A 2IRXA 2XMAA 1NGIA 4ZHRB 3PV8A 1L5UA 2AJQA 4H03B 1WJ9A 3B6OA 2Q6CA 4DR5J 4LF5J 5M1PA 3UDEA 2Q66A 4WQ5A 2A1RA 1OH7A 3OTOK 3RUBL 3I9ZA 1VSDA 4LF5K 5KFCA 2ZE2B 3H3OB 4P74A 3MR3A 2MYFA 3BM7A 3D28A 4OKEA 5DZ6A 4USIA 4XK8C 2CYYA 3I8BA 4I1TA 4AHTA 4DU7A 2DH9A 1VQKN 2PA8D 2QSWA 1U25A 2W2NP 3TA2A 1X4GA 1WSFA 3C0BA 1EETA 1AW0A 3VEZA 4CHYA 4IRDA 3TSPA 2CPJA 5IZHA 1HI8A 1FA0A 3BR9A 4ETXA 2CUYA 3TAMA 4CZMA 1IO2A 4WCEL 5J1PA 1M5KC 1UETA 1RWMB 1W2BR 4YY3F 4K2XA 2V63A 1WBDA 1XMQF 2GHVC 2VWBA 2VG7A 4HWIA 3PO4A 3M5RA 3FGVA 2E20A 4UOHA 4TY8A 2VQFK 4CT9A 4NLRA 2AD9A 4NLPA 4EBEA 4NXMJ 5KT5A 1RBVA 2P9IA 2V52B 5HSPA 2X1FA 1EQ0A 4ES1A 2VQFJ 3R27A 1NSQA 3HVTB 4ZCMA 3QFPA 2RQCA 5AQJA 5HQ8A 2QLBB 1Z4UA 4K4WA 1RYSA 2E1RA 4AL5A 2H1YA 3TJAA 4C6AA 4PG6A 5HMWA 1GOCA 4DFJA 2F8MA 3A13A 4IG3A 4F4KA 3H08A 2DNGA 4CO4A 2DNOA 3H2UB 1UA0A 3W2WA 5AQGA 3MFHA 3OHRA 3PKMA 4RKUC 2M2BA 2XLIA 3HULA 2A40A 3JS6A 5AJ3K 2WVCA 4BR0A 3OYDA 3U1NA 1RAGB 3KLHA 4WP9A 4DXLA 2J76E 5I42B 4DR4F 1LW0A 2QTWA 1RT3B 2UXBF 3I0SB 2YKQA 4YMEA 3QEVA 4BHQA 5AR0A 5EUHA 1EP4B 1W25A 2HNDA 1FWLA 1JWWA 4JI3K 1N8RO 4DV7K 2B7BB 3J7AP 3CD6S 2YQ3A 3CCJN 4X65F 3A2FA 2IRUA 3CW2C 3PIPQ 3SCJE 2C3YA 4DJBA 1YJ9S 2HFUA 5E26A 2R9LA 3PYGA 2RF2A 1QQCA 2F8EX 4ZMMA 2MLYA 2LEAA 3UFCX 3TTDA 3W5YA 2QWQA 1M1HA 1YJ7A 1NH7A 1M5SA 2NYIA 1UFWA 2GUIA 2QMUB 2BUNA 1FJGJ 3K0SA 1KFDA 4CE9A 4FWRA 4ILHA 2CWXA 4JYAF 1Q16B 3OS2A 3SUOA 2ZH8A 4KGMA 2HBLA 1TYQB 2D0CA 1M0SA 1RTZA 3SBGA 3MR2A 3R5GA 4M5MA 3VQPA 3S1TA 2M4MA 2UXDF 4OJ3A 1B64A 1K47A 1WKKA 1CPZA 1Y00A 5C10A 1XHXA 4BRMA 1VQMS 1LNQA 3MCAB 4W4MA 2RS8A 3BH7B 4DR3K 1HYSB 3JXOA 3UVJB 3KVGA 1YSJA 4P75A 2NRVA 3D0HE 2KTQA 4U67Q 5A6WA 1IJFB 1SCJB 2EWHA 4WTOB 2VC1A 3ZTOA 3W2VB 1JLEB 2O67A 1DTTB 4A48A 2NRRA 1XR6A 2JGUA 4CIOA 3NHGA 4YB6A 4IOCQ 2CRLA 1VBYA 1RCXB 3SSRA 1FFSB 3D5MA 1KD1T 1U48A 2GEMA 4DPWA 3D6TB 2KM8B 1EB0A 3IRXA 2IDOA 2F40A 3AOBA 2QL5B 3GWCA 