3KLSX

Structure of complement c5 in complex with ssl7
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
191
structure length
191
Chain Sequence
LHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C5
publication title Structural basis for inhibition of complement C5 by the SSL7 protein from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 33
structure length 191
sequence length 191
chains with identical sequence Y
ec nomenclature
pdb deposition date 2009-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3klsX02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3klsX01
1YN5A 1SE4A 1LTSD 1FNVA 4RH6A 1F77A 2SEBD 1SJHD 1PZJD 5ELCA 4RHRA 1LLRD 5D3IB 1I4HA 1LTBD 4Z9CB 1FD7D 3SEBA 1S5BD 1PRTF 1PTOF 4RCOA 1ET6A 4DXFA 1EEFD 2IJ0A 1DJRD 3BVMA 5D3DA 1KLUD 1M4VA 5ELFA 3R2IA 1PZID 1TS3A 1JCKB 2Z8LA 5I4DA 5ELDA 2IPKD 2RDGA 1YN4A 1STEA 1LTTD 4K6LA 3V05A 1I4RA 2CHBD 3BVZA 1B44D 1EU3A 1PRTB 1BCPD 1PTOB 2XRSD 1V1PA 1PTOH 2AQ2B 1CHPD 1EEID 1D5ZC 2J4XA 1BCPC 1BXTA 3MFGA 1CT1D 1D6EC 4DXGA 1RCVD 1DYQA 1GOZA 1CK1A 5FKAC 3W2DA 2R61A 4C56C 1V1PB 1D5MC 1FNWA 1LT5D 3EA6A 1I4GA 2NTTA 1YN3A 2XRQD 4RGNA 4RGTA 1FNUA 1FGBD 3DWQA 4NZLB 1LT4D 3CHBD 1TY2A 1S5DD 1TS5A 1XXGA 1BCPF 1JQYD 1MD2D 3EFXD 1B1ZA 1EU4A 1S5CD 4TSSA 3O13A 1LTRD 2RDHA 1RD9D 4RGMA 2WV6D 1QILA 3R2TA 1D5XC 1LTAD 5ELBA 1UUPA 1LT3D 1PRTD 1PTOD 5ELEA 3BVGA 1LTID 1PYWD 3URYA 3DWAA 1LO5D 2NTSA 1I4PA 1PRTC 1ESFA 1PTOC 2XNAC 1SE3A 1G8ZD 1BCPB 4BWGB 1TS4A 5TSSA 1RDPD 1I4XA 1V1OA 2QILA 4L63B 2ICIA 1SBBB 1AN8A 1JR0D 1XTCD 3OWEB 3BZDB 1JWUD 1SJED 2QEJC 1PZKD 1CQVA 1KTKA 2G9HD 1JWSD 2XN9C 1KLGD 4RGOS 5FK9C 3BYTB 1LTGD 1JWMD 1TY0A 3R8BA 1EWCA 1HXYD 1LT6D 1SEBD 1T5XD 1L0XB 1EFID 1ET9A 2AQ3B 3KLSX 1UNSA 4O1NA 4RFBA 1S5FD 4L6TB 1HQRD 2AQ1B 3DWPA 1L0YB 3BYYB 1S5ED 1I4QA 1AW7A 3MC0B 3TSSA 1HA5A 4UDUC 2O2LD 4OHJA 3GP7A 4ZYSA 1SE2A 1SXTA 1RF2D 4RHSA 1TS2A 1ENFA 1HTLD 2TSSA 1CHQD
chains in the Genus database with same CATH superfamily
4BKTA 2KC2A 3LWUA 3VDYA 3ML9A 2N7DA 2IX3A 2J7QB 4YWLA 3IFTA 1GUWA 4W9DA 3Q3OC 4KKJA 3VR5A 3OW7A 4ZKCB 3E0EA 3LGJA 1R4PB 2FIDA 1V81A 4HJ9A 2O6VD 4YTNB 2V3NA 1ONLA 1Y1VG 2B2VA 1PYBA 3ML8A 4GXBA 4FHJA 1IXRA 1C9OA 1ZDXA 2F0PA 3W5OA 3NENA 2EYLA 4MZ9A 1VQPA 4I6NB 5CORA 1XQQA 3QOJA 1MI0A 1PZID 2G45B 1SMYD 1XTDA 2GMIC 2EY6A 4K2KA 5EKKA 1IL8A 2YEPF 1WD1A 3VUXA 3I55A 4A3LG 3GD7A 2INPE 1WXVA 2JXTA 4R3DA 1YVCA 2NZ1D 2MP2A 4IJLA 1PRTB 1LTLA 1HR0W 1T0QC 3LDZE 1BDOA 3BDLA 1C4AA 3VR3A 3K81C 4C3IG 1MGSA 4IM3A 1IW7D 4TKOB 5C6AA 1JB3A 3I4LA 5FJ8G 1RL2A 2WIIB 4X3UA 4GDLB 4JE3B 1GC6A 2D0PA 4OO1G 1A15A 1CUKA 4PS7A 5D94A 1MKHA 1A2UA 1V1PB 3A8JE 1EIHA 2NVYB 1Y8PB 1WX7A 3PO2H 4L23A 1YX5B 2BWES 2C9WB 1XCQL 2GVBA 3WDNA 2FIFA 1YN3A 2WWZA 3AXCA 3PZDA 4OL7A 4PV1C 5FLXL 3J81L 1JC7A 3GQBA 2KZRA 2RDBC 3A5UA 5HHDG 1YNTE 2UU9Q 2EPBA 3T53B 2PKOA 2WAQG 1XT9B 1F9JA 1EM7A 3W1SA 4F8MA 3CC2A 3I5JC 2DY8A 1SYFA 4A20A 1QILA 1Q7YC 3K0YA 2ZXOA 5C3WA 4YTPB 1TYGB 3M3YB 2MO1A 4JI5Q 5IGDA 5DAUA 2NVTB 2Y0SE 2O6VA 4QQBX 1XLQA 4A3DG 2CWPA 1W6KA 4UAIA 3QB3A 4IPHA 4Q2JA 2EY2A 2CVRA 3H94A 4LUOA 5EDSA 4DV0L 2QF7A 4BY1G 1VQCA 5FO9B 4DAVA 2CQOA 1SGHA 3N1YC 3MA2B 1WTPA 4HJGE 3RNFC 3TEZA 1GXDC 1KLGD 5FK9C 1YIWA 4A3PA 1TY0A 4DV4Q 3QO2A 1OXSC 1R9TH 2HIXA 3GOEA 2C7HA 4OZCA 2DAJA 1SLJA 4P1CC 1HEZE 2KJHB 2MCNB 5GMVA 2ZTEA 2K5NA 4RFBA 4Q0FA 2KWVB 3NHEB 3AEAB 1L2NA 1TBEA 1WRIA 4X66L 5HURA 4RCNA 2LGXA 2ZNVB 3KBGA 5AZHA 2Q8RE 1SYCA 2XBBC 3RNAC 1IBKL 1V43A 3KYDD 5C0XI 1KABA 1VDZA 1M8AA 4NDXA 2KDMA 2GOWA 1ENFA 1HTLD 1SE4A 4M1UB 3S14B 5KNCA 4IUUA 1HHVA 1TT5B 1OFFA 3CKIB 3VR9B 5AJ3Q 1JORA 4DR1L 4BBNF 3PREA 4ARIA 3SK8A 1Z2MA 2KVZA 3RT3B 2K5HA 3ZXVA 4HSVA 2JSOA 2B2TA 2UXCL 1VQKA 3SEBA 1W6JA 5BMGA 4WWNA 2JRIB 3RPFC 2MBOA 3DBHB 2KUMA 2CW0D 4LFBL 4GN4B 4OELB 3NBHA 1B4OA 1DJRD 3GTKB 3L9AX 1LYLA 5C4XB 2KTRA 3A54A 1E0ZA 3MHBA 3U50C 1M4VA 1PHJA 3UDFA 4LF9Q 2PVGC 1KJTA 4KI0A 5IO9A 4KHZA 3UDXA 3J7ZC 3NS1A 4A3GB 3V05A 4NPNA 4TKNA 3CCJA 3VAWA 5BR8Q 3ZXRA 4YCVA 2ASBA 1E7VA 5EE3A 1LV9A 4GKKL 4B3SQ 3CD6A 4FULA 3VDZA 3OWFA 2R93H 2KCNA 4JOIA 1KL9A 3H3VI 1KM7A 4GSWA 5IYDH 3WIMA 1HQMC 3ZRCA 4BKGA 1EIGA 1WVLA 1AE2A 1MHWC 2BT6A 1C9FA 4H13C 2BKFA 4HCNB 4NKLA 4BVUC 2XTIA 3PO3B 4DR4Q 1K28A 2LGYA 1D5MC 1AP0A 4NJ7A 4XGAB 2K52A 3MVVA 5BYQA 1P3QU 3Q69A 5FO7B 2A73B 4RKBA 1FMAD 4PZ7A 1TR5A 2LRWA 1MIUA 3HGBA 1Y8NB 1SIJA 3DOWA 1A2TA 2AUKA 3BWUD 3M63B 4GIVA 3KVFB 2W3SA 2AEHA 2V4IB 2F0VA 1BUVT 2D3CA 3Q3FA 1CTMA 3HOZH 2KDEB 2CH4A 4K3CA 2Q2IA 3VXWA 3NUCA 4LTUA 3AEFB 1D8LA 4BBNC 3ZUNA 4JWSC 5D2MB 4EFOA 3C1FA 2ZJDA 4FHKA 1Q12A 3IRBA 3ND8A 2YVCA 5G55A 1ICWA 4QUCA 2L52A 2VB3X 3I4NH 1BKBA 2AUJD 1PXUA 4M00A 3KF8B 4BAXA 4IPCA 4K14A 3R3MA 4QCLA 2EXDA 2QKIC 4HEA1 4IUTA 1WGYA 4I7ZC 1HCZA 1HZAA 3S24A 1E9MA 2X8XX 1EFWA 4US9A 4A3OA 3Q14C 2A1AA 4DR5Q 2N1VA 4S0RA 3T13A 4JI6L 4FJVB 2EELA 4F7ZA 1FXIA 2BH2A 5IP9H 3HK0A 1SR3A 1UGMA 5K36H 4IKGA 3PRMB 3ZJVA 2ICEC 4O1NA 2NUCA 2JRHA 4PMWA 3F2BA 2LASA 4JYAL 3RI7C 4LDTB 3M3YH 2PJHA 1EYDA 5DM73 2MQJA 2N9LA 2NVTH 3QJZA 5EPLA 3AEDB 3FILB 3ZGZA 3DWGC 3HOWG 1G6JA 2EDGA 