3KLSX

Structure of complement c5 in complex with ssl7
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
191
structure length
191
Chain Sequence
LHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C5
publication title Structural basis for inhibition of complement C5 by the SSL7 protein from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 33
structure length 191
sequence length 191
chains with identical sequence Y
ec nomenclature
pdb deposition date 2009-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3klsX02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3klsX01
1M4VA 1FNWA 1SBBB 4ZYSA 1PZJD 3EFXD 3O13A 1JWUD 1JWMD 1SJHD 1PTOF 3R2TA 1RF2D 1UUPA 3V05A 1BCPF 1L0YB 1ENFA 1S5CD 1FNUA 1D5XC 1STEA 2IPKD 1CHQD 3EA6A 1DYQA 1TY2A 4RH6A 1LTGD 3DWAA 1SE4A 3DWPA 4RFBA 3MFGA 1LO5D 2ICIA 4C56C 1I4HA 1I4RA 3BZDB 2O2LD 1TS2A 1XXGA 1I4PA 1S5FD 4BWGB 4L6TB 3DWQA 1KTKA 2NTTA 4K6LA 2J4XA 1S5DD 2R61A 3BVGA 4TSSA 2XRQD 1YN5A 1BCPB 1DJRD 4RGNA 1PRTC 1JWSD 1LLRD 5I4DA 1B44D 2QILA 4UDUC 1AN8A 1QILA 4O1NA 4RHRA 1BXTA 4DXFA 5ELDA 1B1ZA 1HTLD 1JQYD 2Z8LA 3BVZA 1D6EC 1AW7A 5ELCA 3R8BA 1I4QA 1TS4A 1EU3A 1V1OA 1V1PB 2RDGA 5ELEA 1YN4A 1PTOD 2XN9C 1V1PA 1RCVD 1FD7D 1PRTF 1BCPD 1SE3A 2XRSD 3CHBD 4RGTA 1PTOB 1TY0A 1XTCD 3OWEB 1EFID 3BYTB 4Z9CB 1I4GA 2AQ1B 1LT6D 1FNVA 2XNAC 1CQVA 4OHJA 1ET6A 1LTSD 3URYA 4L63B 1KLUD 1LTRD 2WV6D 1CHPD 1JR0D 1UNSA 1RD9D 2NTSA 1MD2D 1S5BD 1HA5A 3R2IA 1HXYD 1PYWD 5D3IB 1I4XA 1T5XD 1D5MC 2TSSA 5FKAC 4RHSA 1RDPD 5FK9C 4DXGA 4RGOS 1KLGD 5ELBA 5TSSA 2RDHA 2AQ2B 1PZKD 1CK1A 1LTTD 1LTAD 2G9HD 3KLSX 1HQRD 1LT5D 4NZLB 1LTBD 1PTOH 1TS3A 5D3DA 1LT3D 1SE2A 1EU4A 3MC0B 4RCOA 1PTOC 3BYYB 1LTID 3TSSA 1BCPC 1ESFA 1JCKB 2CHBD 3W2DA 1PZID 1ET9A 1SEBD 5ELFA 1SXTA 1F77A 1D5ZC 1EEFD 1PRTD 1S5ED 2AQ3B 3BVMA 4RGMA 1YN3A 1FGBD 1L0XB 3GP7A 1LT4D 1EEID 3SEBA 1PRTB 2QEJC 2IJ0A 1GOZA 1G8ZD 1SJED 1EWCA 2SEBD 1CT1D 1TS5A
chains in the Genus database with same CATH superfamily
2LGDA 2O5JC 4CDDC 4G7ZC 4ALPA 1XMQL 1XPUA 3P2BA 3O13A 3MXUA 1SNDA 3TCAA 1I42A 1ENAA 2IWHA 2UXBQ 1GUTA 4AUQC 1RF2D 2UUAQ 1VMCA 2NBUA 4DHJD 1H9JA 1J8IA 2PW9A 1CZWA 3RCZA 3U4EG 2VW9A 3GDEA 1JE4A 4RH6A 2PYKA 1A15A 4WIPA 1QOFA 5J22A 4POGA 1NENB 2CU1A 1EF5A 2AMCB 2KECA 2PZTA 1PUTA 2PI2E 4IWOA 2F03A 1RLFA 1WZ0A 1TWGH 2HDMA 2DJGC 1XXGA 1TWAH 1JMLA 3K5NA 1YIWA 5L83A 2FINB 3HOXB 1VQ8A 1GNUA 2UU7A 2ZPNA 3DWQA 3L3OC 2J4XA 2DYBA 1S1QB 2L76A 4I6NB 1YNNC 2EY2A 3CC4A 2LGIA 3NJTA 2KQ3A 4E6IA 2AUJD 2ZJQA 1B3AA 2F3IA 3OW7A 1WMHB 3I91A 5EJWA 3QR8A 1AN8A 2A5UA 2E8GA 3EROA 3SE0A 1I3QH 2C5CA 2N49A 1B1ZA 1F52A 4NJ6A 2K75A 3J81i 1E7UA 2JYOA 1MHXA 3NBIA 3S1RB 4OZBA 1EIHA 2N9XA 4II2B 2BBCA 2R2OA 2BYTA 2SAKA 1HNZL 4LF5L 2JXXA 1JWAD 2KHWB 3APDA 1CM9A 2N3SA 2BCOA 4J6IA 4RMAA 3DHQA 2LHEA 3QIJA 1WTRA 4DR2L 4ILWA 2F4VL 1KF6B 2LWPA 4ZKBB 2F0OA 2PO4A 1Z5SB 2VXWA 1WTPA 1FIQA 4L5SA 1RTOA 3HKZB 2RVLA 4OHJA 3SK8A 2VZKB 3URYA 2IHFA 1QUQB 4EX5A 3GTQB 3TEYA 3K9PB 2ZW0A 5E6PA 3RYTA 4XT3B 1BMLC 1WX9A 3G7LA 1R4MI 1SN8A 2CWPA 4WRDA 4OW0A 3KYDD 5LLIA 1IKMA 4HKQA 1CSPA 5BN5A 1WXVA 4DV5L 2FNJB 3GTOH 1IBKL 4C1NK 5FO7B 2F0KA 3BINA 1EO6A 4LDTD 1CSQA 3A8IE 3U9OA 1HFNA 1C4AA 3Q3OC 1LTTD 2JEBI 1EQTA 2G9HD 3HZXA 3PO2G 1AFPA 1GUSA 3IFWB 4JV5L 4OVVA 4N8FA 1WXMA 4CBVA 5FO9B 3VUYA 1O7ZA 2LJIA 4R4TA 3A54A 2MO1A 4LNQA 1Q1OA 2B76B 2WXMA 4KJNA 1ICFB 2ZM6Q 3OLMD 5EPLA 4DR1L 3I57A 1V9PA 3E6ZX 2LUEA 4DKAC 4JI4L 2L00B 4FJZA 3QOLA 1N36Q 4IC7B 1XO3A 3FILB 4N9TA 3H3VI 1V5TA 2N4FA 3U52E 1H9KA 1LT4D 2VB3X 5C1ZA 2XWBB 2Z4HA 1G8ZD 2FCQA 1A62A 1J6QA 2IO2B 4QY7A 1OGWA 2BF8B 5C44H 1VF5C 3PV0A 1JWUD 4QIWE 2HHHQ 3I4NG 1TWFH 3QCAA 4DAYB 2UXDL 1CUKA 4FP5D 2L7RA 2Q8TA 1WGDA 1STEA 2KHSA 3E9IA 1OXXK 2KFKA 2BE5D 2JA7G 4BXXG 2HDEA 1RL2A 2K05A 3TEWA 5DEHA 2A68D 5CX3A 1TWCH 4LUOA 3QA8A 1FYCA 4LFBQ 1SYDA 3Q2AC 4OL7A 2UUBL 4OWWB 2L3ZA 2EOTA 3PRMB 1ZKOA 2D5DA 3STBC 1K0SA 1WX8A 4PMWA 2KENA 3RN9C 1AEXA 2BQQA 4DDID 4YWLA 1PFNA 3PLVA 4J1MA 4RGNA 3H94A 2JA8H 1MHWC 3U58A 2ZXRA 3K80C 3RZWC 5L95C 4CDEC 4P1CC 5H1SE 3MC9A 3DUZA 1VQJA 2K03A 3GTKB 1Z7TA 2J52A 3MTSA 4UP8A 1UEAB 4K7WA 2B39A 1HTLD 1NCVA 1ZYRD 2Z8LA 2NVXB 2YYZA 1KNAA 2IW3A 2KDIA 2F0NA 3DDCB 3TBLD 2RR9A 4LUZA 3F2UA 3R8BA 5IP9G 5C0XH 1Q0WB 3ZNID 1LYLA 4TRDA 5DNFA 3S14B 1K83B 3AEBB 3W5OA 1SNCA 3T4AC 1TT5B 2QMTA 4X65Q 3PO2B 1QE6A 2OCEA 1K8OA 5EE0A 3OIQA 3SK6A 1ICWA 1E6EB 3JSVB 4H7BA 2QCZA 5M9OA 2NPTA 5HHDG 2MNAA 5JJIA 2KCCA 2IO1B 3MP9A 2Q8IB 3NOBA 1A3VA 1ZXTA 4K2LA 1HA5A 1E8XA 1EM7A 1VQIA 3J81j 3VDZA 3A9JA 1T5XD 4DV6L 2M56B 2BVCA 2V3SA 2BB5A 2FUHB 2FAZA 4WJ3M 1KLGD 2Z0SA 1D4BA 2WXGA 3Q3NC 2Q8RE 3A74A 4WURA 3ZLZA 1Q8KA 3QO2A 1W3SA 1MSHA 4GDKA 4GLVB 3PHWB 1EY8A 5CV5A 1XWEA 5J2RA 3I4NB 2W54A 2RD0A 2KDBA 2QIEB 3VUXA 4HJAA 3IRBA 1RAXA 1CKMA 3BIID 4YSXB 4W9IA 2RPVA 4YSYB 1A2UA 2KWVB 1FFUA 1NBWA 3OTOL 2GB1A 2JA7B 2H1EA 4DHJB 2RDFA 2KOLA 4S3SA 4B3MQ 4EQ5A 3L13A 3MEFA 3Q8FA 1EWIA 5F2DA 3HM3A 1UE1A 3HOWH 1S5ED 1EEFD 3N32A 3IT4B 3VQIA 4JI7Q 4IOCA 2KDMA 3ZDTA 4JQWC 1GXDC 1YNXA 1YITA 1FM0D 1WR1A 1WSPA 2IX1A 4GOPC 3QARA 4JE3B 3SEBA 2C5LC 