3Q2TC 1IKYA 1QSLA 3QAUA 1Q7YT 1S9EA 4E89A 1VYAA 3I87A 1WG5A 3LP2A 2A6OA 4H8KA 5LJ3Y 3RVCA 2B3TB 5HBMB 2D5RA 4M41A 4BS2A 4NO7A 1RP5A 1WOSA 4ERDA 5CZXA 3J7YU 3V81A 4ZVRB 4IUFA 4CJ3A 5DETA 5K14B 4R8UB 3G4SS 3RB0A 5I4MA 3FQKA 1ZBSA 4DL6A 1G7CB 3NCQA 3BGRB 2FPHX 2J0XA 1J5OA 2AWZA 3GU0A 1VQOS 4QYZK 2G8WA 2HFZA 4WK3A 4DQQA 2GHWA 4MTPA 4ZCLA 3Q8QB 3U9DA 3NGDA 2L08A 1K8AO 2GHPA 2QT7A 4ZVEA 2QMXA 4C97A 3K2YA 3C16A 4GMKA 5KT7A 4FF2A 1TZ0A 3LWMA 3CJ7A 4DG1A 4X62J 1TAUA 4NI2A 3H3NO 4EFAC 4C8KA 5E0OA 1HNWK 4I56A 4M5DA 4ID1A 2C22A 1H3DA 5CAAA 4ED8A 1DKGD 2EX3A 4I2PA 4X64F 1Y7PA 2FLOA 1C0GA 2P9KB 3UCZP 2ZH6A 1DHMA 4Z37A 1ZZNA 2WTUA 2CNNB 3PRDA 4DV2K 3IAM9 1OKJA 4O0JA 3WUHA 5DLFA 3GFYA 3GPAA 1S3XA 4KHNA 2AMCB 3LP0A 2X1BA 2FTRA 2ROEA 2MKJA 3DXKA 1BWFO 1PBAA 4ZLPA 3UNYA 2BTFA 4I64A 2VGMA 3FJ2A 1K9MT 2Z0GA 1FNMA 5F3ZA 2M8HA 2I8EA 3VQDA 3NG8A 3FSXA 4Y65A 4OX7A 5EHHA 4FVCA 4JI3F 1GQEA 4FZXC 3CERA 1FD8A 1XMBA 2D9PA 2QKKA 3OFGA 3DN9A 2Q97A 5KFVA 3BP8A 3A12A 3M4XA 2K3KA 4DUYF 4K59A 4DV4J 1BC6A 3KYLA 2JL9A 1WSGA 3K5MA 2RIJA 2R7RA 4FLZA 4JV1A 3OYLA 2YH0A 3NAEA 1XQSC 1FVSA 5AJ3F 1S1UB 2EFVA 4CTAA 1IBCB 2QKBA 2N3OA 4W92B 2QSFA 4YHHF 2E6MA 5A8RA 5K8NA 1JXBA 2BJEA 2AU0A 2E7XA 3TQ1A 4CJKA 2QXLA 2COLA 1T6DA 4DQPA 2XEXA 2MXYA 3CULA 1RTDA 2VA3A 1FK9B 1RNHA 1U2FA 2XI3A 3MN6A 4WYWA 2P6SA 1GNKA 2YX6A 1HBOB 4R0JA 1X4BA 2QL7B 2XYPB 5T14A 3UWTA 3NNCA 2CIMA 3E9OA 3OYJA 1SQEA 5D8HB 3ENOA 5CHIA 2L9NA 3THYA 4IO9L 3N6MA 2BACA 5T7LA 3OYGA 4OI4A 2QWLA 2HW3A 4DV1J 3EKUA 2D69A 3OFFA 4DCHA 2NSBA 4ZK7M 5AXNA 2J7KA 3T69A 3CCLS 3LZIA 3TAFA 3H40A 1SUQA 2HBRB 2CJXB 1B92A 3WC0A 3AB4B 2B8PA 2FLNA 2W1BA 2B4VA 3QT8A 4M42A 5M2PA 2AYMA 2W9BA 1RBOB 2ACMA 2MZRA 3CDBA 3A8YA 4CGFA 4ZVGA 1GTEA 4A47A 3IM8A 4DZDA 2DT9A 4WK1A 3U4LA 5A2QO 1KKHA 4AUKA 2XRIA 4USHA 2G2ZA 4OJRA 4JRQA 2XMMA 3V9XA 4IFVB 2C42A 3VTIA 4JKCA 3DOMB 2VFTA 3CCQS 4FM1A 5F41A 5CHCB 4WYLA 2V5HG 1EX8A 