5M3FG 2DN8A 2O2LD 3QA8A 4IUQA 1SXTA 1SNMA 4DAYB 1TWHB 5FR3A 1Q8KA 4MJSA 4JBWA 4RHSA 2KBNA 4DXAB 3K80C 2L83A 2IZVB 2IW3A 4G11A 2D9UA 1S3SG 3HIZA 1SYDA 2WINB 4LAAA 1SB3C 5D3IB 1HRJA 4Z9CB 2INCC 3ZJTA 2HDMA 3HOXB 2JA5G 2XWBB 1G91A 2LGSA 3Q6BA 5J18A 1JB7A 2ZXPA 2EY5A 4NMZA 4ZLTF 2EQSA 4DHZB 3GTPB 1WGKA 2JY6A 1IBML 3G4SA 2F0SA 2CCZA 2VUMH 4GNXA 4CKCA 1YQBA 4RF1A 2ZCBA 5ELFA 3KJPA 1SNOA 2NBWB 1TZOA 5JPMC 4C7YA 1JWAD 3K58A 1Z7TA 2RDGA 3BDCA 1J0GA 4G7ZC 1TWCB 1N33L 3DVNU 2FHTA 2XSCA 3NQTA 3T3NA 1FFVA 1JOQA 3ZJYC 3PIOA 1HR0Q 1EY9A 3VR6A 3ONSA 4LFCL 1C79A 4LW1A 1KD1C 4ASWC 2HHHL 4MGZE 3PS6A 5CHFA 4K0KL 1P7FA 4LF5L 2R61A 3N1ZC 5C4XH 1EYAA 1JWBD 3CF5A 2MQHA 2XWJB 4KTAA 1NR4A 1PH6A 3HHMA 5IGFA 4ANVA 1TY2A 1MJCA 1XXGA 3DVGX 4A3GH 3M85A 3MTNB 3NUHB 5LNK1 5IGCA 2ZM6L 5EKLA 2LXJA 4XC2A 2D62A 2YV5A 2C7MB 3PSIA 3TMEA 4ZKBB 2ACZB 4DF7A 3AE8B 4MT5A 1Y1VH 2GBKA 4OXPA 2WXLA 3SU8X 3WAOA 3B9JA 5GAHC 2IBIB 5ISRA 1YZ6A 4DV3L 1F2MA 3K5OA 2MX2A 3Q3MC 2YYZA 4C3HG 1UBQA 4XYCA 2J53A 1SE3A 3PO3H 2N7JA 2JA8B 2D3BA 3AE9B 3S2HB 2RD0A 1WR1A 5CV5A 2VQFL 2W3RA 3F2CA 1SBBB 1JR0D 2CH4W 3C0RB 4GLAC 1QOBA 3HS0C 1JJCB 3QWNA 5BO4B 1AZPA 1EOVA 1VZ8A 3CCQA 4BBSB 4C3IH 3M3JA 1PDXA 4HKZE 3UIOB 4A3FG 4KZ0A 1ZDVA 2BF8B 4Y52H 4C3JH 4X66Q 4FF2A 1LM0A 1EL0A 4NB3A 4A3IB 3U4ZA 1PH1A 2OEOA 3GE8C 3I57A 3MC0B 1NENB 2B2YA 1T6BX 2KK8A 2WNMA 1DOMA 4OZAA 1LGRA 2AMCB 1IBKQ 1E7UA 1SE2A 4ODGA 1RF2D 4OO1I 4B9WA 3RD2A 2KLGA 2F0QA 4IJHA 2RA4A 4GN5A 5GQOA 4PT5A 4OIJA 2HJ1A 1WX9A 1DOIA 1GUSA 1XLPA 3D4RA 2LJIA 1SROA 1QVFA 3PQIA 3MC9A 1VQFA 5DNFA 1L1OA 1PRTF 1WY8A 2KC1A 2DZIA 1WJNA 3DMUA 2M0XA 2BA0A 3PLVA 3TBLD 2L76A 5ELNA 3GTGB 2N9XA 3V60A 3RZWC 2RBMA 4JI3L 5L37A 4WJPA 1FL0A 1S4ZA 3HRDD 4JK1C 3S16B 1A62A 2KMCA 1JCKB 4TQUS 2WYQA 4W9EA 1YI2A 4KKUA 1GJXA 4M8NA 1WXAA 3F2DA 2F4VQ 1BVSA 1TWHH 2W9NA 4JGHB 3CMAA 2EY1A 4DUZL 3L08A 3M95A 2KD0A 2YU9H 2JXMB 2F0UA 2OQKA 2L05A 3RNUA 5C23A 4QIWE 1IBLL 3LB8C 3ZTDA 1BXTA 5NUCA 3MFGA 4A3EB 1I6VC 3LX0A 1EWHA 2DGYA 3TN2A 2QDLA 3HOXH 5M9OA 2QDFA 4GOPC 2CKZB 2VQEL 4B3TL 2MP2B 5BN3A 1YNJC 1TZ1A 2CS4A 4IPGA 3AQQA 3MXPA 4DFAA 1GUTA 4MHEA 4HJKA 4JV5L 2Q8IB 1U5KA 1ZE3D 4ILWA 4B9KA 2GBJA 1LUZA 3TP8A 1LT4D 2R3ZA 2N8NA 4EZJA 4KHPL 2KWUB 1TWCH 2WXRA 3CU7A 3DVGY 3H15A 3ECIA 1D3ZA 3SDZA 4W9JA 2WB1B 1SRUA 1NY4A 4HJAA 5E6JA 1WE6A 2JYTA 3AFPA 3KLWA 4U673 2M19A 1F2RC 1UWXA 1VR9A 3J7A5 3HKZB 2JWZA 2WXOA 4II2B 4XWTA 1GHJA 4TMAB 1PRTC 3E9IA 1EY7A 3FKIB 1QF6A 3RZDB 4A3BH 4NJ6A 4FJYA 2JA7B 1VMPA 1PFMA 3L4PA 1RDPD 3J80c 5KHOA 1WGGA 3RNEC 2JA9A 1CSQA 2B63G 5IP7H 1G51A 2A6EC 3SGIA 4C1NI 3HOYH 4M02A 4JPSA 2O6VB 2NZOA 3TREA 4URKA 5JEAJ 4QAYA 4OZBA 2PW7A 3V6CB 1RODA 2KMMA 3R8BA 4JI6Q 2K8HA 1LT6D 1N9WA 3S9WA 1CA5A 2WXJA 4IWQA 3CC7A 3W3AA 4ZOHC 1EFID 3ZVVA 1XWEA 2A6HD 2E75C 5ELOA 3H8HA 4EOYA 3T8MA 1WCMB 2BYFA 2OQ0A 5C0XJ 1MSHA 4JYAQ 2DZMA 1C4PA 2MBQA 1H95A 1I5FA 2JX5A 3G6EA 3TMPB 2C35B 2D07B 2WXFA 2AHOB 2HDLA 3TSSA 2JA8H 1VQ5A 4RWSC 1NMGA 4LNIA 3R2TA 2TSSA 1CHQD 4ME5A 3QOLA 4L2YA 4DWFA 4YWKA 5JJZA 3R7RA 2SEBD 2PE6B 2Y0SG 1QWYA 4KMUC 4KY5A 2NR2A 3WCQA 1LLRD 5MPOA 1PFBA 1F52A 1BQQT 2QW7A 4N9PA 4R4OA 5JVG3 1PH4A 1PH5A 2D2QA 4RAUC 5I2YA 1ET6A 3TRZA 4KLKA 1UE7A 1JOOA 3PUZA 2R7ZG 1C4CA 3DHIC 1EF1A 2F3IA 1IBMQ 3PV1A 1E24A 1ESRA 1KLVA 3HM6X 2FUHB 3M4YA 3NQIA 3HZXA 2PQAA 3NWSA 3T56B 4A3IH 4I6PA 4ZDVA 4HWIB 3HOUG 1WMHA 4S3SA 4NQKE 1L6VA 2N49A 2IPKD 1WTOA 1UGJA 2N7EA 1HTPA 3NBHB 1IGCA 1J8CA 2F1MA 1PH2A 1SFOB 1N33Q 2E5LL 1ZGUB 1F2YA 3VYTA 2VNUD 2E3TA 4MTNA 2ZNVC 3AI5A 1GPXA 1TKGA 4XTCS 2I5MX 3LJ3A 1OQRA 3AYHB 2F0TA 1FIQA 2NZHA 3PHXB 1KC8C 3PRZA 2WXGA 2CU1A 4HVBA 2KAJA 3VA7A 3JAMc 5DM63 3C1EA 4K0KQ 4LF5Q 3PO2B 3GTGH 2ZCCA 1JRPA 4P1BC 3GV3A 1STGA 3KF6A 5EAYA 3IAS1 1SSNA 3IBEA 4DK5A 3S16H 3TS0A 2Q2HA 5A35A 5KYIA 1MJEA 1FGBD 4NZLB 4R1JA 1S5DD 1GG3A 4EQ5A 2KN5A 2B3AA 3C19A 2RSUA 4LF7L 5J1ZA 3CCUA 3PZ7A 2AYOB 3QQ8B 4ZUIA 1S5CD 3ZDTA 3M4QA 1NE3A 3P1MA 3OTOL 4OEMB 4ZRKA 2ZM6Q 2QJLA 1MG8A 3NELA 3G6JB 4IUVA 4B08A 1VQIA 4OVZA 3ABVB 3P4RB 3U4VA 5ELEA 4KGTA 1E0BA 1QJOA 1QVCA 4XT1B 1QUQA 2LUEA 1CFMA 3GZNB 4KSLC 4MELA 2WHIA 2HIVA 3C8YA 4XIGS 4DV3Q 5AFWA 5J17A 4L5TA 3QIAA 2RGFA 4AH6A 1Y1WH 1J7BA 4ZK9B 2GI9A 1BCPB 3QARA 1TS4A 4K81A 3O65B 1I4XA 1V1OA 2QILA 3GS2A 4OX9L 2FFKB 5CV7A 3SDLC 5JJLA 4YCUA 3AE5B 3K9OB 5GADC 2VZAA 1V8QA 4N9F4 1PZKD 5EE1A 2KACA 2F0KA 1YNXA 2KEDA 4FF1A 1B7YB 1N36L 1XO3A 2JT4B 2NCNA 4MM3A 2OJWA 2ZEQA 3DCGA 1I3QB 1ENCA 3TZDA 1STYA 1R9TB 2HTHA 3MXNA 3ZDMC 3TEWA 4JI8L 3S1MH 5J2RA 2WACA 4TQ0A 4KKSA 2ZW0A 3H7PA 4HPPA 1PH8A 2I07B 2BS2B 4BBRH 3CPFA 2A69D 1KHIA 1VQMA 1Q0WB 1JALA 3TL5A 3L17A 1N5XA 3DM1A 4B3RQ 3MTSA 2OJRA 1S40A 3FKIH 3AN1A 2J0JA 5EKIA 5AZGA 1IBXA 3JSVA 3AH7A 1OTCA 1MSGA 3AEEB 2K8BA 1B3AA 5M5WH 2CU3A 4ZYNA 3R93A 4DDID 4X6AH 1LTSD 2KA7A 3J80E 2NBVB 3Q8BA 4KZCA 4DDGD 3ER0A 1H4RA 5L95C 1STAA 1C7YA 1K83B 4CKEA 2KJRA 1E2WA 1YNNC 5I9OA 1LTBD 2EXZA 1K0RA 2JSVX 4FLHA 2XIWA 4A76A 4MJSB 3KUCB 1EIFA 1TWAB 4RCOA 2CHZA 4OWTB 1Q90A 1KDCA 4JCVE 3BVMA 5D3DA 2VH2A 1WZ3A 2KN4A 2HUGA 2JU6X 4EUTA 2LJ5A 5IY0A 4ZHOA 5CYUA 3R2IA 1BF4A 