1IW7D 2M17A 3GO5A 1SJED 1STNA 4ANWA 1CT1D 1FNWA 3RUIB 4XYOA 3J80c 5ISRA 4RG1A 4QJFA 4GNXB 1GJXA 2V4DA 2VUMG 2E2DC 2O5IC 4ZRJA 1IBXB 3CCRA 1YVCA 1KAAA 3R2TA 3UDGA 4A3MH 1UBIA 2IYDB 1L0YB 3NTHA 4O42A 1WE7A 5G3LD 2LI5A 3RNEC 3FP9A 3I4OA 5EKKA 2WS3B 1A2TA 4C3HG 1C4PA 3Q14C 2B63G 5JJLA 3DWPA 1JB7A 1WGYA 3QQ8B 3SDZA 2JWZA 1X32A 1VQMA 4ZLTF 2EJFC 1E0ZA 2X6LA 4JL9A 1S72A 3IAS1 3FC4A 2K3UA 4DV0L 2MW5A 3T56B 4AP4C 1SYEA 1V86A 3AH7A 3A7AB 2WHIA 3HIZA 3S16B 1KTKA 1EIYB 3PF5A 3IKJA 2PI2A 4ANXA 1P8LA 3UF8A 3KLWA 3NVWA 2D0PA 3HOVH 1JW9D 2D2QA 3P4PB 4EZKA 4DUYQ 5C4XG 3K0XA 4UDUC 1QILA 1HRJA 3PRZA 3Q6SA 5IT9E 1MHHE 1QOBA 2CWAA 3ERQA 4A75A 1STAA 4O0AA 5ELCA 2F0DA 3KDFB 5ELNA 1V1PB 3ZTDA 4MGZE 1OO9B 3KLSA 5CR3A 2HQLA 2L15A 2NZ1D 4FXKC 2KYWA 2JN4A 2UXCL 5H8YE 1XLNA 4KY5A 2SNMA 4MN3A 4LDTB 1GC7A 3GD7A 2DAJA 1NNXA 4X3SA 4IFDJ 2WDRB 3JW0X 2CVRA 4TV3A 4HROA 3S17H 1ILQA 1CQVA 2ZXOA 3CF6E 3L17A 4MJSB 1XMQQ 4B3SQ 2BGFA 1G2TA 4B0EA 2KJXA 1UD7A 2KOXA 3ULJA 1LXDA 4KZCA 1R4NB 1JR0D 3D6CA 3KUZA 2PZWA 1KAWA 1N63A 1WD0A 4PYUA 1AZPA 4HXDA 5G3LF 1HXYD 1N62A 5D3IB 3CRKC 3A8KE 1SNQA 2GLSA 2NVXH 3SFDB 3AE2B 4TKNA 3VA5A 3H3VC 2MRPA 2N7JA 1DOMA 1K73C 4QMGA 2CH4A 1MI0A 3M3JA 4PS7A 5CV6A 4RM9A 1ZGUB 2UXBL 1ISNA 1RIPA 1PXUA 2LSSA 1I5FA 2BE5C 1VZ6A 4FF4A 1VDVA 2Z0DB 2B29A 2K5WA 1K83H 4NXNL 5DAUA 2UUAL 1HQRD 2A68C 4JG2A 1HR0Q 1K8RB 4IUMB 2VUMB 3Q3FA 4G7HC 2XK5B 1ZE3D 2WXIA 5LL6X 2RA4A 2ZJDA 2WDTB 3K8AA 2CW0D 1NR4A 1WYDA 3HGBA 4A3BG 3AEVA 1CKNA 2PQAB 5GQOA 4C3HB 4CKBA 3V60A 4RF0A 3CKIB 4KHPQ 4P2CB 4Q0FA 5CHFA 2B63B 1IGDA 2WXLA 4IFDG 2HE7A 5LXIB 1UEBA 4RGMA 3BVMA 1Q81C 2XTIA 3ZJTA 1HFGA 1X55A 4KHVA 5J1ZA 2FCSA 2J0MA 1K50A 4XE0A 2HUGA 1EWCA 3LYYA 1QJOA 3PGEA 1HTOA 1LM0A 1HNZQ 4LF5Q 4BKGA 4FVMA 4P75A 4ZK9B 3D3RA 4AS1A 2F4VQ 1Y1WG 3CRLC 3D0FA 5GAEC 3GTLB 1UAPA 2INCC 1STGA 3N1ZC 3EQLC 1CFMA 5C4XB 1SNOA 2A4ZA 3DWAA 4A3EG 2JE6I 3VTVA 2MFIA 1I4HA 2IO0B 4LW1A 3PCOB 1CZPA 1VCBA 1UE6A 3D32A 4NAMA 3RMKC 4A3JH 2A6ED 1YNTE 2REXA 4DR3Q 2RGFA 1QZHA 3S15H 1Z6HA 2D10A 1UE7A 4MHEA 3V96A 3MZ5A 4DV5Q 4Q5VA 1IBKQ 1OQRA 1PRTC 2B3GA 3RZOB 3I4MG 4YY3Q 3S1MH 2QC8A 3U30A 3GTMB 4CKCA 4KN4C 1VS0A 3T51B 5CTRC 3VR9B 1PLFA 2F0IA 1CTMA 4KD4A 4NMZA 1GG3A 2FIFA 3VR4A 2N9EB 4JV5Q 1LTLA 3B08A 3DBLB 2KNBA 3KVFB 1RJTA 1BXTA 3AB9A 2DYMA 4C2MH 1PFSA 3KJOA 1PGAA 4DR1Q 3U4VA 4R9WA 2WU2B 2EXDA 2OEDA 2ALYB 3M3YB 2L8JA 4JI4Q 4D2KA 1WE6A 1CJEA 2WB1G 2ID0A 4X3KA 5JJZA 4G0NB 5FOBB 5A2QE 4TUUA 3WAMA 3P63A 1Q1BA 4QF4A 3AU7A 1A5RA 1KH0A 4B3RL 3I5JC 4NJ7A 5EE9A 4DK5A 1D2BA 1N32L 4JW0A 5IN7A 3FKIG 5E6NA 1U5KA 2K39A 1G6ZA 1O7IA 3ABVB 3JC66 5FLXL 4LF8L 3ZW3A 1C3TA 1D3ZA 2INPE 1IW7C 1PFBA 1TBEA 2LGSA 4FADA 1WGGA 4PV1C 3QIAA 2KMAA 1KD1C 1XLPA 4DAVA 5IYBH 4FXGC 2M0XA 3ERSX 4IO9A 1SDFA 1B3QA 2R6GA 1J7CA 3H8HA 4GLAC 3L16A 3T9LA 2RDHA 2IO3B 3NXWA 5C0XI 2C7MB 2CH4W 4QQBX 1CK1A 2UUBQ 1TIFA 4ANUA 1EYCA 4W9EA 5TR5A 3KUCB 4JBMA 2PEAA 3AV8A 5IGEA 1TU2B 4M8NA 1QNKA 1JALA 4HK2A 2MHVA 1D1IA 3RR5A 1Y1WB 1ML0D 2E2IH 1G91A 1PTOC 5CMDA 1KDAA 4P73A 2E76C 1HE8A 5GXGB 3WCQA 1GJZA 1F9SA 1Z47A 3VR5A 1RFKA 3W2DA 4A3EB 3HOYH 3KOJA 3X3MA 5IAAC 1PZID 4DXAB 4WJNA 4E74A 1YNND 4U68A 2R93H 1HZ5A 2K5PA 2QKIC 1F77A 1WRDB 2ZEQA 4PZ6A 1DOIA 4M1UB 1G291 1B70B 4B9KA 3CQZH 2VQEL 4GS3A 5E6OA 5CGKA 1V43A 2QJLA 3B1LX 3CIRB 4WJQA 1K9MC 1NUCA 4H44C 3AI5A 2BTEA 2JSOA 2A73B 3CF5A 2KAJA 2NBWB 3AMZA 1K8MA 3GTJH 3V62A 3K81C 3PO3H 2KC1A 4HJGE 3V3XA 4KHZA 3I4MB 2K5NA 2LMCA 4UHVA 1QLBB 1SB3C 2LGXA 2MLBA 3RNUA 5IO9A 3ZQ4A 4WAAA 5EAYA 4JLCA 1UGMA 2YEPB 1YJNA 4NDXA 1H9SB 3ENEA 5EDSA 1PA6A 2GOWA 2O2LD 1G51A 2R7ZG 3PREA 1GC6A 2PCFB 1RRBA 3ZNZB 3I4LA 4DR4L 1SFOH 1Q90A 4ME5A 2MBQA 3OG5A 4QUFA 2WFWA 1TR5A 4W9KA 4BWGB 4A55A 2WB1B 2KLGA 4DV6Q 3R3OA 4ZQ3A 3CMMB 2NN6H 4XC2A 2KTFA 3NQTA 1MG8A 1HJPA 1G6JA 4HAEA 3LGJA 2DBYA 3FKIB 1YQ4B 2F1MA 4BBSH 1NJIC 2WIIB 4EGVA 3R66C 2FJ2A 2QILA 4N9F4 1W6JA 4JBWA 4Y7NH 5HKHA 3S2DH 4KKIA 5K36H 2J0KA 2A69C 5ELDA 1JQYD 1CKOA 1YJWA 4I6PA 1VQFA 2NUCA 2NVTB 4ULLA 3DHIC 3OTOQ 1E2WA 1I4QA 1S4ZA 4JYAL 1I50H 1BBXC 2LVPA 4M8AA 3I73A 3KFUA 4FN2A 4WJ4A 1SE3A 2RSNA 4UY8C 4FYDA 2F3VA 5HG2A 3VH3B 5I2XA 1L4ZB 1O7YA 1A3TA 1E22A 2CR5A 4W9LA 2F0HA 3AMUA 4GKKL 1LT6D 3K7AH 3UDIA 4JC0A 1HHVA 1E5WA 1JWBD 2WXRA 4CDFC 3DOWA 4XZ4A 3W1YA 4XQJA 2DN8A 3Q69A 2EYOA 2K14A 2RSUA 4DV4L 5KEEA 1YX6B 1UE5A 2L12A 5EBCA 4QCLA 2AHOB 1O78A 4WJWA 2PW5A 1B4OA 1XTDA 1A3UA 1DOLA 1L6VA 1DXMA 2NB0A 1SIJA 2LGYA 2OOBB 3ML9A 3WOFA 1XCTL 5I6YA 4IKGA 4IUUA 1HQMC 2OQKA 3FAHA 4R4QA 2J0TD 1TKYA 3PZ7A 1YNJC 3K5LA 3F1ZA 4HPMB 4F7XA 4R4IA 4DV0Q 1KL9A 2AWOA 4HJ5A 1LGRA 5M5WH 3HEJA 1T3QA 4A9AA 3BY4B 1B9NA 2KTRB 3NVZA 2P5ZX 4QIWB 3TRZA 2QEXA 5J3BA 4OO1G 1ROEA 2JU6X 1C1YB 4WWPA 4R3DA 4YCVA 3GTPH 5FJ8H 2K9XA 1OXSC 2BOSA 4B3TL 3QJYA 1SXTA 3TDQA 2R7ZB 1WTXA 2Q2TA 3MXNA 3N6RA 2Z4IA 2XGTA 3KBXA 1SSOA 3NBHB 3IAYA 2ATWA 5BO4B 4AYBE 2I1KA 2NVYB 1LUZA 4HEDA 4PG3A 4C3JG 4YSZB 1EY0A 4I65A 3EFUA 4C7YA 4LNKA 4K2KA 2ASQA 4MM3B 1X54A 4ZRPA 1BDOA 1E1TA 2EJMA 4FA6A 1PH5A 2MGSA 4K7UA 4FHKA 4AQYL 1QOGA 1QCBD 1RYJA 4TVAB 5J39A 3BDOA 3NELA 5CYUA 5IWAQ 