3BN7A 3M2VB 4KB1A 2UV8G 1ZA1B 3HO1A 2FY1A 4UW2A 4X4QA 5KFHA 1HR0F 2L3MA 1EKSA 4ZVOB 4ZPBA 3U6FA 3GONA 2BR0A 2DPIA 3ZT4A 1I94F 4B3TK 2VGNA 1FVQA 1CZBA 2GMHA 4IYQA 5AQWA 2ACYA 2HHHJ 1S97A 7FDRA 3AO5A 3PW4A 2YKOA 2W9CB 1K6YA 3T1HF 2C28A 5LOQA 5EDWA 4KTWA 4LH4A 2UVRA 4B9TA 4AM6A 1HBMA 1GLLO 2HWIA 1U02A 1UP1A 3M8PB 5GAEP 1VQNS 2YVSA 3HVAA 2R8HA 1SZ2A 4FW2A 1G15A 1UMJA 3HJVA 3M8WA 4IKAA 1D8ZA 1ACMB 3VQTA 4G6VB 4Y3CA 4I4BA 3PCOB 2OIHA 2D3ZA 4ER8A 3HF5A 1WDDA 4H5TA 4BBYA 3GR0A 4FPAA 4J2BA 4OV6A 2QLXA 4O8UA 4O0IA 3B82A 2BW7A 1LXJA 3NMUA 2E5LK 3U8XA 1VRTA 1HNXF 4PYAA 1SUQB 4C48A 3I33A 1WOQA 3L09A 4OHWA 5CH7B 4QQBA 5ITHA 4KHYA 5BPMA 3D0IE 3D0GE 2IA6A 1RTHA 5AXKA 1MU2B 1LWFA 1DFDA 3D2FA 3EE3A 2ZE2A 5CZ1A 2LFVA 3CJ2A 2AF6A 2CADA 2MGZA 4HKQA 4GVBB 3P39A 5T7LB 1WTBA 4AH9A 3QNNA 3H98A 2HZAA 2MZSA 4F4YA 4AQYK 4DUYJ 1VQ7N 4JEPA 5L38A 1WSIA 1RWNB 3KK2A 4XH1A 1VQ9S 5IC6B 2KKHA 1Q1KA 4Q44A 3AA2A 3CFOA 3SSSA 3CC7S 1S0VA 1CZAN 3O9UA 3THXB 2VZ9A 2AQ4A 2KG1A 2NS1B 2Q79A 4FK4A 2G13A 2G8IA 5G0RB 1UVNA 3EVMA 3C16B 5HMXA 2QC3A 3GFHA 2QMWA 2OH2A 1ZTWA 1S48A 3MK6A 1WOPA 1S59A 4BC2A 4FWMA 4PAAA 4FYXB 2J9DA 4FF4A 2OCEA 3JSMA 2FC8A 1RT5B 1SC4B 5CZVA 4FWLA 3PM9A 1CBKA 2KT5A 4X66F 5KFXA 4IJAA 1YTUA 3RAMA 1MNEA 1NGHA 4BR2A 5AFUA 3EL2A 3WNFA 4DSLA 4ANCA 4C0HA 2DD8S 2RQKA 2UXDK 4BDZA 2V7ZA 1PAEX 3PY8A 5EY4A 2D1CA 3DOLB 3R5BA 3OTBA 2F3JA 4C8NA 2YHXA 4PG4A 1DTQB 5DG7A 4FPRA 4X64J 2B9WA 2XGPA 3LW5C 2I6WA 3FBCA 2HFOA 3TEHB 1UCNA 2DEJA 3RMCA 2VPYB 3JAMO 4HT5A 1HD0A 3M8YA 4FLUA 3KG0A 1HD1A 1YTAA 4FP9A 5BRFA 1F5CA 2SXLA 4DFKA 3FSIA 3VEOA 3CJ9A 3ZNUA 4X4VA 1VDHA 4H4OA 3OTOJ 2XGQA 1X0FA 4FWQA 1E4GT 2LSNA 2E2OA 1BQMA 1OH6A 2RSQA 4QR2A 3O4WA 4USKA 2E1YA 3E9LA 3LPTA 1S9GA 3MMCA 4DV6F 5L8RC 2VC0A 2RDDA 4UZCA 1BDGA 1F9EB 1AZSA 2RHSB 3D9BA 3MCMA 1XNRK 3A8EA 4NX9A 4B1XB 3AVJA 3DRRA 1NK9A 2K2PA 2GC8A 1CS4B 4NLOA 1KC8T 3ZSXA 3R9PA 4WP3A 3DI6B 1I1GA 