4II3B 3NE5B 2I1KA 3K57A 1A70A 4DK0A 1PUTA 4R4IA 4JI4L 3AB5A 3OJ4B 1STEA 4CDEC 5G3LD 1RHPA 1K8GA 1FR3A 3FP9A 2W55A 5C1ZA 2K0PA 5KRUA 2CJNA 4GNXB 4F1SA 2A19A 3B6YA 2BE5C 2G1EA 5JHBA 1PTOH 2DX5B 3CQZB 3MXUA 5DPWA 3VYUA 4DV7L 4E74A 5C3XA 2R93B 2F0IA 1GKHA 1FEHA 1S3OA 1D6EC 2K05A 3GTMH 1QZGA 1KRSA 3I4MB 2QSDA 2NS5A 4X65Q 3NP8A 3OSOA 3NWTA 2VQEQ 3AE2B 4KVGB 1ICFB 3EFUA 2F0LA 2MFIA 1UH6A 4BOZB 3UQAA 2JN4A 3EA6A 3HKSA 4P74A 1V1QA 4JV5Q 2CJOA 2UUBL 2GBRA 3NVYA 4MEMA 1ZYRC 5T8IA 1V86A 3J81j 4BXXH 1NR2A 1V49A 3T9LA 2WX0A 4IUNA 3MC8A 5JXVA 5EQ0A 4DV2L 2E2IH 2AX5A 1C78A 3CPWA 1N6ZA 2IY1B 4XE0A 4A3KH 3RLNA 1TQOA 1SFOH 5H1SE 1PH7A 1N5WA 3HOZB 3VH4B 4N6EB 3CAMA 4UP7A 1V2YA 2L1AA 3DDCB 2R92G 5ELBA 3TEYA 2KECA 2UUCL 3QK0A 1LT3D 4M8MA 1PTOD 5CHWA 4ITKA 1IPGA 3U58A 3AU7A 2LWPA 3I4NB 1ROEA 4K5VA 2NVXH 3P1HA 3KYCD 3JAME 4BWGB 2NBUA 1WX8A 1W3SA 2JYOA 3EROA 5T1IA 3C2PA 2UUAL 1F9PA 2NVUI 4GDKA 1RAXA 1JW9D 4CHTB 5T1GA 1Q82C 1KTKA 4PZ8A 4K6DA 4OW0A 1QE6A 5E4WC 2L00B 2XK5A 3A4SC 1V97A 3RLOA 3KLSX 4XZ4A 2L3ZA 1LFDA 1TIFA 1N60A 3VHTC 1CKOA 2LRUA 5C44G 1HTQA 5IT9c 1L0YB 2K5QA 4JI2L 2KX3A 3A8KE 2MNAA 2UYZB 1R4NB 5IYBG 3S2DH 1XMQL 1FJGL 2NPTA 3DBRB 4YWMA 2VRRB 4YT0B 2XNAC 5DEHA 5JEAH 4MACA 3FMCA 4X3KA 1F77A 5JHAA 1XEEA 3F8TA 3I90A 4WAAA 4DNTB 1PZJD 4HJ7A 2F0HA 2NVQH 1SN8A 1PH9A 3I3CA 1I3QH 3NSWA 1HA6A 3AFQA 4HRSA 3S2AA 1BNZA 5JJKA 4MDKE 5IGGA 3VRAB 3VH3B 3SK6A 4YY3L 5C0XH 3A74A 4IFDG 2FAZA 3G48A 2AL6A 2WXIA 2IJ0A 4JIOU 1S72A 2CWAA 5LXHA 2VUMB 2JA6H 1U9RA 1YJ1A 1GD7A 4GS3A 2F0MA 2Z8LA 4JQWC 1CI3M 4BA1I 2G4DB 1L1OB 1X3FA 4AQYQ 2X38A 1E8XA 3FRPB 1T0RC 4W9CA 1B2TA 2LHEA 3V3XA 3UINB 1L5PA 1BCPD 4EGVA 4P16A 4PK1A 1GAQB 3T1HQ 1D5ZC 2M0AA 1K83H 3TP7A 2KHIA 1PQSA 4CJ0B 3H0GG 1E1OA 1GOZA 2B2UC 3H91A 2PO4A 2Z59B 3PRPB 1TKWB 3RN5A 1K51A 2VH1A 1TWAH 2K7VA 4KKIA 5AEKB 1WTXA 4ANXA 3PUWA 3BY4B 3LWEA 4HDQA 1TIID 3L7ZC 4JC0A 4BS9A 4XQNA 1P98A 4RGNA 1VDVA 2DWQA 3R3OA 3QX1A 3D3RA 5G3LF 4DAMA 3H3VH 4LNKA 3BU2A 4CYEA 2N0SB 1H9SA 1WR6E 4B0EA 2JQOA 2KX0A 4XDDA 5D7GA 1B1ZA 4FF4A 1PYSB 2D5GA 2PW9A 3VR4A 3OTOQ 4OVVA 4LCDE 3CQZH 1FRDA 2DNCA 2PVOD 3OIPA 4L8JA 5DPTA 1Y1VB 5TR5A 1J5EL 4USAA 3ZNHB 5E6NA 3IL8A 3DWAA 2NTSA 2OEDA 2PMZB 4R4QA 3I4MH 2WX1A 4JWUC 4IC7B 2C5LC 2WXKA 1K50A 2JE6I 4FO2A 2GA4B 4YHHL 1CKNA 2K4KA 1TGZB 2WXNA 1G8ZD 1GM5A 4EZLA 4R8IA 3OOCA 1X32A 3HOUH 3PF5A 2IY5B 4Q5VA 4AS1A 2ICIA 4OX9Q 4P73A 3ULPA 2A68D 4KK7A 5CBAE 4C4VA 4DHJB 2WGSA 4NW2A 1HNWL 2HE7A 2QEJC 1KRHA 1S1QB 4DR3L 2I0QA 1VCIA 4NJCA 4C3IB 1I6HH 2B8GA 2DNEA 5K5PA 2QIEB 4DKAC 1ET9A 2MGSA 1FCLA 2YTVA 3SXHA 2G4SA 2L55A 2ZW1A 4C3JB 3IT6B 5IYCH 3M9BA 4RF0A 4BKSD 4U68A 1S5ED 1I7HA 1IP9A 3OAWA 1AW7A 1DD2A 1UEAB 1VQAA 3N52A 2J0TD 3B08A 4KSKC 3U2SC 2JP1A 1RTNA 2ZT9C 4LMQD 4AJYB 4A90A 2WKDA 2LKVA 2P5ZX 3ERQA 3NZ3A 1GUOA 2KDFB 4IOIE 4L5QA 1PGBA 3CMEA 2MJ8A 2Y3AA 2LMCA 2C9OA 5M3MH 2KEEA 1STNA 1TWGH 4LUVA 2DBYA 3AM9A 3J81i 4BBSG 3FPPA 3PUVA 2HD3A 1R7SA 1HNXQ 1Q86C 3N30A 4FYDA 3RCZA 3D31A 1IUEA 1HNZQ 3GDEA 1PGAA 4WH4A 4ARCA 4ZQ3A 1F2RI 5JZEB 4BFRA 1FO4A 2BTEA 2VY3A 4FXDA 4BY7H 1T0SC 2R7DA 1JROA 1NVID 5LMUQ 4FXKC 3S1RB 4A3MH 4X64L 2WFWA 2MA9B 4B3ML 2UU7A 5IT9E 3A56A 4MNOA 3KUDB 3RZOH 4JI4Q 4BY1B 1EIYB 1SMYC 2RMMA 3P7JA 3NVVA 1XD3B 1UAPA 2DYBA 3GB1A 4A3CG 4PNYA 1YOVB 2Z1CA 2KDIA 2VW9A 2YU9B 2IO1B 2PQAB 2O5JC 1N34L 1XMOL 4DV7Q 4KGRA 1WMHB 5G5HA 1SNPA 1CMXB 1IHZA 1DCZA 3UE0A 2BS4B 3IHPC 5IKCM 2BBCA 1IW7C 1OXUA 3STBD 2MBBB 2IT1A 2K5VA 1KF6B 4C56C 3VVWB 1K8MA 2M00A 4J6HA 3B2FA 3CC4A 5IE8A 3MXGA 4GOCA 2ONQA 1O80A 1VQ4A 5FLMH 4A4IA 1NAPA 1KNEA 1YJJA 4KHVA 4RGTA 2UUBQ 4K7SA 1HJPA 4MSQB 1YJ9A 4BKSA 1O7YA 1F2ZA 3TIXA 2BWFA 5C3EG 1BCPF 1MD2D 4DV2Q 3H6NA 1WM3A 4KJNA 2KANA 2IO0B 3AU4A 3KF6B 3HOVG 3SK4A 2Q5WD 4A3EG 3L13A 2UUCQ 4JX1C 2W54A 1TWFB 5KGUA 3KJOA 1MVKA 1VQ6A 1SYBA 1IZ6A 3M7GA 1VF7A 3F2UA 2JPHA 2Z0EB 2A5UA 1WFQA 5E6OA 3R7QA 4IOAA 2PEAA 4A3BB 2AWTA 3QAQA 3L0OA 5C3JB 4LK1C 4HCSA 1AFPA 5TSSA 1MBYA 4HIDA 1FXAA 3AE6B 5HG2A 1J6QA 4HIOA 1E8WA 2FCSA 1QUQB 1KQSA 2UUAQ 3NTHA 3HOYB 5LXIB 2QDBA 1KFYB 1C4QA 1E8YA 3VYSA 1CQVA 5BN5A 4C80A 2F0DA 2XN9C 2OWOA 1A6XA 4V0BA 1LQBA 2E2JB 2MJDA 2UWQA 1K3RA 4JOIC 2IYDB 2K5PA 1NNXA 4QJFA 3U7DA 1E10A 2EYHA 2F03A 1V5OA 4AOFA 4G7HC 3L3OC 3DWPA 3MJWA 4LUZA 3WWVA 4HMJA 3APDA 3EJIA 4JG2A 3BYYB 1QOAA 2YLMA 4MM3B 1P7EA 3RNGC 4XWWA 2MWSB 3MXNB 3EGRA 3PUXA 2EYPA 4POFA 3A8IE 2HQLA 3OIQA 4ME3A 4N8X1 1E6EB 2DYOA 1XMQQ 3GE3C 3H7PB 4ZYSA 3U8ZA 3DBHI 1WYDA 1R4MI 3RN9C 3VYRA 2J0MA 2NN6G 4CDFC 4DV0Q 4A3LH 2FNJB 1FNVA 4JBMA 2JF5A 1ZP0B 4KGSA 4CHKA 3A5ZB 2ATWA 1IBXB 1ENAA 1PFSA 3PIO3 4BOSC 3JSVB 1JE5A 2JJQA 1L4DB 3AEBB 5FJ8H 3IKJA 4K1RB 1WCMG 3OPOA 3HVDA 2RVLA 3ULJA 2E6XA 2F0NA 4OO1H 2IGHA 5D6JB 2Y5CA 3TJPA 3W9CB 5I2XA 1GVPA 1VQHA 1Y8OB 1RKNA 1BUIC 1VQJA 2IO2B 4FADA 2SNSA 1WTRA 2RSNA 3HFZB 4DV5L 3AE1B 2IHFA 4DHZE 3EN2A 4X3TA 4YSYB 5IA7A 1WOCA 3P4SB 4HJ5A 1NDDA 3H6MA 3VR2A 5HGTA 2LVQA 2E2DC 4ZCKA 1A3TA 1YITA 1TT2A 3AEGB 4J3OD 1SMXA 3I73A 4OWXB 2TMPA 4DR1Q 1ILPA 3MHZA 4REZA 3H09A 4IUMB 4DHJD 3SK5A 2K22A 1RCVD 1DOYA 3K7UC 4AYBB 2KT7A 2UXCQ 3PLUA 