3KLSX

Structure of complement c5 in complex with ssl7
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
191
structure length
191
Chain Sequence
LHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of complement C5 by the SSL7 protein from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
molecule keywords Complement C5
total genus 33
structure length 191
sequence length 191
chains with identical sequence Y
ec nomenclature
pdb deposition date 2009-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3klsX02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3klsX01
1I4RA 1LT4D 1EU3A 4RGNA 3URYA 1CQVA 2J4XA 1PRTC 1ENFA 1JWSD 1S5FD 1D5XC 2Z8LA 1SBBB 1BXTA 1I4PA 1UUPA 4OHJA 1EWCA 1EU4A 3W2DA 1PYWD 4K6LA 3BVZA 1XTCD 1V1PA 1L0YB 1LT3D 4RGTA 1YN5A 2R61A 2AQ2B 1TS4A 4RHRA 1JWUD 5FK9C 1SJED 3DWAA 1PZID 1PTOH 2WV6D 1V1OA 2ICIA 1AW7A 1SE3A 2QEJC 4O1NA 1PRTF 1BCPB 1PTOD 4DXGA 2AQ3B 1JQYD 1S5DD 1SEBD 5FKAC 1CHQD 1BCPF 1L0XB 2NTSA 1CHPD 1EFID 4NZLB 1I4GA 1TS3A 5ELFA 4C56C 1HXYD 3TSSA 1ET6A 1RF2D 3BZDB 3CHBD 2RDHA 1CK1A 1PTOC 5ELEA 2G9HD 1RCVD 5I4DA 1TY0A 1JWMD 1B44D 1DJRD 1DYQA 1LTAD 2AQ1B 1KLGD 1V1PB 2RDGA 2CHBD 1SJHD 1BCPC 1SXTA 4L6TB 1LLRD 2TSSA 1I4HA 1B1ZA 1RDPD 3BYTB 2IPKD 1FNWA 3EA6A 1TS5A 1PTOB 4Z9CB 5ELDA 4BWGB 3R8BA 4RGMA 1D6EC 3DWPA 1PTOF 2NTTA 1PZJD 4DXFA 1LT6D 4RGOS 4RFBA 3SEBA 1EEID 1FD7D 2O2LD 5TSSA 1LTID 1TS2A 1T5XD 1PRTB 3BYYB 1LTSD 1YN4A 1LT5D 1ET9A 1TY2A 1EEFD 3O13A 2XN9C 1BCPD 3BVGA 1LTRD 3R2TA 2XRSD 3MFGA 1LO5D 1LTGD 3GP7A 1UNSA 1CT1D 5D3IB 1LTTD 1I4QA 1S5ED 1RD9D 1SE4A 3V05A 1D5MC 1M4VA 1PRTD 3KLSX 5ELBA 4RH6A 4UDUC 1F77A 1G8ZD 3R2IA 4RHSA 5ELCA 1ESFA 1JR0D 1STEA 1PZKD 1KTKA 4TSSA 1QILA 2SEBD 1GOZA 3EFXD 4ZYSA 3MC0B 3BVMA 2QILA 1KLUD 4L63B 5D3DA 1D5ZC 1S5BD 1YN3A 1FGBD 1XXGA 1I4XA 1SE2A 1S5CD 1HA5A 3OWEB 4RCOA 1HQRD 1FNVA 2IJ0A 1MD2D 1HTLD 2XNAC 1JCKB 1LTBD 2XRQD 1AN8A 1FNUA 3DWQA
chains in the Genus database with same CATH superfamily
2IGDA 4BBRG 2KJRA 2A69D 4OVUA 3SR6A 1STHA 1CQVA 2CJOA 3EFCA 1I42A 1RWSA 1WI0A 2C5LC 1VF5C 4TQ0A 4JI0L 4DK0A 1YJNA 4J1MA 1U5KA 2WYQA 1EWCA 1CA5A 3I2ZA 5J17A 4DNIA 3CCLA 3PLUA 1O7ZA 4DAVA 2M1MA 2WU2B 3RNEC 2QF7A 4AUQC 4C7ZA 3FRPB 4QF4A 3FMCA 3HOXH 4LFCQ 5E7NA 1TS4A 3GTPB 1I3QH 1SB3C 3GE8C 4IW0A 3PO2B 2FE8A 2LHDA 3U4ZA 2PNRC 3QWZB 4QL5A 4JCVE 2JXXA 3A54A 1WFQA 2X8XX 2R7FA 3ULPA 1NENB 1J0GA 4IM0A 1ZW7A 2ZJQA 4GKKL 4N9PA 4K0KL 1VF7A 2LKVA 4KKJA 3CC4A 1Z2MA 1Y8OB 3N6RA 1E90A 3VXWA 3W1YA 1GXDC 1DZ1A 2F4VQ 3BDOA 4IWQA 2OEOA 3VH3B 1K3RA 4DQOC 1N63A 2KUMA 1CZWA 2ZXOA 4R4QA 2LFNA 2VL6A 3HOWH 3CRKC 5HKHA 1FD6A 1NSNS 1N36Q 2KTRA 4BAXA 3EN2A 4DK5A 1Q1EA 1JWMD 2B8GA 2CHBD 4LF4L 2JZZA 3M63B 1BT0A 3N1ZC 1ACCA 3Q8EA 1ZXHA 3GS2A 2IY5B 1HZ6A 1OXSC 2JN4A 4A3BH 4BVUC 1E0ZA 3VYRA 2IPKD 5AZGA 3Q3MC 4LMQD 1CQFA 4GLSC 4JI2L 1WYGA 4P73A 1V43A 5ELDA 1WH3A 3MJWA 2R93B 3Q22A 2IO0B 2W82A 1KRHA 4JE3B 1MBYA 1WJNA 2VRRB 3KF8B 5CR3A 3S2HH 1PMRA 2ZXRA 4UY8C 2F0LA 1UEAB 4KY7A 2K04A 1AE3A 5I6WA 1A70A 1NDDA 2WS3B 4DUZL 1CA6A 2ZCBA 4P16A 3M4OH 4MNOA 1TY2A 3CCMA 1A15A 1E1OA 3A55A 1VZ6A 2LY7A 2MX2A 1J8CA 2EYMA 1QG7A 3GP7A 1H95A 1WY8A 2QDFA 4JI5L 3V61A 1L6UA 1Y1VG 1GUNA 1I4QA 3K7AH 3CWIA 1J19A 3AEFB 3CPFA 4IJHA 1RD9D 1WTWA 4JG2A 1PFDA 1YQ4B 1VMCA 4POFA 2M8SA 3O65B 4HCPB 2L12A 4X65Q 1H9KA 4G4KA 5ELBA 1KDBA 2DLBA 2R93H 3DBRI 1EY7A 2O2VB 1GPXA 3OMCA 3PHWB 4A55A 4X3TA 4EUTA 2K8HA 2J0TD 4WAFA 2WIIB 4RG1A 1G91A 4AQ7A 1E5WA 2AX5A 2KDIA 1FEHA 3APFA 3CMMB 4BKTA 1VZ7A 4B3TQ 2KTRB 3PO0A 4DHJB 4EQOA 1XNQQ 3VUWA 3UDFA 1C4PA 1EO6A 2EYLA 3OWFA 4DR3Q 2R2OA 1HQMC 2JY6A 3H6MA 2KOXA 2EYJA 4HDQA 2AHOB 4KKUA 4LFBL 3NY5A 3I4OA 4ITKA 3HOZB 1RIPA 3K7AB 1VRAB 2LI5A 3TZDA 5DM63 2KHSA 4K2KA 1XYIA 1EUVB 3OLMD 1WYDA 3KYCD 5L37A 3M95A 3U7DA 1WVLA 3QK0A 2C9WB 3I5JC 1N34Q 1QOGA 2EE1A 2RMMA 1YHBA 2R7ZB 2KC1A 1GUSA 3PIPA 4QQBX 4KIKA 1WTXA 4PZ7A 1L1OA 2GI9A 1FJGQ 2A6HC 3T53B 1FRRA 4P7IA 1FXIA 1DCZA 5GADC 1CJEA 1KM7A 3ONSA 3ND8A 1OXTA 2BH8A 1AW7A 1HZAA 3JC66 3NWSA 4OIJA 2QDLA 3U9OA 4QJFA 4C3HB 4BBSB 4GNXC 3N1XC 1YNXA 4R4IA 1XQQA 3IAM1 5C1ZA 2MCNB 4L23A 3JAML 5EDSA 1E7ZA 1EY0A 2VB3X 2RQXA 2A6HD 3H15A 4IALA 4JIOU 4DWFA 4GDLB 2LXJA 4AYBB 1WCMG 1RLFA 2ASQA 4C3IG 5I6YA 1E10A 4DR1Q 3Q6BA 1U0LA 3VDYA 3S14B 3AE1B 1A2UA 2BB6A 2HDEA 1J6QA 4ZHPA 5IYCG 4ZKCB 1B9MA 1TKEA 2K0PA 3Q2AC 3ZIMA 1GUTA 5BN3A 1JOQA 2IO1B 3IXSA 4DV5Q 4CDFC 3A5ZB 2HCCA 4JK1C 3SVMA 2TSSA 1II3A 3NHHA 5IODA 4EEWA 3E3XA 3S1NH 1UBIA 1VMPA 3Q3NC 2EDGA 1VQCA 1FNWA 3Q8FA 3ZDTA 3M3JA 1YJ1A 2B63G 2H88B 3OAWA 3I72A 4O42A 4DR4L 4G3XB 2IW3A 3NTHA 1AH9A 4JC0A 3CXCA 2L05A 3FILA 3T3OA 2DYOA 4DV5L 4RFBA 4WWPA 3ZNID 4K3CA 3HOUB 3DPDA 1L0WA 5FOBB 2BT6A 3B08A 4C4VA 2JA6H 2INNE 2WKCA 3Q3FA 4ME3A 2KHJA 3RCZA 4EX5A 3QX1A 4CO7A 1VQEA 2X6LA 1JWAD 3A9KA 2KC2A 4A3KH 1BDOA 1CT1D 5C4XB 5DLQE 2L1AA 2PZUA 3U52E 1TKYA 2V4LA 3I4NH 1M8AA 1X65A 2F52A 3TMEA 5AJ3Q 1LQBA 2L76A 2E75C 2JRIB 4B3RL 3NXWA 5JVG3 3J80E 1HR0L 4K3BA 4DUYQ 1YNNC 3KLSX 1IBMQ 2ZNVB 3L2PA 3KUCB 5C3JB 3CCSA 3BDLA 4F88A 2IGHA 3WALA 2F3IA 5EJWA 2ZXPA 4KHPQ 4WWMA 1MI2A 5JEAH 1NCVA 