1SC1B 3KZBA 9ATCB 4OZ3A 3GJSB 4CJWA 3CHWA 3Q7CA 3S9HA 4AYBD 3NGYA 4CBUA 2BZ2A 2F1FA 1RDAA 3GJQB 4A8KA 2WAQD 4DPOA 1T05A 2HHHK 3O6QA 2YNFB 4ZS6A 3HCXA 4KRWA 3DWLA 2FZCB 3RSEB 1HMVB 1WEXA 1WSRA 2J0QD 4QS8A 1NRKA 5G0RA 2Q1NA 3CG7A 2MKHA 1GK8A 2B5JA 1T95A 2XMVA 3FFKB 3HZGA 3BQ1A 2ZHAA 3RW7A 2A2DA 4B3RJ 3CFPA 3MM7B 3P4UB 3NFAA 1NG9A 1XBWA 3D2EB 1RGVA 4M5LA 1RT5A 1BCMA 4DR2K 3MWPA 4CK1A 4TNOA 3TAEA 4KGXB 4IO9Q 4NRUA 4OZ1A 4J9RA 4CEDA 4M3ZA 1TUWA 2JEIA 4JS5A 1K73O 2DXDA 2DGXA 1VSIA 3IRXB 1ZM3A 1RAIB 4QYRA 4OLPA 1R8AA 3Q8RB 4LF6J 4EZ6A 3GMGA 2HF4A 2HHXA 3TSQA 1ZM2A 3C94A 3H0PA 1B70B 3NL0A 1PSDA 3NCPA 1GTHA 1BQMB 1QUVA 1C0TA 2EK6A 1YK9A 2DXFA 4ILJA 3TJ8A 1LQ9A 1MN7A 2XQCA 3LH2S 1O51A 3LP0B 1L3UA 4R5PB 1KHVA 4FCYA 2Z8QA 3K2PA 2BE9B 2OPPB 1KAXA 4A8QA 2EFOA 1BXNA 2V4QA 1H2UX 4B9UA 1SQKA 2MHNA 3VEWA 3OS1A 5GAGP 2UU9F 1JLGB 4PY5A 1FXDA 3ZZPA 1U49A 2KH9A 2ZKTA 3AO3A 2O8EA 2F7VA 1S6PB 1KQSM 4P2FA 4OPAA 3RWUA 1IR2A 2IFXA 3JSMB 1I51B 4HACB 3SUPA 3V1OA 1NB7A 2RAQA 2VFRA 1JNRB 3ZTPA 1TL3A 2ATCB 1CS4A 1S49A 1Z26A 5GAGI 3AGKA 4FJIA 2CJAA 4OVLA 2DR7A 4CEZA 2IPOB 4HLBA 1X8DA 5KAKA 4L3QA 1JXLA 3ISNC 4GW6A 5HO4A 3CJ3A 4HTIA 1RT1B 1YTYA 2HFSA 4ES2A 3BKFA 5K8MA 2W01A 2PDAA 3NCRA 3Q23A 3VEVA 3CO0P 4Z4GA 5KRSA 3K8VA 3LUYA 2IS3A 3OYAA 3AB2B 1ASWA 4H4OB 4Z7CA 3AQPA 1R8HA 3FRYA 3BY5A 2WSCC 2A3JA 4Y2IA 1R6VA 3DGPA 3G6ES 2Z1IA 2F9TA 4TU8A 1PYTA 1N52B 4HEA9 1IKVA 3MM6B 1JJ2M 3SFUA 1SKUB 4C98A 2VPZB 4JV2A 1Q0NA 2W2QP 4ZIWA 1VQ7S 3ZLJA 4PKGA 1UVKA 2UVUA 2QWNA 4LBIA 3M2RA 3MHYA 1XNRJ 4ZCIA 1WC3A 3ET6A 1UW4A 4ICLA 3CCMN 3O1WA 4F02A 3FE1A 3EZ5A 4DF8A 3F44A 3BBCA 2BANA 4KHPJ 2UUCF 1MA9B 2WOMA 1BI4A 4CJ5A 4JI1J 2GV1A 3MEDA 4N56A 1ZBFA 4YQWA 4ELVA 1M5HA 4I69A 4IRKA 1U1KA 1SC3B 2C3PA 3I0RA 2ZEJA 2VQEF 1UJ5A 4BRLA 3AOCA 1ATRA 2YWKA 3H5YA 2IDEA 3CJKA 1FFGB 4RX6A 1FHTA 4B3TF 3QAEA 4TLRA 3KNGA 3P31A 3H46O 1ZAXA 4CIGA 4JN4A 5AQXA 3QLHB 1CQMA 1WG4A 