3KLEA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to a dsdna with a bound excision product, aztppppa
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
560
structure length
560
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 142
structure length 560
sequence length 560
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kleA05
4DL6A 1SH2A 3AO4A 3LANA 4NCGB 1S6QB 4DF4A 5DG8A 2YKMB 5KFJA 5KFWA 2XCPA 4M3UA 2BDPA 1ZTTA 2W7OA 3GIKA 3TR8A 4KKOB 2OPQB 4O55A 1IKVB 3NAEA 3BGRA 4CFDA 1EETA 4HVJA 4IRKA 4ZVEA 4YMEA 1LV5A 2CJQA 3GIMA 4KB7A 5KG6A 1WSHA 1R0AB 2BQRA 3DLBA 4AHRA 4URSA 2FBYA 3OLAA 4ZMMA 1O1WA 1QE1A 1HMVA 1S1TA 3ICLA 3KLIA 3KJVB 4K4SA 5FDLB 2QV6A 3V6DB 4HKQA 3IAYA 2IA6A 3C94A 4G1QB 2KQ2A 4YQWA 3QNNA 3OVNA 3AVLA 3OL9A 1ZBUA 1SKRA 4Z4EA 1RBVA 2Y1JA 1BCOA 5L9XA 3RAQA 2V0NA 4DSEA 4QPXA 4IDKA 1XR5A 3VQ6A 2W8LA 1LW0A 1RTIB 2JEGA 2C2RA 4FJXA 1N5YA 1TVRA 1N56A 4YR3A 1TAQA 1U48A 4RW8A 4IH5A 1NK4A 4OGCA 2BGGA 1IM4A 5KFUA 1F21A 1SUQB 1S9FA 2WTFA 3AO1A 3AV9A 3KLEA 4I9QA 2DFFA 2B43A 3AVFA 5F8LA 3HP9A 5L1IA 2P5OA 3ZCMA 4DL7A 4WFYA 4DL4A 3IN5A 4GW6A 3DRSB 4AHSA 3RMCA 3K58A 1RTHA 1S5JA 4FLVA 2IAJA 3CWJA 2YKNA 1VSFA 1LWCA 2XRIA 3CJ2A 5C42B 2G8KA 3GV5B 3FQLA 2PZSA 5K14A 3JSMB 4FBTA 4EZ9A 4IFVA 4Y3CA 4FLTA 1HQUB 1RA7A 3CJ4A 3CJ5A 1NKCA 2IDOA 2QXFA 1UA0A 1VSHA 1HNVA 2I5JB 4BDYA 3VQBA 4DQPA 4MKAA 5F8IA 1TK5A 2HW3A 4CFBA 3IRXA 1YTUA 2LSNA 4CECA 5CYQB 2RN2A 1TK8A 4MK9A 1L3TA 2AX0A 5KFDA 1ASUA 4GVMA 2XGQA 3QEWA 1IG9A 3PJXA 3KHHA 3ZSYA 3LDSA 2I1RA 2R8JA 2W42A 2E4LA 3OYKA 2IM1A 4CJFA 2G8UA 3DRPB 4KFBA 1C1BB 1YTAA 1QSYA 1RT5A 4CIGA 3KHLA 3RB4A 3H5YA 3M9OB 4RNHA 3ISNC 2J6TA 1WAFA 4E3SA 3DOLA 4HHTA 3MEEA 2DPIA 4WYLA 4U7CA 2HHWA 3FRZA 1EP4B 2B4JA 3KHGA 3TAGA 2HNZB 1MMLA 4JV0A 5SWMA 4F8RA 5JUMA 3OYGA 2KTQA 1S0NA 1ITGA 4TLRA 3CM6A 4NRUA 1S4FA 2OPPB 1A5XA 5KG0A 4OKKA 3BDPA 4FW1A 3MXMA 4DTOA 1C1CA 4FLZA 2Z1GA 4ECSA 3MXIA 5L1KA 2W9BB 2OZMA 2C2DA 3ZT0A 3NAHA 5J2QA 3CDUA 4NRTA 4H4MB 3LP2B 3NFAA 3PR4A 1S97A 4Z4CA 3DOKB 4RNOA 1WNEA 4EP4A 1A5WA 4IH6A 4FJ7A 4ECZA 4EO6A 4ECXA 3IG1B 4KV8A 3VQQA 2J6UA 1FKPA 1VRUA 3OYHA 1QTMA 4DSKA 1NJZA 4URQU 2RDIA 2JEIA 3QZ8A 4CJ4A 3T5LA 4URGA 4RW4A 3QNOA 3K5MA 3FSIA 4ZTFA 4OJRA 3RMAA 1BQNB 2X6SA 1HNIB 1SV5A 1DTQA 3CQ8A 4Y2CA 4O0IA 3RAXA 1JLEA 1RDCA 1VRTB 4B9UA 4KBIA 1S10A 2O4GA 1LW2B 1J54A 1UAXA 5KG4A 1TKXA 3TARA 4MIBA 4OLAA 4NLQA 5KT5A 2JC1A 3DRRA 3CO9A 1KVCA 3LWLA 3NH0A 4HTUA 4CEDA 4CHYA 2HNYA 2OA8A 2Z1JA 1WSGA 1YT3A 3SZ2A 3QGHA 3BJYA 5DLGA 3GIIA 5FROA 4OL8A 1S0MA 4FVMA 4TSXA 4I2QB 4K50A 1I6JA 1RT2B 4EEYA 4TQSA 4CGIA 2ZD1B 5HRPA 4B9VA 5F8MA 1TL1A 3Q8SB 5EWFA 4DLGA 3KHRA 1TKDA 3ZT4A 1RTJA 1WSEA 1DLOA 3QERA 1JKHB 4J2EA 3M8SA 4E7HA 4RNFA 3MR2A 2YNFA 4ECYA 4FS2A 4NLGA 1WLJA 4E19A 3TAQA 5KFQA 5HLFA 1S9GA 2GC8A 3ZT3A 5I3UB 2E6LA 3KLHB 4ZP9A 3C6UB 2NUBA 4QCLA 2BE2A 1N6QA 3UDLA 3TAPA 1NK7A 3DYAA 4KO0B 4MKBA 2W9CB 1RTDB 1YVUA 4B3OA 3TAMB 1D8YA 3V81A 2X78A 2XY7A 3KIOA 1BI4B 4MK7A 4J9KA 3KLFB 4CHQA 3TAFA 4DL5A 4TY8B 5DGBA 5EDWA 3OSNA 2QE5A 3SCXA 4DTJA 4KHMA 4IG3A 4FK0A 2AGOA 3KK2A 4PUOB 3L2UA 5KGXA 4RW6A 2AGQA 2FVRA 4CJ3A 1QUVA 1T94A 3VN5A 4F2RA 2KZZA 3T3FA 4FK2A 2IJNA 1J5OB 2OH2A 3N6LA 4FK4A 1NHVA 4CF0A 5C5JA 4Y2AA 1U49A 2Y1IA 3VA3A 5J2MA 4CJRA 1MU2B 2R8GA 3TQ1A 1N48A 4R8UB 3PJWA 3FFIB 5KFNA 3SQ1A 1RT3A 4CIEA 3OJSA 1RT7A 1BQMB 4Q0BB 1QS4A 3I0SA 3RB6A 3L2QA 4R5PB 1EX4A 3HT3A 3SFGA 5SZTA 4GC6A 4EBEA 3OYAA 4IR9A 1XC9A 5DQHA 1JLFB 1SH3A 4I2PA 3KLGA 4C8OA 2WONA 4JV1A 5L1LA 4I9LA 2D5RA 4FM0A 4NLVA 2OZSA 2VG5A 1VSLA 2ETJA 3HPOA 2P5GA 3NH1A 1JLAA 1KCFA 2Z1IA 3OY9A 2OPRA 3ZSWA 5J1EB 4K4ZA 1RDRA 3GIJA 4ZPDA 1TV6B 3KOAA 2V4RA 3KMQA 3SYZA 4CFAA 1NOZA 1JLQB 3PY8A 1NK9A 3DMJA 4EBCA 3M8QA 5DMRA 4E7IA 1WN7A 1KLMB 5J2PA 4DU3A 4B08A 1GX6A 5KI6A 5I42A 3PHEA 2R8IA 4NLOA 2HNDA 3NGYA 3LP1A 4W5TA 2HVHA 5DQGA 3I0RB 5F8JA 4NLPA 4CF1A 4IG0A 2HMIA 1NOYA 1CZ9A 4KTZA 5EUHA 1B9DA 1CSJA 4BE1A 4K8XA 4J9RA 2AWZA 1FK9B 1ZBIA 5HROB 3ZSZA 5HRSA 4RW9B 4M45A 2XI2A 4KHUA 2UVVA 3SQ0A 3P5JA 3NBPB 4DL2A 4FW2A 2FJVA 3O4NA 2YKMA 4IBNA 3RWUA 4O4GB 1C6VA 1JLBB 4F4KA 2G8FA 3SV3A 4N47A 4Q43A 1WAJA 2ZE2B 5KFVA 1RBTA 2P51A 3M8PB 3BR9A 3AVBA 4OPKA 4N56A 4HUGA 4DFKA 3HJFA 3SPZA 2KFNA 3K57A 3QEIA 4RZRA 4LSNB 3U3GA 4QOZB 3CVKA 4JUZA 2FVQA 1RT4B 3WNHA 2D3ZA 1LAVA 5L1JA 3SQ2A 1D1UA 3RR8A 3PR5B 4ECWA 4OKJA 2ATLA 3IS9B 3D5MA 3GV7B 4DG1A 3MECB 3QO9B 4MQ3A 2HWIA 4B8CA 1HJRA 4DQIA 3MR5A 3SI6A 4CGFA 3WNGA 4JV2A 3LAKA 4ZHRB 3FDSA 3HKWA 3G10A 1S1XA 3PUFA 1KVAA 1ZBHA 1C0UB 5DG9A 1BIZA 4CJVA 2OYQA 1S6PA 3T5JA 3H5SA 4FJ9A 5C25B 4Z4FA 1T03B 3OL7A 3MF5A 4JS5A 2FVCA 2DFHA 3E01A 1ASVA 2FC0A 3DLEA 3HVRA 5CY4A 3SV4A 1RBRA 3L3VA 1KSPA 1JX4A 4MFBA 4E89A 1TQLA 4EO8A 2IBKA 4KTQA 4E1NA 5KFTA 1QHTA 4FBUA 4LSLB 3VQSA 1SUQA 4ED6A 4ZPBA 2RF2B 4ID5B 4DTNA 4CGGA 3E51A 3PW7A 4IR1A 3PV8A 4JLHA 4FLXA 3RBEA 3ISND 5KFBA 3DM2B 2OPSB 1WSIA 2WOMB 3SUPA 2R2RA 1TKZB 2CKWA 3G6XA 4F3OA 1LWEA 4NCAA 4B9NA 4QWEA 3BREA 3NF6A 5C42A 5HRNA 3KKRA 1SL0A 1GOCA 2XI3A 1BCMA 3BGRB 2FJWA 4FJ5A 