3GV3A 3S24A 1E8YA 2M0AA 4C4VB 3RI7C 2F0TA 2L11A 3M4PA 5EQ0A 3AE5B 3Q3JA 1Q12A 3TEHB 3UQAA 4A93G 4L2YA 4JI2L 2RHSB 2WINB 3OYYA 4W9GA 2KCMA 4ME3A 1I4PA 4NPNA 5IOCA 2KLCA 4KKSA 1RM6C 2ZNVC 1Q86C 3L7ZC 4C80A 2D62A 4B3SL 4DNTB 2LFNA 1SGHA 3FKYA 4OVUA 4DR5L 1JWSD 3EC8A 2EJGC 5C3EG 1WOCA 4NXNQ 5IODA 1PYBA 2HD3A 3LJ3A 3V61A 2IT1A 3TBIB 3ULLA 4UAIA 5IGGA 1B44D 3DMUA 1NI3A 4O1NA 1MFWA 2K28A 4DXFA 4HWIB 3PMFA 3ZGZA 4BBRB 4APVA 1QVFA 1WH3A 4A8XC 3TZDA 3I2ZA 2M19A 5JOBA 3O65B 4KGRA 5IE8A 1JROA 3T1HL 2Y3AA 1K0RA 3G6JB 5ELEA 4EEWA 4JK1C 5KHOA 3PUVA 4HVBA 4XT1B 1A8VA 1SYCA 1IXRA 1HR0L 1P3QU 2HT1A 4X62Q 3KYCD 4M02A 2HJ1A 4XWWA 4GIVA 3HS0C 4N6EB 2CS4A 1TY0A 4Z9CB 4DWFA 1EF1A 3U7ZA 3GQBA 1D8LA 2XNAC 2DZJA 1FNVA 2YTVA 4KHPL 1ET6A 1TQOA 3D6WA 4G57A 2KT7A 2WV6D 3RD2A 4MT5A 2O2VB 4A3KH 4GDLA 1UNSA 4KZ0A 3CCJA 1EOTA 4J3OD 1B7YB 5AZHA 3K5OA 4IPGA 3GZNI 3VRAB 4BOZB 1VQ4A 1XX8A 5I9OA 2Y5BB 5KYLA 5IYCH 1NY4A 4GOPA 1MJEA 1K8GA 1EOVA 4RHSA 1ZDXA 4A3DH 1SYGA 3DBRI 3ZYYX 3PTFC 5AJ3L 3SR1A 3MTNB 4C3JB 3FEWX 2DY8A 2MBHA 5JEAJ 4GMVA 4HPLB 5M3FH 3KLSX 3MWYW 1K52A 3WDNA 3SHLA 5KNBA 4KKJA 3Q3MC 3MHZA 4QB4A 3CCMA 4II3B 4C3IG 3OIPA 4X64Q 1R9TB 1Q5WB 4PS3A 1GPXA 3A7LA 1IBXA 2OJRA 2YTXA 1EQVA 4S17A 3PS6A 2KKCA 2BYVE 1XPRA 4JX1C 4OZCA 1Y1VG 4BY7G 3IAM1 3LX0A 4MACA 1ET9A 3HOUB 3AEDB 4OWXB 5ELFA 5D6JB 2LKVA 1GUAB 4DR3L 1FRRA 2CHZA 2NVUI 1X1MA 5BMIA 4A93B 4BY1H 1L0XB 3E3XA 3FVQA 2QEJC 1TWHB 3WOEA 3IHPC 4XDCA 1FXAA 1TS5A 2QHOA 4YY3L 1M4VA 1SBBB 4IQZA 2KANA 2JQRB 1L1OA 4IN3A 4ZDVA 2Q2UA 2QSDA 2OEOA 3RUZA 2CKZB 5C3EB 4K8IA 2R92H 4B3RQ 2ZT9C 2KD0A 5JEAG 4A3CH 1N32Q 1JRPA 4K5XA 3TREA 1WFYA 4BVUC 3UE0A 1PFMA 3G4SA 2F4IA 2IL8A 3H9DA 1F0ZA 4F87A 2JA6H 1X56A 3OMGA 4LF8Q 3A56A 1HZAA 2F0GA 3MC8A 3BK1A 1FD6A 2QF7A 1GUGA 1B8AA 2WXJA 4LFCL 4DBGA 2L0FA 3FRPB 4NP5A 3I8ZA 4YHHQ 5CORA 1GHKA 2MBBB 1YD8U 1QKZA 2NBFA 3S1QB 2EKEC 2UU9L 5IYDG 2MBOA 3APCA 2JZZA 1U0LA 1I6HH 2NVYH 5C4ZA 3ECIA 4IM3A 2JQOA 3QAQA 2PPBC 1IBLQ 1Y8OB 3BDCA 5FLMG 4KV6A 4A3GG 2IGHA 5M3MG 5C3WA 1PH4A 3PIPA 1Y8RC 2GBJA 1STHA 1S3OA 2JF5A 1GKHA 2C35B 4K0KL 1E7PB 4KGSA 1XNQQ 3LWEA 3E0EA 1EQRA 2NR2A 1ENCA 3GOEA 4JI6L 3D8GA 4N59A 4A3IG 4LLGM 1DD2A 1J5EQ 4HIKA 4G7OC 2WAQG 2PKOA 1FXTB 2B2UA 2C7HA 2V4IB 1VQNA 4A3FG 2BPSA 2XN9C 4ASWC 2BYFA 1QVCA 2H89B 2VQEQ 1E8WA 2NN6I 1KFYB 3Q8BA 3NWTA 4C3IB 1EY7A 3RNBC 1GD7A 3C8YA 4E3CA 2A8VA 1VQEA 1VQ9A 3VVWB 4EZJA 5LL6S 1Y1VB 4BY7B 1XT9B 2AKWB 2WXKA 4I7AA 4QUCA 3PQIA 3A1QA 5JHBA 4BBRH 1VCIA 3K6OA 2OWOA 1D5MC 3NE5B 5FKAC 2O6VA 1X9NA 1RDPD 2W55A 2Y5PA 3DCGA 5IY0A 4RGOS 2LASA 2V3PA 2SNSA 2HQEA 2HCCA 5IGDA 4HIOA 5JH5C 2C7NB 3RLFA 4B9WA 1J7AA 2IGGA 4DR4Q 3OJ4B 1BVSA 1ZDVA 1BUIC 2DNEA 3TN2A 3HOXH 4C00A 2OF1A 5I6WA 1WJ4A 1RKNA 3PIOA 4HCNB 5JPNC 2L0CA 3I56A 2BB6A 2UYZB 2WKCA 3CP0A 1P16A 2VY3A 3S2HB 2M1MA 1IL8A 3BYYB 1V81A 3OMCA 4IUVA 2DWQA 3TSSA 3C1EA 1ESFA 5EKIA 2FE8A 2LS01 3HUIA 4JVZA 1E7ZA 3P4QB 4LF9Q 1GUOA 2FXQA 3N52A 4ZUIA 3M62B 2HCIA 4JWSC 1PRTD 4PS8A 5L37A 5FR3A 2KJ6A 3VTUA 2K1BA 3NY5A 2NYZD 3PHXB 3Q24A 5J18A 3TS0A 3S1RH 4F8MA 3NK9A 5LMUL 1AP0A 1PDXA 2OT2A 1TKEA 2YVCA 4L23A 1HTQA 3AE6B 4LNOA 1N34L 1YIJA 4C3JH 4JYAQ 1EY9A 2N9LA 3A9KA 3JAMi 5A35A 1ONLA 4A3GB 5M3MB 3A4SC 4GGQA 3PVLA 1PFDA 1HR0W 1KDCA 5M5YB 2YLMA 3EA6A 4DK6C 4RMFA 1TY2A 2MP2A 4GKKQ 3MFGA 4JI8L 1QG7A 1XMOL 3GTQH 3NP8A 4ICVA 5AZFA 1FVIA 4AH6A 4DV4Q 3QG1A 2BW2A 2JRIB 3LXFA 3AEFB 3HOUH 4J6HA 2WAQB 3DLLA 4FF3A 4A3LG 4OIJA 3ZJVA 3J80L 2AX5A 4A3FB 3AM9A 2Q2IA 3S1NB 2HJ8A 2F3WA 3EUB2 3H7SA 4TSSA 1TWHH 1S5DD 1PV4A 4TQ1A 4HJ7A 1SLJA 3TP6A 4X66L 3GTGB 1NVID 1ILPA 3PUXA 4B08A 1MSGA 5FLXE 2DZKA 3T53B 2KMCA 1WM2A 1WZ3A 1Q10A 1WGHA 4LJZC 4XTCS 3F2DA 4TQUS 4F1SA 3IFTA 1IYVA 1KRHA 1D1KA 3A4RA 2A19A 3Q8DA 2H5XA 4B3TQ 3K9OB 2ZW1A 1VQDA 1JT8A 4L5QA 1PTOD 1MJCA 3SFEB 3G6EA 5EPKA 1E24A 1PRTF 3T13A 3TMEA 5HFYA 2LUMA 5AFWA 5IGFA 4DFAA 2N88A 3HKZE 4IALA 2VB2X 2VH1A 2LFIA 2I2YA 1GAQB 4NAWA 1W2BA 1HNXQ 2AQ1B 4G50A 3L4PA 3N3KB 3AU5A 1L1OC 2D3AA 2QDBA 2QDLA 1N33L 2K32A 3R93A 4MZ9A 1CHPD 4KKUA 1YJ9A 1V9JA 4TMAB 5DPTA 2PMZE 1XLOA 2N1VA 4ZKCB 1S5BD 4GKJQ 2ASBA 2UWQA 1UF0A 3LDZE 4ARIA 2I5HA 4KSKC 4DF7A 1PYWD 1K3BC 2A74C 3U9SA 2DY7A 4AQYQ 1WXQA 3OJ3A 1YQ3B 5FK9C 5HI1A 2D9UA 1V6EA 2CU3A 4KIKA 3H7PA 3OWFA 4HR7B 1MKHA 4M00A 2PPHA 1OXTA 1VLBA 1SRUA 4HMIA 4GSWA 1PZKD 3OW2A 1VQ7A 5G55A 4CYEA 1MJDA 3QOJA 4JI2Q 4YL8A 3MA2B 2JA5G 2JK8A 4EUTA 1M8AA 3W1GA 3B2GA 4NJCA 4BKTA 4PK1A 5D94A 3DEPA 5D7GA 4WH4A 3QJZA 5CBAE 2BA0A 2EDGA 1R4MB 5IWAL 4C3IH 3VR6A 2RCNA 1G6PA 4DR5Q 1BCPC 4OX9L 3CMEA 1JOOA 1KHIA 4DK3C 1CA5A 3ZVVA 3GTKH 2WKDA 2E2HB 4EOYA 4CJ2C 4A3PA 2FHTA 5IP7G 2X6GA 3D4DA 5GAGC 1YN3A 1FGBD 2F0UA 4FO2A 3JAME 1BBWA 4FXDA 3R7RA 4CQNA 2E2JB 5AZGA 2DJFC 4XX5A 1ZPSA 3BZDB 1RTNA 2B2UC 2SEBD 3T1HQ 3BS1A 3CCUA 1TVXA 2BKFA 2A69D 3S14H 2KUMA 1EWYC 2PNRC 2DNFA 1PTOF 3VRBB 3MEHA 1L2NA 1Q8IA 3U7DA 4ZRQA 3PO2H 2KFKB 2K4KA 3PT2B 1F9JA 1DYQA 1VQKA 4DK1A 2JP1A 3UE1A 1TIID 4GN4B 2K5HA 1ASZA 3NS1A 3U8ZA 2LXKA 2ZJPA 1I94L 4V190 2JY6A 1SIFA 4J8QA 2JXMB 3KF8A 4JI0L 2INDC 3TEXA 1FGUA 4HSVA 4X62L 4DDGD 1ZOYB 4YT0B 