3PUFA 2CQ0A 4DX5A 2HMPA 1C6VA 2IJRA 3POTB 1C0UA 2YX4A 3KWIA 3BB5A 1LOUA 2BA9A 5KFMA 3M1VA 4DV2J 2A3ZA 3ENBA 3F2KA 3VPZA 4CJLA 4JI6K 2FSJA 2GAHC 2ZGYA 5L46A 3NS7B 2WW4A 3KG4A 3V2UC 1X5PA 3T5HA 3OYBA 3I32A 2HIYA 4JI2J 1HKCA 2ZH1A 4RW4B 5HATA 4N8NA 5FD1A 2OTLN 4A2AA 2O8CA 2CPIA 2VB6A 3TQEA 2V8DA 1FTCA 4CZIA 4U7BA 2J8SA 1L3KA 4X65K 4KB7A 1DURA 3RMDA 1N5TA 4OJGA 1FEEA 1FXLA 4X64K 3G4SN 3EO3A 1RT3A 4RW6B 2F8SA 2L9WA 2Y1LB 3PIOQ 4RNMA 4FWPA 2YPZA 2V4JB 1NOYA 3DGVA 3HHLD 3O3LA 4KH4A 4OYMA 3LPUA 2OI2A 1NGCA 4ECQA 2XCPA 3VHQA 4QU7A 1XI1A 2HBYB 2D3OR 2DNQA 3G8SA 4DV4K 4CEFA 1JLFA 2XYGB 3DNCA 2B43A 2PN6A 3WNGA 2YH1A 1QAIA 2P1JA 4FJNA 4CO5A 1U0HB 4PABA 2QFIA 2VDIA 1N88A 5M1FA 3I56N 1VC6A 5B08A 3S01A 5D6GA 2V68A 4XPCA 2WVBA 3PX4A 1IBLK 3ICLA 2E1ZA 3ZZRA 3THYB 2LU2A 5CA5A 2QLWA 2AT1B 2JRSA 1VSFA 2I38A 1M1KO 3IFEA 4DR4K 5M1NA 3N9UC 1TMJA 4KT0C 2WVDA 4O3RA 3A3NB 4ID8A 3AJ1A 4PXDA 1HBNA 1T9UA 1YJTA 3SCXA 2QYGA 4EO6A 4CVNE 1NSAA 1FDDA 2V8PA 3I5BA 2DY9A 4HH0A 1R31A 2IJFA 1U8WA 4DG1B 4QWAA 3DGPB 3H20A 3OVNA 1F9FA 1JLQB 4ZVQB 4DR5F 3QRPA 3NH0A 3RSEA 4BC4A 4A62A 2CNLB 2CPHA 3CCUS 2VUGA 5KFFA 4MK8A 1H7XA 4B9SA 5CD4H 3AVIA 2AYBA 4DV6J 1ZA2B 4NLBA 3CCUN 4OX6A 3CJ5A 3RMAA 2FJAB 2JWLA 3IKMA 1RT7B 4M63C 4M3TA 1H7WA 4MDAA 2KI2A 3C15B 3VGUA 1PG5B 2NRWA 1W7WA 3HFKA 3MAAB 4CIFA 2XS7A 3MURP 3QQCD 1QVGR 2E5IA 2AHOB 1U47A 1Z6RA 2E1PA 4LF6K 3QPIA 2QA1A 4CFBA 4P7VA 1XMQJ 5F9NA 3MN5A 3B4DA 3PTWA 1T9WA 3F9KA 5KFSA 4HT7A 1H1VA 1RAEB 3R1XA 1WF1A 4Y28C 2RU9A 5AQRA 3J7YP 1AROP 1AZSB 5FLXO 1KLNA 4WFXA 3B78A 4Q0BA 3GV8B 2BKNA 3OXGA 2B9EA 5J2NA 4X4TA 2WW8A 4JI5K 4EHUA 3E9PA 3ELHA 4BC7A 4KAIA 3B8HA 2O01C 3CM6A 1CC8A 2XZDB 4CO0A 2ZDPA 1TUVA 3ILJA 1VQON 3EM1A 4LSLB 2W8KA 1VAZA 4Q2MA 1FD2A 1TL4A 1NGGA 3W66A 2UUCK 1W2IA 2E88A 3W1YC 2JOQA 3H5UA 3G96A 5L1IA 5ETOA 4WU3A 2MQPA 3PW5A 2A42A 1CZ9A 4OZ0A 2GQ2A 4H0PA 1SV5A 2XO7A 1H74A 4BWMA 4KKOA 3K7RA 