4IW0A 4LFBQ 5C2TB 2PI2A 3U9SA 4W9LA 1FNWA 5CBEE 4G50A 1LT5D 1PFNA 3DEOA 3HOWB 4KKTA 3PUYA 2SDFA 4GLVB 3S1RH 4A3DH 3L16A 2DHZA 3HVZA 5AUKA 4DN4M 2R2QA 1QOGA 2Y5BB 3RMHA 4BY1H 3KUPA 1H9MA 1MHHE 1UWMA 4PMCA 3A7AB 1NEKB 3CRLC 4GKKQ 5CV8A 3OLMD 2JA5B 2WV6D 2Z4IA 1D5XC 1LTAD 4DUYL 1RFKA 1WJ4A 2JVCA 3PIPA 3MHSD 3W1GA 1J5EQ 3URYA 3JYUA 2LHDA 1X1MA 3IT4B 2N55A 1A0IA 2MUYA 3Q6SA 2F4IA 2HCIA 4WFN3 4GNXC 3PO2G 1WM2A 2JUOA 3DBSA 4X57B 1Y1WB 1XYIA 3ERSX 1U4AA 2ZVNA 2D2CC 1ZXTA 1TKYA 3KDFA 4DK6C 3P20A 3DBLI 1Y56A 1XLNA 4XDXA 2WDRB 3LNNA 4H44C 3X3NA 4IFDI 4MH8A 1UD7A 5BMHA 2N3SA 1JMLA 2KTFA 2M17A 2QMTA 4AJWA 2D10A 4LNQA 3KLRA 1HNWQ 4MSMB 5DPRA 5I6YA 4DR3Q 2H88B 1SNCA 1EQTA 2LS01 4A3JG 2K5DA 2M4NA 4HCPB 1KAWA 3NTIA 3S1MB 1JT8A 4ANWA 3TQYA 1KNAA 4P71A 1VQ7A 3J7YW 2MH7A 2KQ3A 3WALA 4BBRB 1CKMA 4GDKB 4E3CA 4YXDB 5M5XB 4OVUA 3P42A 1H8CA 2AQ1B 1U4PA 4GB9A 1TWFH 2LGIA 3E5SA 1A5RA 3CW2C 4HROA 2RKSA 5GROA 4A93G 1XNQL 4C00A 3A0JA 2EKIA 3IXSA 1Y69U 1VLBA 2XK5B 1WH3A 4WURA 5M5WB 2INNE 3IFWB 4UPAA 1EF5A 3AMZA 2HQEA 2H5XA 3S17H 1ZKHA 2F3WA 2D3AA 2B8FA 1WJUA 2BYVE 1ZUD2 2RHQB 3NS8A 3UI3A 4RHRA 2LZ6A 2XGTA 2L0TA 4DGZA 2AWNA 2E2JH 4IM0A 1FD7D 1Q46A 3GTQH 3TDQA 1WFYA 4DA2A 1YHBA 4HXDA 2MW5A 3DM3A 2KMAA 4C3HB 3BJUA 2FBWB 3N20C 3U30A 2RCFA 1OQQA 1O7LA 2B3GA 1SNDA 2KWDA 2H4OA 3R66C 1STBA 2R6GA 4NXML 2KNBA 2ZJPA 1X56A 4KY7A 2M1MA 1JICA 4FF3A 3M4OB 2UXDL 1HUMA 2UU9L 3X0WA 1V6EA 3KWLA 1B50A 3BVZA 2A8VA 3A7LA 4DK3C 1PTOB 4OWWB 4TV3A 3VUWA 4GLXA 2KWCA 1ZKOA 1EEID 1N34Q 1A3VA 1XMOQ 3L54A 1TVXA 4JI1L 2WDQB 4US8A 3GTMB 1YQ3B 4GLSC 2MBEA 4A55A 3KFUA 1KXLA 3SR1A 4DK1A 2L9HA 1RRBA 2LXAA 1QKZA 2LFNA 1N61A 1PH3A 3W2DA 5JVH3 3B1LX 4F7XA 1MHXA 3IVFA 3LXFA 4LK0M 2K5WA 2VS1A 2C7NB 4LFAL 2KFKA 4WJQA 2LXCA 4H0LC 3K5MA 3I9V1 2K33A 4IM2A 1P16A 1RYJA 1OO9B 3IAYA 3QHTA 2L12A 3WAPA 2KHSA 2LUMA 4IURA 1IYVA 1QB5D 2F0JA 2V3PA 2PPBC 1VD2A 3P2BA 2WU5B 4QGUA 2E2IB 1ZW7A 1WZ0A 1X3PA 3KBXA 3VTVA 2KTRB 3AULA 4A3KB 4QF4A 4TSSA 1QNUA 3EQLC 4JVZA 5HY6A 3O13A 1WJJA 1IKLA 1EY4A 1WI5A 2R93G 2SOBA 1XX8A 5CC4A 2J52A 1G291 2X69A 1EWIA 5IYDG 1ISNA 2FJ2A 4GN3B 3T51B 2KCMA 3M7NA 1H9RA 2YTXA 3BVGA 3P4QB 4LFCQ 1H9SB 2N1WA 3MJ5A 4JW0A 4KX6B 2DJGC 5JPNC 2HHHQ 4F88A 2NVXB 2JEBI 3A9JA 2M56B 4EX5A 4N8FA 1EUVB 3IAM1 2MP1A 1Z47A 3IFDA 1EZ8A 3C3LA 2NWGA 2WB1E 1SSOA 2GRIA 2KYWA 3HOWH 4L63B 1U0LA 4IO9A 3S1QH 3I4OA 5M3FH 2OTJA 1C0AA 1P0RA 2GBNA 4LNOA 1HFGA 3SVMA 1SAPA 2K3UA 1EY8A 5KNDA 3HKZE 1W2BA 1N8RC 4FXCA 2AWOA 4KIKA 1SJED 4NNJB 4PYUA 3RFZB 1B70B 2LGDA 1WGDA 3ZLZA 4CBVA 1CKNB 1NTGA 2O2VA 3MP9A 3PZ8A 3HOZG 4FP5D 3I72A 1C3TA 3ALBA 2MRPA 1Q1BA 1GB4A 2JA5H 3I3TB 4F8CB 4C4VB 2IY0B 3A4RA 3DVNV 3HEJA 3N3KB 4LF9L 2WS3B 5LLIA 1DONA 2D0OA 4JI0L 4XX5A 1K8RB 4GGQA 1ASYA 1OQYA 1F1HA 4DR7L 4WWPA 2IX0A 3S2DB 2I2YA 2ZPYA 3T16A 1Y8RC 4EQOA 2WXHA 1NYRA 3L0WB 1IYFA 1QNKA 1JJGA 3A1QA 4EVOA 4HSPA 4M01A 2Q2UA 1BR9A 2VQFQ 1D2BA 2K1FA 2ZPNA 1YN5A 3S15B 4OGQC 3ZQ4A 1CSPA 4WRDA 3KK7A 4B3SL 3MZ5A 2LXKA 4LLGM 1VCBA 3Q8FA 4KDLB 4A9AA 2NVQB 5IP9G 1RTOA 3NVWA 3U4EG 4NAWA 5K36G 3ZTCA 1G2TA 1NYQA 4KD3A 2WU2B 1SE9A 3SR6A 2B2WC 3OW2A 4K2LA 5IOIA 1D4BA 1EEFD 3CF6E 2D5DA 4DR4L 1LACA 2LMCB 3Q8DA 2JA6B 1KAAA 2QGQA 5M5XH 3HM3A 1NCVA 3PCOB 2PPHA 4I65A 2K6AA 1M1KC 3D32A 4LF6L 5M5YH 1IGDA 3EC8A 3FHWA 4HMIA 1GJZA 3I7FA 3TP5A 4DV5Q 2NB0A 3EHVA 3UGBB 4WORA 4XYOA 3RR5A 4RG1A 4A75A 1GC7A 2CHBD 1WIAA 4CKBA 5IODA 4P75A 1C48A 3NVZA 1CHPD 4MH0E 4RMFA 3JW0X 5IN7A 3NZSA 3AB9A 4G4KA 1L0VB 4K5WA 2C5CA 5CR3A 1CT1D 1VQEA 2K32A 1EY6A 3RUZA 1E2VA 4LNFA 4MGYE 4HK2A 3CCEA 1JE4A 2Z4HA 2LY7A 5DLQE 1GHKA 2ES2A 2VUMG 1A3UA 2DY7A 4JBKA 5HKHA 2JK8A 4C3HH 1I94L 1E22A 4JI3Q 4DV1L 5IIFA 2QEXA 1MFWA 2RR9A 4A6QA 5LHY1 1KH0A 1AARA 1DGJA 4HKQA 5CV6A 4DU9A 2FUG1 5CV9A 5EBCA 3I63C 3P63A 3VR8B 1FVIA 3E3XA 1WYGA 3CSTA 3M4OH 1K8OA 1TS5A 3RYTA 2DZJA 3MEFA 2Y0SB 3Q8EA 4PQXA 2MLBA 3NTKA 5BYSA 2L11A 4DUZQ 2V1YA 1I50H 1QQRA 2HT1A 1X55A 2RPQA 1K8AC 2MEKA 2G3QB 1KDBA 2KFJA 2EE1A 1IBLQ 4DUYQ 3OMCA 1H9JA 2B2UA 2X6GA 2BB5A 4GU2A 4A3FH 4J6IA 2NN6I 3S15H 2R7ZB 5EE0A 3GTOH 4LJPB 1I35A 2RSOA 5C4XG 1ESFA 2Z9HA 4B3TQ 3ZO5B 3QCAA 2F0FA 3TP6A 1AZQA 2LVOA 4PS8A 5G2NA 3HOUB 4DR2L 4IZ8A 1EY0A 1WJ6A 2AKWB 1AE3A 1EO6A 2KVRA 5AZFA 4DV6L 1FYCA 3BINA 4P2CB 1V80A 2KQ7A 2Z0SA 2PCFB 5JOBA 1VQ8A 1AEXA 3K6OA 4A3GG 1JWUD 2I38A 1FPYA 2VL6A 1X54A 1YQ4B 3WAMA 4KHPQ 4RGOS 1I6HB 1LTGD 3MFYA 4JI7L 2ZTCA 3E6ZX 3JVZX 4DBGA 2KCTA 3H7SA 2LVPA 3NXWA 1II3A 2MHJA 2M2LA 2AQ3B 1RIPA 1JMCA 4PZ6A 1PFDA 2BB6A 4L6TB 2JXXA 1HQRD 2V4DA 4I6LB 2BH8A 4NY0A 3EBEA 2A6HC 5KHQA 1WRDB 1DGSA 3LYYA 3PO3G 1XNQQ 3E9HA 2C60A 1HZ6A 1M94A 1FM0D 2DAFA 4OHJA 4GKJL 3WOEA 2EZVA 2L0CA 5EPKA 3T4AC 4IALA 4I7AA 2D11A 2HTME 2ZVOA 5M3MB 1TWGB 5H92C 1Q3LA 3TBIB 2EMTA 4EKUA 1HR0L 3ZNZB 1J19A 2ID0A 4N9TA 1WTQA 1UF0A 1WXMA 2K25A 3APFA 1EUJA 2ON8A 4BY7B 5IWAL 4C3JG 3RULA 3UDGA 5EPJA 4A3MB 3PO0A 1XCTL 5C4HA 5C4JH 4LF8L 2EJFC 5I4DA 5KNBA 4NXMQ 2F0GA 1WI0A 2IWHA 4CGYB 3RZOB 1EOTA 3CCRA 1YN4A 1AWDA 2SAKA 1ZOYB 3NRZA 2UXDQ 1RJTA 2KQ4X 4EE2A 3PVLA 4F87A 2BDOA 1NSNS 4HCEA 4R8NA 2E2HB 3E56A 4A3JH 