3C46A 5LXHA 1YHQA 2QCPX 5CV8A 5JPNC 1HHVA 2WP9B 4US9A 4BFRA 3VUXA 3TRZA 4EQNA 3IVFA 1VQJA 2LRUA 1S5BD 2FJ2A 1SYEA 3TEWA 5BN5A 1OQQA 2JSOA 3ONAB 2V3NA 1G6ZA 4KKIA 1DOXA 2KCCA 4DV7L 2JA8B 3NBHA 2CKHB 3NVYA 4FNFA 3V62A 2KT7A 1D2BA 2IO3B 4IJLA 5IYBG 3URYA 4Q2JA 3P4RB 1EY5A 4RCNA 2J4XA 1PRTC 3RD4A 3GV3A 3VR6A 1NJIC 2UUAQ 3MXPA 2UUCQ 1S3OA 2I5MX 1EZ6A 1OO9B 4A3IB 1YX5B 3MXNB 4PS3A 3D4WA 4BBRH 1WF9A 5C3EB 3BK2A 4F8MA 2BDOA 1EUJA 4L5RC 3S17B 3W2DA 2KOLA 1B4OA 5BR8L 2MSED 2PKOA 5C4JH 3V6EB 1HH2P 4V0BA 5KHQA 4GGQA 2AQ2B 1XMQL 4MEMA 3TJPA 1SJED 1PTOH 2WV6D 3TS0A 3LX0A 1Z5SB 2KVRA 2Y0SG 2VB2X 3E9IA 1RODA 3W1SA 3CF6E 4IOCA 1D3ZA 4K1RB 3G71A 4A3MH 1XNRQ 4TUUA 1KDCA 1TS3A 1EIGA 3WOEA 1F2LA 3L3OC 2I2YA 2OF1A 1NAPA 4KKSA 3TS2A 1ET6A 2KWDA 3Q69A 1UE6A 4O0AA 5J39A 1EWIA 2F0UA 5A2QL 1X3EA 2RDHA 1QE6A 3S16H 2EMTA 3J7A5 4JOIC 3DQVA 1TY0A 2JP1A 4JI7L 5LMUL 1DJRD 1KH0A 2AWTA 4IPDA 4YY3Q 4MH0E 4MH8A 5M3MH 2B2VC 1Y1WG 3UI3A 4B0MA 3VR4A 3T1HQ 4IOAA 1X3GA 3RUZA 1SNOA 2WXOA 4B6WA 3TREA 1HNXQ 2KZRA 4LUVA 3RNAC 2F0HA 3EA6A 1QZHA 3HOWB 3E9SA 3GTOB 1ENCA 1VQ8A 1ILPA 3AU5A 2VUMB 1V5OA 2KTFA 3W5OA 1WGHA 4YWLA 1FXTB 2JU6X 4POGA 3JSVA 3OJ4B 1SLJA 3SEBA 1EM7A 4WWOA 2MPMA 2JYTA 1UEBA 4DPGA 2MA9B 2YVCA 1BMLC 3BYYB 2Z0EB 1ENAA 2KFKB 4JX1C 1TT2A 3IL8A 1SMXA 5DNFA 2XBBC 3TQYA 1MSHA 4EFOA 3JSVB 4IUMB 5IIFA 4HJ7A 1EF1A 2KYWA 4YSXB 3G6JB 2G3QB 2UU9Q 3VR9B 2M19A 4WJPA 2ID0A 4K0KQ 2WXFA 1HCZA 1SE4A 2EZVA 3IFTA 2R2QA 2V4IB 2INCC 3IFWB 4HK2A 4PYZA 1U4AA 3J7AV 3K5NA 1T0SC 3APDA 4GXBA 1N32Q 1CZPA 5CV7A 4IPGA 1ASYA 4GOPA 5I9OA 4DKAC 2B8FA 2I1KA 4MELA 4FYDA 1QILA 3RNUA 2Q2HA 1V8QA 1WJJA 2JJQA 2WP8J 4BY1H 1GNUA 1WZ0A 1C3TA 3NTIA 4PZ6A 5CGKA 2IT1A 5D3DA 2KQSA 4PYUA 2BVCA 1WJ6A 4KHVA 1PGBA 2LGXA 3ZJUA 4DFAA 4IUVA 2QIEB 2H1EA 2DWQA 5KHOA 1SR3A 4WRDA 3CMEA 3ZNZB 4R4OA 2CWAA 1F2ZA 4JI6Q 1T5EA 2WLBA 1L5PA 1M94A 1ZXIA 1OEYA 3FC4A 1S5FD 2PQEA 3PV1A 5IN7A 2BYTA 2CHWA 2DZJA 1FIQA 3DVNU 4LF8Q 1SBBB 1MKHA 2D3BA 5JHBA 2J0JA 2KMAA 1HE8A 5IP7H 3KLSA 4NKLA 4K6LA 2FXQA 5IGFA 3W9CB 1IKLA 4DV4Q 2CKZB 2HUGA 4FF3A 3DBLB 4GKJQ 1L1OB 5FK9C 1WGGA 2BKRB 1J5EL 2HT1A 3AM9A 3I55A 2KENA 3P1HA 3J7AF 1P7EA 1WGDA 1CI3M 3HKZB 3LGJA 2GBNA 2KJHB 3NVVA 4MGIE 4I6LB 3SE0A 1SNMA 1D7QA 4XDDA 2JWUA 1WTRA 2K01A 4GLAC 1HUNA 3TMPB 2IX0A 2KANA 4AIMA 3P1MA 5HGTA 2N78A 4X65L 3H8HA 5M3FB 3MAQA 3J7ZC 1ZXTA 4ZRPA 1KIXA 2LEKA 5IGCA 1K28A 1J5EQ 2K05A 3KF6B 3CSFA 4CKCA 3NENA 5AEKB 2L11A 2GVBA 2PMVA 1H9MA 3ULJA 4WQOB 1RCVD 1J7AA 4Y7NH 4B3TL 3E6ZX 3DCGA 1SFOB 3PCOB 3AE5B 2N7DA 5G5HA 1VCBA 2FUG1 5IWAL 2WXNA 4UP8A 4PS8A 2IHEA 2GOWA 2WAQE 1MIUA 4LNOA 1B1ZA 3MVVA 3D8GA 1NUCA 4A3JB 4HRSA 1CZGA 2JWZA 3NRZA 3W3AA 1YBYA 1TZOA 1GUGA 3B1LX 4M8MA 3AE3B 3S2AA 3VRBB 4J15A 5FJ8G 2D2CC 2HE7A 3AULA 3G48A 2CVRA 1G291 4G50A 1PTOF 4LF7Q 2LRWA 1T0QC 3E0EA 2K32A 4WWNA 4RGOS 1EY9A 1HJPA 2A8VA 3UDGA 4D2KA 2E2IH 1V9JA 4FLHA 1UH6A 3QOLA 3EBEA 3E5SA 5FO7B 3UE1A 2ZM6L 1OXXK 1PFMA 1FJGL 1N5XA 3T9LA 2C9OA 4OWWB 2BE5D 4GMVA 4LAAA 4S3SA 4DDGD 1BCPD 5IYCH 3ERQA 2QDBA 4HEDA 3WDNA 4LF7L 5E4XA 3SK6A 5C4HA 1N61A 1K8OA 2KVMA 4EOYA 3HZXA 4JW0A 5D3IB 3I73A 1PV4A 1MVKA 2WXKA 1SIFA 3GTOH 5BMHA 3PREA 4YIJA 2K1FA 2B2UC 2VUMH 1ZKHA 3V05A 1YJWA 2BWFA 2J53A 2BE5C 4AH6A 3GTGB 5ELCA 4A3DB 3AEDB 4YTNB 2NN6H 4URKA 2K5PA 4X6AH 2HDMA 3BIID 4MM3A 3J80L 1L7YA 2OXPA 3BVMA 1F2YA 2VUMG 2M00A 2B2YA 5JJIA 3PHXB 1RYJA 4P6VF 3CMAA 5L95C 2K03A 1HR0W 2RF4A 5KYIA 2YU9H 4AQYL 2Z4IA 4A76A 4L2YA 2F3WA 5D7GA 3NS8A 1KAAA 1ISNA 1S3SG 2WX0A 3LJ3A 3EIVA 5BYQA 3QJYA 2I0QA 5LXIB 3MHBA 4Q5VA 4HR7B 4FXGC 2M2LA 2AKWB 1I4RA 2W54A 4YSYB 2AWNA 2GRIA 3ZVVA 3PIO3 5CBAE 2F0MA 1EFWA 1E2VA 2MWSB 1R4NB 1SMYD 1HPCA 3RZOB 1BUVT 4HCSA 1D5XC 5C3XA 1GUWA 5EKIA 1L2FA 1EZ8A 1SF0A 2FFKB 1HNWQ 2N0SB 2PW9A 4HJKA 2F0TA 5JVH3 4DXAB 1TWCB 3JVZX 2LXAA 4HROA 3RZWC 4DUZQ 1F52A 5IT9E 3ZJVA 2HHHQ 2IY1B 3UIPB 3VYUA 5H8YE 3I7FA 1WTVA 1TWAB 1R7SA 3SK5A 2F0NA 3SK4A 3Q6SA 2D10A 5FLXc 1BNZA 1YX6B 1Y1WH 2JYOA 5LL6S 4O1NA 3W1GA 4B3ML 3GTKH 1EL0A 1JJCB 5JXVA 3IAS1 1JJ2A 1JQYD 3A1QB 3S1QH 3M4YA 1R4MB 1T9HA 2J7ZA 1B53A 3I9V1 2E5LQ 1EFID 4DUYL 2K5VA 3M62B 4KD3A 3P20A 1LACA 2ZT9C 1GUAB 3RNCC 3NPPA 3OOCA 3K81C 2HQEA 2G4DB 1JW9D 3RZOH 5D6JB 5J2RA 1YI2A 2K52A 4JI1Q 5IYDH 1RTOA 1XD3B 2ZPNA 1Q8IA 2QGQA 4RWSC 3HK0A 5FR6A 4A3OA 2LVOA 4E3CA 1VS0A 3IRBA 3QCAA 1B44D 1QZGA 3KDFA 3TUOA 3UI2A 1ICWA 3MEFA 4P75A 3PTFC 3KYDD 1WWTA 4GLXA 2EY5A 4DK6C 4IFDG 4IFDJ 2G9DA 2K39A 2A73B 1ONLA 2YV5A 1TIFA 1XMOL 2AL6A 2XGTA 1Y56A 3HP3A 1IBML 2PE6B 1SNDA 3L08A 3MTSA 1A3TA 5K5PA 3RLOA 4DHJD 1VDZA 2KDFB 1EYAA 2A5HA 4I6NB 1N33L 2EY2A 1HUMA 5C5LA 4X64Q 2PI2E 4A3FG 2CU3A 4KSKC 2M0XA 4E71A 4HVBA 1LT6D 4UPAA 2FCSA 1VQAA 5KEEA 2LXCA 1LTID 3OSOA 3GTJB 4KZ0A 2MNAA 1T5XD 4A3BG 1K8RB 3ICEA 5FO9B 4BOSC 3T1HL 1Q90A 3EROA 5K36H 2QMTA 1ET9A 4HMJA 1H4RA 3TCAA 2EYPA 2VNUD 1LTRD 1UWVA 3HOZH 2XRSD 2CS4A 2BYVE 2AL3A 3TBLD 1EOTA 5GXGB 1DM0B 1Q8KA 4PK1A 3RN5A 1PA6A 1V6EA 4DAYA 2XTIA 2UUAL 4ZKBB 2J52A 4LFBQ 4JYAQ 2A69C 3PUVA 3M7NA 2F0IA 1DXMA 3M4QA 4NXNL 4UDUC 2E2HB 1LM0A 5G3LD 5IGGA 1Z47A 3AECB 1B70B 3X3NA 