2IJFA 1EETB 4C8KA 1GOAA 1WNSA 4B9TA 5KFOA 3SPYA 4CJUA 3TABA 4TN2A 5KG3A 2D0CA 1SL1A 4CHNA 3AO2A 4X2BA 1BL3A 4O44B 4QAGA 3AVHA 4QW9A 4ZPCA 4KAIA 1WSFA 1QE1B 1HMVB 2UVWA 3LAMA 1S1TB 2O4IA 3KLIB 4Z4HA 3HYFA 5HRRA 4ZVGA 3OL6A 3B6PA 3U3YA 3LP3A 2PYJA 2V9WA 3CFOA 1NJWA 3BSNA 3VA0A 3PX6A 2ZKUA 3QESA 2GUIA 4EYIB 1D9FA 4O3NA 3ASMA 4KHYA 1J9AA 1XR7A 4H8KA 2YNIB 1I39A 2HB5A 3V4IA 4IDKB 4LQ3A 1NNDA 4J2DA 1HQEA 2HHQA 1T05B 3PW4A 1N5YB 4J2AA 3GYNA 4DL3A 1TVRB 1FKOA 5J2NA 4K4WA 2BR0A 2E9ZA 4RW8B 2W7PA 3AVNA 4Z0UA 2B6AA 5F8NA 4CJKA 3DRPA 4KTWA 3DLRA 4NYZA 4CJ5A 4DF8A 4M3TA 4DTRA 3KLEB 4RW7A 3KK3A 4EBDA 4FJMA 1L3UA 3ITHB 3T5HA 5KFEA 4EP5A 1UWBA 4W5RA 4DSJA 3KD1E 3ALYA 4RG8A 4DEZA 1RTHB 2IAJB 4J9QA 2YKNB 1BISA 1LWCB 4BE2A 5DLFA 5JS2A 4DMNA 4DTXA 1TP7A 2HNZA 1QAIA 1C0MA 1NKBA 1TKTB 4ECUA 3QLHA 3NGZA 3H2LA 5KFLA 3LZIA 3NE6A 2E9RX 1LWFA 4KSEB 2UVRA 2FVSA 4FM1A 1IO2A 1HNVB 3AVKA 4PWDB 4Q44A 4LH5A 3V6KA 1KHWA 2HAIA 5KT3A 2W9BA 1XWLA 1IKXA 5DQIA 4J9LA 1IKYA 1KTQA 1CLQA 3DLGA 4Q5VA 3GQCA 3DOKA 1UA1A 3IRXB 1RAJA 1T8EA 3RMBA 3IG1A 4RU9A 4IFYB 4I7FB 4AHCA 3MFHA 2WHOA 4KHRA 3RMDA 2QKKA 4O3RA 4E1MA 4F50A 4CK2A 4YR2A 5DG7A 1QSSA 3C95A 3NGDA 4ZTJA 3I5BA 3PW5A 3ZSVA 5KRTA 3QIPB 2VA3A 1L3SA 4EZ6A 2GIQA 4DS5A 1W25A 2AQ4A 4IRCA 1NJYA 3SJJA 4B9MA 1RT5B 3V9SA 3L2VA 1LW2A 3NKYA 2Z1HA 1KFSA 2BRLA 1X9SA 3KMSA 5C24A 4DSLA 3DOLB 3MEEB 4FLWA 3F73A 3MFIA 2VWKA 4MH8A 3TAEA 1S1UA 4WXWA 1RT2A 2AU0A 1FXXA 3H40A 3V9WA 3G0ZA 2R7YA 3ZSQA 2UVUA 2XO7A 3BSCA 1D9DA 4IH7A 1HYSA 1C1CB 3KKSA 4DQRA 3BQ1A 2RKIA 1REVA 4FJLA 3S3OA 4FYDA 4HCCA 1Z25A 4ELVA 3ZSXA 2AX1A 3MTKA 4F4YA 1RDBA 1KFDA 4ZVFA 3KD5E 5CYMB 3KLHA 4R0EA 5HP1A 3QGGA 4PQUA 3H08A 5KFRA 3UQSA 1QSLA 4KV8B 3C6UA 2GV9A 5KFMA 3S3NA 1FKPB 3BQ0A 1VRUB 4YFUA 4WE1A 4Y34A 4OGEA 3MEGB 3RRGA 3VQ5A 3HL8A 2W9CA 4H54A 2IGIA 3OYIA 3KLFA 4G3IA 3IGNA 4TY8A 4DFJA 2WK4A 4Z4GA 3DI6B 1JLEB 1U04A 4AHTA 4MIAA 1HYZA 4Q8EA 4DU1A 2UUTA 3AA5X 1D5AA 4Q45A 3PW2A 5KG2A 2YNGA 2HHVA 1TKXB 3HPHA 4OVLA 3TWHA 1JLGA 2D0BA 3OYDA 5JXSA 1JXLA 1VSKA 1J5OA 2VG6A 1HPZA 3TANA 4FS1A 4CEEA 3SQ4A 1S49A 3D0PA 4KI4A 3JYTA 4LQ9A 4ECQA 1VSMA 3CDEA 4FJHA 2FLPA 2IM2A 1BQMA 2ZQBA 4Q0BA 4NLUA 1TL1B 3PO4A 4RNMA 1DTTB 2BANB 3VQAA 4CIFA 1JIHA 4DU4A 4CJPA 1RTJB 2UUWA 2YNHB 3CIZA 4Y1DA 1DLOB 3MXJA 4ED1A 1NK8A 3NAIA 1JLCB 4CF2A 2YNFB 4FJNA 3DLKA 1B9FA 5HLFB 1S9GB 4C8NA 4PY5A 4QWDA 5EWGA 3ZT1A 5KFCA 1RDAA 4DTSA 3C6TA 2G8WA 1QAJA 1X9MA 1S0OA 4NLSA 1K1QA 2BE2B 1N6QB 3WNEA 3OYBA 5F8GA 1L3VA 4IKFA 5HBMA 4RUCA 3QEPA 1BGXT 3CG7A 3AA2A 4B3OB 1TK0A 3V81B 4CESA 5JS1A 3N6NA 2JC0A 3IGVA 1TL3A 1K1SA 4GMJB 4IG3B 3OYCA 2DTUA 4ICLA 3O3GA 3KK2B 4AHVA 4CGJA 3L2WA 3QINA 2HHSA 2IC3A 4K4VA 4CK3A 3RR7A 3DDKA 2WB4A 1S1VA 2YV0X 4HUEA 1TAUA 1NK0A 1RT1A 3OYNA 3BSAA 1RDDA 3LP0A 3HK2A 5KFKA 3OL8A 3NBPA 1K6YA 5J2MB 3LALA 3F9KA 4DSFA 4KB0A 1VSEA 1NJXA 2B5JA 2XY8A 3LPUA 4O4GA 1RCHA 1RT3B 2BQUA 3AVIA 2ILZA 1SKSA 3I0SB 3AVGA 2ASDA 4CEFA 2IM0A 4DSIA 2X6NA 3M8PA 3K5OA 4N5SA 4W5NA 4XPEA 1S1WB 4C8MA 3HVTA 4I2PB 5EWEA 3KLGB 4IOBA 2D3UA 2WONB 4LSNA 3HHKA 4FZZA 3KK1A 1Q8IA 1YVFA 2D7SA 2JEJA 1W9HA 1RT4A 4QWAA 3Q8QB 4NYFA 4XIUA 1NK5A 2VG5B 3HO1A 2EHGA 4W5QA 3V6JA 4HYKA 3SUNA 4FLUA 1RT6A 3H4DA 4CEAA 1JLAB 4NCGA 2OPRB 4NLRA 3CYMA 3SUQA 1S6QA 3MEDB 3AVJA 2FLNA 2IM3A 4WZMA 4DTMA 2HHTA 4NLYA 4KHWA 3AO5A 4KKOA 2IOCA 2OPQA 1IKVA 4ZHRA 3OS2A 1IKWB 1S9EB 3ZT2A 3HVAA 3DMJB 3OHAA 3M8QB 5D3GB 4H4OB 4GC7A 4KB1A 5J2PB 3SNNA 3HP6A 5C25A 3VQ7A 1T03A 1R0AA 4K4XA 4OPJA 2KFZA 2HNDB 3QZ7A 1JXBA 2VWJA 3LP1B 4FZYA 3V1QA 3GILA 1BHLA 1QQCA 3HVWA 3KJVA 4WFXA 4E7LA 4IG0B 2HMIB 2ASLA 3AO3A 5FDLA 3EY1A 3V6DA 3UPFA 4KI6A 5KGWA 5KG5A 1TGOA 4K4TA 4G1QA 3VQPA 3I5AA 2XWYA 1CZBA 3K2PA 3VQEA 2OPSA 4M3YA 1TKZA 1KLNA 3VQ9A 2EC0A 5KT4A 3OHBA 1RILA 5KRSA 1RTIA 5KFGA 3N6MA 4ELUA 2VG7B 3PX4A 3AVMA 5KT7A 3EPGA 4ZP8A 4CJLA 2XCAA 3QETA 3MR3A 1C0TB 5F9NA 4O44A 4QW8A 1JL1A 2ALZA 3H5XA 2V4QA 4IQXA 4LD0A 3DRSA 1N4LA 2HHUA 3HPGA 4DG1B 3SFUA 4B9SA 2JGUA 3PO5A 4KPYA 2FBXA 2C28A 4LH4A 4KRFA 3JSMA 2WCXA 3LWMA 3P1GA 1S1XB 2WRMA 4TY9A 2G8IA 4CF8A 1HQUA 4U6PA 4CGDA 1S6PB 3OLBA 2YNIA 3VQ8A 2I5JA 4Y1CA 1T05A 3E01B 1XI1A 1U47A 3DLEB 3H5UA 4ID1A 1S48A 4MFBB 4NLTA 2W9AA 3HM9A 1ZYQA 3OYMA 4YR0A 1ZTWA 3K5LA 4CK1A 2DPJA 2PY5A 4BWJA 4ZPAA 2XY5A 3ITHA 4F4ZA 5KFIA 4CHPA 5CYQA 1HRHA 1LWEB 2DY4A 2IMWP 4LY7A 4FJJA 1KRPA 4C8LA 4ED8A 1EKEA 2KW4A 4TYAA 3QEVA 3QIDA 2FLLA 2R8KA 1LW0B 3AA4A 3SI8A 3G6VA 3NL0A 1TKTA 3RBDA 5KFZA 3OS0A 4B9LA 3TI0A 3PZPA 5KFXA 5CZ2A 3K59A 1RBUA 4FJGA 2X74A 3UIQA 1C1BA 4CEBA 1C1AA 3AA3A 4NCBA 5KG1A 1NHUA 4PWDA 2ATQA 3O3FA 1X1PA 2A1SA 4QWCA 4XO0A 1Q9XA 2FBTA 3CM5A 2JEFA 4BACA 3RTVA 2E6MA 2G8VA 1EP4A 1RA6A 2C22A 5K14B 5T14A 5KT6A 3EZUA 5DGAA 5KFAA 4M3WA 4IFVB 2P1JA 3KLVA 3D28A 2HWHA 4IFYA 4DQQA 2YHAA 4I7FA 4O5BA 1C2PA 4W5OA 4ELTA 3G6YA 5T7BA 1UOCA 2OPPA 1HYVA 3V4IB 3Q8PB 1HQEB 1U09A 4MK8A 2R8HA 3HSTB 4WXOA 4ZP7A 1FKOB 1EXQA 5J2NB 2A1RA 2HHXA 3P83D 3VQ4A 4RNNA 1ZETA 3QIPA 2B6AB 4FM2A 5F9LA 1RYSA 4H4MA 3LP2A 4AHUA 2PYLA 3U6FA 2IS3A 4KHQA 