2G9DA 5LMNW 3UIPB 3FPUB 1TU2B 4JI1Q 3T1YL 1P1AA 2W82A 5LMNL 3RD4A 2K28A 4C2MB 4K5XA 5C5MA 3J9CA 4WIPA 1KRTA 3PHWB 3KUZA 1I42A 2DYMA 1PGXA 2K6QA 4A93H 4LFAQ 3NG0A 2NTTA 1SYGA 3P75A 4ZAIA 1RFAA 2WXQA 1K52A 2Z6KC 4LF4L 3N32A 3GZNI 3CHBD 3RZFA 2B63H 4NAMA 3C46A 4TVAB 1WF9A 4JPBW 2FXQA 1YHQA 4HIKA 4DR6L 4O2DA 1PVOA 5LL6S 1OEYA 1IYUA 2WXMA 3DPDA 1EZ6A 2N78A 2E5LQ 2EYOA 1K53A 1TXYA 3DQVA 2WP9B 3V62A 4RGMA 3QG1A 4R4TA 4G7OC 3HOXG 2PLPA 2OOBB 5CX3A 3ITPA 1PYWD 1UE5A 2F0WA 1LO5D 1NMFA 2WLBA 4IFDJ 1AH9A 3F1ZA 3Q0AA 4MGIE 2MPMA 1L6UA 2R2OA 2BA1A 1UZXB 2I1JA 2KLCA 3CMMB 2MJEA 2V3SA 3QWZB 1EQRA 2K1BA 4W9IA 2KKCA 2KHJA 3FAHA 2I46A 2BKRB 2EYJA 2CHWA 1KOTA 3PPAA 3H9DA 1J7CA 4LF7Q 2ZZPB 3W5VB 2CKHB 3KDFB 2E8GA 2OHFA 3ZIMA 1T5XD 4WJ3M 1K3BC 1L0XB 2VB2X 1B9NA 1R4MB 2BPSA 4ICVA 1TTNA 1S5FD 2B2VC 2I5HA 1CZPA 3BS1A 3V6EB 1CQFA 2EYFA 2R7ZH 4UY8C 1T0YA 3CCLA 2K9XA 3K59A 4A3BG 4JI0Q 4X3SA 4POGA 5IGBA 1J8IA 3PSEB 5GXGB 4DR7Q 2A69C 2ENBA 1V9JA 2Z0DB 2JQRB 4KD4A 1F2LA 3GP7A 2F4VL 1FFUA 1TJEA 2H1EA 4HLEA 4ID6A 5A2QE 3VRBB 5IP7G 1C8CA 3M4PA 1ASZA 3HOYG 2CFMA 3EECA 1SE8A 4RH6A 3Q23A 1CJEA 1TKEA 1VZ6A 1V9PA 2KENA 4HAEA 4QL5A 1QLBB 1YBYA 2B29A 1N36Q 2ZTDA 2R92B 3IG3A 1F0ZA 4IOCA 4JI8Q 3UE1A 1PTOF 3MEHA 3E0JA 2RDFA 5JH5C 2BYEA 3M62B 1B8AA 4M0WA 3DHQA 4TRDA 4JL9A 3I2ZA 1C76A 1A8VA 1HTOA 1QCBD 1HE8A 5ELDA 2JA8G 2MSED 1VZ7A 4LF6Q 2JWUA 1N32L 1E2ZA 1AYFA 2FMCA 3TUOA 1WTVA 3VTWA 1DOKA 5CV4A 4UHVA 4RM9A 5KEEA 4NP5A 1Q1OA 3ZNGC 3ENEA 1G6ZA 5F2DA 5C4ZA 1VJKA 4EEWA 1T9HA 2WAQB 2AQ2B 2CR5A 3AV8A 3PGEA 1Q10A 3W1SC 1ILQA 1B9RA 2J4XA 1FGUA 4WJ4A 3OYYA 1H9KA 3ETRA 4CO7A 4D2KA 5CTRC 4DQOC 3UQBA 1GB1A 1YNJD 1SYEA 1C77A 4O0AA 1CK1A 1STHA 4XQJA 3APCA 2PI2E 3D6WA 2MHVA 5C44B 3A9KA 4B0MA 1YD8U 2PQEA 3OMGA 4FNFA 4H02A 4JLCA 2A74C 4FA6A 2NVYH 3K5NA 4A3DB 4ACFA 4A3IG 1I94Q 3SFEB 3NHHA 1WTHA 4DV1Q 1BMLC 2BVCA 3EUB2 2V1CC 1VRAB 2L5TA 1ZEQX 5E3FA 4CDCC 2PZUA 3KQ4A 5FLXc 1Z5SB 1Q8IA 3J81c 4UP8A 4MGKE 1QG7A 1EWYC 1IYJB 2KFKB 4WJWA 3BG3A 2HDEA 1XJVA 1HZ5A 3DLLA 3PTFC 1EYGA 1RD9D 2CHXA 2E2HH 5FR6A 4FN2A 4PS3A 1O7ZA 1N63A 3DBLB 3FKYA 2N9KA 4P7IA 2F52A 1PA6A 4AYBG 2JYEA 2L32A 1PRTD 3UF8A 2IL8A 4YTMB 4C2MH 3Q3JA 2EMSA 1PTOC 2RHSB 5E4XA 2E76C 2FE8A 3X23A 1VF5C 3QJYA 4B95A 2QHOA 1WXQA 2A6ED 4DR2Q 3FC4A 3N6RA 2MO0A 4DV6Q 3AE4B 3ZW3A 2VZKB 1T5EA 2PMZE 2IGDA 3D8GA 3PGZA 3A9JB 1HZCA 2A4ZA 1M90C 1JWSD 2HD5B 2OT2A 1R4NI 2HJ8A 2PTLA 3D4WA 4HN7A 1Q1EA 4JI7Q 1EWCA 2J7ZA 3K8AA 4V190 4W9GA 2DZKA 3I8ZA 3DBRI 3H0GB 1YX6B 2B2TC 3SE0A 2J0KA 2EJGC 1XNRL 1MPEA 1UNSA 4RKLA 3TEHB 1FCCC 2LEKA 4KIKB 4GOPA 4KN4C 1QOHA 3UDIA 3V96A 1E8ZA 1EY5A 2BW2A 2LD9A 4TUUA 2O2VB 3BZKA 1Y1WG 4B6WA 5D65A 3RN2A 3Q8AA 2K01A 1DM0B 4ZRJA 2GB1A 2KDBA 4APVA 1BBXC 2E74C 4HR7B 2REXA 5E1FA 4GKJQ 3FVQA 3VTUA 2BDNA 1TS2A 3J80L 3S17B 2KOXA 2WQYB 1HZBA 1WSPA 3S14H 2V9HA 2PYKA 1D1IA 4FVMA 4MN3A 5ELCA 3ND9A 2WDTB 4YIJA 4RMAA 1GUGA 1PMRA 2ZJRA 2XVSA 2WB1G 3TZUA 3GTQB 1OGWA 2FCMA 3A1QB 5FO8B 3B2GA 1XPOA 2LSSA 3N9YC 4BBRG 2JZZA 3NZUA 3SHLA 5IWAQ 3GO5A 3G7LA 3HKZG 4NPSA 5GAGC 2WAQE 3GTKH 2EOTA 3MAQA 1V5TA 3FKIG 4JI2Q 3PV0A 4IDIA 4LNNA 4P6VF 2JA7G 1SF0A 4NAWB 4XQQA 4LF8Q 1E90A 4QIWB 1X65A 5EJWA 4IWPA 1SNQA 1VMCA 3JC66 2DENB 1FJGQ 2UXBL 4GDLA 2K03A 3HRZC 4K6LA 1B44D 2PMVA 4W9FA 3WANA 3ZKJC 1V1PA 3G71A 1YIJA 2N9PC 2N88A 4WJNA 4WAFA 1BCPC 2OXPA 2X6LA 3T1YQ 4DXGA 5LMNQ 1KDAA 4L5RC 2R92H 1BBUA 3S1NB 3HUIA 1MG4A 1F9QA 3L2PA 5FKAC 4GZYC 1SIFA 4YY3Q 1CA6A 2NMQA 3NY5A 3Q2AC 4K7WA 2YEPB 4CJ1B 1D7QA 4PMBA 1OTRB 2EVBA 4NXNL 1RLFA 3AEVA 1C1YB 3ULLA 3KOJA 2CW0C 1I4GA 4N59A 2L0FA 3HP3A 2D3GA 2JZ3B 2EJMA 2MBHA 2FMMA 5EE9A 4LF4Q 1FXTB 1L0WA 4C7ZA 4IPDA 4BZAA 3DWMA 4AIMA 4DPGA 3EFXD 3UI2A 2DLBA 4CDDC 5E7NA 4DR6Q 2O4XA 2L1BA 3SD5A 4ANUA 1LTRD 5E6PA 3NBIA 3BZCA 1P8LA 3SHQA 4G0NB 3CCVA 3PMFA 1UUPA 3NPPA 2PZWA 2L7RA 1UE6A 2N4FA 3JAML 2FCNA 4X62L 2QC8A 3Q3NC 4L1BA 3NEMA 5C44H 4B3RL 1ZXIA 3Q24A 2KJ6A 1OXVA 2L4NA 1MI2A 1OEYJ 1F9RA 2IX1A 1UELA 5IYBH 1EQQA 2L15A 5M3FB 3S1QB 4BXXG 3Q22A 3KLSA 2RCNA 2G5DA 3RNBC 5H8YE 3X3MA 3CP0A 1XTCD 1UBIA 1HZ9A 3BZDB 3OWEB 3GTJB 4FXGC 3GTLB 3VQIA 4IQZA 5EBDA 5FLXE 4A3KG 2MJ3A 3PF4A 3QIJA 2A68C 2SNMA 4OONA 3BYTB 3J81E 3OG5A 4E71A 2M9VA 2IGGA 1SEBD 4PG3A 1DOXA 4KJOA 3BDOA 2BS3B 4ULLA 3H3VC 3A33B 4EQNA 2KQSA 4TQ1A 4IFDH 5J39A 2YTYA 1O78A 4HJ8A 2JEAI 4A8XC 2RF4A 2FCQA 4G3XB 4HPMB 1Z9FA 4R9WA 1YJIA 3KWVA 4YHHQ 2L8JA 2V0GA 3K5LA 4ZRPA 1IL2A 2NYZD 3NK9A 3I56A 4IUPA 1X9NA 5C3EB 4M8AA 2VXWA 1J7AA 3NOBA 1HFNA 3AE7B 4DNIA 1YNND 1B9MA 3D4DA 3DEPA 2IO3B 4XYQA 2Z6BA 3HOVB 1G2SA 2KXJA 2LFIA 2RPVA 4YWGG 3DUZA 3ZJUA 2GVAA 1XLOA 2BQQA 1T3QA 1JJ2A 1LXDA 1VQGA 3ZRFA 1S5BD 4X65L 4AQ7A 1Z6HA 3H0GH 2B76B 4DXFA 2NBFA 3I91A 4QB4A 4LWCA 3GTPH 4IWOA 5BMIA 4EQPA 3VFKA 1NI2A 4Y7NB 4H7BA 1V8CA 1TS3A 2PIAA 3NJTA 3AECB 5M5YB 2OCEA 1VS0A 4LDTD 2IDYA 1X3GA 4MIUA 1N32Q 2BE5D 5IOCA 1LTTD 4DAPA 5JEAG 4XT3B 4WQOB 1ML0D 2RQXA 1I4RA 2M8SA 3J80i 2DJFC 2XRSD 3T3OA 2WKCA 2BGFA 3EVQA 5IGEA 4YCWA 3L10B 3B0AA 4ICUA 3TS2A 1X3EA 1VQDA 3VA5A 2VZKD 3PT2B 5C0XG 3PIP3 2CQAA 2B2WA 3ZYYX 1DYQA 2NPTB 2XEWA 1E3PA 