3F2BA 4W9IA 2BYEA 5COYA 2NR2A 1V1QA 3OTOL 3CC2A 3AB5A 2DZMA 1L4ZB 4JLCA 1OTRB 5G5GA 4LDTD 3QC8B 3ZTDA 1WXSA 1BF4A 4K7WA 3VA7A 2K1BA 1LYLA 1VQBA 2RDFA 1VCIA 4WJQA 2PYKA 4HJ9A 2JA7B 3T1YL 2JA6G 1N60A 1UF0A 3CCEA 3ZTCA 2X69A 2MH7A 4BOZB 2UXDL 2I38A 1N9WA 2NZOA 1JWSD 4XWWA 5M5WH 5T8IA 2Z9HA 2E76C 2MP1A 1WYWB 4OHJA 5LNK1 4DK1A 1QOBA 2NB0A 1S1QB 2KJXA 4H44C 2RCFA 3N20C 1N36L 1JMCA 5J22A 2DAFA 3I91A 4YCVA 1JC7A 3GDEA 2BS2B 3DWAA 1HZCA 4ZRJA 1X32A 1HZ9A 4A3EH 2EPBA 4C3HG 2K3UA 2KDMA 1N32L 1QVFA 2A74C 1HZBA 3A74A 2KLCA 1H9SA 2KNBA 4C00A 3G4SA 4HJGE 4ACFA 1DOMA 3PUZA 1ESRA 4OVZA 2A1AA 3HKZE 4C3IH 4QY7A 1V2YA 1WXVA 5IP4D 2K5DA 2JUOA 4ILWA 4PNYA 1T0YA 4REZA 4PMWA 4JI8Q 4BZAA 1ZGUB 3UE0A 2E6XA 2JXMB 1Y1VH 2Z6KC 1Q12A 1O80A 2K5NA 3MZ5A 4OXPA 2MEKA 3KVFB 4ANUA 4K8IA 1F1HA 1JROA 4HEA1 1DYQA 1LTAD 5T1GA 4LNKA 5E3FA 3AE4B 1AZQA 2CCZA 1SJHD 2NMQA 5EE9A 5K36G 1R4QB 1KC8C 2WDVB 4DV1Q 1LLRD 2XEWA 2AEHA 1YITA 3HS0C 2Q8IB 3RR5A 1FXAA 4GDLA 2I1JA 4ALPA 4KGTA 3ZKJC 2GBKA 4Z9CB 2IO2B 2K4KA 4LTUA 3QAQA 4ODGA 3N9YC 4EE2A 4NAWB 2UUBL 1Q82C 2WINB 1YEZA 1J9OA 3BDCA 4JI2Q 1WXMA 4W9CA 4ZDVA 5M5XH 5C44B 3FPPA 3HHMA 2MJ8A 1FD7D 1KRTA 3WANA 4LFAQ 1K3BC 4YL8A 1LGRA 5KRUA 2NVYB 3PRMB 1QOHA 3TBIB 1WX9A 2KHWB 4NB3A 2DBYA 4FN2A 3CP0A 4C2MH 5G55A 3R93A 5D2MB 3R2TA 1TJEA 2NVUI 3CKIB 5JJKA 1YNTE 2E8GA 4HSPA 3H7SA 4HN7A 1VLBA 2KDEB 4YT0B 1PUTA 1IGCA 2KD0A 4GDKB 3DVGY 2UXCQ 1D1IA 3NVZA 2O6VD 2H5XA 2KAJA 1E7PB 1T6BX 1JB3A 1STEA 3T13A 5CV9A 2D07B 3EFUA 1YVCA 3U8ZA 2K28A 3PF4A 1KL9A 3IHPC 2NN6G 3H0GH 4L1BA 3U9SA 4KVGB 1I50H 1D5ZC 2EQSA 3DM1A 2ON8A 1WR6E 2KDBA 1S5CD 3OWEB 1FCCC 2NPTB 1CMXB 1NR4A 3C1FA 2JA8G 1FR3A 3RNGC 1TQOA 4QIWB 2NVXB 4GOPC 3PZ8A 3GTPH 3L54A 4ARIA 1GVPA 1HTPA 4UHVA 2D3GA 2NUCA 3DUZA 4TKNA 1D8LA 2ALYB 1XLQA 2NVQH 1IW7C 3GTQB 1FFVA 3S1MH 3J81c 1A3UA 2ZVNA 2V3SA 4GIVA 1OXUA 4IWPA 2MP2A 1JMLA 1AZPA 3NE5B 3Q8DA 1ZPSA 3IT4B 3J80i 3BZCA 1KJTA 4OZAA 5EQ0A 5CHWA 3K7UC 1IW7D 4M0WA 2V3PA 5C4XG 1V1OA 3M4PA 3AE7B 1SE3A 4MGZE 2BYFA 1CM9A 3NUHB 1YIJA 1ZKOA 4DXGA 3PO2G 1EF5A 3BS1A 2AQ3B 3PUXA 1CHQD 1TWCH 4XDXA 2NTSA 4N58A 4NZLB 2D0PA 4A3BB 5EBDA 2Q8TA 2MHVA 3PV0A 2WACA 3T8MA 3D32A 1PDXA 2DUDA 5T1IA 3K5LA 4A3FB 1XPOA 4IO9A 4B9WA 1QWYA 1R4NI 2CR5A 2J42A 4XXEA 3Q3OC 4M0WB 3SD5A 1A5RA 3KUPA 3RT3B 4A3IH 3RNFC 5DPRA 5C6AA 4WORA 2KA7A 3AFQA 1WJUA 1KLGD 4MDKE 1KF6B 1I6HH 2WXGA 2L5TA 1IXRA 4XT1B 2JF5A 3P75A 4X3SA 1PH7A 2NS5A 1YD8U 4L6TB 1VQOA 3JAMi 4RMAA 4OWXB 1WTQA 2PE9A 1FVIA 3K9PB 4ZAIA 4FDBA 1PVOA 3AXCA 2TMPA 1WXQA 1PTOB 2K14A 5C0XG 5M5YB 3PZDA 4RKLA 5JZEB 5C5MA 3VH4B 1YNND 1GC6A 2NYZD 4FJVB 2RA4A 2MRPA 2O2LD 1WCMB 1M90C 2KACA 2MBHA 1C0AA 1J7BA 2VZKB 2G5DA 4LNQA 4P1CC 1C77A 1LV9A 2EKIA 4GKJL 4QGUA 1J8IA 2ATWA 1Q5WB 1XLOA 3H7PA 4J3OD 1QF6A 5MPOA 2WU5B 1PH9A 3L4PA 4ID6A 2PZWA 3BVGA 3MHSD 2ZJDA 4US8A 4W9FA 4P74A 3GO5A 1UBQA 5G2NA 1TWGB 2B2VA 3SHLA 4KY6A 5GAGC 3FILB 4QB4A 3TZUA 3GTMB 1LTTD 2F0JA 4A3GB 4W9DA 3TL5A 1KRSA 5DM73 4LW1A 4CDCC 1F9PA 1I94L 2F4IA 3DLLA 1PRTD 3U4EG 5M5YH 2OCEA 2N1WA 3FKIH 5IT9L 1DD2A 1SAPA 3ZXRA 2EJFC 4JI3Q 3PIOA 1CKNA 3MP9A 1A8VA 2ZPYA 3W1SC 1KLUD 4HIMA 2HQLA 2REXA 4LWCA 2WGSA 4DAPA 2K6AA 2A68C 1XMQQ 1ILQA 2JA7G 2R7ZH 3AE8B 1I3QB 4KTAA 4CYEA 3PIP3 3P2BA 3AB9A 1AN8A 1SROA 2F0VA 1N33Q 4KV6A 3DWQA 1VD2A 4IZ8A 1CKOA 2D5GA 2QEXA 2C35B 2N3SA 2P5ZX 4CKBA 3GV6A 5BN4A 1F2RI 1ZDXA 2OJRA 2F0KA 2ACZB 4MTKA 3IAYA 1IPGA 4JV5L 5IA7A 1YMHE 2A68D 3M3YH 1W2BA 3I4LA 2YLMA 1WTOA 4HAEA 1UUPA 3V3XA 5D94A 3BG3A 3HOVG 4HJ8A 3U50C 4A3DG 1NYRA 4C1NK 1WXAA 1WZ3A 1B50A 1RKNA 1XTCD 1YN5A 3ZUNA 3AU7A 3ZJYC 3C1EA 5CYUA 1IYVA 4FXCA 4XQNA 3B6YA 4TVAB 5EGTA 3AFPA 4DV3Q 3L16A 4BKSD 3P7JA 2DZKA 2PQAA 1PTOD 1N8RC 2UXDQ 3RN9C 1AP0A 1P8LA 3TP5A 1IBKL 4NAWA 4A90A 2KK8A 2NVQB 4B3SQ 3HOYH 3SHQA 1UE1A 1ZEQX 1C48A 2F1MA 3PMFA 4AOFA 3AN1A 1RF2D 1STNA 1SYGA 1PH1A 2FAZA 1PTOC 1E9MA 3H7PB 3A7AB 4RF0A 5I4DA 4DR1L 4E6IA 1PH4A 1PHJA 4IUUA 1PFBA 3U30A 5J18A 5GROA 3ZJTA 3N30A 3MWYW 1YJIA 2ZJPA 1GUOA 5E6PA 3BYTB 4EKUA 3L0OA 3C0RB 3J7YW 1Q10A 5IP9H 4FHJA 5J3BA 1O7LA 3PF5A 1SYFA 2A6EC 2V0GA 4KN7C 3M85A 1E24A 1K8AC 1IL8A 5DPWA 1HNZL 1G6PA 1TT5B 1Q3LA 3VYSA 3AMUA 2KEDA 2NTTA 5C2TB 1TWHB 4WQMA 2N9EB 3HOVH 3DOWA 3BK1A 4L5TA 5M3FH 3QWNA 1JQ4A 2KX3A 4OW0A 2ES2A 1EYDA 5HI1A 1K0RA 2IWHA 4KGSA 4EZJA 1MJDA 4NY0A 2RHSB 2LD9A 1WSPA 4LK1C 2OT2A 1A62A 1UWXA 4JL9A 1AYFA 2NVTB 2O2VA 4HJAA 1PDQA 1V8CA 1WMHB 1WM3A 5C44H 2UUBQ 2E5LL 3HFZB 4YSZB 2K50A 1VQFA 3K5OA 1GB4A 5CV4A 1F77A 3RPFC 4RHSA 3VVWB 3WCQA 1B8AA 2EELA 2WXMA 2DY8A 2OHFA 1KTKA 4LK0M 3NHEB 2M0AA 1DOKA 3UGBB 2QCZA 3AQQA 1JB7A 1AWDA 4II2B 3PLVA 3H1UA 2PTLA 3HOWG 3HEJA 4DN4M 1BOSA 1PXUA 5IYDG 4EQPA 4BBRB 2EJMA 2M56B 3UQBA 1K8MA 1L6VA 1I4XA 1F9JA 2W9NA 3PQIA 3RMKC 3H9DA 5GMVA 2KEEA 1MD2D 2B76B 4RM8A 1JCKB 4MHEA 2UU7A 1CTMA 4AYBE 4WJNA 3B2GA 4TRDA 5KNCA 1IKMA 2JA5G 1VQGA 5EPKA 2L52A 3TIXA 4GZYC 2PZTA 2WDTB 4HDOA 2LXKA 2PMZE 5IT9c 2Z8LA 3BZKA 4XT3B 4X66L 1V80A 3E0JA 1QUQA 2WNMA 5ISRA 1BXTA 4ULLA 4ZHOA 3T3NA 1B9RA 2IL8A 1EU4A 1TWFH 5C0XH 3P4PB 1HZ5A 2BA0A 2KN5A 4RGTA 1V1PA 5JEAJ 4P2CB 3DVGX 