4AHRA 4H5RA 1SL2A 3KFWX 4U7UK 1E6VB 3WBZA 2AJ0A 3G9CA 4CZHA 2IC3B 2VQEK 4RNFA 5CCLA 2KXFA 4J7CA 2OMOA 2DFFA 1TL1B 2OTLS 5BYQA 3L6QA 3VAHA 2VKZG 1WSHA 2VICA 3SAGA 2AW0A 1HBMB 3QEXA 3L2VA 3LDPA 3CF5L 3NP5A 3C15A 3BF3A 2LDYA 2Z58B 4I0WA 3U1LA 3T19A 3MM9B 2X7IA 2CQPA 2W2PP 4BACA 4DL5A 3IMQJ 3CJKB 2V2VA 3NWGA 4ANEA 2P9LA 3QGGA 4XEIA 3OL9A 1CC7A 3PIPL 5LSOA 2IIHA 2GMLA 2DFHA 4GV3A 4C0OC 3PW2A 4RW8A 2LP4A 4DCJB 4UTGA 2ALYB 3GZ7A 4YHHK 5ETSA 1VR6A 3O5BA 3FMWA 4AHUA 3Q89A 3WXLA 5KG6A 2M3DA 1RDWX 2V2ZA 2FD2A 5GVQA 3H6EA 5HVFA 4JKGA 5C24B 1WSVA 2GS8A 3SV4A 1HBNB 3TSUA 2VG6A 4HDGA 4DUZF 3UKUA 4YNQA 4QW8A 4KR0B 4KGKA 5MLCV 1JJ4A 2XZTB 1JL1A 3KK2B 2DCLA 1Q18A 4OHXA 2FHKA 2HGMA 4M63A 4UQGA 1DGKN 2IVPA 3DLLL 3T9ZA 4I67A 2AEMA 1VBZA 3HSJA 1DQAA 3TABA 2DHHA 2QO3A 5E3AA 4ZLNA 1YJNS 2P9IB 4IEEA 5HK4A 2FYXA 1WC5A 1RBTA 4FNIA 3C6HA 3HHKA 3N0VA 2VYPA 4MKVA 1EWQA 3MUVP 3IO1A 2AGQA 2EK1A 3IWNC 2AV5A 2OSQA 5GADI 5C7PA 3JAMU 1S4EA 4LVOP 3CQ8A 4EMDA 2OPRB 2YNGA 4I7FA 3EMTA 2M9KA 3QETA 5AQNA 2Y3YA 4IFVA 4HUGA 3GYGA 2NZTA 1J27A 3RGIA 2VBWA 1R0BG 3PACA 3RYLA 5BPLA 3M2RB 4ECVA 2L9DA 3CCES 4EIAA 1FERA 4KI4A 3KLEB 3G87A 5D3GA 2CG8A 3ET6B 4FZYA 1T9YA 4DTNA 4NLDA 4NXNF 5FPEA 4NXMK 1U8SA 3FNNA 2C3OA 4E8UA 1NNEA 3OHBA 4CLZA 3J7AN 2RDIA 1WAJA 3UE5A 5AQFA 2O8EB 4WU2A 4QAGA 1WAFA 2ZC4A 2HHSA 3WHIA 3K57A 5GAEI 3TUZC 1NBWA 2RF2B 3AA9A 3VALA 2W4PA 2P9UA 1T03A 2O66A 4CHPA 1PJ5A 4ILLA 3HI0A 4KBIA 1FTRA 1ESVA 3O4NA 3EX7B 1KP6A 4KFBB 1IN0A 4BQLA 5IV4A 5B0CA 4W5QA 4A59A 5HRSA 5AJ3J 4GKKF 1HRHA 5J1NA 3KDNA 4FJMA 2ZJQQ 2H3GX 4DR7J 4PZVA 3OYCA 3ZSVA 1ZPVA 4PPDA 2HRYA 3KOAA 3OA9A 4Y2CA 1XK8A 1TKTB 3R7NB 4WE1A 3DAWA 2NLWA 1D9FA 4WIQA 4HHUA 1YG0A 1VIXA 3HHLB 3IS9B 4CJFA 2Q3PA 3ETOA 4ED4A 4EYIB 1VQLN 2XHWA 4XAKA 3RMBA 1GLEG 4QBUA 1N36F 3G82A 3SYZA 1FDBA 5DQGA 1R59O 4U9RA 3PSFA 2MZTA 4F50A 3CCWA 1IH7A 3S3OA 2YWGA 4GKJF 4CJEA 4O4GB 1L3VA 2HHUA 2QI2A 5AZIB 