3KLSX

Structure of complement c5 in complex with ssl7
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
191
structure length
191
Chain Sequence
b'LHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPKDQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C5
publication title Structural basis for inhibition of complement C5 by the SSL7 protein from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 33
structure length 191
sequence length 191
chains with identical sequence Y
ec nomenclature
pdb deposition date 2009-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3klsX02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3klsX01
1LLRD 1HTLD 3BYTB 2AQ2B 1SE4A 5ELFA 1I4XA 1PTOB 1SE3A 1CHPD 1FNVA 1LT6D 4RGOS 1HA5A 1KTKA 1DYQA 1CK1A 1ESFA 3KLSX 1LTAD 2O2LD 1TY2A 1EU4A 2ICIA 2G9HD 2Z8LA 3CHBD 1GOZA 1UUPA 1CT1D 4O1NA 1ENFA 1UNSA 4BWGB 1XTCD 1FD7D 1PRTD 1EWCA 4RHSA 1DJRD 1TY0A 1TS5A 3BVGA 1EFID 1PRTF 1S5FD 2XN9C 4DXFA 1JR0D 3BZDB 2AQ3B 1AN8A 2XNAC 1STEA 2SEBD 2XRQD 1BCPF 2QILA 4RCOA 3BYYB 3BVMA 3URYA 1TS4A 1EEFD 5ELEA 4OHJA 1ET9A 3R8BA 1TS3A 1QILA 1T5XD 4RGNA 1LT3D 1RDPD 1CHQD 1D5ZC 1LT4D 1KLUD 3GP7A 2RDHA 1YN5A 1L0YB 4Z9CB 4C56C 1PTOH 1PTOD 3MFGA 2NTSA 1YN4A 1PTOF 1YN3A 3R2TA 1PZID 1FNUA 4RGMA 1RCVD 2CHBD 2IJ0A 3R2IA 4L63B 1SEBD 1BCPD 4RGTA 3BVZA 1PZJD 2NTTA 1M4VA 1SE2A 2WV6D 4L6TB 1PRTC 1RD9D 1AW7A 4TSSA 3W2DA 1LTGD 1S5BD 4K6LA 1SXTA 1SJED 1CQVA 4NZLB 1BCPC 5ELDA 1I4PA 1FNWA 1V1PB 5FK9C 5FKAC 1JWSD 2XRSD 1HQRD 1LTTD 1L0XB 2J4XA 5D3IB 1G8ZD 1PZKD 1HXYD 1B1ZA 1BXTA 3DWAA 1LT5D 1I4HA 2TSSA 3DWPA 3O13A 4RH6A 1EU3A 2AQ1B 1KLGD 1SJHD 1LTRD 4RHRA 3EFXD 1B44D 1LTSD 1PTOC 1PRTB 2QEJC 1S5CD 1V1PA 1JQYD 2R61A 2IPKD 4ZYSA 3OWEB 1MD2D 1S5ED 1D5MC 1ET6A 1JWUD 3MC0B 1I4QA 3SEBA 4DXGA 1F77A 1BCPB 1JCKB 1RF2D 5ELCA 1I4GA 1LTBD 3TSSA 3V05A 5ELBA 1SBBB 1PYWD 1JWMD 1V1OA 1XXGA 1D5XC 5TSSA 3DWQA 1D6EC 1TS2A 1EEID 2RDGA 5D3DA 4RFBA 4UDUC 1LTID 5I4DA 3EA6A 1LO5D 1I4RA 1S5DD 1FGBD
chains in the Genus database with same CATH superfamily