1F2MA 3DVNV 2PPHA 4RHRA 1SN8A 2K75A 2XWBB 3R66C 2VY3A 1NYQA 2J7QB 2Z6BA 1N34L 3A0JA 2Y0SB 4PQXA 1X9NA 3U4VA 2Y5CA 1SYCA 2AUKA 1UE5A 1F9RA 1EQQA 3FKYA 1ZP0B 4ICUA 4KKTA 1CSPA 1S40A 4ANWA 2MBQA 1RAXA 4ASWC 4LF9Q 2Z0SA 1B9NA 5JOBA 2FUHB 1UWMA 1U9RA 1CHPD 1UGJA 2VS1A 4USAA 1E22A 1E3PA 5J1ZA 3PO3H 4CGYB 3UDXA 4KX6B 2R7ZG 2NN6I 1GJXA 2BF8B 4DAMA 1IBXA 1SDFA 4IPCA 1X55A 3PT2B 3BZDB 2OJWA 4ZUIA 4OVVA 3NZ3A 1A2TA 4YWMA 4FF2A 4NAMA 4OELB 2R92H 3C8YA 3HOZG 1XWEA 1E7UA 3NS1A 1MG4A 1K83B 5A35A 2Q5WD 2RSNA 1B7YB 2PEAA 4YTMB 3B0AA 4GN4B 1S4ZA 1Q0WB 1SE9A 2JXTA 1BCPC 4G57A 4JI0Q 3A4SC 2GLSA 4DBGA 2FMCA 3ENEA 2G45B 1V97A 3F2CA 2E2HH 2K8CA 2OEDA 4IWOA 2RD0A 3QIJA 1XX8A 1N5WA 5EKKA 4TQ1A 2LGYA 4A3PA 4IUNA 3MTNB 4ZUJA 3QB3A 4IUTA 2PQAB 3CCRA 4HIDA 3E9HA 3EQLC 3TEHB 3M7GA 3Q23A 2HJ8A 2J0KA 1HA6A 4K14A 4P1BC 3L9AX 1Q1OA 3PPAA 4IFDH 5JPMC 5M3FG 2EYHA 4XZ4A 3DMUA 1LT5D 2O6VB 1HFGA 4X62Q 1NEKB 2KO3A 2PIAA 1MHHE 5I9PA 4WJOA 5L83A 1H8CA 2EMSA 4HCEA 1LTGD 1QB5D 1YNJC 2HIVA 2L15A 2CQOA 4A3LG 2GB1A 4NMZA 1C4CA 3ML8A 2KXJA 3KWLA 3DBSA 2EY1A 4IM3A 4KJOA 1Q46A 4OX9L 2YTYA 1G6JA 3KUZA 1AARA 1H9SB 3A8JE 3FEWX 2VH1A 3RD2A 3E56A 3KBGA 5EKLA 2ZW0A 3NTKA 4GNXA 3EFXD 4ZYSA 1QQRA 4A3IG 1EY8A 2F0PA 3BJUA 1YNJD 2PW5A 4G7HC 3S2HB 1N6ZA 4L63B 1LXDA 2CHZA 3OW7A 4FF1A 1LFDA 2R7DA 1WTPA 3P4QB 1RL2A 4IN3A 2BS3B 3NELA 2E3TA 2B3GA 4BBSH 2NCNA 3RFZB 3R7RA 1FNVA 4KHPL 2N55A 4LJPB 2FMMA 1GO3E 2WXPA 3AEBB 4LCDE 2MFIA 4RAUC 4M8NA 2ICEC 2L7RA 1VQMA 2JT4B 4AP4C 1QCBD 3MXUA 5LHY1 5HURA 4Y52H 1VQHA 1R4MI 2VQEL 2K5HA 2WXRA 2PVGC 1EQRA 4A4IA 4JI6L 4FVMA 2UU9L 1WX8A 4W9LA 4JWSC 2LZ6A 3OIQA 5AFWA 4IC7B 2L4NA 3TEXA 3ERSX 4AYBG 1QLBB 2F0FA 1C8CA 4K6DA 1GG3A 3D6CA 1SSNA 3BWUD 3JYUA 2VQFL 4BBNC 2WX1A 1IBLL 2Q2IA 3CAMA 4A75A 1P9DU 4K7SA 4LLGM 4LUOA 4DV4L 5BMIA 1L1OC 3W1BA 1JRPA 1NE3A 3AEAB 2BDNA 4DNRB 5M3MB 5BO4B 1PRTF 3NBIA 5CBEE 5FLMG 3J80c 4ZRZA 1U4MA 1V9PA 4OIKA 4DV2Q 1KQSA 5M5XB 4A3CG 4GB9A 4ZK9B 3DWGC 2UXCL 5E6NA 1XMOQ 1BCPF 3D3RA 2F03A 5E6OA 2CQAA 1PYSB 2KECA 2UXBQ 4I6PA 4YCUA 2KKCA 5IGDA 5CC4A 3S2DH 4UP9A 3I63C 3HOUH 4WJ3M 2DJFC 4B0EA 4KHZA 5C44G 2K25A 2Y5PA 1ML0D 3R7QA 4F7ZA 1E2ZA 3N32A 3UINB 1KNAA 1FL0A 2E74C 5JEAG 1BBXC 5EE3A 3NZUA 4DDID 4N6EB 2FIFA 3ABVB 4K5VA 2GBJA 3MJ5A 3S1RH 1TU2B 5GAHC 4MZ9A 4OWTB 1Y8PB 1SXTA 2EYOA 2R6GA 3I4NB 1WFYA 4XWTA 4DF7A 1Y8NB 2H4OA 2B3AA 1KLVA 1HFNA 4GSWA 1PFNA 3WIMA 1QNKA 3BU2A 4X66Q 1TS5A 1E2WA 3TEZA 3PO3B 4KI0A 5HHDG 5A2QE 2BTEA 3OW2A 4JYAL 1C76A 2MQJA 1OGWA 1GKHA 1RTNA 4DAYB 1EIYB 2N9PC 3EUB2 3DWPA 3H0GB 2AYOB 2O5JC 4CHTB 1PZJD 1FFUA 2MGSA 3K57A 1QVCA 3JW0X 4BBNF 1E8XA 1ZYRC 4FHKA 4QCLA 2RR9A 1YQBA 2NBUA 4APVA 2R92B 4IG7B 4NDXA 5C4ZA 3A9JA 3Q24A 1K83H 2YEPF 3V6CB 4MIUA 2KCMA 1WGRA 4KSLC 2JA8H 2XN9C 2LHEA 2OOBB 2IX3A 3K5MA 3DHIC 1Y1VB 3ZNHB 3ER0A 4GU2A 4RMFA 3S1RB 2WXHA 4DHZB 3TN2A 2L55A 2V4DA 4GN3B 3X23A 2K33A 5DEHA 1E7VA 1HNZQ 2L8JA 5GAEC 2ZW1A 3AEGB 2RPQA 4LNIA 3DHGC 2PPBC 1AE2A 3F2UA 3S24A 3PRPB 1WI5A 1ZOYB 4E74A 1K51A 1EY6A 4DR7L 2M9VA 3R2IA 1AFPA 1I5FA 1ESFA 2H89B 3RI7C 4CJ2C 4B9XA 1B3QA 2D62A 4JPBW 3PRZA 4MSMB 2LS01 4ARCA 2QILA 4DU9A 3FVQA 2A19A 5CV6A 1EQTA 3QA8A 1FGBD 2JA6B 1BQQT 4A3JG 2AWOA 2KMCA 1SSOA 2MP2B 1HQRD 2W3SA 4J6HA 2ZM6Q 4HSVA 3BY4B 2DN8A 2Y5BB 2EVBA 3QHTA 1VQ5A 3NQTA 1X3QA 4A3MB 2IYDB 4MGKE 2E2JB 2EXDA 2JQRB 4MGYE 5IGEA 1EIHA 3T16A 3VQIA 4CBVA 5E1FA 3ETRA 5C3WA 4NP5A 3DWMA 4NQLB 1EYGA 1UAPA 2GA4B 1HNXL 4C7YA 2C7MB 1A6XA 1PH5A 2PMZB 4H2AA 3OYYA 4N59A 4OZBA 2WHIA 3FDTA 3OG5A 5DPSA 5IOIA 3RYTA 3CCVA 2BB5A 2MO0A 2BW2A 2CW0D 1JWUD 1NBWA 2HHHL 2RGFA 4KIKB 3AE6B 2A5UA 1PZID 3VDZA 3D31A 3HKZG 2FBWB 3RMHA 4IM2A 1WJ4A 4BY7H 4MSQB 1ZE3D 2NWGA 2F0DA 1I94Q 2Y0SE 2EY6A 4CDDC 2N9KA 5E4WC 1TWFB 2Z4HA 4PZ8A 3Q3JA 4AS1A 4GLVB 3A5UA 2PW7A 4XE0A 4GOCA 2NVXH 2CW0C 4IOIE 3HOUG 2K7VA 1IGDA 3SK8A 3WAOA 4ABNA 1RFKA 4NNJB 2JQOA 3LXFA 4RF1A 5C3EH 2G4SA 3PSEB 4GN5A 1Y14B 1T3QA 1VQPA 4LF4Q 4FJZA 1BR9A 3LNNA 4O2DA 4A6QA 2OQ0A 3GOEA 2KCNA 4QUCA 3CD6A 1V1PB 4A20A 4C3HH 2L0CA 3GTJH 3KQ4A 3L10B 4MM3B 2FCNA 3GD7A 1HR0Q 2F3VA 4JBKA 4L5SA 3P63A 1RDPD 1BVSA 2LVPA 1STGA 2EIFA 2L3ZA 5BYRA 2CHXA 4KN4C 1STYA 3KK7A 4JV5Q 4PS7A 4BWGB 4A3KG 4B3MQ 2ZEQA 5AZHA 4C3JG 4NPSA 2GBRA 1FYCA 2JVCA 4PV1C 1SNPA 5CHFA 4BA1I 3QIAA 5TSSA 2B2WA 1JRUA 5DPTA 2LUEA 1H9RA 1TS2A 5H92C 3ZQ4A 4DR3L 5CORA 2LVQA 2LMCA 4LFAL 1MGSA 1EEFD 4K7UA 3ZDMC 1UELA 3B2FA 5BMGA 1X54A 3CCJA 4FADA 4BBSG 1DOIA 1QUQB 4FXDA 2FCMA 3NG0A 2MLBA 4LUZA 3L13A 3M3YB 4KLKA 3RNBC 3FPUB 1NMFA 2DYMA 1WE6A 4I7AA 3K59A 1C7YA 2CWPA 4X3KA 1EOVA 4IPHA 3UF8A 1M4VA 2BOSA 5CV5A 2QHOA 3EECA 3HVZA 2WXLA 2X38A 3HOYG 2PNHA 1ROEA 3WA0A 2W55A 1STBA 2IX1A 4DV7Q 1VQ9A 2MBOA 3MC0B 1OTCA 3SDLC 5D65A 3DBRB 1NR2A 1XNQL 4LF6L 2D3AA 3Q0AA 1C9FA 4Q0FA 4NXMQ 4WURA 1PGXA 1PGAA 2ZVOA 3EC8A 3VTVA 1SE2A 4RCOA 5EE1A 2SAKA 2QKIC 2XWJB 3UIOB 3LB8C 1Y1WB 3NWTA 5EAYA 1X3PA 1LT4D 4UP7A 1OQYA 4HXDA 3SU8X 3RUIB 5JJZA 2L0TA 1PFSA 4B3SL 1P1AA 1V5TA 2C60A 4KK7A 1OEYJ 4KZCA 1ICFB 1WOCA 4U673 3NOBA 3OJ3A 5IYBH 5BYSA 4X62L 3CCQA 5FJ8H 3A9KB 4YTPB 1XF5L 4XQQA 1QOFA 3NVWA 3TP6A 3BVZA 