4CHZA 2NZCA 1T8EA 4EEYA 2Y8WA 1RSCA 5F8LA 3PR4A 2G2YA 2UYTA 4B3MK 3FEYB 3MMCB 2YTCA 2F8HA 3ZSWA 1V4SA 1QQNA 1RT6A 4P73A 3NGZA 3KHYA 3KIOA 1F1BB 1B9FA 2XMJA 2PYLA 2ZH9A 4FLYA 4ED0A 2RE1A 4DPXA 3WNHA 3TZXA 3EWGA 4RW7B 4Y1CA 4AHCA 4IWVA 1RHUB 4DX8H 5IXUA 1TFWA 3DI6A 4JB8B 2UUWA 4EK2A 3CPWR 1GH8A 5GAGU 1A5XA 2Y8YA 1Y5IB 4ILRA 3UR0A 1KR4A 1RQ0A 2QW9A 3LL3A 2HBKA 1RT6B 3AT1B 5B0FA 4DLEA 4B9MA 4CLLA 2GJ2A 3U27A 4UY8T 5AQSA 2KM8C 3RRHA 3CC2N 3M6GA 3VGKA 1VQ6S 2FBVA 4NCAA 3SQ0A 4IFYB 1TP7A 2BE2A 1F2HA 4OKJA 1BWVA 3W64A 3IC1A 3AVCA 1BA1A 5D4OA 1S6OA 1ZBHA 1S7HA 1T05B 5A2QU 5ETNA 1EXQA 1FO1A 1YBTA 3N79A 1R8CA 1HW8A 4M5NA 4YOEA 4M3UA 5KOWA 4CNZA 4ED5A 5TKYA 3OYKA 3EZUA 2P9LB 3IAYA 4AHVA 4NOHA 1S1XA 2Z2LA 4EWTA 4IFYA 3TX8A 1NGAA 2EFQA 4FLTA 4K0KJ 2DGTA 3SV3A 1NJZA 3KLIA 1VIOA 3J7Z5 4J2DA 3MR7A 1YBUA 2CDRB 3R5AA 1HNIA 4NRTA 3V81B 2CZVC 3FSYA 1RT7A 3I4HX 1S9GB 4CHNA 1SIZA 1A7GE 1HI1A 4F9OA 4C8ZA 4OKKA 4CJRA 1D3WA 2QN6B 2QYCA 3BZQA 2BX6A 3PVXA 3JSRA 1HQUB 1TTHB 4CW7B 1ITGA 5I3UA 4DL7A 4B1VA 4LMZA 1Y11A 3MAQA 4CEQA 3AA5X 4RW7A 2CPFA 2W6KA 1LWEB 2QGFB 4A8WA 3W62A 5M1KA 4NLXA 1FF2A 1TK8A 4LH5A 4ZP8A 4M94A 1GLBG 2VA2A 3VV2B 2HHWA 1B0TA 4HTUA 5KG7A 4KTQA 4YB1P 4Q0BB 3OS0A 4DB3A 1VRUB 4B1WB 5L1LA 4GKKK 2CGJA 2WZ1A 3ITHA 4OX9F 3NNHA 4BRGA 5CYQB 1S0MA 1UZHA 1MMLA 4QZVB 2MSSA 1L3TA 4NLQA 3DM2B 4P7TA 1X1PA 2G8VA 4QWBA 1FX4A 1QAXA 3UIQA 3H2LA 3L2QA 4NLGA 1RBAA 2OLWA 4X65J 3SCIE 3O9RA 6FD1A 4A2BA 4AD6A 3QT5A 3PZPA 1Q82O 3RAXA 3UE2A 3TAQA 1CJVB 2DGSA 1UAWA 3VGMA 1HYSA 4DTXA 5F8HA 3R7SB 5KOXA 1D1UA 1DJ0A 4DEZA 4ED1A 2IVNA 1HHTP 2B4JA 1VJQA 3KLFB 3QIPA 3QEPA 3N4WA 1BQNB 3CFRA 4E1NA 4FS2A 5AQYA 3R2DJ 4CFCA 3ZXWA 4CGJA 4FM0A 4K4ZA 3ZEUB 3CD0A 2G0JA 1R6YA 3KG1A 3BREA 4FYWB 5K20B 1T7PA 3H4BA 1HUXA 1VQNN 2ZBRA 3LTOA 1OSCA 2GX9A 3BGFA 2C2ZB 4A8XA 3R1HA 1N34K 4MYTA 3Q7BA 3U1MA 3I0SA 4J9LA 2LQJA 3MTJA 4A8MP 4ZJLA 3SDEB 4O3PA 3NAHA 