1KHVA 4RW7B 3KK3B 2VA2A 1VSDA 4KREA 2F96A 5KFSA 3NF7A 3NHGA 3GV8B 1UWBB 3UR0A 5KT2A 4O0JA 1JXEA 1IH7A 1RNHA 4J9OA 1HNIA 1BQNA 4NLDA 1RYRA 5F8HA 1VSIA 4QWBA 4EYHB 3PVXA 1GX5A 3QLHB 3NF8A 1U4BA 3EZ5A 4N76A 5FRNA 1XHZA 5DK5A 3NDKA 1VRTA 1D0EA 4KFBB 3OYJA 3ZSRA 4J9PA 1LWFB 1ZBFA 1T7PA 2AJQA 3S3MA 2EX3A 1WSJA 3A2FA 1JL2A 4FLYA 1L5UA 1IKXB 4DQSA 2D0AA 4CEZA 3S9HA 1IKYB 4WZQA 4IKAA 3DLGB 4HUFA 5CYMA 4I2QA 2ASJA 4ZP6A 3NF9A 4OKEA 2ZD1A 4M3RA 4O3PA 4J9MA 3MEGA 3BQ2A 3PW0A 4L8RB 1XR6A 2RPIA 3NCIA 1JKHA 5J2QB 4JS4A 3DI6A 3QYYA 3NGIA 4O3OA 4O3SA 4O3QA 3RB0A 4DFMA 4OLBA 5I3UA 3CJ0A 4Q8FA 4K8ZA 4M95A 5C24B 1Y97A 3MR6A 2QKBA 2JLEA 4XPCA 4RW4B 4KO0A 3OYLA 1RTDA 3BSOA 3TAMA 4J9NA 3AVAA 4M3XA 1SV5B 1BI4A 1S1UB 1CXUA 1OS5A 2GBZA 4KHNA 1DTQB 2E9TA 1BIUA 2DFEA 4FJ8A 4CJTA 3NH2A 2ITGA 1X9WA 3KTQA 4CJEA 1DTTA 2BANA 4PUOA 1RBSA 4K4UA 1HYSB 1G15A 4F4XA 5KFPA 3H98A 4CGHA 5EU7A 2RKIB 1REVB 2YNHA 3DRRB 4FZXC 1SH0A 3QGIA 3QIOA 3ULDA 3VQDA 3D45A 1JLCA 2HNYB 3EPIA 4CEOA 2Q3SA 4CHOA 1T3NA 1MU2A 5HP1B 2YHBA 4PQUB 4R8UA 3V9UA 3FFIA 3K5NA 1ASWA 4FJIA 1CXQA 4TQRA 1Z26A 5KTQA 1W0HA 4K4YA 2XGPA 4ED0A 3RB3A 4WE1B 3M9NB 4E7JA 2O5DA 4PA1A 3MAQA 4R5PA 2GIRA 3M8RA 3WNFA 3B6OA 1KVBA 1Z4UA 1JLFA 1LAWA 2W8KA 2BRKA 2R2UA 3OYEA 4F2SA 3CJ3A 3OSPA 3V1RA 5FRMA 4TYBA 4DLEA 4ECRA 3NMAA 4O4RA 2XC9A 3LPTA 4BDPA 2FJXA 3EYZA 4BDZA 3G86A 2YNGB 5J1EA 4M42A 4AILC 1TV6A 4JRPA 2KZMA 1JLGB 4KAZA 1JLQA 2VG6B 1HPZB 3I8DA 3DYAB 4FJKA 4ECVA 2BQ3A 4ZVHA 5KFHA 1KLMA 4CHZA 3L2RA 4CCHA 3V6HA 3JYTB 3LZJA 4N41A 4YP3A 3T5KA 4M3ZA 4CJWA 4CJQA 3I5CA 4TXSA 4F3TA 5KFFA 4FXDA 5E41A 1B92A 2G8HA 3I0RA 3SUOA 4AH9A 2FVPA 4YNQA 1VK0A 4M94A 4ED2A 4ECTA 2FBVA 4UQGA 3CFRA 1S1WA 4RW6B 4DFPA 4NZ0A 4WFZA 3CDWA 3V9XA 4DTPA 2QK9A 1FK9A 1J53A 5HROA 4RW9A 4RUAA 3DLKB 4DTUA 3TVKA 1HARA 3AVCA 3MEDA 3C6TB 2F8EX 4CE9A 1GOBA 1JLBA 2AGPA 4IRDA 4DWIA 1RT7B 3OJUA 5HBMB 1Q9YA 4BWMA 1IKWA 1S9EA 3ZSOA 2ZE2A 4CFCA 5D3GA 4H4OA 1A5VA 4E7KA 4BE0A 2XY6A 4CF9A 1ZBLA 1U45A 3OYFA 4F4WA 3PX0A 1XHXA 3DLHA 3L8BA 1TL3B 3H59A 4CJSA 4WYWA 4ED7A 3HXMA 4ICLB 5KFYA 4FCYA 1SKWA 2ILYA 4J2BA 3V9ZA 3IS9A 3MECA 3QO9A 1SL2A 2IC3B 4E0DA 4Z4IA 5CZ1A 1S1VB 1RT1B 3H4BA 2XHBA 4KHSA 2RDJA 3LP0B 1C0UA 2R2TA 2F8SA 5I42B 3L3UA 2B5JB 1NKEA 4DS4A 4NLXA 3Q8RB 4CEQA 5KG7A 4CERA 2VG7A 3KNAA 3V1OA 3THVA 2F8TA 4JRQA 3OS1A 1VSJA 4KE5A 3CFPA 3T1AA 4LSLA 4J9SA 2HVIA 4NLWA 1I3AA 3HVTB 4ED3A 2J6SA 2RF2A 4ID5A 4M41A 3M9MB 3QEXA 4HCBA 2R2SA 3KK1B 1C0TA 3FQKA 4NYNA 3T19A 3VQCA 2D41A 3O3HA 3DM2A 3RRHA 4B8AB 1NK6A 2WOMA 2C2EA 3O4QA 1RT6B
chains in the Genus database with same CATH superfamily
3BBBA 1N8RO 4WQ5C 2E5LF 3SCKE 5DG8A 2YKMB 5KFJA 2XCPA 3AH6A 2CRLA 2HSEB 2BDPA 4M3UA 4OYPA 3TR8A 3AGKA 2O8DB 3NAEA 4A5BA 2FHJD 3UN5A 3QBXA 4HVJA 3GU0A 5EN1A 1EQMA 3CMQA 2BQRA 2JL9A 3WIUA 3H25A 4AHRA 4URSA 3UD5A 4LR8A 1O1WA 1T6DA 1S1TA 3ICLA 3KLIA 2LQ8A 3W9IA 1X60A 1OYDA 4PZVA 5IC6B 2OI2A 1E6YB 3PRBA 4YQWA 3MCNA 2PMZD 3A12A 3OL9A 1SKRA 1O8BA 4Z4EA 2AZ1A 5MAOA 1NGBA 2HFVA 1A6LA 4LF6F 2Y1JA 3RAQA 4JI1J 1KQSM 4DSEA 4QPXA 4IDKA 1NSPA 2K3IA 1LW0A 4FJXA 1N5YA 1TVRA 1NXIA 4K42A 3NS7B 2ADBA 3SBTA 1TAQA 1AT1B 4IH5A 4OZ3A 2HK2A 5KFUA 2J7WA 1HBOA 1S9FA 4CQ1A 1NDLA 3AO1A 3UD3P 3M2RB 2NRVA 2H1YA 4F67A 3AVFA 3PTWA 5F8LA 5A76A 4E98A 2P5OA 5A8RA 5HMZA 1Q5VA 2YX7A 4DL7A 3ZX0A 1FD2A 3R1LA 1WKJA 3JS6A 2P9IB 4AHSA 1UW4A 2N7YA 4FLVA 3CWJA 2BJEA 4BC7A 4LF8K 4DUZK 3GV5B 3JSMB 3VF4A 4EZ9A 3WXJA 4IFVA 2NCKL 1RLDA 2R7QA 3M2VB 1IJEB 1TELA 5HMYA 5GMKa 1HQUB 3CJ4A 3CJ5A 2QXFA 3CJ1A 3THWA 1VSHA 3UDCA 4CLWA 3UW1A 3VQBA 4N8OA 2ROEA 3PFEA 1CULA 1TK5A 4ZCLA 2BM0A 3R5JB 1ATNA 4IFEA 4BG8A 4LUBA 3K89A 1T9VA 2J0SD 2LSNA 4CECA 1OO0B 3D0GE 2F1FA 1L3TA 3T69A 3MOJB 5B0GA 3K9JA 4FVUA 1SS6A 3B4DA 2Q1NA 3FSXA 5HVGA 2VBXA 5HJYA 3BKUA 1KAZA 3OTOK 2NYIA 4ILGB 2G8UA 4MTPA 3HHDA 5GAGI 5EGYA 1RT5A 3T9NA 3KHLA 3EJMA 4ZVOB 2GMLA 4L76A 4A8KA 3ISNC 2J6TA 4CO5A 4HHTA 3MEEA 2CQBA 5F0UA 5JMVA 4WYLA 3FRZA 1EP4B 4M5IA 3Q24A 4JI3K 2HNZB 1X9JA 2VGNA 2PEBA 4JV0A 4F8RA 5SWMA 1NZ8A 5JUMA 2MKCA 3S6EA 3MI7X 3OYGA 1T9TA 2MGZA 1S0NA 2Q0UA 3CM6A 1S4FA 2UV8G 5KG0A 2ZWPA 1UMJA 3BDPA 3KFWX 1RACB 7FDRA 1K8KB 2Z1GA 3MGJA 4E8UA 4ECSA 4LF5K 2NZ4A 2C2DA 1MMDA 1S57A 1YK9A 3OFGA 3IR5B 3DOMB 3DOKB 2ITMA 1WNEA 1A5WA 3GSIA 4ECZA 1FRJA 4KV8A 2MZJA 1FKPA 4JKHA 3T5LA 3LDLA 7AT1B 2XMTA 3VTHA 5FLXU 3OHRA 3H6EA 4JI0F 1HI0P 1HNIB 3TU5A 4PXBA 2XZTB 5HJXA 2J5AA 4Y2CA 3ZZZA 1X4BA 1XNQJ 1VRTB 3W9HA 2ZC4A 4NYOA 3C15A 1WBDA 2O4GA 1VISA 1J54A 2XMKA 1TKXA 3TARA 2Q66A 4NLQA 5KT5A 5FLXO 3MZIA 2XBPA 1UW9A 4UTGA 3GG4A 4CHYA 5AZJA 1TR0A 1YT3A 2WFBA 3QGHA 5FROA 2P9NB 2LCWA 3Q2SC 1S0MA 4BCAA 4K50A 4I67A 3CJ8A 2GWJA 5DM7Q 4X84A 5F8MA 2EXUA 3D67A 5EWFA 3QSYB 3L09A 2M70A 1WSEA 3HI9A 4J2EA 4LFBF 3M8SA 3S8SA 1YX2A 1X4FA 4FS2A 4E19A 4DB3A 3TAQA 5HLFA 2EFQA 2WW8A 4HVZA 1DQAA 1BUPA 1N34K 3KLHB 4DMZA 2AYBA 2RT3A 2IFXA 2Y9HA 1JQGA 2CQCA 2BE2A 1N6QA 3UDLA 3OD2A 4LF4F 1DQ8A 1YITN 3MMBB 4LFAK 4KO0B 4MKBA 4B3OA 2GMHA 1HWIA 2XY7A 4PXCA 4MK7A 2MKHA 5EDWA 5AJ3F 3OSNA 