4JBMA 4FXKC 1L0YB 1LT3D 2DENB 1HEZE 3RZDB 2MJDA 2R61A 4KDLB 4WJWA 3KW5B 3LYYA 4A9AA 4NPNA 5LMNL 2QW7A 2O4XA 3OTOQ 1RRBA 3VR5A 1ASZA 2E2JH 2WFWA 3GTLB 4K5WA 3ZYYX 2ASBA 1TWHH 5FKAC 1SEBD 2N9LA 4KJNA 2WXIA 3P42A 5LLIA 4OX9Q 2F4VL 3PVLA 4FP5D 1JWBD 1YHAA 2KX0A 3W5VB 2MUYA 2CU1A 5C3EG 1F0ZA 1JOKA 5C4JB 4BA2I 2HD5B 3CHBD 4A93B 2N7EA 2KFKA 5KYLA 3HIZA 1L4DB 1HTOA 3ZW3A 4LFCL 2D9UA 4PMCA 2LJ5A 1Z6HA 2EYFA 3PZ7A 3MEHA 1EWYC 1OFFA 3K0YA 2QSDA 5I2YA 2LGDA 3NZSA 4LF8L 3A56A 3AYHB 2WB1E 4DR4Q 3HOXG 4B95A 3CRLC 3K8AA 2N88A 4A3DH 5FO8B 3A1QA 2GVAA 3NK9A 4QMGA 4MTNA 4RGMA 3X0WA 1EY4A 4PT5A 5KNBA 4XGAB 2A4ZA 4DXFA 3QO2A 1WD0A 2F0SA 3S16B 2JSVX 1JE4A 2RKSA 4ZYNA 3AE2B 1PYBA 3AI5A 4P72A 2VQFQ 3WAMA 1ZDVA 1K73C 4DR5L 3ZRFA 2B2TA 5TR5A 3EJIA 3PSIA 3J9CA 4CKEA 1TIID 2BPSA 4HPLB 1MJEA 4JI1L 3VR8B 2F0GA 1YQ3B 3MFGA 4KDIC 4A8XC 2UUCL 1K50A 1BKBA 2IZVB 4ZQ3A 1U4RA 1A0IA 1LM8B 3CSTA 2VQEQ 4PG3A 2B2YC 3J81L 3UQAA 1WD1A 4GDKA 3MFYA 1DOYA 1WX7A 4HKZE 2PCFB 3NQIA 4DHZE 3Q8CA 3DDCB 1JR0D 1J7CA 2WXQA 4A3CH 4IUPA 3S15B 3NEMA 4YWKA 2B2UA 1K52A 4A3KB 4XTCS 4HIKA 2E2IB 4G7ZC 3KBXA 4R8NA 5C4XH 1DONA 3WAPA 2B63B 4YXDB 4BXXH 2PI2A 2C7NB 2D11A 4JVZA 3TP7A 4M00A 3D4DA 3HRDD 3ZRCA 1XXGA 2NZHA 1CKNB 4HTHA 4OZCA 1E8YA 1VZ8A 2JYEA 2K6QA 2I5LX 4N9TA 3T56B 3HVDA 3I90A 3T4AC 1EU3A 1E0BA 1LABA 3PUWA 1A3VA 5EPJA 1XLPA 1RM6C 3VFKA 2WQYB 4DGZA 1NMGA 1KDAA 3G6EA 2WB1B 3I56A 4RNAA 4C3IB 4XYCA 3KH0A 1DOLA 3GTGH 1ZUD2 3VTWA 1PYWD 1KXLA 1PH8A 1VQKA 4C3JH 3G7LA 2N8NA 3UDIA 5IP9G 5IY0A 4OO1I 3S15H 1EQVA 5IP7G 1TKGA 1UGMA 1CUKA 2GMIC 3I4MG 4H0LC 4BS9A 3N52A 1GM5A 4EGVA 3CQZH 1U4PA 3ECIA 3EGRA 1BCPB 4DR7Q 2FNJB 5C0XJ 1F2RC 1MHWC 4CJ0B 2SNSA 4X57B 1I6HB 4II3B 1GB1A 3OPOA 1L0XB 3DHQA 3ITPA 3L0WB 3GQBA 1C4AA 2MJ3A 3WWVA 2A6ED 1MHXA 1SNQA 1IBKQ 1D1KA 3T1YQ 4FF4A 1S72A 1JT8A 4LF5L 3RULA 2BKFA 3NP8A 1EYCA 2I46A 1K0SA 1P0RA 5NUCA 3PGEA 2GBMA 5ELEA 2M4NA 3PS6A 2K5WA 3HGBA 4BY1G 2LMCB 4MT5A 4OL7A 1WTHA 2ZTEA 3CW2C 3QR8A 4DV0L 1JOOA 4F7XA 2JPHA 1FGUA 4LNNA 1TWAH 1VQ4A 3NJTA 4KMUC 4OO1G 1HNWL 5IE8A 2KMMA 3R3MA 3VTUA 4LF5Q 1KD1C 2SOBA 3FHWA 3V96A 1XJVA 4GKKQ 2NBFA 3PUYA 2XK5B 1V49A 2B2TC 3IFDA 4M02A 4ME5A 2IBIB 2MBEA 2DGYA 3AEVA 2MBBB 4MACA 4OEMB 3FP9A 3KFUA 3GTMH 4A3GH 2HIXA 4A93G 1W6JA 3K9OB 1IHZA 1GAQB 1EEID 1VQIA 2YEPB 3CCUA 4AQYQ 4R3DA 3I70A 3IKJA 3PGZA 2V1CC 2BCOA 4XX5A 4HJ5A 2WAQG 4N8X1 1VQ6A 3FKIB 3LWUA 4LJOB 3SFEB 2D5DA 1CFMA 4R4CA 2KVZA 1F9QA 1QT9A 1MI0A 1T0RC 2LJIA 1XTDA 1LUZA 3OHXC 2BQQA 1QKZA 2K6DB 3N3KB 2OTJA 4V190 1IYUA 5JHAA 1S5ED 3C2PA 2UXBL 2LGSA 2KQ3A 2KCTA 2WAQB 2KN4A 1D5MC 2K9XA 5ELNA 1KABA 4W9HA 4IUQA 4G0NB 1G8ZD 3LWEA 3F8TA 1XPUA 1V86A 3NSWA 1MJCA 4TSSA 3S1MB 1MFWA 5C0XI 3HKSA 1X6OA 3HUIA 1GOZA 4H13C 1L2NA 4B08A 4R4TA 2KWCA 4FA6A 2JEBI 1YZ6A 2R93G 2L1BA 2JZ3B 2I07B 3SDZA 1GHKA 1KFYB 4L8JA 1TR5A 2MO1A 1IBLQ 3STBC 3QQ8B 2AMCB 3KLWA 4JI8L 4JBWA 3ZNGC 5LL6X 1VQ7A 3ML9A 1P98A 2Q2TA 1C1YB 2YYZA 4XQJA 1GHJA 3F1ZA 1FNUA 4HCNB 3DHHC 1Z9FA 5DCNA 3H94A 5CMDA 2Y3AA 4RGNA 2NBVB 4B3RQ 2KWVB 2D3CA 5IKCM 4ZRQA 3JAMc 3A4RA 5IO9A 2UYZB 1SNCA 2DHZA 3STBD 3AH7A 3VA5A 3HOYB 2RVLA 4FULA 2B63H 2RDBC 4RKBA 4W9KA 1NVID 4CQNA 1X1MA 3H3VI 1PH3A 3S1NB 3DBHB 2INDC 1JE5A 1FPYA 3N1YC 5CHVC 5EPLA 4EVOA 1NTGA 2ICIA 5M3MG 1WRIA 4MN3A 2M17A 2W3RA 3DM3A 1XPRA 3KLRA 3I4MB 4OO1H 5IOCA 2N1VA 3Q14C 3H3VH 4TMAB 2JZPA 3OIPA 4C56C 3KYHC 5LMNW 1E6EB 3TSSA 2EKEC 2Z0DB 3EHVA 5M5WB 3C19A 4AJYB 1IZ6A 4K5XA 4K8JA 4C3JB 1C78A 2PLPA 4IFDI 5DAUA 4IDIA 3SR1A 3HG9A 4A3LH 2Z59B 2KWUB 2K22A 2G1EA 2ZCCA 3AV8A 1I6VC 1TBEA 2G9HD 1WCMH 4I65A 4YHHL 5LMNQ 1Q1BA 5G3LF 3A8KE 1X56A 2I5HA 1K8GA 2FINB 1LTLA 3GTLH 2L83A 2F0QA 3U58A 2LGIA 1WGKA 2ONQA 3A9JB 3CQZB 2WKDA 4YCWA 5GQOA 2BGFA 2K8BA 2N9XA 4B9KA 2JK8A 4BKGA 3M9BA 4NJCA 3U7ZA 1I4HA 4JI4Q 1Q7YC 1E1TA 1SYDA 2HD3A 2RSUA 3EVQA 3SXHA 1O78A 1XLNA 4CJ1B 2N7JA 3U2SC 3F2DA 2YTXA 3CF5A 2XK5A 1MSGA 2JRHA 4DA2A 1GD7A 4Y7NB 3AE9B 2KJ6A 1SFOH 3H3VC 3X3MA 2DAJA 5JJLA 2KQ4X 1DGJA 2B29A 3ND9A 3RLNA 2ZZPB 4HWIB 2CJNA 3AMZA 4MJSA 4KY5A 4NXML 1KHIA 3H91A 1PLFA 1LTSD 3KJOA 1EWHA 1YN4A 4XYOA 3QJZA 4CHKA 4YY3L 5E6JA 3I3CA 4NJ7A 2LUMA 4RA8A 2FHTA 4R1JA 3AU4A 3KWVA 4W9JA 1LO5D 4MJSB 2D2QA 2IGGA 1H9JA 3CPWA 1G51A 4I7ZC 2HTME 1YJJA 3IG3A 4R8IA 4G11A 3GTQH 4C80A 3MXGA 4JOIA 3CIRB 4FBJB 4G7OC 3DEOA 3KOJA 3AEEB 2JEAI 4RH6A 4PMBA 4WJ4A 2RBMA 3ZGZA 3I3TB 5HG2A 1PZKD 1I7HA 4N9F4 2BA1A 1QJOA 1QVGA 2SEBD 5IGBA 2DNCA 2XSCA 4DNTB 1JALA 3R3OA 2BBCA 2HTHA 3BINA 1GC7A 1C9OA 2IY0B 1W6KA 4ZCKA 2VZKD 3HM3A 4S17A 1YN3A 3APCA 4XC2A 4ZRKA 4ANVA 2KLGA 3HRZC 1BBUA 1HA5A 1M1KC 5C23A 1JICA 3L7ZC 2ZNVC 5FR3A 2XNAC 1LTBD 5EE0A 3MXNA 4CDEC 1YOVB 1TYGB 3PO2H 2FIDA 3GB1A 4IQZA 4A3EG 1WMHA 3H09A 4AJWA 3KJPA 1CSQA 4A3FH 1AEXA 1SIJA 4DR2Q 3LDZE 1NNXA 1I4PA 4KD4A 1JORA 1BBWA 2LWPA 1KNEA 2LSSA 3SGIA 1IYJB 4DR5Q 4BKSA 4EQ5A 1OXVA 4XIGS 3RN2A 4WAAA 1R4PB 3ZLZA 3TP8A 3K58A 2ENBA 2PO4A 3A8IE 1Y69U 4R9WA 1R9TH 1X3FA 1XO3A 4BXXG 1I50B 5F2DA 1Q81C 4EZLA 4JPSA 2QEJC 4FJYA 3J81i 3S9WA 4DR2L 2BWES 2VW9A 4X64L 2XVSA 3I8ZA 1C79A 2C5CA 1BUIC 1NI3A 5AJ3L 4LF9L 3D4RA 3K0XA 