1C48A 3KF6A 4IUTA 1DONA 1FEHA 2KN5A 1Z9FA 3ZNHB 4H02A 4AIMA 4YWKA 5IYDH 5DM63 5M5XB 3Q8EA 5AJ3Q 2N0SB 5J17A 3J81L 1XCQL 2EVBA 5BR8L 1R7SA 3VR3A 1FFVA 4KY6A 1F2RI 4KN7C 1IGCA 2HTHA 2OJWA 4LK1C 3NSWA 3HRDD 1H95A 3AEEB 1EZ6A 3I4NH 5BYSA 2CQAA 3PF4A 4GN1A 1IZ6A 1YNJD 4RHRA 1E2ZA 2VS1A 1L5PA 2Z6BA 1AE2A 2Y5CA 3TQYA 1E2VA 5D65A 4K3CA 2JA7H 4BXXH 1TS4A 4HMJA 3DM1A 2JYEA 3VFKA 1FO4A 2X69A 2L1AA 1XPOA 2FMCA 1C4CA 5C5MA 2MCNB 4XGAB 4UP9A 2B2WA 1N5WA 5HY6A 2KMMA 3SGIA 4X64L 2XRSD 2KFJA 2ZJRA 1WYWB 1SYBA 2JA5B 1MPEA 2NPTB 3BZCA 3AEAB 4WAFA 1XYIA 1TGZB 2F0MA 2KO3A 1YOVB 1QB5D 3EGRA 1PH7A 1WCMG 5ELOA 4HIDA 3AE8B 4OVZA 2K52A 2O4XA 4OGQC 4X3TA 4HSPA 4DPGA 2WXOA 3BWUD 2G4SA 4MGKE 4IUQA 2RCFA 4P1BC 3R2IA 5C4JB 1Y14B 1NMGA 1UZXB 2QCPX 1GO3E 1DM0B 1GVPA 2LXJA 5E7NA 1X3EA 3EIVA 4YTMB 1F9PA 4DXGA 1EQQA 2K5DA 2EIFA 2F0JA 2GBRA 5TSSA 1EIGA 4GDKB 3WALA 5C3JB 3AE7B 4ZYNA 2AQ2B 1EUJA 2WLBA 4A90A 3DWMA 5IP9H 2HIXA 4LFCQ 4MH8A 2XIWA 3MJ5A 3N1YC 2XSCA 5EPJA 1PH1A 2G1EA 2AYOB 4JPBW 2UU9Q 3S16H 4E71A 3UDFA 4MM3A 2MPMA 3K57A 2K1FA 3PSIA 4YCUA 5D3DA 3BK2A 2MSED 4MTKA 1F2ZA 3P20A 4ODGA 4EQNA 3M85A 4ITKA 4MSMB 4A3BB 2PNHA 2Y0SE 4LF7L 2E3TA 4IUPA 1K8AC 3HK0A 4A3OA 1U9RA 1PDQA 3HP3A 2B2YA 4UPAA 2V3NA 1WIAA 3RPFC 3B6YA 2EYFA 5KRUA 4YHHL 4P7IA 2ES2A 2PZUA 1D5ZC 1BF4A 4K0KQ 1YZ6A 2D3CA 4ACFA 4ANVA 1PH9A 1UWVA 3ZO5B 4JI6Q 3NHHA 2WP9B 4YTNB 3RNFC 1IBLL 4LWCA 4IURA 1Y8PB 4ZYSA 1S3SG 3PPAA 3EFXD 3Q8AA 3ZNGC 4LF6L 2LRWA 2KHJA 3VYSA 2MH7A 2I0QA 2W9NA 2OHFA 4OZAA 1BUVT 4KDIC 4H13C 1XNQL 2BH8A 2Q5WD 2K6AA 1TXYA 3J7AV 1U4LA 4B9XA 5IGBA 3K5MA 2PVGC 3PGZA 4WWOA 1J5EL 4WFN3 5BYQA 2VH2A 2J0JA 3TZUA 3H0GG 1LO5D 4OWTB 3G71A 4M0WB 1VRAB 1T0RC 1UBQA 5MPOA 1E1OA 3S2AA 1AWDA 5CC4A 2KVRA 5K5PA 2K7VA 2E2HH 4WQOB 5D14A 5CV4A 3CD6A 1QVGA 1P98A 2DYOA 1HPCA 4BFRA 1VQPA 2FBWB 2VNUD 5EE3A 1EIFA 1RHPA 3VDYA 2RF4A 1KM7A 1A6XA 4ZUJA 1YI2A 4K6DA 4P72A 3KJPA 1AARA 4AWJA 3HM6X 2R2QA 2VUMH 1NEKB 1WCMB 3EVQA 4G4KA 3NQIA 1LABA 4DR6L 3M4OB 1WMHA 3EHVA 3CC7A 3ICEA 3QWNA 3PUWA 4C3HH 2WXHA 2L83A 2YU9B 3PZDA 3BU2A 2B63H 1HH2P 1V1OA 1C78A 1OEYA 1V80A 1IUEA 2PTLA 2XEWA 2KWCA 3FDTA 2X38A 5IT9c 3GB1A 3KUPA 2QA4A 1IBML 4M8MA 3L0OA 3X23A 4JIOU 4ZAIA 2I46A 3TP5A 5E4WC 1SAPA 1LFDA 4GLSC 3MXPA 3SVMA 4K3BA 4NXML 5LNK1 1YJIA 2W3RA 2BDOA 4IW0A 4K7SA 5LMUQ 3RN2A 2KVMA 3P4RB 3U2SC 3LWUA 1NYRA 3J7AF 1N34Q 3M95A 1JICA 2B8FA 2ZXPA 4L63B 1PH3A 1NDDA 2IGDA 2RPQA 3B0AA 2KX3A 2L05A 4LF9L 4FBJB 1KDBA 1R4QB 3RT3B 1E90A 1QUQA 4XYQA 3GTLH 1TWGB 4K14A 1NYQA 3GE8C 4P16A 4W9JA 2AUKA 5C4XH 4I6LB 3AE3B 3UIOB 1ASYA 1TWAB 4RKLA 5CV8A 1P9DU 2AWNA 1WJJA 2TSSA 3RN5A 3WAOA 4JI8Q 4L5TA 1VJKA 3RFZB 1XMOQ 4BA1I 2W3SA 5C44G 3DWGC 4XDXA 1BNZA 3D4RA 1XEEA 3JAMc 3DBHB 1LTAD 1I6VC 3I3TB 2WNMA 1WI0A 4QGUA 3SDLC 2NVQB 2KK8A 1CKNB 1TS3A 4R4OA 2N1WA 4REZA 2IX3A 1WYGA 1I3QB 1YJJA 1B9MA 2CHWA 2DUDA 3RZOH 4X66Q 3GTMH 1EY5A 2NWGA 1F9QA 1QZEA 4RAUC 2INNE 1H9MA 3IFDA 1GUNA 2CHBD 4NQLB 2CCZA 2KXJA 3H0GB 4BKSD 3P42A 4DNRB 3GV6A 1U4MA 4RA8A 3T16A 1HUMA 4KVGB 1ZUD2 4P6VF 2EYLA 4DK0A 5FR6A 1YHQA 3N1XC 4ARCA 1EEID 4KKTA 4KGTA 4BKSA 4BA2I 1MIUA 2JA8G 1XQQA 3FILA 3M3YH 4HJKA 1F2LA 1PZJD 3A5ZB 4G3XB 3SR6A 2B2WC 2Z9HA 3T1YQ 2HTME 3RZDB 4K5WA 5JVG3 1TZOA 1CA6A 3VR8B 1F2RC 3Q0AA 4PNYA 1D5XC 3CSFA 2IPKD 4DV2L 1WJNA 4DAYA 3ZDMC 1GB1A 3QWZB 1J0GA 5AUIA 1VF7A 3W5VB 4B0MA 1HUNA 3DM3A 2K50A 4PMBA 1C7YA 4C1NI 1PHJA 2OTLA 4A3BH 2LHDA 5C0XG 2J42A 4HJ9A 1N33Q 1QNUA 2K6DB 3GTOB 4H0LC 4KJOA 4HDOA 1TS2A 1NMFA 1QWYA 4IFDH 1NBFC 1S5FD 4F88A 3AQQA 1YQBA 2IDYA 2LRUA 1Z2MA 2NTTA 1HNXL 1WVLA 3PV1A 1AE3A 2XRQD 2WXNA 3H09A 5C6AA 3AU4A 1L6UA 3A55A 1OFFA 3BJUA 4BS9A 3APFA 2L55A 2X8XX 3P1MA 2V9HA 1QZGA 2PVOD 2Z6KA 3A5UA 4TQ0A 4GKJL 1WXSA 2PLPA 4OELB 3H6NA 3AECB 1C76A 1E9MA 1P7FA 1UH6A 1Y1WH 2H4OA 1YJ1A 1U4RA 3FPPA 4DAMA 3DVGX 3Q8CA 2PQEA 1AW7A 3TJPA 2HD5B 2B2YC 4JI3L 3CXCA 4A3EH 3W1BA 4OX9Q 4FXCA 3M4QA 2NCNA 4XXEA 2M00A 4KV2A 4X57B 5C44B 5I2YA 2K04A 2F0WA 1HNWL 2PE6B 1TWFB 2F0PA 4R8IA 4LFAQ 3L9AX 4KSLC 3BYTB 4LJOB 1UGJA 3FPUB 2KQ4X 3KBGA 5BMGA 1I4GA 4LCDE 3WA0A 2E74C 1KLUD 2PE9A 1E3PA 1LTRD 3JSVA 1TWCB 2KEDA 3I4MH 2Z1CA 4DNIA 3HOWG 4K1RB 3X3NA 4MELA 2KA7A 4YCWA 3M9BA 1Q3LA 3WWVA 4HJ8A 2K25A 3J7A5 4KI0A 2L32A 4P74A 4USAA 2B2VA 2ZNVB 3ETRA 3UGBB 1VQLA 3AULA 3TEZA 3RLOA 2B3AA 1BOSA 1V8QA 2DAFA 2N55A 5CV7A 1UWXA 5ELBA 3NUCA 3QB3A 1I94Q 2G45B 1Y56A 4JI0Q 4ZRKA 1QF6A 4A3MG 2JA8B 1CZGA 4WWNA 5H92C 4JOIA 3SHQA 3ZRFA 4BOSC 3DVNV 4YXDB 3ML8A 4JCVE 4K8JA 3OHXC 1F2YA 3MC0B 2F0LA 1L2FA 1H8CA 2WGSA 3FKIH 4A4IA 1K3RA 5BR8Q 3HOZG 1T0SC 4AOFA 4DV7L 5JXVA 4IWQA 2E5LQ 3DPDA 3Q6BA 4HEA1 5JPMC 3M7GA 1M90C 3WANA 3BDLA 5E1FA 1MGSA 1DGSA 1E0BA 4KTAA 1XJVA 3EFCA 4ZRIA 3NZ3A 3J80E 1KQSA 5DPSA 4HCEA 3PUZA 1G2SA 2NVTH 1PMRA 4IJHA 4DUZQ 2EQSA 1WWTA 2ZVOA 3JVZX 2EYPA 2UUCQ 2LZ6A 1N9WA 3HOVG 2LMCB 1EY6A 1SJHD 1C4QA 2L9HA 4YTPB 2I07B 2QGQA 1GM5A 1KC8C 4IPHA 5KIXA 1ENFA 2D3BA 4GNXA 2F0EA 2GVBA 2NVQH 1B2TA 5KNCA 3WAPA 3NENA 1BR9A 2WWZA 5CHVC 3IG3A 2GA4B 4Q2JA 3VUWA 2LJ5A 1JRUA 2LVOA 2ICIA 2ZTCA 5IOIA 4US8A 1HZ9A 3H0GH 2WB1E 1HEZE 2WXPA 1WTWA 