3C66A 3SCXA 2CG4A 3D1OA 5CHIA 2AP1A 4DCJB 2AGOA 1I1GA 3EL2A 1NHKL 4CJ3A 4UOHA 3C2PA 1CPZA 4USTA 2IJNA 4YORA 1Y9OA 1J5OB 5IT4A 2OH2A 1P8ZA 4CLYA 1U49A 1YJWS 4M5LA 3VA3A 3VGVA 5AQYA 1E4FT 3MPYA 2R8GA 3V4MA 1RT3A 3EVOA 4H5TA 1RT7A 4YOVA 5AQIA 3Q86A 1EX4A 5CA5A 4U67Q 3OYAA 1XC9A 3PEHA 3GYXB 2YH1A 3KLGA 4X64F 4WKYA 3FUYA 2HQ3A 3BPDA 5ETLA 4I9LA 5H9EK 1U1KA 2PN6A 3BZQA 3CMAS 4BRGA 3HPOA 3P45B 2P5GA 2Z1IA 2FPHX 3ZSWA 3OTBA 3GIJA 2PMHA 1B0TA 3ILJA 1YQHA 3KMQA 1NK9A 1BA0A 5BR8F 3BO4A 1FF2A 1WN7A 1PO6A 3T7ZA 4B08A 1R8BA 3VZHA 2IIRA 4DR7F 3PHEA 3J8AA 1T02A 1X5PA 5D8HB 2RQKA 4J90A 5EHHA 5F8JA 3GL1A 4CF1A 2HMIA 3W0LA 5EUHA 1EHWA 3VF2A 1R89A 1G4CA 4J9RA 3R2CJ 2DCLA 4J9UE 4MKYA 1FK9B 3EICA 3MDFA 1ZBIA 5HROB 2OTJS 1YBAA 5MLCQ 3P5JA 1TUYA 3KWMA 1WB9A 3TUIC 3O4NA 4GKJK 5C15A 1YKWA 4F0HA 2ACYA 3T1HK 5TKWA 1KN6A 4N47A 2GVDB 4Q43A 4ES2A 2H51B 3KYLA 2UUBK 3EMTA 1WAJA 4OPKA 4WK1A 4OHXA 2KFNA 1RWKB 3K57A 3F41A 2FHOB 3MM6A 4LSNB 4OI6A 4C1NK 3CVKA 1X7VA 5T7LA 1M90O 3VZIA 5IQ6A 4LBIA 4JYAK 1IN0A 2COLA 2LQBA 3PR5B 2ATLA 4DG1A 4WFBL 1BMQB 3MECB 2ZH3A 4EK2A 1FWPA 1MMNA 1P1LA 3MR5A 3FVYA 4CGFA 2V7YA 1VOMA 4HHUA 1EKSA 1GTHA 4HH0A 3R7BB 1ZBHA 2OYQA 2BKPA 1S6PA 2JFKA 5LXRA 3U4LA 3C14B 5M1QA 3BO3A 3MX5A 3MF5A 2DNYA 3K7RA 3DLEA 3HVRA 5BPLA 3SV4A 1D9AA 2F5GA 1M5SA 3MCPA 4FBUA 1CJVA 2Z8QA 5HQ8A 4DTNA 1EARA 1H2TZ 3M32A 4CGGA 3PW7A 3PV8A 4IR1A 1VQKS 4JKGA 2FJEB 4FLXA 2J9DA 2V4JB 2OPSB 5GAEP 1WSIA 3SUPA 5CAAA 2R2RA 4F3OA 1LWEA 1RHMB 4ER8A 2NS1B 4QWEA 4AYBD 4WTYA 4JHDA 3KKRA 1SL0A 1GOCA 4I6MB 3SAGA 5LSLA 3E66A 2E7XA 4FJ5A 2IJFA 1GOAA 5BYRA 1WNSA 4CJUA 2MQQA 3TABA 4TN2A 4X4VA 4CLTA 2M5YA 1HR0F 3AB2B 3NGUA 3F2KA 4XH5A 3DXBA 1RHUB 4AUKA 3AVHA 4M1KA 3LAMA 4LREA 3CQXA 1S1TB 1RCOB 2O4IA 3KLIB 2CIMA 1M90T 3B6PA 2RMLA 3U3YA 3HFZB 4GVBA 2CNNB 3G82A 3BSNA 1TFWA 3VA0A 2W2NP 2X1FA 1GTEA 3N79A 3B82A 4EYIB 2I7NA 1FNMA 3R6LB 5LL6Z 4WTOB 1K47A 3EO3A 4X4OA 2Y8WA 2OD6A 2HB5A 4IDKB 4LQ3A 4J2DA 1KC8T 5IS2A 1FTCA 2D3O1 1N5YB 1M1GA 1TVRB 4DL3A 4I0WA 5RUBA 2MPUA 3GJRB 1OQ6A 1TL7A 5F8NA 4OJ3A 1C0GA 1H2VZ 3LO3A 3W66A 1S0VA 2OIHA 1X3MA 5A8RB 2I8EA 3TWZA 3ITHB 3T5HA 1XTZA 1UWBA 3KD1E 3ALYA 2RHSB 3EGVA 2FJBB 4BE2A 4HTJA 3I56S 2OKQA 2CPDA 4DTXA 2R7RA 3ZFVA 1VLYA 2QXLA 1NJIO 1TKTB 3TJ8A 1B0VA 1F6TA 3NGZA 2Q97A 5KFLA 1JJ2R 1KAYA 4LF6K 2K1RA 5FPEA 4ATNA 2RAQA 2YWKA 1Y11A 1HWJA 4KSEB 3QGPA 2ROPA 3RUBL 2HYIB 2VONA 4BC4A 3GJTB 1SC6A 1XWLA 5DQIA 3TA0A 1NPRA 5HMXA 1KTQA 4C3MA 2RJZA 4HWIA 1IBMJ 3GQCA 4CVNE 1UA1A 3L7PA 1VC5A 1T8EA 1RGIA 4M5HA 5ADXA 2CPZA 1HI8A 3O5TB 1Q16B 1FI4A 3GJQB 4I7FB 4KHRA 3LM9A 3FJ2A 2XS7A 4IUFA 4DR6F 1CJUB 1AB8A 1CS4B 2VBYA 5DG7A 4C98A 2H5EA 4ZTJA 2V67A 1G2EA 2DBBA 4YOWA 4X4TA 5KRTA 2GIQA 1R59O 1YG0A 4X65F 4DS5A 2P9UA 2AQ4A 1RT5B 5D77A 1X9SA 1YBUA 3U1MA 3TSPA 1T6CA 1P9YA 1U2VA 4LVNP 2UXCJ 4A47A 4BHQA 3MEEB 3O9QA 4FLWA 3MMVA 2AYEA 2GVZA 3OBIA 2FJDB 3TAEA 2LXUA 4WXWA 1URRA 1YJ7A 1FXXA 1FFGB 1BWVA 4UUXA 1ZPWX 3CJSA 1VFJA 3BSCA 1J2VA 2E5IA 1HJOA 4CLLA 5F3ZA 4IH7A 2GX8A 1F2GA 2KRRA 1Q53A 3AAPA 3P39A 3KKSA 4DQRA 2E1MC 1REVA 1FA0A 2RB7A 2J76E 2F40A 3C65A 1Z25A 2DNOA 2AX1A 3EM1A 1WHXA 5HATA 2YHWA 4R0EA 5HP1A 3UQSA 2EBGA 4KV8B 5KFMA 1FKPB 3CJ9A 2I7PA 4Y34A 3RRGA 4ZVTB 3VQ5A 2ASOA 4U7UK 3L7UA 2IJRA 4QYZJ 3IUCA 2B4VA 2IIHA 3A8EA 1N36F 2IGIA 4G3IA 3MX2A 2NXEA 3IGNA 3PYDA 2NREA 4C0HA 1U04A 3C15B 1HYZA 4Q8EA 3AA5X 4PG6A 1D5AA 2DRDA 2YNGA 1TKXB 1YI2S 3HPHA 2CZ4A 3ID6A 4EAHD 5JXSA 2DNZA 1VSKA 1YJWN 2MB0B 1CLFA 5AZJB 2HFUA 3SQ4A 1S49A 1N33K 3IXQA 5KOWA 2M0GB 4K59A 4H4KA 4E2FB 1VSMA 1RBOB 3BR8A 4FJHA 4UOFA 4WU3A 3ZX2A 2IM2A 4NZ7A 5GAHU 1V9OA 1CEZA 2WVCA 4JI0K 2LYVA 3VQAA 2B4PA 3CMAN 4R0JA 1JJ2M 1NK8A 1U1NA 3NAIA 1LOTB 3IP0A 4CF2A 1R8HA 4GKKF 2QMWA 5HLFB 3TW0A 4C8NA 2JNJA 3MPVA 2XS5A 4MJKA 1RDAA 3K0SA 4DTSA 3C6TA 3M1FA 3GFHA 2BE2B 1N6QB 3ATUA 3EX7B 1L3VA 2Z2MA 5HBMA 2MHNA 3WX4A 4B3OB 1TK0A 4IYQA 2GQ2A 2JC0A 3V5RA 2BE7D 4CM0A 7FD1A 3TOQA 2VQEK 1HNZJ 2DTUA 4ICLA 2QO3A 1UPMB 1FRHA 5BRHA 1VIOA 3L2WA 2XYHB 4B02A 1U6ZA 1I51B 2LEAA 3HKZD 3MWPA 1LOUA 3DDKA 2WB4A 4HUEA 4HH1A 4Z2XA 2J9EA 3BSAA 1OKJA 4NXMJ 3U7JA 1RDDA 2RQMA 3NGSA 5E84A 3F5TA 2CQ2A 5BR9A 1YJTA 3LALA 1F3VA 4DSFA 3F9KA 3TZZA 1NJXA 4O4GA 1RT3B 3AVIA 2ILZA 2UXDF 4FWRA 2HHHF 1O6XA 2J9DE 3HT0A 3HVTA 2MQNA 4OX8A 4CZIA 4A48A 3KLGB 2RD5C 1Q8IA 1RDWX 4W5QA 3V6JA 3NG8A 4IJAA 3QNWB 4NLRA 3EKSA 3AVJA 3OBWA 3QB0A 4WZMA 3D0IE 5IWAF 3IO1A 2V51B 4KHWA 1NH8A 1IKVA 4ZHRA 4KYZA 4FZVA 2QWNA 4RWTA 1UVIA 2DXEA 3VQ7A 1T3OA 1XNQF 4G9ZA 1R0AA 4K4XA 4YB1P 1HFEL 4D3HA 4Y00A 2HMIB 3AO3A 2ZHOA 1VQKN 5DDRC 4A8XA 2DKOB 1A9NB 1TGOA 2E2OA 4K4TA 3BZCA 5KGWA 1WC5A 3I5AA 2A1BA 2XWYA 4QR1A 3K2PA 3F56A 4DV5J 4M5GA 3GFXA 1KLNA 1HUXA 3KDOA 5KT4A 1WHVA 2FGCA 1SI9A 3FLCO 1RTIA 4TU9A 1RWUA 2VG7B 5BR8K 2HF3A 5M1NA 2GHVC 2V9KA 3C7NA 4CJLA 1WEZA 4X4SA 4YDXA 4OX7A 4DR7K 1V5IB 3MR3A 4AM7A 3MM6B 3VGSA 2Z2YB 5F9NA 5T7LB 2V4QA 4CLSA 2PT0A 2FSJA 1SQFA 1WC6A 3KJNB 1T44A 3SAFA 2VPXB 5AQNA 4DG1B 1FDDA 1VC6A 2JGUA 5AQWA 1X4EA 2DEJA 4K8RA 2G2OA 4LH4A 2DNQA 1RKJA 