1VDVA 2DNEA 2VZAA 5KNDA 2R92G 4HIOA 2KQ7A 3VR3A 2JA9A 3IBEA 1ZYRD 2WB1G 3H0GG 4K2LA 2F0EA 1FM0D 1CK1A 5IWAQ 3CC7A 2RHQB 1E8WA 2O6VA 4NJ6A 3K80C 1FO4A 1UZXB 3PO3G 3L17A 2OQKA 3V60A 5FLMH 2JA5B 4EZKA 2RDGA 3S1QB 3S17H 3FAHA 4ICVA 4JBJA 4TQUS 1IUEA 3WOFA 1R9TB 4F87A 4NXNQ 3I4MH 4DR6L 4TV3A 1U4LA 2EOTA 2F0OA 2LASA 3ALBA 1VQLA 1PQSA 1XT9B 3Q8AA 2HDLA 4HKQA 2C7HA 2CFMA 5HY6A 3GZNB 1IP9A 4ZRIA 4BY1B 2UWQA 4H02A 3R8BA 1HRJA 2RPVA 1D6EC 1QNUA 4DV6Q 4OGQC 1G2TA 1TZ1A 3TEYA 3B9JA 4BY7B 3QOJA 2PVOD 3MHZA 1STAA 2DX5B 2DZIA 4JI4L 4DR6Q 1FMAD 3J81E 2V1YA 4WH4A 1KOTA 1PRTB 5BR8Q 1YJ9A 4KGRA 3D6WA 5H1SE 3VYTA 3A33B 1PH2A 2SDFA 2WXJA 1OQRA 3C3LA 2B39A 3OMGA 4GS3A 2ZJRA 2JA5H 4J8QA 3DBLI 1IYFA 1UNSA 4M8AA 1K53A 2INPE 2KBNA 4YWGG 3VRAB 1L0VB 5FLXE 2Q8RE 4JGHB 4XDCA 2FCQA 2YTVA 2QJLA 3VHTC 4TKOB 3RZDH 2OWOA 4KV2A 4F8CB 2F0WA 4H7BA 4DV0Q 4BY7G 2IDYA 1P16A 5HGQA 3CU7A 1N62A 2NBWB 2X6GA 1UD7A 1SGHA 4JI7Q 3HOXB 1C4QA 2RSOA 3H6NA 1Q86C 4RM9A 2JX5A 1CKMA 4F1SA 1F9SA 1IBXB 1D4BA 4P71A 1WE7A 3MC8A 4GN1A 1TWGH 4LNFA 5AZFA 4DK3C 4W9EA 3V2TA 2D0OA 3SFDB 2EXZA 2VXWA 1TTNA 5D14A 1FRDA 2MW5A 1FCLA 1XCTL 1ENFA 2DY7A 1DGSA 4QAYA 1WR1A 3ZO5B 1XCQL 2Q2UA 4OONA 5CTRC 4ZLTF 4X3UA 1VR9A 5HFYA 1GJZA 2KHIA 3QG1A 3TDQA 3RZFA 3VAWA 2LFIA 4JQWC 4DV1L 3S2DB 2L32A 3VUYA 2BS4B 2IHFA 2RCNA 4A3JH 2JA7H 5I2XA 2Z6KA 1RFAA 4W9GA 1K9MC 2QA4A 3QARA 2WWZA 3KF6A 5KIXA 3W5UB 2OTLA 3A7LA 1O7YA 1B3AA 3S14H 1WM2A 3KF8A 4IURA 4M1UB 4HPMB 4JI3L 4WFN3 3KUDB 1S5DD 3RLFA 4L5QA 4WIPA 3FKIG 4HMIA 1EIFA 2EJGC 3D0FA 1SMYC 1NI2A 1I4GA 4QIWE 5ELFA 1HXYD 1E8ZA 3HOVB 1VQDA 2MJEA 1TXYA 2AUJD 3NBHB 4UAIA 3GZNI 4J6IA 2HCIA 2NPTA 2DJGC 1IL2A 2Z1CA 4A3EB 1WRDB 2WDRB 3P4SB 3Q8BA 1G2SA 4NW2A 2XIWA 2AQ1B 2O5IC 4A3MG 3DEPA 2DYBA 4N8FA 2NVTH 1BO0A 1B2TA 2KFJA 5FLXL 3M4OB 4GNXB 2PJHA 2BH2A 2WDQB 3HM6X 5AUIA 1O7IA 2CH4W 1TVXA 4QUFA 2L9HA 3DBHI 2MHJA 1UE7A 1QOAA 4C1NI 2CH4A 1VJKA 1TKWB 5CX3A 2VH2A 1KAWA 4AWJA 4HLEA 5EBCA 4DV2L 4LJZC 1HTQA 1RJTA 1RHPA 4JI5Q 1JJGA 2MQHA 2JE6I 2GN5A 3T51B 2YU9B 1MPEA 1TGZB 4JWUC 1I35A 1W3SA 2L00B 4LDTB 1P3QU 1YIWA 4K81A 3KDFB 5KGUA 3IT6B 5IAAC 1SE8A 4LF6Q 1P7FA 4ANXA 4C4VB 2R3ZA 3O13A 5ELOA 5M9OA 1MG8A 4A3GG 4A93H 1Y8RC 1A63A 3VR2A 2B2WC 3GE3C 1NBFC 4XYQA 3ULLA 2HJ1A 2K5QA 1WGYA 2J0MA 2L0FA 4ZOHC 3NUCA 2SNMA 3MC9A 2N4FA 5AUKA 5JH5C 3DXJC 1XNRL 3I57A 2NVYH 3K6OA 4M01A 2V9HA 4S0RA 1NY4A 1SRUA 2E2DC 2ZTDA 2QC8A 2DNFA 2NZ1D 4C2MB 1WIAA 3MA2B 1V81A 4HPPA 2ZTCA 4YHHQ 4NQKE 4U68A 3JAME 4DV3L 1Z7TA 1PH6A 3GTKB 2N49A 4IKGA 4FO2A 5LMUQ 1QZEA 3ZXVA 2IJ0A 1SYBA 1XEEA 1HTLD 2XRQD 4GOPB 3I4NG 3J81j 4DV6L 5JAVA 1VQNA
chains in the Genus database with same CATH topology
2IGDA 2A69D 3SR6A 1STHA 1CQVA 2CJOA 1RWSA 1VF5C 4TQ0A 4DK0A 4J1MA 1EWCA 1CA5A 1O7ZA 4DAVA 2WU2B 4C7ZA 2QF7A 3FRPB 4QF4A 3FMCA 1TS4A 3GTPB 1SB3C 3PO2B 2FE8A 2LHDA 2PNRC 3A54A 1NENB 4N9PA 4KKJA 1VF7A 2LKVA 1Y8OB 3N6RA 1GXDC 1DZ1A 3BDOA 2OEOA 4DQOC 1N63A 2KUMA 1CZWA 2ZXOA 2LFNA 3CRKC 1FD6A 1NSNS 1Q1EA 1JWMD 2B8GA 2CHBD 1ACCA 3Q8EA 1ZXHA 3GS2A 1HZ6A 1OXSC 1E0ZA 3VYRA 2IPKD 4LMQD 1CQFA 4GLSC 1WYGA 1V43A 5ELDA 2R93B 3Q22A 2W82A 1KRHA 4JE3B 1MBYA 5CR3A 1PMRA 2ZXRA 2F0LA 1UEAB 4KY7A 2K04A 5I6WA 1A70A 2WS3B 1CA6A 4P16A 1TY2A 1A15A 3A55A 1VZ6A 2LY7A 2EYMA 1QG7A 3GP7A 1L6UA 1GUNA 1I4QA 3CWIA 3AEFB 5HG2A 1RD9D 1WTWA 1YQ4B 1PFDA 1VMCA 2L12A 1H9KA 4G4KA 5ELBA 1KDBA 2DLBA 1EY7A 1GPXA 3OMCA 4A55A 4X3TA 2J0TD 4WAFA 2WIIB 1G91A 4AQ7A 2AX5A 1FEHA 1VZ7A 4EQOA 1C4PA 2EYLA 3OWFA 1HQMC 3H6MA 2EYJA 4KKUA 4ITKA 3HOZB 3K7AB 1VRAB 3TZDA 5DM63 2KHSA 4K2KA 1XYIA 1WVLA 1QOGA 2EE1A 2RMMA 2R7ZB 1GUSA 1WTXA 2GI9A 2A6HC 3T53B 1FRRA 1FXIA 1DCZA 1CJEA 3ND8A 1OXTA 3NWSA 1AW7A 3U9OA 4C3HB 4BBSB 4OIJA 3IAM1 4L23A 3JAML 1EY0A 2VB3X 2RQXA 2A6HD 4IALA 4GDLB 4AYBB 4C3IG 5I6YA 1E10A 3S14B 3AE1B 1A2UA 2BB6A 2HDEA 4ZHPA 4ZKCB 1B9MA 1TKEA 2K0PA 1GUTA 5BN3A 1JOQA 3IXSA 2HCCA 4JK1C 3SVMA 2TSSA 1II3A 3NHHA 5IODA 1VMPA 2EDGA 1FNWA 3Q8FA 2H88B 3I72A 4O42A 2IW3A 3NTHA 3FILA 3T3OA 2DYOA 4RFBA 3HOUB 5FOBB 2BT6A 2INNE 2WKCA 2X6LA 1JWAD 1BDOA 1CT1D 5C4XB 2L1AA 2PZUA 3U52E 1TKYA 1M8AA 3TMEA 2E75C 3NXWA 5JVG3 3J80E 1YNNC 3KLSX 5C3JB 3BDLA 4F88A 2IGHA 5EJWA 2ZXPA 4WWMA 1MI2A 5JEAH 1NCVA 3C46A 2QCPX 5CV8A 5JPNC 1HHVA 2WP9B 4US9A 4EQNA 1S5BD 2FJ2A 1SYEA 3TEWA 5BN5A 1OQQA 2JSOA 3ONAB 2V3NA 1G6ZA 4KKIA 1DOXA 2KCCA 2JA8B 3NBHA 3NVYA 4FNFA 1D2BA 3URYA 4Q2JA 3P4RB 1EY5A 4RCNA 2J4XA 1PRTC 3RD4A 3GV3A 3VR6A 3MXPA 4A3IB 1EZ6A 1OO9B 3D4WA 5C3EB 3BK2A 4F8MA 2BDOA 3S17B 3W2DA 2KOLA 1B4OA 2PKOA 4V0BA 2AQ2B 1SJED 1PTOH 2WV6D 3LX0A 2VB2X 1RODA 3W1SA 1KDCA 1TS3A 1EIGA 3WOEA 1F2LA 3L3OC 2I2YA 2OF1A 1NAPA 4KKSA 2KWDA 1ET6A 3Q69A 5J39A 2F0UA 5A2QL 2RDHA 1QE6A 1TY0A 2JP1A 1KH0A 1DJRD 4MH8A 3UI3A 2B2VC 4B0MA 3VR4A 3RUZA 1SNOA 2WXOA 2F0HA 3EA6A 3HOWB 3E9SA 3GTOB 1ENCA 1ILPA 2VUMB 2JU6X 3SEBA 1EM7A 2MPMA 2JYTA 1BMLC 3BYYB 1ENAA 4JX1C 1TT2A 3IL8A 5DNFA 1MSHA 5IIFA 3G6JB 3VR9B 2M19A 2ID0A 2WXFA 1HCZA 1SE4A 2EZVA 3IFTA 2V4IB 3J7AV 3K5NA 1CZPA 5CV7A 5I9OA 2B8FA 4FYDA 1QILA 1V8QA 2WP8J 3NTIA 5CGKA 2IT1A 5D3DA 4KHVA 1PGBA 3ZJUA 4DFAA 