2JZPA 3HG9A 1E10A 4FJYA 4ICUA 2ZPYA 5IKCM 1X6OA 3BVGA 1T0QC 4LF4L 2I1JA 2V1YA 2D2CC 2JWUA 1TTNA 3KH0A 5I4DA 4DV1Q 4DV3Q 3RZDH 2J53A 2NS5A 4DHZE 1IHZA 4JI5L 5BMHA 5C4HA 3HOWB 2WX1A 2LXAA 2MA9B 4B95A 2D5GA 2WQYB 3ZJUA 3MVVA 2PMZB 4JBJA 2Z59B 2EYHA 4HCSA 2AEHA 5BN3A 4LF7Q 3OOCA 1C77A 3IL8A 3GS2A 1EU3A 3F2CA 5JVH3 2RDGA 1R4NI 2EY6A 1V5OA 4MSQB 1DOYA 2KEEA 4EFOA 4YWMA 2R7ZH 3KDFA 2MQJA 4FLHA 1V1PA 1J8CA 1FD7D 2OQ0A 1BCPD 4A3MB 3U4ZA 3ALBA 3ONAB 1YX5B 1KRSA 3OWEB 4FJVB 3AFQA 1K51A 2KBNA 1WR6E 2GMIC 2BWES 3AXCA 5LMNL 1OTRB 1PH8A 2CKHB 1N6ZA 4MDKE 4RNAA 2JRHA 4LF6Q 4RM8A 2BKRB 3E56A 1Q46A 3HOZB 4MJSA 3C1FA 1U4AA 4PQXA 4EE2A 1AH9A 4RF1A 2BH2A 1OQYA 5C2TB 4IDIA 3DVNU 3MXGA 1KXLA 2KHIA 1JJGA 1SROA 2FCMA 3NPPA 1JC7A 3P7JA 5LHY1 4L8JA 2F0QA 1CMXB 2F0SA 4FF2A 1SNMA 3HOVB 4JI1L 1LT5D 2DZIA 4V0BA 3I9V1 5JJKA 4IM2A 3CU7A 4MGYE 4EKUA 2XK5A 2ZTDA 3KLRA 4RCOA 3ZXVA 2O6VD 4ZCKA 2Z6KC 1IYJB 2VQFL 1WI5A 2E6XA 4A3JG 3MXNB 2Y0SG 1L4DB 2PQAA 2KWUB 5EKLA 1D7QA 4LUVA 1IP9A 2ICEC 4W9DA 4DR6Q 3CC2A 3ONSA 2EYJA 1SMXA 3CCLA 2JJQA 1WJ6A 3OSOA 1CI3M 1VMPA 3KW5B 3UI3A 1M1KC 5NUCA 4WWMA 4N8X1 1MG4A 2AL3A 3KWVA 2CFMA 4C7ZA 2ZCCA 3P4SB 2B2TA 3Q22A 3S17B 2KN4A 3VYRA 3J81E 2F0FA 1IBMQ 2MO0A 5C23A 1Q7YC 5C3XA 1BCPF 1EYDA 1EYAA 1HZCA 4NXMQ 1C9OA 1S40A 2K8HA 1WTHA 2MUYA 1F9RA 4MGIE 3TMPB 1LTGD 4L1BA 1C9FA 3QC8B 1SE4A 4OO1H 3L08A 2DNCA 3W3AA 1ACCA 3I70A 2MX2A 2V0GA 1JORA 1L0VB 2JA9A 3M4YA 2DHZA 3NZUA 1NAPA 3DBLI 2RKSA 4MH0E 2XWJB 4B6WA 3I55A 2B2VC 4LMQD 2PMVA 3W5UB 5G5GA 4ABNA 4DR7L 1TZ1A 2EMSA 2KCNA 3TL5A 3C46A 3RNGC 2RHQB 1MBYA 3FHWA 2CQOA 4RKBA 2RDBC 1TYGB 1EYGA 3TP8A 1LLRD 4HCPB 1XD3B 1C8CA 3T3NA 4KDLB 3AYHB 4JOIC 2F0VA 1ZP0B 3VHTC 1HCZA 1R9TH 3E9SA 4WQMA 5IYBG 4URKA 5KYIA 2VL6A 1W6KA 2GBKA 3L0WB 4GN5A 2DX5B 3M63B 1A63A 3VXWA 1O80A 2GVAA 2WACA 1O7LA 5DPRA 1D6EC 4A3IB 1WTOA 5AUKA 2AL6A 4BBNF 2KDFB 4DN4M 2KDEB 1YN4A 1ZXIA 3ULPA 1RFAA 4WJOA 1NTGA 4K81A 1FCLA 4MTNA 4IFDI 1Q1EA 4A93H 2JPHA 1I35A 1J7BA 3LNNA 1CQFA 1B53A 1A70A 1KNEA 2IBIB 3HVDA 2R7FA 2WP8J 4KY7A 2WDVB 5DM73 3W1SA 2KJHB 4GDLB 3VH4B 2L5TA 3HOYG 3PUYA 3KUDB 2YV5A 1WD1A 2JEAI 3CPWA 2R93G 5C3EH 4GNXC 2DGYA 2K5VA 3S9WA 4AQ7A 1ZKHA 4GOPB 1TKWB 4A3JB 2V4LA 2Y0SB 4DV2Q 2ONQA 2JZ3B 2KVZA 2YTYA 2MP1A 1IPGA 5T8IA 3EECA 3S15B 3A33B 1E7VA 4IM0A 3CWIA 4FF1A 5IGCA 2I5MX 1JOQA 3NHEB 2IY1B 2MJEA 3T1YL 4DQOC 5CV9A 2R3ZA 5FO8B 3PO3G 2A1AA 1SF0A 3IVFA 4L5RC 3S1MB 4WORA 3C0RB 3PIP3 3S1QH 1JJCB 4KK7A 4OIKA 1LTBD 2IY0B 3SU8X 4JPSA 3GZNB 1VDZA 4CHTB 3TP7A 4XYCA 3TIXA 2ZZPB 1JJ2A 1EU4A 1WTQA 4IOIE 1ZW7A 2LD9A 4C2MB 3TS2A 2MJ8A 3DBRB 1X3FA 2L4NA 3HOZH 1SEBD 4IWPA 3HVZA 1P0RA 1E8ZA 3Q23A 4YWGG 2BT6A 4M0WA 4NB3A 1BO0A 2NN6G 1V49A 4HPPA 3RLNA 4GZYC 3NRZA 1NSNS 3D4WA 2BS3B 1L1OB 4JI3Q 2JXTA 1HTPA 4O2DA 4KLKA 2RBMA 3MJWA 5DCNA 4BBSG 2FUG1 3B2FA 4BAXA 1JWMD 1V97A 1HNWQ 3SXHA 2WYQA 3J7YW 1DGJA 2WU5B 2SDFA 2C9OA 5K36G 4NQKE 3EBEA 4A6QA 1SE8A 3K59A 3N20C 4JWUC 3AN1A 3ITPA 1YBYA 4R8NA 3HRZC 1Q82C 1K53A 2WDQB 1XNRL 3H1UA 1N8RC 4IUNA 5C5LA 4FHJA 2A6HD 1I4RA 2MBEA 5LMNW 3NTKA 1R4PB 1X65A 2V1CC 1Y1VH 1H9SA 4BY7H 4F8CB 4IZ8A 2FFKB 4MNOA 2GRIA 4XDDA 1VQOA 1NE3A 4LFAL 2WX0A 2BYEA 2K01A 1DOKA 1YHBA 2K8BA 2E75C 1FJGQ 1ESRA 2A5HA 4AYBG 1BQQT 2NZOA 4CJ0B 3PIO3 1PVOA 2EY1A 4Y52H 4ZHOA 1BCPB 1DJRD 5JAVA 2E2IB 4A20A 5T1IA 1UELA 1STBA 3RMHA 1WGKA 3DBHI 4GN3B 3P1HA 1PQSA 3HOYB 3IBEA 2DENB 4OXPA 2M2LA 2EYMA 4LNFA 1SYFA 2R93B 5EBDA 2K5QA 2LVQA 4FNFA 3S2HH 2GI9A 5JEAH 3BVZA 3CQZB 1VQ6A 2IX0A 4DV7Q 2NZHA 3VA7A 3ER0A 2LXCA 3RNCC 4NY0A 5IA7A 1LM8B 2F52A 3GTJB 1JMCA 1RCVD 3PO3B 4BBNC 3CHBD 1F1HA 1QOAA 1EFID 2N7EA 2MJDA 1JQ4A 2JVCA 2B2TC 2K33A 3E9HA 2DLBA 4GU2A 5FJ8G 1LTSD 1YHAA 2E5LL 3ZTCA 3K0YA 1KLVA 5FLMH 4A3GH 5M3MH 1RD9D 5DPWA 1WXAA 4KD3A 4IOAA 1MD2D 2H88B 5M5YH 3A1QB 2O6VB 2YEPF 1V1QA 1PH2A 1SFOB 1JE5A 4AJYB 3CSTA 3ZUNA 1T5EA 4DUZL 4IPDA 4LTUA 4US9A 4A3IH 3NTIA 1T0YA 2WXFA 2UUCL 2J7ZA 2Q2HA 1DCZA 1Y69U 1ZXHA 4LNIA 3A8JE 4EZLA 3TUOA 1SE9A 4A3FH 4W9CA 1ZYRC 2XVSA 4BBSB 1FR3A 1VQ5A 2VRRB 2C60A 2N78A 3S1NH 1AYFA 2CJOA 5BYRA 3F2BA 1MVKA 1GB4A 4DR2Q 3NWSA 4KX6B 4Y7NB 1LT3D 3S2DB 4LF4Q 3J81c 3GTGH 1L7YA 4AJWA 1WRIA 2KTRA 1LTID 4DU9A 1B50A 1OXVA 1LV9A 3A9JB 2D0OA 1FMAD 2XBBC 1SMYD 3VAWA 1I50B 4JI5Q 2AQ3B 2G4DB 3RNAC 3T3OA 2K6QA 4LJPB 4DA2A 3QX1A 3D31A 2M4NA 3GP7A 1WJUA 2ACZB 1PRTB 1IYFA 2ENBA 1SSNA 2BWFA 4HDQA 3CW2C 3NBHA 2K8CA 3A9KB 4TKOB 1EY4A 3K7AB 4AYBB 3LB8C 3KK7A 4DV1L 1EZ8A 3K7UC 4DV3L 1AZQA 2RMMA 3J7ZC 4YIJA 3UI2A 5GADC 3IXSA 5G2NA 1UUPA 1PGXA 3V05A 1SNPA 2MP2B 1S5CD 1FNUA 1Y8NB 2NBVB 3RULA 2M9VA 3MAQA 4HRSA 3VTWA 3F8TA 3W1SC 4HTHA 3L54A 4ID6A 1DZ1A 5E6JA 4F7ZA 4RWSC 4RFBA 4C56C 5LMNQ 2JUOA 2WAQE 3NVVA 3NZSA 1RWSA 4H2AA 3UINB 1A0IA 3V6CB 2DZMA 5JZEB 4FDBA 1B9RA 2FIDA 2N9PC 3E0JA 2W82A 4C4VA 4CGYB 1STYA 3CCEA 1N60A 2EPBA 5IIFA 1TKGA 1F2MA 3G48A 5M5WB 4GB9A 4HKZE 4K6LA 4ZHPA 2EXZA 1EWHA 2R61A 3KQ4A 1II3A 1YN5A 4N58A 2ZM6L 3C2PA 3OPOA 4PZ8A 5HURA 4CJ1B 3PSEB 3I7FA 4A3KG 1WX7A 5HGTA 2FCNA 3GTPB 2K0PA 2D11A 3I63C 3N9YC 4JI1Q 3M7NA 4PT5A 4OONA 1N36L 1BKBA 3MFYA 3H91A 5IYCG 2UXDQ 