5KG4A 3O1BA 2PEBA 4ID5B 4QS9A 3QSYB 3HM8A 1LWXA 4CBXA 4G3IA 4NA2A 3C8YA 4H0TB 4JI1K 3C65A 2CQGA 4EP4A 3A5MC 1X4HA 4F3TA 1C1CA 5C2DA 1Q86O 4CO1A 5D3GB 4DFMA 4GO7X 4LF8F 4FVUA 3G6VA 3AVKA 1Z1ZA 2IA0A 3UB5A 2ASJA 3OYMA 1PC4A 1ROFA 3OD2A 3ITHB 2KG0A 1F5BA 3EUNA 2KYZA 4O44A 4AL7A 3RAQA 3I0RB 4YOYA 4IG3B 1RAFB 4FF3A 3OQ2A 3CVKA 4OYPA 1HNWJ 1TL1A 1B3TA 2EC0A 5BJRA 3JYTA 4KQZA 3P49B 2EG1A 4E2FB 2Q6BA 1MDUB 1E6VA 3OL7A 4OV1A 1LEOA 3EZWA 5ADXA 3GILA 1BA0A 3WXMB 4XDDA 3CJBA 3ZETB 3BKTA 4FO0A 4FZZA 1ZETA 1IM6A 5IT9O 1VSHA 1N8RT 4DV3J 2FJXA 2E7WA 4MIWA 5BXIA 1SPBP 4MAKA 2K1RA 3OJSA 3O6WA 1W7AA 2DIVA 3RRGA 3EPGA 4F3MA 3GSDA 4CJPA 3FFIB 3BUZB 4O5FA 3VQ9A 2B51A 4RPFA 3GBTA 3ZTRA 5G4DA 3DXKB 4RW4A 3BGLA 4Z4CA 3AA4A 2KRBA 4LF4K 2XSFA 1HQEA 4RU9A 3SUNA 1RHKB 4L8RB 4RW8B 5FPDA 4FBTA 1YQHA 3R2CJ 1BGXT 1C4CA 1GEHA 2LVWA 4OJHA 2FHOB 3GJTB 3QBXA 2R8IA 4WFAQ 2HRTA 3O08A 4DF4A 4CZEA 1RT1A 2UUTA 2YWHA 2BABA 5GMDA 5HQLA 4DSIA 4UUWA 2LMIA 3CCMS 1FKAF 2KHCA 3SK3A 3IN5A 4Q8EA 2GW8A 4BGBA 4OI3A 1MWKA 4QU6A 1KVCA 3MPVA 4KY3A 2ZNYA 1HHSA 2ILYA 3WIUA 1UZDA 3OW2M 1HMVA 3LQVA 3D1QA 5H1SQ 2HRUA 1NJIT 5H9EJ 4DSEA 1OH5A 3M32A 1JLGA 3AA3A 1FWPA 2MLXA 4LIWA 4FKXA 2HYIB 4MYUA 2WCXA 4RUCA 4WFNQ 1KD1O 3DMJB 2E9RX 5KFGA 3FR0A 4ECYA 3CDEA 2O1PA 3Q24A 2YX1A 4E7IA 4V19J 5I3PA 4IO8A 1N32F 1HNXK 1LW2A 1F5AA 3FBFA 4PQAA 2O8BB 3QINA 1KVBA 2JJ4D 3CI5A 2YKMA 8RUCA 1AA1B 3BDPA 3NF9A 2QIFA 3H42A 2D0PA 4F7VA 3VQQA 5IFMA 1CJKA 2WBMA 3K8WA 1GT8A 1MROA 3KLVA 1HKBA 1AUSL 1Y5LB 2MKIA 4YY3K 2BOAA 1B0VA 3R8YA 1N34J 4NYFA 4DUTA 4EU0A 4N5SA 2AGPA 2GTDA 3M6VA 2VH7A 3MXIA 1UWBB 2FY8A 2XY8A 4DCPB 3QFWA 5KT6A 1FCAA 3M9OB 1OMSA 1C1AA 2G8KA 1C4AA 3L7PA 1JB0C 4IG0A 3K58A 2VPWB 1EO1A 1MSWD 4ECRA 1PC5A 2F4VK 4DLGA 2XULA 2NUUG 4K5RA 4AILC 1P1LA 4B1UB 3UO0A 3OR2B 2CJ9A 1BHNA 1SBRA 4WQ5C 5IC4B 1K8AT 3MDFA 2ZD1A 4BR5A 1JCGA 1QSSA 3THTA 3TVKA 5AE1A 2RILA 4Q8FA 2IHR1 1TK5A 3F5TA