4IUVA 2QIEB 2H1EA 2DWQA 4WRDA 1F2ZA 1T5EA 2WLBA 1L5PA 1ZXIA 3FC4A 1S5FD 2PQEA 2BYTA 1FIQA 1SBBB 3KLSA 4NKLA 4K6LA 3W9CB 5IGFA 1IKLA 2HUGA 4FF3A 5FK9C 3AM9A 3J7AF 3P1HA 1P7EA 3NVVA 1CI3M 3HKZB 3SE0A 1SNMA 4XDDA 2JWUA 1WTRA 2K01A 1HUNA 2IX0A 3P1MA 5HGTA 3H8HA 5M3FB 3MAQA 1ZXTA 4ZRPA 2LEKA 5IGCA 2K05A 4CKCA 2L11A 2PMVA 1H9MA 1RCVD 1J7AA 3E6ZX 1SFOB 3AE5B 5G5HA 2FUG1 2WXNA 1B1ZA 3MVVA 3D8GA 1NUCA 4A3JB 4HRSA 1CZGA 3NRZA 3W3AA 1TZOA 3VRBB 1GUGA 3AE3B 2D2CC 2CVRA 1G291 1PTOF 2K32A 4RGOS 1EY9A 4D2KA 3QOLA 3E5SA 5FO7B 1N5XA 1OXXK 1PFMA 2C9OA 2BE5D 4LAAA 4S3SA 1BCPD 3ERQA 2QDBA 4HEDA 3WDNA 5E4XA 3SK6A 5C4HA 1N61A 1K8OA 2KVMA 3HZXA 5D3IB 3I73A 1MVKA 2WXKA 5BMHA 4YIJA 2B2UC 3V05A 2J53A 2BE5C 3GTGB 4A3DB 5ELCA 3AEDB 4YTNB 2NN6H 2K5PA 2HDMA 3BIID 3J80L 2OXPA 3BVMA 1F2YA 2M00A 2B2YA 1RYJA 4P6VF 2K03A 5KYIA 2Z4IA 4L2YA 2F3WA 5D7GA 1KAAA 5BYQA 3QJYA 3MHBA 4Q5VA 4HR7B 4FXGC 2M2LA 2W54A 1I4RA 4YSYB 2AWNA 2GRIA 3PIO3 5CBAE 2F0MA 1E2VA 1SMYD 1HPCA 3RZOB 1BUVT 4HCSA 1D5XC 5C3XA 1GUWA 5EKIA 1SF0A 1EZ8A 2N0SB 2FFKB 2PW9A 2F0TA 5JVH3 1TWCB 4HROA 5IT9E 3ZJVA 3VYUA 5H8YE 1WTVA 1TWAB 1R7SA 3SK5A 2F0NA 3SK4A 3Q6SA 1BNZA 2JYOA 5LL6S 4O1NA 1EL0A 5JXVA 3IAS1 1JQYD 3M4YA 2J7ZA 1B53A 3I9V1 1EFID 4KD3A 3P20A 1LACA 2ZT9C 3NPPA 3OOCA 2HQEA 1JW9D 1RTOA 1Q8IA 4RWSC 1B44D 3TUOA 3UI2A 1ICWA 1WWTA 2EY5A 4IFDG 4IFDJ 2G9DA 2A73B 1ONLA 1Y56A 3HP3A 1SNDA 3MTSA 1A3TA 5K5PA 1VDZA 1EYAA 2A5HA 2EY2A 1HUMA 5C5LA 2CU3A 1LT6D 5KEEA 1LTID 3OSOA 3GTJB 1T5XD 5FO9B 1Q90A 3EROA 5K36H 2QMTA 1ET9A 4HMJA 2EYPA 2VNUD 1LTRD 2XRSD 1EOTA 5GXGB 1DM0B 4DAYA 4ZKBB 2J52A 2A69C 3PUVA 3M7NA 2F0IA 1DXMA 4UDUC 2E2HB 5IGGA 5G3LD 3AECB 1Z47A 3X3NA 5COYA 3AB5A 1L4ZB 5G5GA 1BF4A 3VA7A 2K1BA 2RDFA 1VCIA 2PYKA 2JA7B 1N60A 2X69A 2MH7A 2I38A 4XWWA 1JWSD 5T8IA 2E76C 2MP1A 4OHJA 5LNK1 4DK1A 1QOBA 2NB0A 2KJXA 4H44C 5J22A 3I91A 1JC7A 2BS2B 3DWAA 1X32A 2EPBA 4C3HG 2K3UA 2KDMA 2A74C 1H9SA 4HJGE 1DOMA 3PUZA 1ESRA 4OVZA 2K5DA 4REZA 4ILWA 4PNYA 4PMWA 2E6XA 2JXMB 1Q12A 1O80A 3MZ5A 2MEKA 4K8IA 1JROA 4HEA1 1DYQA 1LTAD 5T1GA 5E3FA 3AE4B 1AZQA 1SJHD 2NMQA 5EE9A 5K36G 1R4QB 2WDVB 1LLRD 3HS0C 2Q8IB 1FXAA 4KGTA 4Z9CB 4LTUA 4ODGA 3N9YC 4EE2A 4NAWB 2WINB 1J9OA 3BDCA 5C44B 3FPPA 2MJ8A 1FD7D 5KRUA 2NVYB 1QOHA 3TBIB 2DBYA 3R93A 3R2TA 1TJEA 3CKIB 1YNTE 4HSPA 4HN7A 1VLBA 4YT0B 1PUTA 1IGCA 4GDKB 1D1IA 3NVZA 2KAJA 1E7PB 1T6BX 1JB3A 1STEA 3T13A 5CV9A 2K28A 2NN6G 4L1BA 3U9SA 1D5ZC 3DM1A 2ON8A 1S5CD 3OWEB 1FCCC 1NR4A 3C1FA 1FR3A 1TQOA 4QIWB 2NVXB 3PZ8A 4ARIA 1HTPA 2NUCA 3DUZA 1XLQA 1IW7C 3GTQB 1FFVA 1A3UA 1OXUA 1JMLA 1AZPA 3NE5B 1ZPSA 3IT4B 4OZAA 5EQ0A 4M0WA 1IW7D 2V3PA 1V1OA 3AE7B 1SE3A 1CM9A 3NUHB 1ZKOA 4DXGA 3BS1A 2AQ3B 3PUXA 1CHQD 4XDXA 2NTSA 4N58A 4NZLB 4A3BB 5EBDA 2Q8TA 2MHVA 3PV0A 2WACA 1PDXA 5T1IA 3K5LA 4A3FB 2J42A 4B9WA 1QWYA 4XXEA 3KUPA 5C6AA 4WORA 2KA7A 1KLGD 1KF6B 2WXGA 2L5TA 4XT1B 3P75A 4X3SA 4L6TB 1WTQA 4ZAIA 2TMPA 1WXQA 1PTOB 5C0XG 5M5YB 4RKLA 5C5MA 1YNND 2NYZD 2RA4A 2O2LD 1WCMB 2KACA 1J7BA 2VZKB 1C77A 1LV9A 2EKIA 1J8IA 1XLOA 4J3OD 1QF6A 5MPOA 2WU5B 3L4PA 4ID6A 2PZWA 3BVGA 4US8A 3GO5A 1TWGB 2B2VA 3SHLA 4KY6A 3FILB 4QB4A 3TZUA 3GTMB 1LTTD 2F0JA 4A3GB 5DM73 1F9PA 2F4IA 1PRTD 3U4EG 1DD2A 5IT9L 1SAPA 2EJFC 3MP9A 1KLUD 4DAPA 2K6AA 2A68C 1ILQA 3AE8B 1I3QB 4KTAA 3PIP3 3AB9A 1AN8A 2F0VA 4KV6A 3DWQA 4IZ8A 2D5GA 4CKBA 5BN4A 1ZDXA 3GV6A 1F2RI 2F0KA 2ACZB 3IAYA 1YMHE 2A68D 3I4LA 1WTOA 4HAEA 1UUPA 3V3XA 3BG3A 1NYRA 4C1NK 1B50A 1RKNA 1XTCD 1YN5A 3AU7A 3C1EA 5CYUA 1IYVA 4FXCA 4XQNA 5EGTA 3P7JA 1PTOD 1AP0A 3TP5A 4A90A 2NVQB 1ZEQX 1C48A 2F1MA 3PMFA 3AN1A 1RF2D 1STNA 1SYGA 1PTOC 1E9MA 3A7AB 4RF0A 5I4DA 4E6IA 4IUUA 1PFBA 3ZJTA 3MWYW 1YJIA 1GUOA 3BYTB 3J7YW 1Q10A 1O7LA 1SYFA 2A6EC 2V0GA 4KN7C 3M85A 1IL8A 1Q3LA 3AMUA 3VYSA 2KEDA 2NTTA 5C2TB 1TWHB 4WQMA 3BK1A 3QWNA 1JQ4A 4OW0A 1EYDA 5HI1A 2IWHA 4KGSA 1WSPA 4LK1C 2OT2A 1UWXA 1AYFA 2NVTB 1PDQA 1V8CA 4YSZB 3K5OA 1GB4A 5CV4A 1F77A 3RPFC 4RHSA 3WCQA 2EELA 2WXMA 2DY8A 2OHFA 1KTKA 4LK0M 2M0AA 1DOKA 1AWDA 2PTLA 3HEJA 4DN4M 1BOSA 1PXUA 4EQPA 4BBRB 2EJMA 2M56B 1K8MA 1L6VA 1I4XA 2KEEA 1MD2D 2B76B 1JCKB 4MHEA 1CTMA 3B2GA 4TRDA 5KNCA 1IKMA 5EPKA 2L52A 4GZYC 2PZTA 2Z8LA 4XT3B 3E0JA 3T3NA 2WNMA 5ISRA 1BXTA 4ULLA 4ZHOA 1B9RA 2IL8A 1EU4A 5C0XH 3P4PB 1HZ5A 2BA0A 4RGTA 1V1PA 5JEAJ 4P2CB 1F2MA 4RHRA 2XWBB 1NYQA 2Y0SB 4PQXA 2Y5CA 1SYCA 2AUKA 1F9RA 1ZP0B 4KKTA 1B9NA 5JOBA 1UWMA 1U9RA 1CHPD 1UGJA 4USAA 5J1ZA 4KX6B 4CGYB 2NN6I 1GJXA 1IBXA 1SDFA 3BZDB 4ZUIA 3NZ3A 1A2TA 4FF2A 4NAMA 3C8YA 1XWEA 3NS1A 1K83B 5A35A 2Q5WD 2RSNA 4YTMB 1S4ZA 2JXTA 1BCPC 4G57A 2FMCA 1V97A 2OEDA 1XX8A 1N5WA 5EKKA 4TQ1A 4IUNA 4ZUJA 3QB3A 4IUTA 3EQLC 3Q23A 3M7GA 1HA6A 4K14A 3L9AX 4IFDH 5JPMC 2EYHA 3DMUA 1LT5D 1HFGA 1NEKB 2PIAA 1MHHE 5I9PA 4HCEA 1LTGD 1QB5D 1YNJC 2GB1A 4NMZA 1C4CA 3KWLA 2EY1A 4KJOA 1H9SB 3A8JE 3FEWX 3E56A 3KBGA 5EKLA 2ZW0A 3NTKA 3EFXD 4ZYSA 1QQRA 1EY8A 2F0PA 1YNJD 2PW5A 4G7HC 3S2HB 4L63B 3OW7A 4FF1A 1WTPA 3P4QB 4IN3A 2BS3B 2E3TA 1FNVA 2N55A 2FMMA 2WXPA 3AEBB 4RAUC 2ICEC 1QCBD 3MXUA 5LHY1 5HURA 2WXRA 2PVGC 4FVMA 4JWSC 3OIQA 5AFWA 2L4NA 3TEXA 