4EQPA 4X6AH 1HA6A 2PJHA 4S0RA 4NPSA 4JBKA 5FLXc 4A3DG 4W9HA 5G5HA 4QAYA 3CMAA 1PH6A 3CCVA 1FPYA 3T8MA 4OO1I 1U4PA 4XQQA 2EE1A 2VQFQ 2JX5A 2RQXA 5M3FG 5EGTA 1TJEA 4PMCA 3W9CB 1QT9A 2RSOA 2HHHL 1UWMA 1VR9A 1VQGA 1TT2A 4NAWB 3DVGY 2E2JH 4A3LH 3I3CA 4HN7A 4RGTA 2MHJA 1VZ7A 1PTOB 1XTCD 4CKEA 3K58A 1H4RA 3NG0A 1EL0A 4U673 1J19A 3PZ8A 4ZOHC 3V2TA 1FXIA 1EFWA 2D07B 1P7EA 1EUVB 4LFBL 3C19A 4PYZA 4CDCC 2FMMA 2N7DA 3CAMA 2NTSA 2WXQA 1VQHA 2CHXA 3R7QA 5IT9L 1VQAA 4BY1G 4IPCA 2EZVA 2KZRA 2O2VA 1X3QA 3H3VH 4KIKB 3H7PB 3SK4A 1I7HA 5T1GA 2ZTEA 3MHBA 2JT4B 2KCTA 3ZRCA 1KIXA 2KQ7A 2EMTA 5COYA 2EELA 5EE1A 5IP4D 1OTCA 2MWSB 2G5DA 1WY8A 1C0AA 5CHWA 4DGZA 2R92G 3AE4B 1XLQA 3AE9B 1WTVA 2VZKD 2A6HC 4NZLB 4KMUC 4A3CG 3E5SA 4DR7Q 2I5LX 1PYSB 5M5XH 5GAHC 3B9JA 2JA6G 5JHAA 1KABA 2EY5A 2IHEA 5BN4A 3CPFA 2G3QB 4NNJB 1VZ8A 1KJTA 2MQHA 2PIAA 3N30A 3ND9A 1JCKB 2BS2B 3SD5A 4QL5A 3ZJYC 1GHJA 2D3GA 2L1BA 3OAWA 1WM3A 1BT0A 1VQCA 3BG3A 3EJIA 1FRDA 3JAML 1C79A 1K28A 4X65L 1YEZA 3NVYA 3KWLA 4ZRZA 3DQVA 4M01A 3KYHC 2IJ0A 3H15A 2NMQA 1L0WA 3VYTA 3P75A 3CCQA 2N9KA 3U50C 4LNNA 1RODA 4BZAA 4MEMA 2VZAA 1LACA 2IZVB 1PGBA 5GROA 5C0XJ 3X0WA 4A3KB 2JA5H 4IG7B 4GLXA 2JSVX 1V2YA 1CHQD 1VD2A 1DOXA 1QOHA 3ZXRA 4GXBA 2MJ3A 3KF8B 1IYUA 4DHZB 5CBEE 2KACA 1GUWA 5E4XA 4A3DB 1WF9A 2BS4B 2I38A 4UP7A 2OTJA 1QQRA 3KF6B 5D2MB 4I7ZC 2MEKA 5C4JH 3HHMA 2CW0C 5M3FB 4CO7A 1IKLA 3QHTA 2IY5B 1WFQA 5IP7H 4L6TB 3UIPB 1IL2A 1HZBA 5E3FA 3PO0A 4POFA 4W9FA 1XF5L 3L10B 1MI2A 1T9HA 2LY7A 1HZ6A 1J9OA 4P71A 4XQNA 1NR2A 2TMPA 1JOKA 1OEYJ 3MHSD 5GMVA 5KGUA 3DHHC 2KWDA 4GOCA 4EQOA 3J80i 2GN5A 4B3ML 4NW2A 1H9RA 4R1JA 3JYUA 2PW7A 3AB5A 5KHQA 1X3PA 5LXHA 4JI7L 4EVOA 4BBRG 3L2PA 2Z0EB 1WGRA 4XIGS 1VQBA 5AEKB 4BY1B 4X3UA 1OXUA 3I90A 1FCCC 3AE1B 2OXPA 4K5VA 2KC2A 1YMHE 3UQBA 4JGHB 3VYUA 2L0TA 2QDFA 3QK0A 2KX0A 4HLEA 1SR3A 5HGQA 2KJRA 2BA1A 3HOXG 1OQQA 4A76A 2KQSA 3DEOA 3DBSA 3R3MA 1LQBA 4DAPA 2R92B 1SMYC 3NUHB 1JB3A 3SK5A 2N8NA 3WIMA 2A6EC 5I9PA 3UDXA 3STBD 3PLUA 4J15A 2JA6B 1V8CA 2JYTA 3V6EB 3ZKJC 2B8GA 5DLQE 4LAAA 2AWTA 2EKIA 2ZCBA 3NS8A 2M8SA 2GBMA 2ON8A 3IT6B 2G9DA 4HIMA 3VR2A 3GE3C 1I4XA 3HFZB 3FMCA 4OEMB 1ZEQX 3AFPA 4PZ7A 2C9WB 1XNRQ 1I6HB 2HIVA 2HDLA 4FULA 4RCNA 3RZFA 2ZVNA 2SOBA 3DHGC 3CCSA 2J7QB 2LEKA 4R4CA 1P1AA 3AEGB 5KNDA 2L52A 5A2QL 2UXCQ 2QW7A 2K22A 4DUYL 4MIUA 1M94A 1N61A 1PTOH 3H6MA 4WJPA 3ZIMA 3HKZG 2BDNA 3C3LA 1KOTA 2GBNA 1SE2A 4N9PA 4LK0M 1KRTA 3I72A 3ND8A 1N5XA 1T6BX 3HOUG 1WCMH 3PRPB 3RD4A 4G11A 3BZKA 3M4OH 3EN2A 4CHKA 1NI2A 1BBUA 3DXJC 3NEMA 2CJNA 1FJGL 4XWTA 4NKLA 1X3GA 3HKSA 2YU9H 3J9CA 3A0JA 1GOZA 4IJLA 2R7DA 1FL0A
chains in the Genus database with same CATH topology
2O5JC 4G7ZC 3O13A 3MXUA 1SNDA 1ENAA 2IWHA 1GUTA 1RF2D 1VMCA 1H9JA 1J8IA 2PW9A 1CZWA 3U4EG 1JE4A 4RH6A 2PYKA 1A15A 4WIPA 1QOFA 5J22A 1NENB 2KECA 2PZTA 1PUTA 2F03A 2HDMA 1XXGA 1JMLA 3K5NA 2FINB 3HOXB 3DWQA 3L3OC 2J4XA 1YNNC 2EY2A 2LGIA 2KQ3A 4E6IA 2AUJD 1B3AA 3OW7A 3I91A 5EJWA 1AN8A 3SE0A 3EROA 2C5CA 1B1ZA 2JYOA 1MHXA 3NBIA 3S1RB 4OZBA 1EIHA 2BBCA 2BYTA 2SAKA 1JWAD 1CM9A 2BCOA 3DHQA 2LHEA 1WTRA 4ILWA 1KF6B 4ZKBB 2F0OA 2PO4A 2VXWA 1WTPA 1FIQA 1RTOA 3HKZB 2RVLA 4OHJA 3SK8A 2VZKB 3URYA 3GTQB 3TEYA 2ZW0A 4XT3B 1BMLC 3G7LA 4OW0A 4WRDA 1IKMA 4HKQA 5BN5A 4C1NK 5FO7B 2F0KA 3U9OA 3A8IE 1HFNA 1C4AA 1LTTD 2JEBI 1EQTA 2G9HD 3HZXA 1AFPA 1GUSA 4CBVA 5FO9B 1O7ZA 2LJIA 3A54A 2B76B 2WXMA 4KJNA 5EPLA 3I57A 3E6ZX 3QOLA 1XO3A 3FILB 4N9TA 3U52E 1H9KA 1LT4D 2VB3X 2XWBB 2Z4HA 1G8ZD 1VF5C 3PV0A 1JWUD 4FP5D 2Q8TA 1STEA 2KHSA 1OXXK 2BE5D 2HDEA 2K05A 3TEWA 5DEHA 2A68D 1FYCA 1SYDA 4OL7A 2EOTA 1ZKOA 2D5DA 4PMWA 1AEXA 1PFNA 4J1MA 4RGNA 3H94A 2ZXRA 3DUZA 2K03A 3GTKB 1Z7TA 2J52A 3MTSA 1UEAB 2B39A 1HTLD 1NCVA 1ZYRD 2Z8LA 2NVXB 2YYZA 1KNAA 2IW3A 2F0NA 3F2UA 3R8BA 5C0XH 4TRDA 5DNFA 3S14B 1K83B 3AEBB 1SNCA 3T4AC 2QMTA 3PO2B 1QE6A 1K8OA 5EE0A 3OIQA 3SK6A 1ICWA 1E6EB 4H7BA 5M9OA 5HHDG 2KCCA 3MP9A 2Q8IB 1A3VA 1ZXTA 4K2LA 1HA5A 1EM7A 1T5XD 2M56B 2BB5A 1D4BA 1KLGD 2WXGA 2Q8RE 4WURA 3QO2A 1MSHA 1EY8A 5CV5A 1XWEA 3I4NB 2W54A 2QIEB 3BIID 4YSXB 2RPVA 4YSYB 1A2UA 1FFUA 2GB1A 2JA7B 2H1EA 2RDFA 2KOLA 4S3SA 3Q8FA 5F2DA 1S5ED 1EEFD 3VQIA 3IT4B 2KDMA 1GXDC 1FM0D 1WSPA 2IX1A 4JE3B 3SEBA 1IW7D 3GO5A 1SJED 1STNA 1CT1D 1FNWA 4XYOA 5ISRA 1GJXA 2V4DA 2E2DC 2O5IC 1IBXB 3R2TA 1KAAA 1L0YB 3NTHA 4O42A 5G3LD 5EKKA 2WS3B 1A2TA 4C3HG 1C4PA 3DWPA 3SDZA 1X32A 4ZLTF 2EJFC 1E0ZA 2X6LA 3IAS1 3FC4A 2K3UA 3T56B 1SYEA 3AH7A 3A7AB 3S16B 1KTKA 3IKJA 3NVWA 1JW9D 3P4PB 4UDUC 1QILA 1HRJA 3Q6SA 5IT9E 1MHHE 1QOBA 3ERQA 1STAA 5ELCA 2F0DA 1V1PB 1OO9B 3KLSA 5CR3A 2NZ1D 5H8YE 4FXKC 1XLNA 4KY5A 2SNMA 4MN3A 3GD7A 4X3SA 4IFDJ 2WDRB 2CVRA 4HROA 1ILQA 1CQVA 2ZXOA 1G2TA 4B0EA 2KJXA 1JR0D 3D6CA 2PZWA 1N63A 1WD0A 1AZPA 5G3LF 1HXYD 1N62A 5D3IB 3CRKC 3A8KE 1SNQA 3SFDB 3AE2B 3VA5A 3H3VC 2N7JA 1DOMA 4QMGA 1MI0A 5CV6A 1VZ6A 1VDVA 1PXUA 2BE5C 4FF4A 2K5WA 5DAUA 1HQRD 2A68C 2VUMB 4G7HC 1ZE3D 2WXIA 5LL6X 2RA4A 2CW0D 1NR4A 3HGBA 4C3HB 4CKBA 4RF0A 3CKIB 4P2CB 4Q0FA 2B63B 1IGDA 2WXLA 4IFDG 4RGMA 3BVMA 3ZJTA 1HFGA 4KHVA 5J1ZA 1K50A 4XE0A 2HUGA 1EWCA 