1BBWA 1NBFC 1NJIC 3CCMA 5BN4A 5EGTA 1SDFA 2JA6G 1MJDA 3RNCC 4NQLB 4N58A 1ZYRD 5JAVA 3AU5A 3STBC 1WWTA 3K7AB 4HPLB 4X64Q 1BO0A 2ZJQA 2GN5A 4B3MQ 5BYRA 4CQNA 3QC8B 4AYBE 3I70A 1FNUA 4WQMA 3ZNID 3DWQA 2KOLA 1EQVA 4FDBA 3CXCA 4AUQC 4IN3A 1L2FA 1OXXK 5GAEC 4KV2A 4ZRIA 2Y5PA 3U7ZA 3GV6A 2BCOA 3HG9A 4OIKA 1XPUA 4S17A 4YSXB 1RM6C 1EU4A 3EIVA 4J8QA 1I50B 1DZ1A 1EYCA 2RDHA 1JOKA 2BYTA 3KF8A 3V2TA 1PV4A 1Q81C 5JJIA 1B53A 3ONAB 4A3FB 4JI5L 2QCPX 1LTID 1HPCA 4HTHA 1KIXA 2F3VA 1GO3E 3FEWX 2B39A 4KV6A 3GTOB 3S1NH 2EKEC 1YJNA 2A5HA 1XPRA 4K8IA 1VQOA 1WYWB 3U9OA 2ZXRA 3CSFA 3U52E 3DHHC 5DPSA 4K7UA 5A2QL 3KW5B 2B2YC 2FINB 1WXSA 3S2HH 5KYLA 3OHXC 2PW5A 4RNAA 3MWYW 5IAAC 3BK2A 1U4MA 1AN8A 2I5LX 3AE3B 1CM9A 3W1BA 4EZKA 3KH0A 1GUNA 1ACCA 3VUYA 3QR8A 2K39A 3V61A 2KO3A 1BOSA 3FILA 4DV4L 1QT9A 3TEXA 4BBSH 4G57A 3E9SA 4KDIC 1HXYD 1UEBA 4WWMA 3DXJC 2KCCA 1J9OA 2KHWB 2INDC 1D1KA 1L1OC 4DAYA 1XNRQ 1QOFA 3I4MG 4K3BA 3K9PB 1R4QB 3RMKC 4RM8A 4KY6A 1UWVA 2PE9A 1K0SA 5D14A 3JAMi 1X3QA 2PZTA 4XXEA 2K75A 2H89B 4AQYL 2R7FA 1LM8B 1P9DU 1HH2P 3EFCA 4B9XA 1K73C 3RLFA 3TCAA 5CGKA 4W9HA 3GTJH 3T1HL 5AJ3L 3GTLH 2K04A 4A3CH 1SJHD 5J3BA 1NBWA 4YL8A 1I4HA 1B3QA 1Y14B 1YJWA 5IP4D 5COYA 3OJ3A 1PLFA 1E1TA 1YMHE 4O42A 3ICEA 5I6WA 5IYCG 1L7YA 1WE7A 1Q5WB 2O5IC 1K9MC 1A63A 1KLUD 3CRKC 1QVGA 2Q8TA 5IT9L 3I4NG 4QMGA 5C4JB 2LI5A 1FRRA 2AL3A 3Q8CA 4L5SA 3DHGC 1NI3A 4FBJB 1X6OA 2N9EB 3FDTA 4ABNA 3KYHC 4KN7C 1E7PB 3D6CA 2GLSA 1U4LA 2J42A 4UP9A 1GNUA 5KIXA 3CCSA 3BIID 2UXBQ 3H1UA 5I9PA 5HI1A 1E5WA 1GUAB 3A55A 5BR8L 1LABA 5M3MG 5C3EH 3CWIA 4M0WB 1EU3A 2QCZA 1O7IA 4A3JB 1IKMA 4W9KA 4JBJA 4GMVA 2WDVB 1L4ZB 3HOVH 1VQBA 1U4RA 1G6PA 1DXMA 5C5LA 4A3EH 4BY7G 2KVMA 4WWOA 3D0FA 2K8CA 2V4LA 5CHVC 1CZWA 2OTLA 2EIFA 4A3MG 3WA0A 4ZHPA 4A93B 5AUIA 4E6IA 4H2AA 4LJOB 3RUIB 1VQLA 4NXNQ 5J22A 1JRUA 4PYZA 2XRQD 4Y7NH 3AMUA 4LJZC 4AP4C 1DOLA 4C1NK 1NUCA 4J15A 3A9KB 2B63B 1JQYD 3CIRB 4ZRQA 4R4CA 2WXPA 4K8JA 1WD0A 5LL6X 5L83A 1RWSA 5G5GA 1FD6A 1F9SA 1HUNA 1XF5L 4ZUJA 4HEDA 2ASQA 3SFDB 1QZEA 3BK1A 1BT0A 2K50A 2GBMA 2DUDA 1I4PA 2K14A 2PNHA 4CJ2C 5HGQA 4P72A 4X62Q 1CZGA 2OF1A 5FLMG 4GN1A 4YSZB 3RZDH 1WGHA 3W1YA 2JA7H 4AWJA 3K7AH 3N1XC 1E7ZA 2Z6KA 4J1MA 5HFYA 2HCCA 2QA4A 2EYMA 2WP8J 2F0EA 2Q2TA 4BA2I 2JZPA 4IG7B 2ALYB 1VQNA 2NN6H 5DCNA 2G9HD 4DR5L 4WJOA 1OXTA 3P4PB 1YHAA 1HNXL 2K6DB 5CMDA 1JWMD 1ZXHA 1HNZL 4MTKA 3WOFA 4HIMA 4FJZA 4XDCA 2KJXA 3J7AF 3J7AV 2F0OA 2BOSA 1N62A 4DNRB 1WCMH 5LMUL 2PNRC 4QY7A 2IHEA 1UE1A 1VQ9A 1YEZA 1WGRA 1ZPSA 2DNFA 3K0XA 1I4QA 3W5UB 5FOBB 1QZHA 1HA5A 4UDUC 4RA8A 4QUFA 4HDOA 4ZRZA 1WTWA 1JQ4A 4GOPB 1PDQA 4ALPA
chains in the Genus database with same CATH topology
3LWUA 2IX3A 3IFTA 1GUWA 4KKJA 3VR5A 3OW7A 4ZKCB 1R4PB 4YTNB 2V3NA 1ONLA 2B2VA 1ZDXA 2F0PA 2EYLA 5CORA 3QOJA 1MI0A 1PZID 1SMYD 2EY6A 4K2KA 5EKKA 1IL8A 2YEPF 1WD1A 3GD7A 2INPE 2JXTA 4R3DA 2NZ1D 1PRTB 1BDOA 3BDLA 1C4AA 3VR3A 4C3IG 1MGSA 1IW7D 4TKOB 5C6AA 1JB3A 3I4LA 2WIIB 4X3UA 4GDLB 4JE3B 4OO1G 1A15A 1A2UA 1V1PB 3A8JE 1EIHA 2NVYB 1Y8PB 4L23A 4C7ZA 1XCQL 3WDNA 1YN3A 4OL7A 4PV1C 5FLXL 3J81L 1JC7A 3GQBA 5HHDG 1YNTE 2EPBA 3T53B 2PKOA 1EM7A 3W1SA 4F8MA 2DY8A 1SYFA 1QILA 3K0YA 2ZXOA 5C3WA 4YTPB 1TYGB 3M3YB 5IGDA 5DAUA 2NVTB 1XLQA 1W6KA 4UAIA 3QB3A 4Q2JA 2EY2A 2CVRA 3H94A 2QF7A 5FO9B 4DAVA 3MA2B 1WTPA 4HJGE 3TEZA 1GXDC 1KLGD 5FK9C 1TY0A 3QO2A 1OXSC 4OZCA 1HEZE 4RFBA 4Q0FA 3AEAB 5HURA 4RCNA 3KBGA 2Q8RE 1SYCA 1V43A 5C0XI 1KABA 1VDZA 1M8AA 4NDXA 2KDMA 1ENFA 1HTLD 1SE4A 4M1UB 3S14B 5KNCA 4IUUA 1HHVA 1OFFA 3CKIB 3VR9B 1JORA 4ARIA 3SK8A 4HSVA 2JSOA 2B2TA 3SEBA 1W6JA 5BMGA 3RPFC 2KUMA 2CW0D 3NBHA 1B4OA 1DJRD 3GTKB 3L9AX 5C4XB 1E0ZA 3A54A 3MHBA 1M4VA 2PVGC 4KI0A 4KHZA 3NS1A 4A3GB 3V05A 5EE3A 1LV9A 3OWFA 2KCNA 1HQMC 1EIGA 1WVLA 2BT6A 1C9FA 4H13C 4NKLA 3PO3B 1D5MC 1AP0A 3MVVA 5BYQA 3Q69A 5FO7B 4RKBA 2A73B 1FMAD 1TR5A 3HGBA 1Y8NB 1SIJA 1A2TA 2AUKA 3BWUD 2W3SA 2V4IB 2F0VA 1BUVT 1CTMA 3NUCA 4LTUA 3AEFB 4JWSC 3C1FA 1Q12A 3ND8A 1ICWA 4QUCA 2L52A 2VB3X 2AUJD 1PXUA 4K14A 4QCLA 2QKIC 4HEA1 4IUTA 4I7ZC 1HCZA 1E9MA 4US9A 3T13A 2EELA 1FXIA 5K36H 4IKGA 3ZJVA 2ICEC 4O1NA 2NUCA 4PMWA 1EYDA 5DM73 2N9LA 5EPLA 3AEDB 3FILB 3ZGZA 3DWGC 2EDGA 2DN8A 2O2LD 4IUQA 1SXTA 1SNMA 5FR3A 1TWHB 4JBWA 4RHSA 2L83A 2IW3A 2D9UA 1SYDA 2WINB 4LAAA 1SB3C 5D3IB 1HRJA 4Z9CB 3ZJTA 2HDMA 3HOXB 1G91A 2XWBB 2ZXPA 2EY5A 4NMZA 4ZLTF 3GTPB 1WGKA 2F0SA 4CKCA 4RF1A 5ELFA 1SNOA 4C7YA 1TZOA 5JPMC 1JWAD 3K58A 1Z7TA 2RDGA 3BDCA 4G7ZC 1TWCB 2FHTA 2XSCA 3NQTA 3T3NA 1FFVA 1JOQA 3VR6A 1EY9A 1C79A 1P7FA 2R61A 1JWBD 1EYAA 2XWJB 4KTAA 1NR4A 5IGFA 1TY2A 1XXGA 3M85A 3NUHB 5LNK1 5IGCA 5EKLA 2D62A 3TMEA 4ZKBB 2ACZB 4DF7A 3AE8B 4MT5A 2WXLA 3B9JA 5ISRA 1F2MA 3K5OA 2YYZA 4C3HG 2J53A 1SE3A 2N7JA 2JA8B 3AE9B 3S2HB 5CV5A 2W3RA 1SBBB 1JR0D 1QOBA 3HS0C 3QWNA 1AZPA 1VZ8A 4BBSB 1PDXA 4HKZE 1ZDVA 4FF2A 1EL0A 4A3IB 2OEOA 3I57A 3MC0B 1NENB 2B2YA 1T6BX 2WNMA 4OZAA 1DOMA 1SE2A 4ODGA 1RF2D 4OO1I 4B9WA 2F0QA 2RA4A 4PT5A 4OIJA 1DOIA 1GUSA 1XLPA 3D4RA 2LJIA 5DNFA 1PRTF 3DMUA 2BA0A 3GTGB 2RBMA 3HRDD 1S4ZA 4JK1C 3S16B 1JCKB 4TQUS 4KKUA 1GJXA 2EY1A 