4DR3K 2WRMA 2X7IA 5AQGA 3THXA 1I94K 1EX8A 5HANA 1S6PB 1Q79A 2A3JA 3E9OA 4WPAA 4U96A 3SDEA 2IVNA 4RTFD 4OHWA 5ELZA 1U47A 3DLEB 1S48A 1WKLA 1NBEB 1YXQA 3HM9A 2MKJA 1ZYQA 3EXYA 3A4TA 4ZCIA 5DJBA 4YR0A 1CJVB 3M32B 2PY5A 4JKGB 3TUZC 2F63A 5KFIA 1GLAG 4DV2K 4PXDA 1HRHA 1LWEB 3IKMA 2IMWP 4FJJA 3OR1A 4A61A 1IUJA 1Q7YO 4JHDB 2FLLA 2BXJA 4QR2A 3NL0A 1H7WA 2YWWA 3ULEA 2FC9A 5AFUA 1X5SA 4B9LA 3C0BA 3IFEA 3PZPA 1HHSA 2J7UA 4OZLA 2MKKA 2RQCA 1C1AA 1X4AA 4NCBA 5KG1A 1NHUA 4FWOA 2UUCK 1X1PA 2ZVSA 2GAHC 2A1SA 2E1AA 1Q9XA 3A0IX 4P75A 3X3UA 5AQRA 2QL5B 4GVBB 3H2UB 4X4PA 3DFEA 5AZIA 3EZUA 1D3WA 2XMMA 2Y0SD 3MWTA 3KLVA 3OR2A 4CP5A 4DQQA 4O5BA 2NXNA 1XNRK 5LMNF 4IOAQ 1RADB 3B8HA 2R8HA 1R8AA 4ZP7A 4HL9A 3VQ4A 3QIPA 1TL7B 1WC0A 3LH2S 4FWQA 3BBCA 4H4MA 4DQ8A 1R43A 5E3RA 4KHQA 4B3SF 4KREA 2HGNA 4KGMA 3DGVA 3NHGA 2VF3A 1UWBB 3UR0A 1BQXA 2BACA 2K8GA 2ZDOA 4O0JA 4ZN3A 2PFUA 2QJ3A 1BQNA 1RYRA 2B9WA 1VSIA 4LF7F 3J7AN 4EYHB 4P71A 3PVXA 4C8YA 5E3CA 3NF8A 1U4BA 3MN5A 3P49B 1XHZA 1WTBA 1D0EA 3T6BA 2W01A 3BDEA 3KK7A 4OYMA 5HQLA 2XM3A 2EX3A 1WSJA 3A2FA 4FLYA 4NX9A 1CJTA 1QJHA 4BRLA 1YZ7A 2APOA 1WOSA 4R79A 1T95A 4OX9K 2ZM6K 3QAEA 1Y4ZB 4I2QA 2NUHA 4I68A 5L9NA 1ZS6A 2ZD1A 1ELOA 4M3RA 2FQQB 3R3TA 3SBMA 5MLCV 3BQ2A 1S3XA 4FWLA 3MM9B 5CD4A 4A8YA 1NB2A 3M8YA 5J2QB 3DI6A 2P9UB 4FWPA 4O3OA 1UCNA 3RB0A 2AJ1A 2D74B 3NEKA 4DFMA 2EI5A 4OLBA 1AZSB 3W2VA 3VEZA 3LTOA 4ES3A 2DTJA 3Q7CA 4C3LA 3IWXA 1U2VB 1OIAA 1P6TA 4YUDA 4EWTA 2CZ9A 1LNQA 4ZITA 2FZKB 3CC4S 5BXIA 1IVZA 3H45C 4FWMA 3OYLA 1RTDA 4LF8J 2O67A 3TAMA 4ANDA 4NXNF 2MSTA 1O5JA 2EK1A 4M3XA 1SV5B 4U95A 1SCJB 2WSEC 2D1KA 3MCMA 1OS5A 3QFPA 4KHNA 3W2WB 4IJNA 1FX2A 1BIUA 1Q86O 2XEXA 2DFEA 3AOBA 4FJ8A 3VMFB 5BJRA 4DR6K 1MROA 5K8MA 1ZBSA 3KHYA 4KT0C 2BANA 4PUOA 1RBSA 5ETQA 4K4UA 2B56A 2OAUA 5KFPA 1KBRA 5EU7A 1REVB 2YNHA 3DRRB 3QQCD 3WXLA 3ULDA 2GV1A 1JLCA 4LIRA 4FYWB 4CEOA 2Q3SA 1RGVA 5HP1B 2W2QP 5IFMA 1BWEA 2NXUA 3V9UA 3FFIA 1ASWA 4FJIA 2YPZA 4E1JA 2CFXA 4TQRA 1Z26A 3K8WA 4ED0A 3RB3A 1D09B 4DV0K 4E7JA 2O5DA 5CE3A 4RO0A 2BRKA 3I96A 4BGBA 4PWWA 1UPPA 1QTNB 4RPFA 4ECRA 2DGOA 3NMAA 2XC9A 3EYZA 1UZDA 3TZYA 1IG8A 2YNGB 2C3OA 3JTNA 5IV3A 5EOYA 1ITPA 4JRPA 5E26A 2ZNYA 3D7SB 1JLQA 4BLGA 1YLXA 2BQ3A 2D0OA 4JI3J 1F1BB 4B3MK 4CHZA 4YP3A 1EJ7L 4M3ZA 4CJWA 2VBZA 2CWXA 3I5CA 4NMXA 5KFFA 4FXDA 3WX8A 2PAVA 3BY5A 4EMDA 4LF1A 2FVPA 1ZAVA 1FJEB 4ECTA 5IQQA 2FBVA 3ATVA 1N36K 4LF5J 4WFZA 1KWMA 3EZOA 4DTPA 2QK9A 5JLHA 4B3RK 1S7HA 2AKWB 3HLUA 2FD2A 4RUAA 1FNXH 2CJKA 2RSQA 3K2YA 3TVKA 5A8WB 1HARA 3MEDA 3C6TB 2MZRA 5J1NA 4IRDA 2NRXA 4JI4J 4Y28C 5HBMB 1Q9YA 2DNLA 1IKWA 1M5VC 3ZSOA 1U26A 4CFCA 1NLKL 5D3GA 4H4OA 1YJRA 2FGOA 3NLCA 4KRWA 4DL0C 2XY6A 1ZBLA 9RUBA 1H1VA 3OYFA 5LJ3Y 2XO6A 3DLHA 2XULA 4ED7A 1RAEB 4ICLB 1SKWA 4FCYA 1UJ4A 4DV4F 2WVEA 3Q8VA 4CI0B 4JKFA 1RCXB 1VBXA 2A10A 4DX7A 3R3LA 2XHBA 4KHSA 2DGWA 2HVZA 5THWA 2RU9A 2BJ3A 2EWSA 2R2TA 4OQJA 4DR1F 3M7VA 5I42B 3L3UA 4DS4A 4CEQA 4CNYA 3THVA 3VEWA 4OYXA 3OS1A 1VSJA 4WF9Q 4KE5A 3RSEA 4J9SA 2NUUG 2XSFA 3HVTB 2RF2A 1P9QC 5AQXA 4C6AA 1C0TA 3FQKA 3MEKA 4Y0FA 4HLBA 2G0IA 3DXSX 1N34J 1IBLK 2VGMA 4DL6A 2Y0BB 3VF0B 3MTJA 3MAAA 2GO8A 3IMQJ 4CLFA 3GIKA 3R9PA 4LFAJ 4O55A 1IKVB 3BGRA 2B7CB 4CFDA 4FNHA 1GQEA 2E1YA 1LV5A 5K20B 3BGFA 4KB7A 5KG6A 5DETA 1E3MA 1R0AB 3DLBA 1RISA 1WI6A 4RBUA 2BUNA 2FBYA 2UXDK 1X31C 2HHHK 3OLAA 4X62J 2CXEA 1HMVA 9ATCB 2U1AA 1EKRA 1RWNB 1HHQA 4HKQA 1N54B 3IR6B 4EHTA 4L72B 3AVLA 1AUSL 3AA8A 1B4SA 4FVCA 4CIOA 2V5HG 2QFJA 3E1YA 1OH6A 4FPAA 3TX8A 4UF4A 1PC5A 5IWAK 1OWXA 1RTIB 2C2RA 3BYRA 2D1CA 5A0YB 1FXDA 3HHLA 5F0WA 4RW8A 1GK8A 3C7NB 1GMVA 1U1RA 4JI7F 1IM4A 5AQHA 2WTFA 2HBKA 4G6VB 5H9EJ 1J6ZA 2FC8A 3VTIA 4CLPA 3KLEA 4I9QA 5L1IA 4AQYF 2VDIA 3JXUA 2M9KA 2RS8A 3IDHA 3H20A 4YB7A 4GW6A 4CD1A 5AXKA 1UVNA 1S5JA 3AT1B 3CJ2A 2ZDPA 2ZOFA 3C6AA 5IC4B 3D66A 4OZ1A 3VGTA 3GCWP 3W3SA 5E2QA 4FBTA 2DXDA 4XAKA 4Y3CA 4FLTA 4JNEA 3THXB 1NKCA 2HEKA 1MN9A 2KH9A 2VWBA 3SDEB 4MMOA 5JMNA 2BOPA 3ZTRA 3PKYA 3FBCA 3T6JA 4MKAA 5I9EB 1J27A 4CZHA 1S7IA 3NS6A 1HBUA 2WVDA 4P2MA 2HW3A 4CFBA 3IRXA 3TJAA 3VENA 2ZKTA 3SCJE 5E3QA 1DFDA 2XS2A 4YY3F 2RN2A 1TK8A 3PRVA 2V6AA 2CQ0A 4GKJJ 5KFDA 1ASUA 5LM7E 4GVMA 2O8BA 3OR1B 3L4BC 3ZSYA 2ZITA 3QDKA 4YHHF 5BRFA 3HZGA 3N4WA 1U6BA 2I1RA 2R8JA 3GFYA 4AE5A 2UUBJ 2IM1A 2YWFA 2IVYA 3ULEB 2HRTA 4CJFA 1UVLA 1YJNS 1FESA 1GFWB 1XIQA 3M9OB 4JYAJ 5C2DA 3LGMA 5A8KA 4E3SA 1HX1A 1N0UA 3QATA 5IV4A 2CJYB 2KHCA 1WELA 3PNIA 4DUYK 5AZIB 4I69A 3ENQA 4DV3K 3OR2B 2DJWA 3OV7A 2A6MA 2YQ3A 1C1CA 5HN0A 3TNVA 4CO2A 2QA2A 3M6XA 3TTFA 3NAHA 3CDUA 4H4MB 5ETTA 4DV5F 2KKZA 4C11B 4IH6A 4CH7A 3CC4N 1VRUA 2YJFA 2RDIA 5BN8A 3QZ8A 4URGA 4RW4A 3KJFB 3O80A 2BV3A 1K44A 3K5MA 4J7CA 5K9FA 1FDBA 1Q18A 4OJRA 3RMAA 1EQYA 3CB4A 4IO9L 1Q82O 1BQNB 4PKGA 3RGIA 1RWPB 3OUYA 3PIPQ 4GO5X 5AXMA 4BGAA 4CT8A 2FJAB 2YQ1A 4BG9A 4DR2F 1QZ6A 1RDCA 5LMNK 2AW0A 4B9UA 4Y2IA 4KBIA 2KHDA 2DR9A 5K8NA 4DR4K 2C2ZB 2QT7A 3N4PA 1LW2B 3KG4A 1KOHA 1UAXA 4BC2A 1KXPA 4O5FA 1NSQA 4FN5A 1RB0A 4CEDA 2HNYA 2B4OA 1WSGA 3BJYA 3GIIA 