3LYYA 1QJOA 4FVMA 4ZK9B 3D3RA 4AS1A 3CRLC 3GTLB 1UAPA 1STGA 3EQLC 1CFMA 5C4XB 1SNOA 3DWAA 2JE6I 1I4HA 4NAMA 1CZPA 2A6ED 1YNTE 1Z6HA 3V96A 4MHEA 3MZ5A 4Q5VA 1OQRA 1PRTC 3RZOB 3GTMB 4CKCA 4KN4C 3T51B 3VR9B 1PLFA 2F0IA 1CTMA 4KD4A 4NMZA 3VR4A 1RJTA 1BXTA 3AB9A 2DYMA 1PGAA 4R9WA 2WU2B 2OEDA 3M3YB 4D2KA 1CJEA 2ID0A 4X3KA 5JJZA 5FOBB 5A2QE 3P63A 1Q1BA 4QF4A 3AU7A 1KH0A 5EE9A 1D2BA 3ABVB 1G6ZA 5FLXL 2INPE 1IW7C 1PFBA 4PV1C 3QIAA 1XLPA 4DAVA 4FXGC 1SDFA 2R6GA 1J7CA 3H8HA 2RDHA 3NXWA 5C0XI 1CK1A 1EYCA 3AV8A 5IGEA 1TU2B 1QNKA 1JALA 2MHVA 1D1IA 1Y1WB 1ML0D 1G91A 1PTOC 5CMDA 1KDAA 2E76C 5GXGB 3WCQA 1F9SA 1Z47A 3VR5A 1RFKA 3W2DA 4A3EB 3X3MA 1PZID 1YNND 4U68A 1HZ5A 2K5PA 2QKIC 1F77A 1DOIA 4M1UB 1G291 5CGKA 1V43A 2QJLA 3CIRB 4H44C 1NUCA 2BTEA 2JSOA 2A73B 3AMZA 2KAJA 1K8MA 4HJGE 3V3XA 4KHZA 3I4MB 2LMCA 1QLBB 1SB3C 3ZQ4A 2YEPB 4NDXA 1H9SB 2O2LD 2PCFB 3I4LA 1Q90A 4ME5A 4QUFA 1TR5A 4BWGB 4A55A 2WB1B 3R3OA 4ZQ3A 2NN6H 3NQTA 4HAEA 2DBYA 3FKIB 1YQ4B 2F1MA 2WIIB 4EGVA 2FJ2A 2QILA 1W6JA 4JBWA 4KKIA 5K36H 2A69C 5ELDA 1JQYD 2NUCA 2NVTB 4ULLA 1E2WA 1I4QA 1S4ZA 1BBXC 4M8AA 3I73A 1SE3A 2RSNA 4FYDA 2F3VA 5HG2A 5I2XA 1L4ZB 1O7YA 1A3TA 2F0HA 3AMUA 1LT6D 1JWBD 2WXRA 1HHVA 4XQJA 2DN8A 3Q69A 2EYOA 5KEEA 2L12A 5EBCA 4QCLA 1O78A 4WJWA 1B4OA 2PW5A 1SIJA 1A3UA 1DOLA 1L6VA 1DXMA 2NB0A 3WOFA 1XCTL 5I6YA 4IKGA 4IUUA 1HQMC 3FAHA 1TKYA 2J0TD 3PZ7A 1YNJC 3K5LA 4F7XA 2AWOA 3HEJA 1T3QA 4A9AA 1B9NA 3NVZA 4QIWB 4OO1G 2JU6X 1ROEA 4R3DA 2K9XA 1OXSC 2BOSA 3QJYA 1SXTA 3TDQA 2R7ZB 1WTXA 3MXNA 3N6RA 2Z4IA 3KBXA 1SSOA 3IAYA 2NVYB 4HEDA 4C3JG 4YSZB 1EY0A 4I65A 4C7YA 4K2KA 4MM3B 4ZRPA 1BDOA 2EJMA 2MGSA 1QOGA 1QCBD 1RYJA 5J39A 3BDOA 5CYUA 3GV3A 2M0AA 2F0TA 2L11A 5EQ0A 3AE5B 1Q12A 4L2YA 2WINB 1I4PA 5IOCA 4KKSA 1RM6C 3L7ZC 4C80A 2D62A 4DNTB 2LFNA 1JWSD 2EJGC 5IODA 2IT1A 3TBIB 4UAIA 5IGGA 1B44D 3DMUA 1NI3A 4O1NA 2K28A 4DXFA 3PMFA 3ZGZA 4BBRB 4A8XC 3TZDA 2M19A 4KGRA 5JOBA 1JROA 2Y3AA 3G6JB 5ELEA 4JK1C 3PUVA 4XT1B 1SYCA 4XWWA 3HS0C 4N6EB 1TY0A 4Z9CB 3U7ZA 3GQBA 2XNAC 1FNVA 1ET6A 1TQOA 3D6WA 4G57A 2WV6D 4MT5A 1UNSA 1EOTA 4J3OD 3K5OA 3VRAB 1XX8A 5I9OA 5KYLA 4RHSA 1ZDXA 1SYGA 3ZYYX 3SR1A 4C3JB 3FEWX 2DY8A 5JEAJ 3KLSX 3MWYW 1K52A 3WDNA 3SHLA 5KNBA 4KKJA 3MHZA 4QB4A 4C3IG 3OIPA 1R9TB 1GPXA 3A7LA 1IBXA 1EQVA 4JX1C 4OZCA 3IAM1 3LX0A 4MACA 1ET9A 3HOUB 3AEDB 5ELFA 2LKVA 1FRRA 5BMIA 4A93B 1L0XB 3FVQA 2QEJC 1TWHB 3WOEA 4XDCA 1FXAA 1TS5A 1M4VA 1SBBB 4IQZA 2JQRB 4IN3A 2QSDA 2OEOA 3RUZA 5C3EB 4K8IA 2ZT9C 5JEAG 1JRPA 4K5XA 1PFMA 2F4IA 2IL8A 1F0ZA 4F87A 3OMGA 3A56A 2F0GA 3BK1A 1FD6A 2QF7A 1GUGA 2WXJA 3FRPB 4NP5A 3I8ZA 5CORA 1GHKA 1QKZA 2NBFA 3S1QB 5C4ZA 2PPBC 1Y8OB 3BDCA 4KV6A 2IGHA 5C3WA 1STHA 1E7PB 4KGSA 3LWEA 1ENCA 3D8GA 4N59A 4LLGM 1DD2A 4G7OC 2PKOA 2V4IB 2B2UA 2XN9C 2H89B 2NN6I 1KFYB 3Q8BA 3NWTA 4C3IB 1EY7A 3C8YA 5LL6S 1Y1VB 4BY7B 2WXKA 4QUCA 3EGRA 1VCIA 3K6OA 1D5MC 3NE5B 5FKAC 2W55A 2Y5PA 1RDPD 4RGOS 2V3PA 2SNSA 2HQEA 2HCCA 5IGDA 3RLFA 4B9WA 1J7AA 2IGGA 1ZDVA 1BUIC 2DNEA 3TN2A 2OF1A 5I6WA 1RKNA 5JPNC 2L0CA 2BB6A 2WKCA 3S2HB 1IL8A 3BYYB 2DWQA 3OMCA 4IUVA 3TSSA 3C1EA 1ESFA 5EKIA 2FE8A 2LS01 3HUIA 3P4QB 4JWSC 1GUOA 4ZUIA 3N52A 2HCIA 1PRTD 5FR3A 2K1BA 2NYZD 3Q24A 4F8MA 3NK9A 1PDXA 1AP0A 1TKEA 2OT2A 4L23A 3AE6B 1EY9A 2N9LA 5A35A 1ONLA 4A3GB 5M3MB 1PFDA 1KDCA 5M5YB 3EA6A 1TY2A 3MFGA 1QG7A 3NP8A 3QG1A 2BW2A 3LXFA 3AEFB 4J6HA 2WAQB 4FF3A 4OIJA 3ZJVA 3J80L 2AX5A 4A3FB 3AM9A 3S1NB 2F3WA 3EUB2 4TSSA 1S5DD 4TQ1A 3TP6A 3GTGB 1NVID 1ILPA 3PUXA 4B08A 1MSGA 5FLXE 3T53B 1Q10A 4LJZC 4XTCS 4TQUS 3IFTA 1IYVA 1KRHA 1D1KA 2ZW1A 1PTOD 3SFEB 5EPKA 1PRTF 3T13A 3TMEA 5HFYA 2LUMA 5AFWA 5IGFA 4DFAA 2N88A 4IALA 2VB2X 2LFIA 2I2YA 1GAQB 2AQ1B 3L4PA 2QDBA 2K32A 3R93A 4TMAB 1CHPD 4KKUA 1XLOA 4ZKCB 1S5BD 4ARIA 4DF7A 1PYWD 2A74C 3U9SA 2DY7A 1WXQA 1YQ3B 5FK9C 5HI1A 2D9UA 2CU3A 3OWFA 4HR7B 1OXTA 1VLBA 4HMIA 1PZKD 3QOJA 3MA2B 1M8AA 3B2GA 4NJCA 5D7GA 3DEPA 4WH4A 5CBAE 2BA0A 2EDGA 3VR6A 1BCPC 1JOOA 1CA5A 2WKDA 2E2HB 4CJ2C 2FHTA 2X6GA 3D4DA 1YN3A 1FGBD 2F0UA 4FO2A 3JAME 4FXDA 4CQNA 2E2JB 1ZPSA 3BZDB 1RTNA 2B2UC 2SEBD 3BS1A 1TVXA 2A69D 2KUMA 1EWYC 2PNRC 1PTOF 3VRBB 3MEHA 1Q8IA 4ZRQA 1DYQA 4DK1A 2JP1A 1TIID 3NS1A 4V190 4J8QA 2JXMB 3KF8A 3TEXA 4HSVA 1ZOYB 4YT0B 1C48A 4IUTA 1DONA 1FEHA 3Q8EA 5DM63 5M5XB 2N0SB 3J81L 1XCQL 2EVBA 1R7SA 3VR3A 1FFVA 4KY6A 1F2RI 4KN7C 1IGCA 4LK1C 3NSWA 3HRDD 3AEEB 1EZ6A 5BYSA 2CQAA 1YNJD 4RHRA 1E2ZA 1L5PA 2Y5CA 1E2VA 5D65A 1TS4A 4HMJA 3DM1A 2JYEA 1FO4A 2X69A 2L1AA 2FMCA 1C4CA 5C5MA 2B2WA 1N5WA 2KMMA 2XRSD 1SYBA 2JA5B 1MPEA 3AEAB 4WAFA 1XYIA 2F0MA 1QB5D 4OVZA 3AE8B 2O4XA 4OGQC 4X3TA 4HSPA 2WXOA 3BWUD 4IUQA 3R2IA 5C4JB 2QCPX 1DM0B 4YTMB 1F9PA 4DXGA 2K5DA 2F0JA 5TSSA 1EIGA 4GDKB 5C3JB 3AE7B 2AQ2B 2WLBA 4A90A 3DWMA 4MH8A 2XIWA 3MJ5A 2XSCA 5EPJA 2G1EA 2MPMA 3K57A 5D3DA 3BK2A 4ITKA 1F2ZA 3P20A 4ODGA 4EQNA 3M85A 4A3BB 2E3TA 4IUPA 1U9RA 1PDQA 3HP3A 2B2YA 2V3NA 3RPFC 5KRUA 2EYFA 2PZUA 1D5ZC 1BF4A 3NHHA 2WP9B 4YTNB 4IURA 1Y8PB 4ZYSA 3EFXD 3Q8AA 3VYSA 2MH7A 4OZAA 2OHFA 1BUVT 4H13C 2Q5WD 2K6AA 3J7AV 1U4LA 4B9XA 5IGBA 3K5MA 2PVGC 4WFN3 5BYQA 