1QLBB 1SSNA 2F0FA 1C8CA 4K6DA 3BWUD 3D6CA 4LLGM 5BMIA 1JRPA 3AEAB 2BDNA 4DNRB 5M3MB 1PRTF 3NBIA 5CBEE 4ZRZA 1U4MA 4OIKA 5M5XB 4ZK9B 3DWGC 1BCPF 3D3RA 2F03A 2CQAA 2KECA 5IGDA 5CC4A 4B0EA 4KHZA 2Y5PA 1ML0D 1E2ZA 1KNAA 2E74C 5JEAG 1BBXC 5EE3A 4N6EB 3ABVB 4K5VA 3MJ5A 1TU2B 1Y8PB 1SXTA 2EYOA 3I4NB 2R6GA 4XWTA 4DF7A 1Y8NB 2H4OA 1HFNA 1PFNA 1QNKA 1TS5A 1E2WA 3TEZA 3PO3B 4KI0A 5HHDG 5A2QE 2BTEA 1C76A 4NJCA 1RTNA 3EUB2 3DWPA 3H0GB 2O5JC 4CHTB 1PZJD 1FFUA 2MGSA 3K57A 1ZYRC 4QCLA 2R92B 4NDXA 5C4ZA 3Q24A 2YEPF 4MIUA 2XN9C 2LHEA 2IX3A 3K5MA 1Y1VB 3S1RB 2WXHA 3TN2A 2L55A 2V4DA 2K33A 5DEHA 2ZW1A 3AEGB 2PPBC 3F2UA 1ZOYB 1K51A 1EY6A 2H89B 2M9VA 3R2IA 1AFPA 1ESFA 4CJ2C 4B9XA 2D62A 2LS01 4ARCA 2QILA 4DU9A 3FVQA 5CV6A 1EQTA 1FGBD 2JA6B 1BQQT 2AWOA 1SSOA 1HQRD 2W3SA 4J6HA 4HSVA 2DN8A 2EVBA 3NQTA 1X3QA 4A3MB 2E2JB 2JQRB 5IGEA 1EIHA 3T16A 3VQIA 4CBVA 5E1FA 3ETRA 5C3WA 4NP5A 3DWMA 1UAPA 2GA4B 4C7YA 1A6XA 2PMZB 4H2AA 4N59A 4OZBA 3FDTA 2BW2A 2BB5A 2CW0D 1JWUD 3AE6B 1PZID 3D31A 2FBWB 3RMHA 1ZE3D 2NWGA 2F0DA 2EY6A 2N9KA 5E4WC 1TWFB 2Z4HA 4AS1A 2PW7A 4XE0A 2CW0C 4IOIE 1IGDA 2K7VA 3SK8A 4ABNA 1RFKA 3LXFA 4RF1A 4YSXB 1T3QA 4A6QA 1BR9A 3LNNA 2KCNA 4QUCA 1V1PB 2L0CA 3KQ4A 4MM3B 3GD7A 2F3VA 3P63A 1RDPD 1STGA 5BYRA 4KN4C 1STYA 3KK7A 4BWGB 4C3JG 1FYCA 4PV1C 1SNPA 4BA1I 3QIAA 5TSSA 2B2WA 5H92C 3ZQ4A 1H9RA 1TS2A 5CORA 2LMCA 1MGSA 1EEFD 3B2FA 5BMGA 1DOIA 4FXDA 3M3YB 3FPUB 2DYMA 3K59A 4X3KA 1M4VA 2BOSA 5CV5A 3HVZA 2WXLA 2X38A 1ROEA 2W55A 1STBA 2IX1A 3MC0B 5D65A 1NR2A 3Q0AA 1C9FA 4Q0FA 4WURA 1PGXA 1PGAA 1SE2A 4RCOA 5EE1A 2SAKA 2QKIC 2XWJB 3LB8C 1Y1WB 3NWTA 1X3PA 1LT4D 5JJZA 4KK7A 4U673 5BYSA 4YTPB 1XF5L 4XQQA 1QOFA 3NVWA 3TP6A 3BVZA 4FXKC 1L0YB 1LT3D 2MJDA 1HEZE 3RZDB 2R61A 4WJWA 3LYYA 4A9AA 2O4XA 3VR5A 3GTLB 4K5WA 3ZYYX 2N9LA 5FKAC 1SEBD 2WXIA 4KJNA 3P42A 4FP5D 1JWBD 3W5VB 2MUYA 1F0ZA 1JOKA 5C4JB 4BA2I 3CHBD 4A93B 5KYLA 1L4DB 2D9UA 4PMCA 1Z6HA 2EYFA 3PZ7A 3MEHA 1EWYC 1OFFA 3K0YA 2QSDA 5I2YA 3A56A 3CRLC 2N88A 5FO8B 3NK9A 4QMGA 4RGMA 1EY4A 4PT5A 5KNBA 4DXFA 3QO2A 1WD0A 2F0SA 3S16B 2JSVX 1JE4A 2RKSA 3AE2B 1ZDVA 2B2TA 3EJIA 3J9CA 4CKEA 1TIID 3VR8B 2F0GA 1YQ3B 3MFGA 4A8XC 1K50A 4ZQ3A 1U4RA 2B2YC 3J81L 1WD1A 1DOYA 3MFYA 4HKZE 2PCFB 3NQIA 3Q8CA 1JR0D 1J7CA 2WXQA 4IUPA 3S15B 1K52A 2B2UA 4A3KB 4XTCS 2E2IB 1DONA 4G7ZC 3KBXA 4R8NA 4YXDB 2B63B 3TP7A 3D4DA 3HRDD 1XXGA 4HTHA 4OZCA 2JYEA 1VZ8A 4N9TA 3T56B 3HVDA 3I90A 3T4AC 1EU3A 1E0BA 1LABA 3PUWA 1A3VA 5EPJA 1XLPA 1RM6C 2WQYB 4DGZA 1KDAA 2WB1B 4RNAA 4C3IB 1DOLA 1ZUD2 1PYWD 3G7LA 4OO1I 1EQVA 1TKGA 4H0LC 4BS9A 3N52A 4EGVA 1U4PA 3EGRA 1BCPB 5C0XJ 1F2RC 4CJ0B 2SNSA 1I6HB 1GB1A 3OPOA 1L0XB 3DHQA 3ITPA 3GQBA 1C4AA 2MJ3A 2A6ED 1MHXA 1SNQA 1D1KA 4FF4A 3NP8A 1EYCA 2I46A 5NUCA 5ELEA 2K5WA 3HGBA 2LMCB 4MT5A 4OL7A 1JOOA 4F7XA 4KMUC 4OO1G 2KMMA 2SOBA 3V96A 2NBFA 3PUYA 2B2TC 3IFDA 4ME5A 4MACA 1W6JA 1IHZA 1GAQB 1EEID 2YEPB 4R3DA 3I70A 3IKJA 2BCOA 3FKIB 3LWUA 3SFEB 2D5DA 1CFMA 1F9QA 1QT9A 1MI0A 2LJIA 3OHXC 1QKZA 4V190 1IYUA 1S5ED 3C2PA 2KQ3A 2WAQB 2KN4A 1D5MC 2K9XA 1KABA 4IUQA 1G8ZD 3LWEA 3NSWA 4TSSA 3S1MB 5C0XI 3HUIA 1GOZA 4H13C 4B08A 2JEBI 2L1BA 2I07B 3SDZA 1GHKA 1KFYB 4L8JA 1TR5A 4JBWA 5LL6X 2YYZA 4XQJA 1GHJA 1FNUA 3H94A 5CMDA 2Y3AA 4RGNA 4ZRQA 1SNCA 3AH7A 3VA5A 3HOYB 2RVLA 4RKBA 1NVID 4CQNA 3S1NB 5EPLA 4EVOA 2ICIA 1WRIA 4MN3A 2W3RA 3KLRA 3I4MB 4OO1H 5IOCA 4TMAB 2JZPA 3OIPA 4C56C 1E6EB 3TSSA 5M5WB 4K5XA 4K8JA 4C3JB 1C78A 2PLPA 4IFDI 5DAUA 4IDIA 3SR1A 3HG9A 3AV8A 5E6JA 2K22A 2G1EA 1I6VC 2G9HD 4I65A 1Q1BA 5G3LF 3A8KE 3RFZB 2FINB 2ONQA 2LGIA 2L83A 2F0QA 1WGKA 3CQZB 2WKDA 3U7ZA 1I4HA 1SYDA 3EVQA 3SXHA 1O78A 1XLNA 4CJ1B 2N7JA 3U2SC 1MSGA 4DA2A 4Y7NB 3AE9B 3H3VC 3X3MA 2KQ4X 1DGJA 3ND9A 2CJNA 3AMZA 4KY5A 3H91A 1PLFA 1LTSD 1EWHA 1YN4A 4XYOA 3I3CA 2LUMA 4RA8A 2FHTA 3KWVA 1LO5D 2IGGA 1H9JA 4I7ZC 2HTME 1YJJA 4R8IA 4C80A 3MXGA 3CIRB 4G7OC 3DEOA 3AEEB 2JEAI 4RH6A 4PMBA 2RBMA 3ZGZA 1PZKD 1I7HA 2BA1A 1QJOA 5IGBA 2SEBD 2DNCA 2XSCA 4DNTB 1JALA 3R3OA 2BBCA 1W6KA 2VZKD 1YN3A 3HRZC 1HA5A 1JICA 3L7ZC 5FR3A 2XNAC 1LTBD 5EE0A 3MXNA 1TYGB 3GB1A 4IQZA 3H09A 1AEXA 1SIJA 4KD4A 1I4PA 1JORA 1KNEA 1OXVA 4XIGS 1R4PB 3TP8A 3K58A 2ENBA 2PO4A 3A8IE 1Y69U 4R9WA 1XO3A 1I50B 5F2DA 4JPSA 2QEJC 3S9WA 2XVSA 3I8ZA 1C79A 2C5CA 1BUIC 1NI3A 3D4RA 1VDVA 2DNEA 5KNDA 3VR3A 1ZYRD 4K2LA 2F0EA 1FM0D 1CK1A 1FO4A 2JA5B 2RDGA 3S1QB 3FAHA 4TQUS 1IUEA 3WOFA 1R9TB 4F87A 1U4LA 2EOTA 2F0OA 3Q8AA 2HDLA 4HKQA 4BY1B 3R8BA 1HRJA 2RPVA 1D6EC 1QNUA 1G2TA 4OGQC 3TEYA 3B9JA 4BY7B 3QOJA 2PVOD 3MHZA 1STAA 1FMAD 3J81E 4WH4A 1PRTB 4KGRA 3D6WA 3VYTA 2SDFA 2WXJA 1OQRA 3C3LA 2B39A 3OMGA 4J8QA 1UNSA 4M8AA 1K53A 2INPE 4YWGG 3VRAB 1L0VB 5FLXE 2Q8RE 4XDCA 2QJLA 4TKOB 2F0WA 4H7BA 2IDYA 1N62A 3CU7A 2X6GA 3HOXB 1C4QA 2RSOA 2JX5A 1F9SA 1IBXB 1D4BA 3SFDB 3V2TA 2EXZA 2VXWA 5D14A 1FRDA 1FCLA 1XCTL 1ENFA 2DY7A 1XCQL 4ZLTF 4X3UA 1VR9A 5HFYA 3QG1A 3TDQA 2LFIA 3S2DB 2L32A 2BS4B 5I2XA 5KIXA 3W5UB 3A7LA 1O7YA 1B3AA 3KF8A 4IURA 4M1UB 4WFN3 1S5DD 3RLFA 4WIPA 4HMIA 2EJGC 1SMYC 1I4GA 5ELFA 1HXYD 3HOVB 2MJEA 2AUJD 4UAIA 2HCIA 2Z1CA 4A3EB 2WDRB 3P4SB 3