1R27B 4OL8A 2YKQA 4I2QB 1RT2B 4A5AA 5HL7L 4QQBA 4CGIA 4HI2A 2E5LJ 2ZD1B 3AY9A 4BROA 4DLGA 2QTDA 1V4TA 4LF7K 3QT5A 3J80Y 3ZT4A 2BABA 1RTJA 4JI5F 1DLOA 4B3TK 3R7SB 2YNFA 4ECYA 5LXYA 1WLJA 2XG8A 4DU7A 3W2VB 2E6LA 5BRDA 1GXUA 1TFYA 3C6UB 3OA9A 3HFVA 4QCLA 3JTOA 5D0GA 2CDQA 2HIYA 3CO0P 5KQ8A 3DYAA 1FE4A 1RTDB 3D6FB 4F7VA 3TAMB 1X4DA 1KAXA 5AQZA 4DR5F 1D8YA 3GZ7A 3KLFB 2NQPA 2K2PA 3VEYA 4LF6J 3TAFA 4DL5A 4KC5A 4TY8B 2L9WA 3MM7A 3WXMB 1ATRA 1Q82T 2HRUA 3IAS9 4IG3A 3CCVN 4PUOB 3L2UA 4XDCA 3GE9A 5KGXA 4JOUA 1T94A 3VN5A 4QS7A 2QA4G 4FK2A 5GINA 4C7QA 1YAGA 1ACMB 1RKIA 3N6LA 4BQLA 1V5VA 3G6ES 1B7FA 2Y1IA 2G9OA 5J2MA 1RHQB 1SXLA 3HFKA 3FFIB 4UUWA 1HKBA 3JAMY 3SQ1A 5E0OA 4NA2A 1WACA 4Q0BB 3ENBA 1WF1A 3DHXA 3RB6A 4RKUC 3HT3A 2FZGB 4NXNK 5SZTA 4GC6A 4ETXA 2IDLA 4IR9A 2GZOA 2V68A 1SH3A 3AARA 1ZZFA 2VZ9A 2WONA 4GV9A 2ZJQQ 4JV1A 5L1LA 2D5RA 3UDEA 4O8UA 2OZSA 2KO1A 1KVIA 4U8VA 4ZOSA 2V8GA 3BGLA 2GTDA 4K4ZA 4ZPDA 4NLBA 1LEOA 2V4RA 3R5GA 3SYZA 4CFAA 1NOZA 4Y6IA 1K8AO 1JLQB 5K5MA 3G25A 1WC4A 3IFRA 5DMRA 2HBZB 1J5EF 2FIUA 5J2PA 3FMWA 2ZNZA 3AD9C 2QM1A 5KI6A 2R8IA 2VKRA 3WQUA 1T0TV 1TUVA 2HNDA 4OHVA 3NGYA 3LP1A 4DPXA 1F5BA 2F3JA 4IG0A 1NSAA 5B0EA 1CZ9A 2ZBCA 1CSJA 1X0FA 2GELA 4BE1A 1MWMA 4K8XA 4BC3A 5I3PA 5DZ7A 1Q7LB 2XI2A 2UVVA 3POTA 4NEZA 3SQ0A 3NBPB 1Y7PA 1T9XA 1X4CA 4DL2A 2B9XA 1YWXA 2YKMA 5CHCB 2G1HA 1OVYA 4F4KA 2QWQA 2O8DA 2OP5A 2G8FA 4CLZA 5BN9A 1M1HA 3CIMA 5E7OB 3AVBA 4BRMA 2YWEA 2Q43A 1VQPS 4RZRA 4BQZA 3P5BP 4JUZA 1NNEA 2FVQA 1RT4B 2I2YA 2LU1A 1NMNA 2D3ZA 3FRYA 3D6HB 2VODA 3BEGB 1MWQA 3J80U 3RR8A 4OKJA 3GV7B 4CBWA 4JI6K 4ZLJA 1VI7A 3D6MB 4DQIA 3ISZA 4OIXA 4KHPF 3SI6A 2ZWHA 4JV2A 4DUZF 2DYAA 5AE3A 3G10A 1S1XA 3N01A 1BU6O 3PUFA 2ERRA 3CSKA 2BEFA 1BIZA 2QA4N 3IR7B 1KD1O 5C25B 5LMUF 2CAJA 1T03B 4OLOA 4CZJA 4JS5A 3J80O 4JKDA 2FVCA 2IRYA 1T9YA 3E01A 4JI0J 3L3VA 1KSPA 4MFBA 4PHTX 1TQLA 4EO8A 4KTQA 1EB0A 3PFOA 1CVJA 3RSEB 3VQSA 3ZXWA 4ED6A 1PC4A 4ZPBA 4FKYA 2RF2B 1FVQA 3M2RA 1VQ9S 4JLHA 4USHA 3NRBA 1UKUA 1KR4A 3C6HA 2J0XA 1RAOA 2IVPA 3G6XA 1VQ6N 3MAAB 4DV4K 1UETA 3VAIA 4Q7AA 1QD1A 2JWKA 2XI3A 3BGRB 1HKCA 1S6OA 2Y1RI 4DJBA 3CCQS 5KFOA 4DR1K 3DRXA 3OTOF 2QL7B 2M8HA 3JAMU 3HTVA 3TR5A 1UVMA 3MPWA 4X2BA 4O44B 4QAGA 3HSZA 1WOOA 4QW9A 1LWXA 3UCZP 4KAIA 1HMVB 2DXFA 2UVWA 3HYFA 3MM8A 3A5NC 3EE9A 3OL6A 3HSCA 1L3KA 2J8AA 5GAEU 2KVQE 3LP3A 3CCLN 2I0XA 2C3PA 2ZKUA 4WIQA 2OUGA 1K9MT 3NS5A 1D9FA 3QPIA 3ASMA 1HIYA 1I39A 3ENOA 4LF4J 2RILA 5CCLA 3PW4A 3HHLB 3CJBA 1LXNA 2BR0A 4P52A 2QTWA 2UP1A 4RW8B 1YJNN 4Z0UA 2JLGA 2IYGA 4KTWA 1RTZA 4NYZA 1IBCB 1YBTA 5AJ3J 1VLOA 4CI6A 4M3TA 4DTRA 3KLEB 4RW7A 5DM7L 3ZLJA 5KFEA 2IY5B 1Z2ZA 4EP5A 4W5RA 1YRUA 4DSJA 2V8HA 4BC9A 5A6PA 2HLUA 4J9QA 2NXJA 1TMJA 4DMNA 3RZAA 3MD1A 2HNZA 1QAIA 2AP6A 3T1YK 3AAWB 1NKBA 5HAOA 3MCSA 3H2LA 2M4MA 3LZIA 1VQ4S 3NE6A 2BTFA 1ESVA 2E9RX 5CZVA 1R6VA 1VK3A 1R0BG 1M5KC 2P2CB 4PWDB 1K8KA 2CQHA 4Q44A 2CA9A 1KHWA 5KT3A 1CQNA 2DPNA 4JI7K 3WEEB 3HSJA 4DV6K 4J9LA 4X64J 4MT1A 1IKYA 3CT9A 1HBUB 4UOCA 3DOKA 3CCWA 3IRXB 4MO4A 1RAJA 3R7NB 1M5HA 4ANCA 2VC0A 1ZA1B 2PFDA 3N5FA 3MFHA 1NEEA 2ZVIA 3BGOP 3BN4A 3RMDA 4O3RA 4JN4A 1Y0HA 3D1QA 2O8BB 5B0AA 1HL6A 1MLAA 1YIJS 5BR8J 1QSSA 1S76D 3A13A 3NGDA 2OMLA 3MMCA 2NRRA 4MLEA 1PBAA 2VOPA 1W7AA 3QFWA 2DGUA 4Y0WA 4DR7J 5JICA 1W25A 4B9MA 3V9SA 2Z1HA 2VASA 4JP8A 4DDFA 3KMSA 3JSBA 4DSLA 2EFVA 2QL9B 5A8KB 3WXKA 4U67L 3MD3A 1RJJA 3F73A 4I56A 3MFIA 4LFAF 2VWKA 2YHXA 4MH8A 4YOUA 3OFHA 1S1UA 4WFAQ 4YY3K 2AU0A 1NGEA 1X0PA 3TTDA 3H40A 2HURA 3FBEA 1P90A 2EC2A 2WBRA 3ZSQA 2UVUA 1DBDA 4ZPTR 4PPZA 4HDHA 1C1CB 4WIIA 5IT9Y 3CD6N 3BQ1A 3CW2C 3S3OA 2HQGA 5D15A 2KU7A 4ELVA 2YKOA 3JS9A 5JJBA 3MTKA 2VPYB 1RDBA 4RWXA 3PKMA 3KLHA 4ILRA 3QGGA 4PQUA 3JQKA 1ZXOA 2NRZA 1VRUB 4ZLLA 3MEGB 3HL8A 3TQEA 1WJ9A 2CADA 3OUYB 3R97A 1YVNA 2R4FA 4DFJA 2WK4A 4PQAA 2KFYA 4AHTA 2AEMA 4Q45A 3PW2A 2HHVA 5C7PA 1RSCA 2QMXA 2DK2A 2D0BA 3OYDA 3G6EN 1J5OA 2VG6A 1OVQA 4JI8F 2X3GA 4FS1A 4YDDB 2QSWA 3D0PA 4FOEA 2J8SA 4LRCA 1FFWB 2ZH9A 3CDEA 3J7ZT 3GG0A 2CGKA 2GJIA 4NLUA 3PO4A 4RNMA 3HX9A 4NLCA 1N88A 4O0NA 4OYOA 1JIHA 1Q0NA 2QW9A 3Q0AA 5EY4A 1NGDA 1RTJB 4IO1A 3NCQA 1DLOB 3MXJA 1FX4A 1HR0J 1VQ8S 3Q2TC 3G8SA 2YNFB 4H0YB 4FJNA 3DLKA 2KN4A 4QWDA 1KP6A 3ZTQA 1Q78A 3UNYA 5KFCA 2G8WA 5ETVA 1QAJA 2MZ1A 1K1QA 3OYBA 1S79A 4RUCA 3T1HF 1ZPVA 2DNKA 2XHWA 4CESA 1AFIA 4U9RA 3M8WA 4W92B 3TRGA 1R7IA 1TL3A 3DXMA 1Y00A 2V2KA 4IG3B 4AF1A 5HMWA 5FIIA 3P4IA 4AHVA 5AQQA 4CGJA 1UFWA 1URNA 2HHSA 4OI2A 4K4VA 1RHRB 5DDQC 4CK3A 2YV0X 1S1VA 1RT1A 3OYNA 3I9ZA 4QR0A 3VQTA 3HK2A 1HWLA 5KFKA 3EE3A 3OL8A 1H2UX 2CPXA 5J2MB 3MPUB 4KB0A 3IA0A 4NWBA 4EU0A 2CH5A 1R8PA 3G71S 3C16A 2WC9A 4H0VB 2BQUA 4K2JA 1LXJA 1SKSA 3OW2R 2QZ8A 2ASDA 2IM0A 4DSIA 3K5OA 1FJGK 1VQPN 3SSRA 1S1WB 3GFZA 2RU3A 4K2XA 1Q5YA 4LFCF 4FZZA 2WONB 4LSNA 3HHKA 4HTIA 2P9LB 3U9ZA 4OMFG 1W9HA 3Q8QB 4XIUA 2EHGA 2C3YA 2Q0RA 2DNRA 1XMOF 3UKUB 1PBUA 3H4DA 5IT9U 1S6QA 1XEZA 2FLNA 2IM3A 3CCJS 4DTMA 4PG7A 3TX0A 3AO5A 3ZT2A 4BR5A 3OHAA 2RQ4A 1EWQA 2GIFA 4GC7A 5J2PB 1BY9A 