2JXMB 2F0UA 3LB8C 5NUCA 1BXTA 3MFGA 4A3EB 1I6VC 3LX0A 1EWHA 3TN2A 5M9OA 5BN3A 1YNJC 3MXPA 4DFAA 1GUTA 4MHEA 2Q8IB 1ZE3D 4ILWA 3TP8A 1LT4D 2R3ZA 2WXRA 3CU7A 3SDZA 2WB1B 5E6JA 2JYTA 4U673 2M19A 1F2RC 1UWXA 1VR9A 2WXOA 3HKZB 4XWTA 1GHJA 4TMAB 1PRTC 1EY7A 3FKIB 1QF6A 3RZDB 2JA7B 1VMPA 1PFMA 3L4PA 1RDPD 2A6EC 4C1NI 4JPSA 5JEAJ 4OZBA 2PW7A 1RODA 2KMMA 3R8BA 1LT6D 3S9WA 1CA5A 2WXJA 3W3AA 4ZOHC 1EFID 1XWEA 2A6HD 2E75C 3H8HA 1WCMB 5C0XJ 1MSHA 1C4PA 2JX5A 2WXFA 2HDLA 3TSSA 4RWSC 3R2TA 2TSSA 1CHQD 4ME5A 3QOLA 4L2YA 5JJZA 2SEBD 1QWYA 4KMUC 4KY5A 3WCQA 1LLRD 5MPOA 1PFBA 1BQQT 4N9PA 5JVG3 4RAUC 5I2YA 1ET6A 3PUZA 1JOOA 1C4CA 1ESRA 3M4YA 3NQIA 3HZXA 3NWSA 3T56B 4S3SA 1L6VA 2IPKD 1WTOA 1UGJA 1HTPA 1IGCA 2F1MA 2E3TA 1SFOB 1F2YA 3VYTA 2VNUD 1GPXA 1TKGA 4XTCS 1OQRA 2F0TA 1FIQA 2WXGA 2KAJA 3VA7A 5DM63 3C1EA 3PO2B 1JRPA 3GV3A 1STGA 3IAS1 1SSNA 5A35A 5KYIA 1FGBD 4NZLB 1S5DD 3PZ7A 5J1ZA 4ZUIA 1S5CD 3P1MA 2QJLA 4IUVA 3G6JB 4B08A 4OVZA 3ABVB 3P4RB 5ELEA 4KGTA 1E0BA 1QJOA 4XT1B 1CFMA 3C8YA 4XIGS 5AFWA 3QIAA 1J7BA 4ZK9B 2GI9A 1BCPB 1TS4A 1I4XA 1V1OA 2QILA 3GS2A 2FFKB 5CV7A 3AE5B 1V8QA 1PZKD 5EE1A 2KACA 2F0KA 2KEDA 4FF1A 1XO3A 1I3QB 1ENCA 3TZDA 1STYA 1R9TB 3TEWA 3MXNA 2WACA 4TQ0A 4KKSA 2ZW0A 2I07B 2BS2B 2A69D 1JALA 1N5XA 3DM1A 3MTSA 3AN1A 1IBXA 5EKIA 3AH7A 1MSGA 3AEEB 1B3AA 2CU3A 3R93A 1LTSD 2KA7A 3J80E 3Q8BA 1STAA 1K83B 4CKEA 1E2WA 1YNNC 5I9OA 1LTBD 2EXZA 2JSVX 2XIWA 1TWAB 4RCOA 1Q90A 1KDCA 3BVMA 5D3DA 2KN4A 2HUGA 2JU6X 4ZHOA 5CYUA 3R2IA 1BF4A 3NE5B 3K57A 1A70A 4DK0A 1PUTA 3AB5A 1STEA 5G3LD 1RHPA 1FR3A 2W55A 2K0PA 5KRUA 2CJNA 2G1EA 2BE5C 1PTOH 3CQZB 3MXUA 3VYUA 5C3XA 2R93B 2F0IA 1FEHA 1D6EC 2K05A 3I4MB 2QSDA 3NP8A 3OSOA 3NWTA 3AE2B 2F0LA 3EA6A 2CJOA 3NVYA 1ZYRC 5T8IA 1NR2A 4IUNA 5JXVA 5EQ0A 2AX5A 1C78A 4XE0A 1TQOA 1N5WA 3HOZB 4N6EB 2L1AA 5ELBA 3TEYA 2KECA 1LT3D 1PTOD 4ITKA 3AU7A 3I4NB 1ROEA 4K5VA 3P1HA 3JAME 4BWGB 2JYOA 3EROA 5T1IA 3C2PA 1F9PA 1JW9D 4CHTB 5T1GA 1KTKA 4K6DA 4OW0A 1QE6A 5E4WC 1V97A 3KLSX 1N60A 1L0YB 2K5QA 3A8KE 4YT0B 2XNAC 5DEHA 5JEAH 4MACA 3FMCA 4X3KA 1F77A 1XEEA 3I90A 4DNTB 1PZJD 2F0HA 3I3CA 3NSWA 1HA6A 4HRSA 1BNZA 3VRAB 5IGGA 3SK6A 5C0XH 4IFDG 2WXIA 2IJ0A 2VUMB 1U9RA 2F0MA 2Z8LA 1CI3M 4BA1I 2X38A 3FRPB 1B2TA 2LHEA 3V3XA 1L5PA 1BCPD 4EGVA 4P16A 1GAQB 1D5ZC 2M0AA 3TP7A 4CJ0B 1GOZA 2B2UC 3H91A 2PO4A 1TKWB 1K51A 2K7VA 4KKIA 1WTXA 3PUWA 3LWEA 1TIID 3L7ZC 4XQNA 4BS9A 1VDVA 4RGNA 2DWQA 3R3OA 3D3RA 5G3LF 2N0SB 1H9SA 4B0EA 4XDDA 5D7GA 1B1ZA 4FF4A 2D5GA 2PW9A 3VR4A 1FRDA 2DNCA 2PVOD 3OIPA 4L8JA 1Y1VB 4USAA 3IL8A 3DWAA 2NTSA 2OEDA 2PMZB 4JWUC 2WXKA 1K50A 2JE6I 4FO2A 2GA4B 2WXNA 1G8ZD 4R8IA 3OOCA 1X32A 4AS1A 4Q5VA 2ICIA 2A68D 4KK7A 5CBAE 4NW2A 2QEJC 1KRHA 1VCIA 4NJCA 4C3IB 2B8GA 2DNEA 5K5PA 2QIEB 1ET9A 2MGSA 1FCLA 3SXHA 2L55A 2ZW1A 4C3JB 3IT6B 4RF0A 4U68A 1S5ED 1I7HA 1AW7A 1DD2A 1UEAB 3U2SC 3N52A 2J0TD 2JP1A 1RTNA 2ZT9C 4LMQD 4A90A 2WKDA 2LKVA 3ERQA 3NZ3A 1GUOA 4IOIE 1PGBA 2MJ8A 2Y3AA 2LMCA 2C9OA 2KEEA 1STNA 2DBYA 3AM9A 3FPPA 3PUVA 1R7SA 4FYDA 3D31A 1IUEA 1PGAA 4WH4A 4ARCA 4ZQ3A 1F2RI 1FO4A 2BTEA 4FXDA 1JROA 1NVID 4FXKC 3S1RB 5IT9E 3A56A 4BY1B 2RMMA 1SMYC 3P7JA 3NVVA 1UAPA 3GB1A 4PNYA 2Z1CA 2YU9B 2O5JC 4KGRA 5G5HA 1SNPA 1IHZA 1DCZA 2BS4B 2BBCA 1IW7C 1OXUA 2IT1A 1KF6B 4C56C 1K8MA 2M00A 4J6HA 3B2FA 3MXGA 2ONQA 1O80A 1NAPA 1KNEA 1YJJA 4KHVA 4RGTA 1O7YA 1F2ZA 1BCPF 1MD2D 4KJNA 3SK4A 2Q5WD 4JX1C 2W54A 1TWFB 5KGUA 1MVKA 1SYBA 3F2UA 3M7GA 1VF7A 4A3BB 5C3JB 4LK1C 4HCSA 1AFPA 5TSSA 1MBYA 1FXAA 3AE6B 5HG2A 3NTHA 3HOYB 2QDBA 1KFYB 1C4QA 3VYSA 1CQVA 5BN5A 4C80A 2F0DA 2XN9C 1A6XA 4V0BA 2E2JB 2MJDA 2K5PA 1E10A 2EYHA 2F03A 4G7HC 3L3OC 3DWPA 4HMJA 3EJIA 3BYYB 1QOAA 4MM3B 1P7EA 4XWWA 3EGRA 3PUXA 2EYPA 1E6EB 3A8IE 3OIQA 2DYOA 4ZYSA 3VYRA 2NN6G 1FNVA 1ZP0B 4KGSA 1IBXB 1ENAA 3PIO3 1L4DB 3AEBB 3IKJA 3OPOA 3HVDA 2RVLA 2E6XA 2F0NA 4OO1H 2IGHA 2Y5CA 3W9CB 5I2XA 1Y8OB 1RKNA 1BUIC 2SNSA 1WTRA 2RSNA 3AE1B 4X3TA 4YSYB 3P4SB 3H6MA 3VR2A 5HGTA 2E2DC 1A3TA 3AEGB 1TT2A 4J3OD 4REZA 3I73A 1ILPA 3MHZA 2TMPA 3H09A 1DOYA 3SK5A 2K22A 1RCVD 4AYBB 5C2TB 3U9SA 1FNWA 5CBEE 1LT5D 1PFNA 3DEOA 3HOWB 4KKTA 3PUYA 2SDFA 3HVZA 5AUKA 4DN4M 1QOGA 3RMHA 3KUPA 1H9MA 1MHHE 1UWMA 4PMCA 3A7AB 1NEKB 3CRLC 5CV8A 2JA5B 2WV6D 2Z4IA 1D5XC 1LTAD 1RFKA 3URYA 2LHDA 3IT4B 2N55A 2MUYA 3Q6SA 4WFN3 2F4IA 2HCIA 1Y1WB 1XYIA 2D2CC 1ZXTA 1TKYA 3P20A 1Y56A 1XLNA 4XDXA 2WDRB 3LNNA 4H44C 3X3NA 4IFDI 4MH8A 5BMHA 1JMLA 2QMTA 3KLRA 5I6YA 2H88B 1SNCA 1EQTA 2LS01 2K5DA 3S1MB 3NTIA 1KNAA 3J7YW 2MH7A 2KQ3A 4BBRB 4GDKB 4YXDB 5M5XB 3P42A 2AQ1B 1U4PA 2LGIA 3E5SA 4HROA 2RKSA 2EKIA 3IXSA 1Y69U 1VLBA 4WURA 5M5WB 2INNE 3AMZA 2HQEA 2F3WA 2B8FA 1ZUD2 3UI3A 4RHRA 4DGZA 2AWNA 1FD7D 3TDQA 4DA2A 4C3HB 2FBWB 1OQQA 1O7LA 1SNDA 2KWDA 2H4OA 1STBA 2R6GA 4KY7A 1JICA 4FF3A 3M4OB 1HUMA 3KWLA 1B50A 3BVZA 3A7LA 1PTOB 1ZKOA 1EEID 1A3VA 1TVXA 2WDQB 4US8A 3GTMB 1YQ3B 4GLSC 4A55A 3SR1A 4DK1A 2L9HA 1QKZA 2LFNA 1N61A 3W2DA 5JVH3 4F7XA 1MHXA 3LXFA 4LK0M 2K5WA 4H0LC 3K5MA 3I9V1 2K33A 1RYJA 1OO9B 3IAYA 2L12A 2KHSA 2LUMA 4IURA 1IYVA 1QB5D 2F0JA 2V3PA 2PPBC 2WU5B 2E2IB 1X3PA 