3TZUA 1LO5D 1VRAB 5MPOA 1AWDA 5CC4A 5K5PA 2K7VA 5D14A 5CV4A 2DYOA 1HPCA 2FBWB 2VNUD 5EE3A 1RHPA 1A6XA 4ZUJA 4K6DA 1NEKB 1WCMB 3EVQA 4G4KA 3NQIA 1LABA 3M4OB 3QWNA 3PUWA 2WXHA 2L83A 2YU9B 2PTLA 1C78A 1V1OA 1IUEA 3GB1A 3FDTA 2X38A 3KUPA 4ZAIA 2I46A 3TP5A 5E4WC 1SAPA 4GLSC 3MXPA 3SVMA 5LNK1 1YJIA 2W3RA 2BDOA 3P4RB 2KVMA 3U2SC 3LWUA 1NYRA 3J7AF 1JICA 2B8FA 2ZXPA 4L63B 2IGDA 1KDBA 1R4QB 1NYQA 4XYQA 1TWGB 4K14A 4P16A 2AUKA 3AE3B 1TWAB 4RKLA 5CV8A 2AWNA 2TSSA 1VJKA 3RFZB 4BA1I 2W3SA 3DWGC 4XDXA 1BNZA 3D4RA 1XEEA 1LTAD 1I6VC 2WNMA 2NVQB 1TS3A 4REZA 2IX3A 1WYGA 1I3QB 1YJJA 1B9MA 1EY5A 2NWGA 1F9QA 2INNE 4RAUC 1H9MA 3IFDA 1GUNA 2CHBD 3H0GB 3P42A 4DNRB 3GV6A 1U4MA 4RA8A 3T16A 1HUMA 1ZUD2 4P6VF 2EYLA 4DK0A 4ARCA 1EEID 4KKTA 4KGTA 4BA2I 3FILA 1F2LA 1PZJD 3SR6A 2B2WC 2HTME 3RZDB 4K5WA 5JVG3 1TZOA 1CA6A 3VR8B 1F2RC 3Q0AA 4PNYA 1D5XC 2IPKD 4DAYA 1GB1A 5AUIA 1VF7A 3W5VB 4B0MA 1HUNA 4PMBA 2LHDA 4C1NI 5C0XG 2J42A 1QNUA 3GTOB 4H0LC 4KJOA 1TS2A 1QWYA 4IFDH 1S5FD 4F88A 2IDYA 2NTTA 1WVLA 2XRQD 2WXNA 3H09A 5C6AA 1L6UA 3A55A 1OFFA 4BS9A 3P1MA 2L55A 2PVOD 4TQ0A 2PLPA 3AECB 1C76A 1E9MA 1P7FA 2H4OA 1U4RA 3FPPA 3Q8CA 2PQEA 1AW7A 2B2YC 4FXCA 4XXEA 2M00A 5C44B 5I2YA 2K04A 2F0WA 1TWFB 2F0PA 4R8IA 3L9AX 3BYTB 1UGJA 3FPUB 2KQ4X 3KBGA 5BMGA 1I4GA 2E74C 1KLUD 1LTRD 1TWCB 2KEDA 2Z1CA 3X3NA 2KA7A 1Q3LA 4KI0A 2L32A 4USAA 2B2VA 3ETRA 3TEZA 1BOSA 1V8QA 2N55A 5CV7A 1UWXA 5ELBA 3NUCA 3QB3A 1Y56A 1QF6A 2JA8B 1CZGA 5H92C 4YXDB 4K8JA 3OHXC 1F2YA 2F0LA 3MC0B 5JXVA 4HEA1 5JPMC 3M7GA 3BDLA 5E1FA 1MGSA 1E0BA 4KTAA 3NZ3A 3J80E 4HCEA 3PUZA 1G2SA 1PMRA 1WWTA 2EYPA 2LMCB 1EY6A 1SJHD 1C4QA 2L9HA 4YTPB 2I07B 5KIXA 1ENFA 2F0EA 1B2TA 5KNCA 1BR9A 4Q2JA 2GA4B 2ICIA 4US8A 1HEZE 2WXPA 1WTWA 2JZPA 3HG9A 1E10A 3BVGA 2D2CC 2JWUA 5I4DA 2J53A 1IHZA 5BMHA 5C4HA 3HOWB 2D5GA 2WQYB 3ZJUA 3MVVA 2PMZB 2EYHA 4HCSA 5BN3A 3OOCA 1C77A 3IL8A 3GS2A 1EU3A 5JVH3 2RDGA 2EY6A 1DOYA 2KEEA 1V1PA 1FD7D 1BCPD 4A3MB 3ONAB 3OWEB 1K51A 4RNAA 3E56A 3HOZB 3C1FA 4PQXA 4EE2A 4RF1A 5C2TB 4IDIA 3MXGA 3NPPA 1JC7A 3P7JA 5LHY1 4L8JA 2F0QA 2F0SA 4FF2A 1SNMA 3HOVB 1LT5D 4V0BA 3I9V1 3CU7A 3KLRA 4RCOA 2E6XA 1L4DB 5EKLA 2ICEC 2EYJA 3OSOA 1CI3M 1VMPA 3UI3A 5NUCA 4WWMA 3KWVA 4C7ZA 3P4SB 2B2TA 3Q22A 3S17B 2KN4A 3VYRA 3J81E 2F0FA 5C3XA 1BCPF 1EYDA 1EYAA 2MUYA 1F9RA 1LTGD 4L1BA 1C9FA 1SE4A 4OO1H 2DNCA 3W3AA 1ACCA 3I70A 2V0GA 1JORA 1L0VB 3M4YA 1NAPA 2RKSA 2XWJB 2B2VC 4LMQD 2PMVA 3W5UB 5G5GA 4ABNA 2KCNA 3C46A 1MBYA 4RKBA 1TYGB 3TP8A 1LLRD 1C8CA 3T3NA 2F0VA 1ZP0B 1HCZA 3E9SA 4WQMA 5KYIA 1W6KA 1O80A 2WACA 1O7LA 1D6EC 4A3IB 1WTOA 5AUKA 4DN4M 1YN4A 1ZXIA 1FCLA 4IFDI 1Q1EA 1J7BA 3LNNA 1CQFA 1B53A 1A70A 1KNEA 3HVDA 2WP8J 4KY7A 2WDVB 5DM73 3W1SA 4GDLB 2L5TA 3PUYA 1WD1A 2JEAI 3S9WA 4AQ7A 1TKWB 4A3JB 2Y0SB 2ONQA 2MP1A 5T8IA 3S15B 3CWIA 4FF1A 5IGCA 1JOQA 2MJEA 4DQOC 5CV9A 2R3ZA 5FO8B 1SF0A 3S1MB 4WORA 3PIP3 4KK7A 4OIKA 1LTBD 4JPSA 1VDZA 4CHTB 3TP7A 1EU4A 1WTQA 4IOIE 4C2MB 2MJ8A 2L4NA 1SEBD 3HVZA 3Q23A 4YWGG 2BT6A 4M0WA 1BO0A 2NN6G 4GZYC 3NRZA 1NSNS 3D4WA 2BS3B 2JXTA 1HTPA 2RBMA 2FUG1 3B2FA 1JWMD 1V97A 3SXHA 3J7YW 1DGJA 2WU5B 2SDFA 2C9OA 5K36G 4A6QA 3K59A 4JWUC 3AN1A 3ITPA 4R8NA 3HRZC 2WDQB 1K53A 4IUNA 5C5LA 2A6HD 1I4RA 3NTKA 1R4PB 1H9SA 4IZ8A 2FFKB 2GRIA 4XDDA 2K01A 1DOKA 2E75C 1ESRA 2A5HA 3PIO3 1BQQT 4CJ0B 4ZHOA 2EY1A 1BCPB 1DJRD 5JAVA 2E2IB 5T1IA 1STBA 3RMHA 1WGKA 3P1HA 3HOYB 2M2LA 2EYMA 1SYFA 2R93B 5EBDA 2K5QA 4FNFA 2GI9A 5JEAH 3BVZA 3CQZB 2IX0A 3VA7A 3GTJB 1RCVD 3PO3B 3CHBD 1QOAA 1EFID 2MJDA 1JQ4A 2B2TC 2K33A 2DLBA 1LTSD 3K0YA 1RD9D 4KD3A 1MD2D 2H88B 2YEPF 1SFOB 1T5EA 4LTUA 4US9A 2WXFA 3NTIA 2J7ZA 1DCZA 1Y69U 1ZXHA 3A8JE 3TUOA 1ZYRC 2XVSA 4BBSB 1FR3A 2CJOA 1GB4A 1AYFA 5BYRA 1MVKA 3NWSA 4KX6B 4Y7NB 1LT3D 3S2DB 1WRIA 1LTID 4DU9A 1B50A 1OXVA 1LV9A 1FMAD 1SMYD 1I50B 2AQ3B 3T3OA 4DA2A 3D31A 3GP7A 2ACZB 1PRTB 2ENBA 1SSNA 3NBHA 4TKOB 1EY4A 3K7AB 4AYBB 3LB8C 3KK7A 1EZ8A 1AZQA 2RMMA 4YIJA 3UI2A 3IXSA 1UUPA 1PGXA 3V05A 1SNPA 1S5CD 1FNUA 1Y8NB 2M9VA 3MAQA 4HRSA 4HTHA 4ID6A 1DZ1A 5E6JA 4RWSC 4RFBA 4C56C 4H2AA 3NVVA 1RWSA 1B9RA 3E0JA 2W82A 4CGYB 1STYA 1N60A 2EPBA 5IIFA 1TKGA 1F2MA 5M5WB 4HKZE 4K6LA 4ZHPA 2EXZA 1EWHA 2R61A 3KQ4A 1II3A 1YN5A 4N58A 3C2PA 3OPOA 5HURA 4CJ1B 5HGTA 3GTPB 2K0PA 3N9YC 3M7NA 4PT5A 3MFYA 3H91A 1HA6A 4EQPA 5G5HA 4OO1I 1U4PA 4XQQA 2EE1A 2JX5A 2RQXA 3W9CB 5EGTA 1TJEA 4PMCA 1QT9A 2RSOA 1UWMA 1VR9A 1TT2A 4NAWB 3I3CA 4HN7A 4RGTA 1VZ7A 1PTOB 1XTCD 4CKEA 3K58A 3PZ8A 4ZOHC 1EL0A 4U673 3V2TA 1FXIA 1P7EA 2FMMA 2NTSA 2WXQA 5IT9L 2EZVA 1X3QA 3SK4A 1I7HA 5T1GA 3MHBA 5COYA 2EELA 5EE1A 4DGZA 3AE4B 1XLQA 3AE9B 1WTVA 2VZKD 2A6HC 4NZLB 4KMUC 3E5SA 3B9JA 1KABA 2EY5A 5BN4A 1VZ8A 2PIAA 3ND9A 1JCKB 2BS2B 1GHJA 2L1BA 1FRDA 3BG3A 3EJIA 3JAML 1C79A 3NVYA 3KWLA 4ZRZA 2IJ0A 2NMQA 3VYTA 3P75A 2N9KA 1RODA 1LACA 1PGBA 5C0XJ 4A3KB 2JSVX 1CHQD 1DOXA 1QOHA 2MJ3A 1IYUA 5CBEE 2KACA 1GUWA 5E4XA 4A3DB 2BS4B 2I38A 1QQRA 4I7ZC 2MEKA 2CW0C 5M3FB 1IKLA 4L6TB 3PO0A 5E3FA 1XF5L 1MI2A 2LY7A 1HZ6A 1J9OA 4XQNA 1NR2A 2TMPA 1JOKA 5KGUA 2KWDA 4EQOA 4NW2A 1H9RA 2PW7A 3AB5A 1X3PA 4EVOA 4XIGS 4BY1B