4PXEA 3SNNA 2DO0A 3C14A 4IWVA 4ZJOA 4EFAC 4DR6J 5IT9O 2HNDB 3LP1B 3AJ1A 2N3OA 1QQCA 2JWLA 3VERA 3KJVA 2DY1A 4WFXA 4E7LA 4IG0B 4L73A 2FY1A 2G0JA 1VQ9N 3V6DA 3AD8C 5HVFA 4QIVA 2BJDA 2OCEA 5KG5A 4G1QA 1IJJA 4X65J 3VQPA 2PEHA 4LR9A 4DV1K 2OPSA 3I82A 3MN9A 3POTB 2F9JA 3ILLA 5CR4A 1OJ4A 1VMBA 3TZXA 1RILA 2YQ0A 2LQ5A 5KFGA 4UT4A 4DV0J 4H5VA 4ELUA 4I6MA 4EUVA 3CCQN 5KT7A 1PYSB 4N77A 1J5EK 1H3DA 2Z57B 3CQYA 3BUZB 2XCAA 3CTRA 2UV8A 1Y10A 1RBLA 3SBGA 1JL1A 3PIOL 3H5XA 4LD0A 1ZM2A 2A2DA 2FF3B 2P9CA 1S99A 2Q3PA 3HPGA 3ELHA 4B9SA 2HBYB 5FLXY 1HLWA 1KVJA 3HOTA 3LWMA 4BVPA 3P1GA 2ZBPA 1MNEA 1S1XB 3LW5C 4USVA 3MK6A 4CF8A 3M6WA 5HVHA 2DNMA 2LA6A 2Q6BA 3OLBA 1U24A 3AGRA 3BEXA 4J91A 4KGVB 2I5JA 2DH7A 1FT8A 3E01B 2HGLA 4MFBB 1N36J 5D0HA 4TVAB 3OYMA 1BO5O 4BR4A 2DPJA 1WWHA 3TUJC 5D0RA 5J1PA 3ITHA 5CYQA 5CCMA 1PJ6A 2DY4A 2VFUA 4LY7A 2FDNA 1KRPA 3ZEUA 4ED8A 3HZ6A 1RI7A 2GMJA 2QEXN 1AW0A 4KHPK 3SI8A 3G6VA 1TKTA 1VQ4N 2FHMA 3RBDA 4I1TA 3TI0A 2HS3A 5KFXA 5CZ2A 3K59A 2A6AA 1RBUA 2HG4A 2WB1D 3AB4B 5LMUK 4QU6A 1FTRA 2CQGA 2HBJA 2I6WA 3I6PA 4XO0A 1T3VA 1A0OB 3CM5A 1WORA 2JEFA 3MM8B 4BRPA 2E6MA 3A5OC 2VFSA 5B08A 1VR6A 3NGTA 2LEBA 3TA1A 2CQ3A 4GKKJ 5K14B 3CDAA 2GX9A 2HF4A 1LK5A 5KFAA 4M3WA 2P1JA 3D28A 3M6UA 2HWHA 5GAEI 4W5OA 4I7FA 1C2PA 3G6YA 1YIJN 1CJUA 2ZH1A 3NY0A 1CS4A 1U09A 4CO4A 4PG8A 2A1RA 1ZZNA 3P83D 3M4XA 1KDNA 1VQNS 1RU2A 3D7EO 2QN6B 2RHKA 4AHUA 3U6FA 2BMBA 1RAHB 1NM2A 4RW7B 2VA2A 2YXLA 3R5DA 4QIEA 2E88A 1IBLJ 1O51A 3NF7A 4C97A 2H3GX 2DGXA 1U25A 3CF5Q 1JXEA 2QG9B 2O01C 1IH7A 4MYTA 1G3OA 5C12A 4NLDA 5F8HA 1H6KX 3A3OB 2CGJA 1GX5A 2ASPA 4FP9A 3GP9A 4YOEA 3EZ5A 2QYCA 1N0VC 3ZZYA 5DK5A 1WOQA 3D3CJ 4KFBB 2VFTA 4K5RA 2VPWB 3BP8A 1MWKA 1LFWA 4HEA9 2UXDJ 1ZBFA 2HHHJ 3EGWB 4OYBA 1WF2A 1ZC6A 2RDDA 2W2PP 3AQPA 1AA1B 3UE2A 2YX6A 2V7ZA 4DQSA 2D0AA 4LVOP 4FYXB 1IKYB 5TKYA 4BRQA 2CZVC 4BRIA 4IKAA 4JI2K 2DR5A 1N33F 2NXCA 4V1Ak 2J9CA 2O8EB 1U2RA 2GCFA 2QRRA 1TL4A 2HGMA 3JSYA 4FWKA 2ZJPQ 2D4WA 4J9MA 4R25A 5IWAJ 2ZBQA 3PW0A 1ILYA 2AYGA 4XDDA 3MUVP 3CETA 2VJUA 3U02A 1JCEA 2RPIA 3MMCB 1JKHA 4JS4A 1ATSA 4Q2MA 4C48A 4CZCA 2W41A 1NDCA 4MO5A 4RCHA 1QQNA 3CJ0A 1YHQS 2B8QA 4ILHA 3QFHA 4B1XB 4FYVB 4JKBA 5FJ4A 3J81Y 3H42A 1YRTA 3M30A 1IXKA 1W7WA 3SXLA 4J9NA 3CC7N 1VK8A 3AVAA 1S1UB 1UVJA 5GAHP 1DTQB 4CZEA 1VQ7S 1X9WA 3GYGA 2VQEF 3HCXA 1GNKA 4LF9F 1U0HB 6FD1A 4DCPB 1EIYB 4EIAA 4CGHA 1M1KT 4B1VA 3D45A 3F44A 5M2RA 2P5VA 4Z7YA 5C2CA 3FE1A 3BF4A 3RRKA 3EPIA 4F04B 2W4DA 2ZOMA 2E7WA 2MJUA 3M6VA 3ZZTA 4AXIA 1AROP 1T3NA 3OFFA 4PQUB 4FF1A 4R8UA 3DN9A 3BH6B 3TYTA 3K5NA 3QAUA 3NNCA 1RXOB 4FPRA 5KTQA 4K4YA 1W0HA 2XGPA 8AT1B 3UCUP 3M9NB 2XZDB 2AF6A 3PJ9A 1O13A 3MAQA 3P96A 2G4BA 1LAWA 3ZC4A 3V1RA 2ZZTA 2A3ZA 3I31A 4M5DA 4BDZA 3O1WA 3FGUA 1PIEA 3ZNUA 3E2EA 3G86A 4USWA 1TV6A 1YJUA 2KZMA 3ZZUA 1NDKA 2HS4A 2KJWA 5DDPC 3H3NO 2VG6B 2DHXA 4FJKA 2R3VA 4ZVHA 5KFHA 1KLMA 2QSFA 4DUYJ 4TU7A 4CCHA 3L2RA 3G71N 2CDRB 2V94A 4DV3J 3LZJA 2HBQB 2E2PA 2H4YB 5E41A 3NMUA 2G8HA 4XTTA 4USIA 1T9UA 3TSQA 1DEJA 4RBVA 1T9WA 4ZKAA 3CFRA 4RW6B 3CDWA 1TL5A 4N7TA 1E4GT 3DLLQ 4FDFA 4HT5A 3UKRA 2E5HA 5ETOA 1J53A 5DS7A 2RE2A 2DIUA 2LA4A 2Z0GA 4RW9A 3DLKB 3I55N 3MUTP 2XLKA 1APSA 1SC3B 5GADP 1YDLA 2NPIA 1NM1A 3AVCA 2F8EX 2CNKB 1RFQA 4BREA 2MY8A 5AT1B 2AGPA 2KXFA 3QFUA 4DWIA 4JI8K 3CCZA 3OJUA 1XMQF 2ZE2A 1ZM9A 4ZVRB 1U1LA 4PKHA 5A2QU 2XTJP 4BBYA 1XHXA 4P73A 5LMNJ 3L8BA 4C2MA 1TL3B 4YS2A 3DXMB 5KQDA 3GWCA 5KFYA 1FXLA 2ILYA 4J2BA 3V9ZA 3IS9A 2XSJB 4WWSA 2F9WA 3QO9A 3SMPA 1SL2A 5GIPA 5D4LA 3GE1A 1WG4A 3RW6A 1S1VB 1KQKA 3O8MA 3HJVA 1RT1B 3F0NA 1K0VA 5A2QO 2RDJA 3D3BJ 4ILLA 5CH7B 1OY8A 4B3SJ 4DR3F 2ZH5A 3BPSP 3SQOP 1I94F 1A7GE 1NKEA 4N8NA 3J81U 1W26A 3C16B 1C0FA 2ZC3A 2VG7A 5F3TA 3IM8A 4ZN1A 1U8WA 4LF7J 2Q6CA 3CFPA 5F1XA 3QEXA 3A8JA 5DO2A 1Y64A 3FZMA 3VAHA 5EX5A 4OPAA 3VQCA 3DC2A 4KH0B 1HNXF 1OH7A 4B8AB 2WOMA 3J81O 4IOAL 1WSVA 4DV2F 5I3QA 1KS2A 3ZETA 3LANA 1DAXA 2DIVA 1SJ1A 4WCEQ 1S6QB 2E1ZA 5KFWA 1ZTTA 2W7OA 1N5QA 5AQMA 3CJCA 2XYPB 2WW4A 1EETA 4IRKA 1KC8O 4ZVEA 3H8YA 4OV1A 4YB5A 2ZH7A 2HAFA 3TPQA 3DGPB 1EO1A 2JFDA 2Q36A 4DN9A 2UUCF 4ZMMA 2P9GA 3KJVB 4K4SA 1NBWA 4IO8A 6AT1B 4X4QA 1IBKF 4DX6A 4LFCK 2QV6A 3FR0A 3V6DB 3IAYA 4G1QB 3Q89A 3RBZA 3MM5A 1ZBUA 4WFNL 4BR2A 1XMOK 1SZ2A 1RBVA 2V0NA 1XNRF 2HVDA 2CQIA 2HSTA 4NZ6A 3L3CA 4YR3A 4NXNJ 1NK4A 4OGCA 3FBFA 2N3LA 4ZLPA 1F21A 1SUQB 3AV9A 3ENHA 1H7XA 4ZJLA 2B43A 2DFFA 2RNEA 3J81j 3ZCMA 4J9VA 4WFYA 3CJ7A 1Z1ZA 5HK4A 3IN5A 5IOLA 2QLFB 2PMWA 4CZMA 3K58A 2YKNA 2BW2A 4JKAA 5C42B 3ONQA 1FRXA 3NOGA 4H0OA 1WG5A 1CZAN 3JB9k 2VH7A 2Y3YA 2C2NA 1HNVA 2I5JB 5AE1A 2A5XA 4BDYA 2F4VF 1FKAF 1GLDG 5EX3A 3L0QA 2V8VA 5F8IA 4ILJA 4FPIA 3AJDA 1QVFR 4OX9F 2ZM6F 2DNGA 3SCLE 5D78A 3WUHA 5CYQB 4MK9A 3ZEUB 2AX0A 3QEWA 1IG9A 3KHHA 1QDUB 4UW2A 4Y65A 4ILMA 2W42A 3OYKA 2LFVA 1N32F 3BF3A 4F3QA 2NSCA 2AD9A 1DGKN 4BRHA 3DRPB 1XN9A 3MAHA 4P74A 1YTAA 1QSYA 3KNGA 2I9SA 3JTPA 2DR7A 3H5YA 4RNHA 1WAFA 2JWNA 3FZHA 4WJBA 2CJBA 3ZZ0A 2RVJA 1SQKA 1IWGA 4K43A 2B4JA 1DRZA 1QUPA 1HWUA 2K7JA 3AAQA 3PIOQ 