3KBXA 4A3KB 4QF4A 4TSSA 1QNUA 3EQLC 3O13A 1IKLA 1EY4A 2SOBA 1XX8A 5CC4A 2J52A 1G291 2X69A 2FJ2A 3T51B 3M7NA 1H9RA 3BVGA 3P4QB 4KX6B 1H9SB 3MJ5A 5JPNC 4F88A 2NVXB 2JEBI 2M56B 3IAM1 2MP1A 1Z47A 3IFDA 1EZ8A 3C3LA 2NWGA 2GRIA 1SSOA 4L63B 1HFGA 3SVMA 1SAPA 2K3UA 1EY8A 5KNDA 4FXCA 2AWOA 1SJED 3RFZB 4CBVA 3MP9A 3PZ8A 4FP5D 3I72A 1Q1BA 1GB4A 3HEJA 2WS3B 1DONA 2IX0A 3S2DB 2I2YA 3T16A 4EQOA 2WXHA 1NYRA 1QNKA 4EVOA 4HSPA 1BR9A 1D2BA 1YN5A 3ZQ4A 4OGQC 4WRDA 3KK7A 3MZ5A 4LLGM 3Q8FA 4A9AA 2NVQB 3NVWA 1RTOA 3U4EG 5K36G 1G2TA 1NYQA 4KD3A 2WU2B 3SR6A 2B2WC 1D4BA 4K2LA 1EEFD 2D5DA 1LACA 2LMCB 2JA6B 1KAAA 1NCVA 4I65A 2K6AA 1IGDA 4HMIA 3TP5A 2NB0A 4WORA 4XYOA 2CHBD 4CKBA 5IODA 3NVZA 1C48A 1CHPD 3AB9A 4G4KA 1L0VB 4K5WA 2C5CA 5CR3A 1CT1D 2K32A 3RUZA 1EY6A 1E2VA 1JE4A 2Z4HA 2LY7A 1GHKA 1A3UA 2DY7A 5IIFA 4A6QA 5LHY1 1KH0A 1DGJA 4HKQA 5CV6A 4DU9A 2FUG1 5CV9A 5EBCA 3P63A 3VR8B 1WYGA 1K8OA 1TS5A 2Y0SB 3Q8EA 4PQXA 3NTKA 5BYSA 2L11A 1QQRA 2MEKA 1KDBA 2EE1A 3OMCA 1H9JA 2B2UA 2X6GA 2BB5A 2NN6I 2R7ZB 5EE0A 2RSOA 1ESFA 2F0FA 3TP6A 1AZQA 3HOUB 4IZ8A 1EY0A 1FYCA 4P2CB 2PCFB 5JOBA 1AEXA 3K6OA 1JWUD 2I38A 1YQ4B 4RGOS 1I6HB 1LTGD 3MFYA 3E6ZX 3NXWA 1II3A 2M2LA 2AQ3B 1PFDA 2BB6A 4L6TB 1HQRD 2V4DA 2A6HC 3LYYA 1HZ6A 1FM0D 4OHJA 3WOEA 2EZVA 2L0CA 5EPKA 3T4AC 4IALA 2HTME 5M3MB 1TWGB 5H92C 1Q3LA 3TBIB 2ID0A 4N9TA 1WTQA 2ON8A 4BY7B 4C3JG 5EPJA 4A3MB 3PO0A 1XCTL 5C4HA 2EJFC 5I4DA 5KNBA 2F0GA 2IWHA 4CGYB 3RZOB 1EOTA 1YN4A 1AWDA 2SAKA 1ZOYB 3NRZA 1RJTA 2KQ4X 4EE2A 4F87A 2BDOA 1NSNS 4HCEA 4R8NA 2E2HB 3E56A 2G9DA 3FPUB 1TU2B 2W82A 3RD4A 2K28A 4C2MB 4K5XA 5C5MA 3J9CA 4WIPA 2DYMA 1PGXA 2NTTA 1SYGA 3P75A 4ZAIA 2WXQA 1K52A 3CHBD 4NAMA 3C46A 2WXMA 5LL6S 1IYUA 1EZ6A 2EYOA 1K53A 2WP9B 4RGMA 3QG1A 4G7OC 2PLPA 3ITPA 1PYWD 2F0WA 1LO5D 2WLBA 4IFDJ 3Q0AA 2MPMA 1L6UA 2BA1A 2MJEA 2K1BA 3FAHA 2I46A 2EYJA 3W5VB 1J7CA 2OHFA 1T5XD 1L0XB 2VB2X 1B9NA 1S5FD 2B2VC 1CZPA 3BS1A 1CQFA 2EYFA 2K9XA 3K59A 4X3SA 5IGBA 1J8IA 5GXGB 2A69C 2ENBA 2JQRB 4KD4A 1F2LA 3GP7A 1TJEA 1FFUA 2H1EA 4ID6A 5A2QE 3VRBB 1C8CA 4RH6A 3Q23A 1CJEA 1TKEA 1VZ6A 4HAEA 1QLBB 2R92B 1F0ZA 1PTOF 3MEHA 3E0JA 2RDFA 4M0WA 3DHQA 4TRDA 1C76A 1QCBD 5ELDA 1VZ7A 2JWUA 1E2ZA 1AYFA 2FMCA 3TUOA 1WTVA 1DOKA 5CV4A 5KEEA 4NP5A 1G6ZA 5F2DA 5C4ZA 1VJKA 2WAQB 2AQ2B 3AV8A 1Q10A 1B9RA 1ILQA 2J4XA 1GB1A 1H9KA 3ETRA 4D2KA 4DQOC 1YNJD 1SYEA 1C77A 1CK1A 1STHA 4XQJA 3D6WA 2MHVA 5C44B 4B0MA 2PQEA 3OMGA 4FNFA 2A74C 3K5NA 4A3DB 3SFEB 3NHHA 3EUB2 1BMLC 1VRAB 2L5TA 1ZEQX 5E3FA 3KQ4A 2PZUA 1Q8IA 1QG7A 1EWYC 4WJWA 3BG3A 2HDEA 1HZ5A 1RD9D 1O7ZA 1N63A 2N9KA 2L32A 2JYEA 1PRTD 2IL8A 4YTMB 1PTOC 5E4XA 2E76C 2FE8A 1VF5C 3QJYA 1WXQA 2A6ED 3FC4A 3N6RA 3AE4B 2VZKB 1T5EA 2IGDA 3D8GA 1JWSD 2OT2A 2PTLA 3D4WA 4HN7A 1Q1EA 1EWCA 2J7ZA 4V190 3I8ZA 3H0GB 2B2TC 3SE0A 2EJGC 1MPEA 1UNSA 4RKLA 1FCCC 2LEKA 4KN4C 1QOHA 3V96A 2BW2A 1EY5A 5D65A 3Q8AA 2K01A 1DM0B 2GB1A 1BBXC 2E74C 4HR7B 5E1FA 3FVQA 2BDNA 1TS2A 3J80L 3S17B 2WQYB 1WSPA 2PYKA 5ELCA 1D1IA 4FVMA 4MN3A 3ND9A 4YIJA 1GUGA 1PMRA 3GTQB 2XVSA 3TZUA 3B2GA 5FO8B 3N9YC 3SHLA 3GO5A 3G7LA 2EOTA 3MAQA 4P6VF 3PV0A 4IDIA 1SF0A 4NAWB 4XQQA 4QIWB 5EJWA 1SNQA 1VMCA 2K03A 3HRZC 4K6LA 1B44D 2PMVA 1V1PA 2N88A 4WAFA 1BCPC 2OXPA 2X6LA 4DXGA 1KDAA 3HUIA 3S1NB 1F9QA 4GZYC 5FKAC 2NMQA 1CA6A 2YEPB 4CJ1B 4PMBA 2EVBA 2CW0C 1I4GA 4N59A 3HP3A 2EJMA 2FMMA 5EE9A 3DWMA 3EFXD 3UI2A 2DLBA 2O4XA 2L1BA 1LTRD 3NBIA 3PMFA 1UUPA 3NPPA 2PZWA 3JAML 4L1BA 1ZXIA 3Q24A 1OXVA 2L4NA 1MI2A 1WRIA 1F9RA 2IX1A 3S1QB 5M3FB 3Q22A 3KLSA 5H8YE 3X3MA 1XTCD 3OWEB 3BZDB 3GTJB 3GTLB 4FXGC 3VQIA 4IQZA 5EBDA 5FLXE 2MJ3A 2A68C 2SNMA 3J81E 3BYTB 2M9VA 2IGGA 1SEBD 1DOXA 4KJOA 3BDOA 2BS3B 4ULLA 3H3VC 4EQNA 4TQ1A 4IFDH 5J39A 1O78A 2JEAI 4A8XC 4R9WA 1YJIA 3KWVA 2V0GA 3K5LA 4ZRPA 2NYZD 3NK9A 4IUPA 5C3EB 4M8AA 2VXWA 1J7AA 1HFNA 3AE7B 1YNND 1B9MA 3D4DA 3DEPA 4XYQA 2LFIA 3HOVB 1G2SA 2RPVA 4YWGG 3DUZA 3ZJUA 1XLOA 1T3QA 1S5BD 4AQ7A 1Z6HA 2B76B 4DXFA 2NBFA 3I91A 4QB4A 5BMIA 4EQPA 4Y7NB 4H7BA 1V8CA 1TS3A 2PIAA 3AECB 5M5YB 2IDYA 4MIUA 2BE5D 5IOCA 1LTTD 4DAPA 5JEAG 4XT3B 1ML0D 2RQXA 1I4RA 2XRSD 3T3OA 2WKCA 3EVQA 5IGEA 3VA5A 2VZKD 5C0XG 3PIP3 2CQAA 2B2WA 3ZYYX 1DYQA 5BN4A 5EGTA 1SDFA 4N58A 1ZYRD 5JAVA 1WWTA 3K7AB 1BO0A 5BYRA 4CQNA 3I70A 1FNUA 4WQMA 3DWQA 2KOLA 1EQVA 4IN3A 1OXXK 2Y5PA 3U7ZA 3GV6A 2BCOA 3HG9A 4OIKA 4YSXB 1RM6C 1EU4A 4J8QA 1I50B 1DZ1A 1EYCA 2RDHA 1JOKA 2BYTA 3KF8A 3V2TA 1B53A 3ONAB 4A3FB 3S15B 2QCPX 1LTID 4HTHA 1HPCA 3GTOB 2F3VA 3FEWX 4KV6A 2B39A 2A5HA 4K8IA 3U9OA 2ZXRA 3U52E 5A2QL 2B2YC 2FINB 5KYLA 3OHXC 2PW5A 4RNAA 3MWYW 3BK2A 1U4MA 1AN8A 3AE3B 1CM9A 1GUNA 1ACCA 1BOSA 3FILA 1QT9A 3TEXA 4G57A 3E9SA 4WWMA 1HXYD 3DXJC 2KCCA 1J9OA 1D1KA 4DAYA 1QOFA 1R4QB 4KY6A 5D14A 1X3QA 2PZTA 4XXEA 2H89B 4B9XA 3RLFA 5CGKA 2K04A 1SJHD 1I4HA 5COYA 1PLFA 1YMHE 4O42A 5I6WA 2O5IC 1KLUD 3CRKC 2Q8TA 5IT9L 4QMGA 5C4JB 1FRRA 3Q8CA 1NI3A 3FDTA 4ABNA 4KN7C 1E7PB 3D6CA 1U4LA 2J42A 5KIXA 3BIID 5I9PA 5HI1A 3A55A 1LABA 3CWIA 1EU3A 4A3JB 1IKMA 2WDVB 1L4ZB 1U4RA 1DXMA 5C5LA 2KVMA 1CZWA 4ZHPA 4A93B 5AUIA 4E6IA 4H2AA 5J22A 2XRQD 3AMUA 4LJZC