2PO4A 2N7CA 3CCMS 2MKYA 1B7YB 5I4MA 5GMEA 4FW1A 3MXMA 4DTOA 3THTA 4FLZA 2CNLB 3MM9A 1XERA 2DGQA 2CG8A 2V8PA 3MXIA 3FNNA 1TMMA 2W9BB 1ZOTA 5J2QA 1FRIA 4OYAA 3PR4A 1S72S 3JSRA 1AZSA 4RNOA 4K0KF 4FJ7A 3H7HB 2ABYA 4ECXA 3IG1B 2WUSA 4DSKA 1QTMA 3OYHA 1NJZA 4URQU 4CJ4A 4DV4J 2W4CA 3QNOA 2E2QA 3EDQB 4DV0F 4A8WA 3R6GB 1X3NA 2W4PA 3RVCA 5IXUA 2X6SA 4RJVA 1SV5A 1VQ7N 3R27A 1HW9A 2JRSA 3W2WA 4DR1J 3VF6A 4L75A 4BRDA 3RAXA 1JLEA 2XMVA 3KZBA 1BA1A 1HA1A 4RU2A 4MIBA 2E5GA 4OLAA 2MLXA 2JC1A 3DRRA 3CO9A 3LWLA 4HTUA 2BKNA 2OA8A 2VKZG 2Z1JA 5L39A 3SZ2A 4QU7A 5DLGA 2BW7A 2AJFE 4TSXA 4B3MF 4H5NA 4LR7A 1I6JA 4EEYA 4TQSA 4CNZA 3BH7B 4WQ4C 4X66F 4X4NA 1G99A 3CIPA 5DM6Q 1SC1B 2EG2A 2VQFK 3KHRA 1TKDA 1NG9A 2JSXA 2DGSA 3MN6A 1PILA 2HFZA 1JKHB 3N28A 3O44A 3ENWA 4FXVA 4B3RF 4RNFA 5D6GA 2GC8A 1Q1KA 1JCGA 4ZP9A 3QBWA 3D68A 1ROFA 4RL1A 2O8CA 4WF9L 3TAPA 1NK7A 3M30B 1AFJA 2W9CB 4X4RA 1YVUA 1SJFA 3LGNA 2X78A 3KIOA 2LLZA 4CHQA 5DZ6A 2O1PA 3I32A 1PJ5A 1RUSA 2J0QD 2QE5A 1X5OA 2W6KA 4FK0A 1X5TA 1FEHA 3KK2A 3SLCA 2MZTA 3SQGA 1H98A 2A0FB 3HHEA 1YTYA 4FSVA 2FVRA 1KQSR 2CJXB 4F2RA 3QT7A 2OFHX 4JI7J 2KZZA 2AYMA 3X1LB 5SUHA 4CF0A 2H4WB 2MDAA 5C5JA 2G13A 3M2UB 4AQYJ 2IPOB 2HKEA 5A8WA 2HK3A 2V2VA 3TQ1A 1N48A 4R8UB 2MQLA 5KFNA 3F9MA 2OD4A 5GVQA 1GLFO 3OJSA 1BQMB 3I0SA 3R5CA 3ZTSA 3L2QA 4J37A 2CJAA 3FBBA 1SBRA 3US5A 4DXLA 3P4UB 5DQHA 1WBBA 4I2PA 2W24A 1VC0A 2R9LA 4C8OA 1BDGA 1RBAA 3L95X 2YWGA 4FM0A 4NLVA 5C10A 1UJ5A 2VG5A 4M5DB 2ETJA 3IBCB 4OZ0A 4LF9K 1CC8A 4ZA1A 3OY9A 5E3AA 4OHZA 2OPRA 1IBLF 3W64A 2KLAA 5H9FJ 1TV6B 1Y5IB 2KB2A 3AODA 2OTJN 4K5SA 3PY8A 4E7IA 2PDAA 1KLMB 2O3DA 4DU3A 3HI0A 4YY3J 4J5OA 5I42A 4FNIA 2IHR1 1B70B 2HVHA 4QPTA 3Q22A 5DQGA 4YHHJ 4ETZA 4L3KA 2OANA 1NOYA 3O3LA 4QIWD 3W61A 3CCSS 1SQGA 3UKRB 2GEMA 1SC4B 1XC3A 3AQOA 1VQOS 5HO4A 2AWZA 4KQZA 5D0EA 3Q7BA 4RW9B 3QJLA 4M45A 4PCQA 4KHUA 2GWKA 1MDUB 5KAKA 4FW2A 3RWUA 3O1BA 1C6VA 4U7UD 1DARA 2MSSA 2E8AA 1REGX 1W2IA 2VC1A 1S6UA 2ZE2B 1RBTA 3M8PB 2P51A 1T11A 4DFKA 3HJFA 5L8RC 3RJMB 3CI5A 4ZIVA 1IQTA 1F3FA 3AFGA 4LC9B 1B3TA 1Q81T 2N4DA 2E2NA 3IS9B 3D5MA 4CO0A 3QO9B 4MQ3A 1C4AA 3VGMA 2HWIA 3UD4P 1HJRA 1RZMA 1SIZA 3H1QA 3LAKA 4NO7A 2HRYA 4XH4A 1KVAA 2HWTA 3BBFA 4DHYA 4M7YA 3H5SA 2AEJA 4Z4FA 3VEVA 2YTCA 2MTLA 4XH1A 2EFPA 4C23A 5A0YA 1XMQK 1ASVA 2FHJA 4JBCA 2XLJA 1RBRA 1JX4A 1SPBP 2DCUB 1NUEA 4E1NA 5KFTA 2LEPA 3VEOA 3U9DA 2O66A 3W65A 4DR2J 1HQ2A 3CCES 5K8OA 3BM7A 3T41A 4BRNA 3RBEA 4ZVSB 2WOMB 2VHGA 2OFGX 1HW8A 1TKZB 3PYEA 3O08A 3ZETB 2E5JA 1KOOA 2YJEA 2IYIA 2HZCA 5HRNA 3R5AA 4DI6A 1EETB 1Q8LA 2M3DA 2MQMA 4B9TA 3SPYA 3H90A 4JV5F 5B09A 5KG3A 2AJ4A 1SL1A 1K73T 2D0CA 2FYXA 3FZ2A 3FZLA 3KUGA 3AO2A 3N4QA 1BL3A 2F7TA 4LBPA 3DDIA 1V3RA 2W25A 2CYYA 5HRRA 4JI5J 4DHVA 5CZXA 4OZ5A 3PIPL 1MA9B 2PYJA 2V9WA 1NJWA 1YF5L 5ETNA 1HNXK 1N8RT 3QT8A 3QESA 3HF5A 3MM5B 4DUYF 2R7UA 1RWWB 4O3NA 4DV3F 4LJMA 1J9AA 5ADXH 4DU8A 3HOSA 2XLIA 3D2EB 3I56N 4H8KA 3FCVA 2YNIB 3GTYX 1NNDA 1HQEA 3KUHA 4CLKA 1T05B 3Q8YA 3NOCA 5J2NA 4K4WA 5AQFA 2E9ZA 1FJGJ 4DR5J 1IR1A 3AVNA 4CLUA 2B6AA 4CJKA 3DLRA 2VB6A 4CJ5A 2AZ3A 4DOZA 2RRNA 1W97L 1H73A 1FRMA 2KG1A 4PL8A 6FDRA 4RG8A 1IBKK 4DEZA 4CZFA 2YKNB 4JB8B 2OTLS 4A8SA 5DLFA 5JS2A 1U1PA 1TP7A 2YPYA 4FF2A 3T9ZA 3CCMN 1CJKB 2Q2RA 4PRFA 3UDVA 4HACB 2UVRA 2FVSA 4FM1A 1IV0A 1UJ6A 4DR4F 1HNVB 3AVKA 2B9EA 2H5JB 2E1CA 3WQTA 3WDOA 3CUNA 4CH0S 5H1SQ 3RYLA 4ZCMA 4MDAA 2HAIA 4A57A 2A40A 3NP5A 4A4JA 1S72N 3S41A 4ZDNA 3DLGA 5FPDA 2CPEA 1F60B 3LGHA 4Q5VA 2XZWA 4ITSA 4C11A 1F9EB 4DV1J 2FUG9 3RMBA 3O8WA 1XK8A 4FF3A 2PA8D 2F8MA 3CGIA 4IFYB 3HSDA 1CC7A 1JMTA 5AQUA 2DHGA 4E1MA 4CW7B 4NA1A 3G2XA 1J5EJ 3I5BA 3PW5A 3ZSVA 3FZFA 1BHNA 4BRAA 4FPBA 4B3TF 1EWRA 4DV7K 3M8ZA 4WFNQ 4IRCA 4P6QA 3UO0A 1NJYA 3SJJA 2L9NA 1WDTA 1LW2A 2B9YA 3LPEA 1KFSA 3L6QA 2BRLA 2W7AA 3OTDA 2F4VK 5C24A 2CGLA 3CULA 3HRGA 5LOQA 5C2GA 4JI4K 2VD3A 4G65A 1QLNA 1UTAA 2ZJQL 3SMSA 1PSDA 1RT2A 3I33A 4UY8O 3V9WA 2R7YA 3OQ2A 3FFKB 3B4MA 3HM8A 4QJVA 2ZJRQ 3AXKA 2RKIA 3B78A 1N32K 4FJLA 1NGIA 4FYDA 3VAKA 2R42A 4RX6A 1MG7A 3ZSXA 2F7VA 3VV2B 2RRBA 4F4YA 1YI2N 3CNQP 1KFDA 5CYMB 2ATCB 3H08A 3C6UA 2GV9A 4KPCA 4WE1A 1N52B 2PIIA 4KHPJ 2KT5A 4DUZJ 4H54A 2P9SA 2EFOA 3OYIA 2D9PA 3KLFA 1QVGR 4ANEA 4F36A 1VHIA 4TY8A 3CD7A 5LMUJ 1JLEB 3DJCA 3E3XA 4DU1A 3MMAA 3G96A 4AL7A 1ZM4A 4HR2A 2CWKA 1CBKA 4OVLA 2ACMA 3O4WA 1JLGA 4GO7X 1QY7A 2IA0A 3CCTA 3TANA 4YOTA 2UXBF 1LFPA 2HFNA 3FC9A 4K0KK 2XMWA 4KI4A 4LQ9A 3ETMA 2RIJA 2FLPA 2KJVA 4Q0BA 2X51A 3B6BA 4X62K 1DTTB 4UY8T 1SJ4P 2OJ3A 3DKDA 4DU4A 1V4SA 3OTOJ 2MHEA 4Y1DA 1FXRA 5AQOA 5HOOA 1YJ9S 2GQCA 2H54B 3NCRA 3J7YI 4PY5A 5EWGA 1UZHA 2A42A 4YOYA 4JAXA 1S0OA 3WNEA 2KKHA 2O8CB 5F8GA 4IKFA 4CDIA 2R7SA 1QAYA 3QEPA 1BGXT 2V34A 3BZKA 1F5AA 3MR7A 2BKOA 5JS1A 1SVDA 1I3OB 1JB0C 1VQMS 4X66K 3C46A 5LL6d 3IGVA 4FF4A 1K1SA 3CMES 4GMJB 3OYCA 4M8LA 3KK2B 3SQGB 3QINA 3CCSN 4PKDB 2IC3A 1X4HA 4A8FA 1VQON 4JI6F 3RR7A 3IBWA 1YUWA 4NPOA 2G2ZA 4YDUA 1NK0A 1MN7A 1EAYC 4NYPA 3E9LA 2UU9F 1RLCL 2QYGA 1E6VA 4JI2J 2WAQD 4DPUA 2HQDA 3NBPA 1K6YA 1UEVA