2KYWA 3GZNI 3RPFC 2V3SA 1SMYC 5DM73 2QIEB 2ZW0A 4H7BA 3ZO5B 1SFOH 2JA7B 4JI3Q 2EYMA 1VZ7A 2RD0A 3Q14C 1RHPA 2MBBB 5HI1A 3X23A 1YIJA 1GUGA 2N1VA 1CHPD 1VQEA 2O6VA 1RM6C 4CJ0B 2HDMA 2DWQA 3N1XC 1FJGL 2NUCA 4A3GB 1F2RI 1EQQA 3T3OA 2PPBC 3ZYYX 4YTPB 2D3AA 1C48A 4OO1I 1UUPA 1PYSB 4IFDH 2LZ6A 2N55A 3OHXC 1PH6A 2F03A 2K33A 4OWTB 4ZLTF 2LGSA 2W55A 2WDVB 3TQYA 1J7CA 3NTIA 2RCFA 2PEAA 3HOYG 1Z6HA 1RTOA 1PH8A 3BJUA 1DM0B 3X3NA 4A3CG 3VR4A 1ASYA 4C4VA 1KFYB 5IP9G 2MH7A 5G5HA 1H4RA 1QOBA 4B3RQ 3DBHI 3BZCA 3U4EG 2H1EA 3I2ZA 2KACA 4K2LA 4QUCA 1TS4A 4JI4L 1RIPA 3T1YQ 2PMVA 3MA2B 4ZRZA 1XNQQ 4YSYB 1QILA 4LF8L 2JA5G 4NAMA 1A15A 1FR3A 2ZJPA 3ZJYC 3NVVA 5C0XG 1Y1VH 2ZM6L 4DHZE 1VQGA 2Z0EB 4LNOA 2B2YC 5KRUA 1SDFA 1YJWA 1YN5A 2DZKA 4WH4A 4A3OA 1OXSC 4A3BH 1NR4A 2F4VL 2RVLA 1EQVA 2IO3B 4CHKA 2X6GA 1ILQA 1CSQA 4HMJA 4DV0Q 1JWBD 1JJCB 3I57A 4JGHB 5J39A 2I2YA 4LK0M 2GN5A 4BOZB 2DY8A 2LHEA 1C7YA 1Q1EA 2B63B 4X6AH 2KFJA 4M00A 4WJWA 1GAQB 3V62A 1S1QB 3OW2A 4DR2L 1LTGD 4AS1A 4JI5Q 1GPXA 1E2ZA 4KHPQ 1BBUA 2LRWA 3D0FA 5JHAA 5MPOA 2F0HA 3K8AA 2HD5B 1CM9A 3GTGH 1LTTD 3PO2G 5C4XG 2IGGA 4FXDA 1XPUA 2DYOA 2WAQE 1VF5C 5LL6X 2BYTA 2FMCA 2LKVA 1ZXIA 2DAFA 4DV6Q 3B9JA 4A3EB 2PZTA 1HRJA 2UYZB 3B0AA 4ICVA 4DF7A 4GN4B 4EZJA 1WGGA 3DPDA 3MJWA 4RH6A 2E5LL 4A3CH 3UIPB 3NOBA 1SJHD 2IO1B 5IYDG 4KSLC 5IP9H 2H89B 3VRAB 2JA8B 1N34Q 2LRUA 3N6RA 5LXIB 4POFA 1HNZQ 4C3JB 1JWAD 4OWWB 1X3GA 3WIMA 5JH5C 1IW7C 1RF2D 1LM0A 1PLFA 1LTBD 2INCC 3M3YH 3S1MB 3RLFA 3S2AA 5C0XH 3ZXVA 3I3TB 2F0QA 4YHHL 2F0NA 3RZWC 3NTHA 2VW9A 2O2VA 5C2TB 5AEKB 1QVGA 5D3DA 2MW5A 5JOBA 5JJIA 4ANWA 3AEDB 4ZYNA 2J7QB 5C5LA 4B3SQ 2WWZA 2BWFA 2KJ6A 4P1CC 2F3IA 2KWUB 2I5HA 2WFWA 4LNKA 5AJ3Q 2K5NA 1ZKHA 1E24A 3H09A 3ZJTA 2OTJA 3PO3B 1TBEA 3SVMA 1DZ1A 1BMLC 3L10B 3QOLA 3FKIB 4YWGG 2C9OA 3TREA 3KYHC 2K0PA 4W9LA 1I50B 3KLWA 1PA6A 4BBNC 1Y1WG 5GQOA 1F9RA 4CHTB 2XWBB 3LDZE 4TKOB 1K0RA 2F0SA 4GDLA 4EUTA 3WDNA 1OEYA 1NY4A 4E74A 1J19A 2RGFA 3IXSA 4JI1Q 3CMEA 4PQXA 1FD7D 2MGSA 2PW5A 1HZ5A 4NQLB 2NPTB 3RNEC 3IFTA 2N7JA 4X65L 1HR0Q 4I6NB 2CFMA 1MFWA 3P2BA 2UXDL 2DZIA 2ID0A 1C77A 4N59A 3J80i 4IUVA 5IYDH 2KCTA 1EYAA 5ELOA 1WVLA 3P42A 2LVQA 2F0UA 1C9OA 2BS4B 3BVMA 2RSUA 1R4NB 3VH4B 5AUIA 2B2VA 1VQIA 3AB9A 4RF0A 1WTXA 1OQQA 1TS3A 3D3RA 2MBQA 1D4BA 3I73A 1RJTA 1L1OC 3UINB 4HMIA 3IT4B 1TWAB 1K73C 2HHHL 1GXDC 2N7DA 3FILB 4XIGS 4NAWA 1HZ6A 2QCPX 4EFOA 3MFGA 4LF6L 4W9EA 1N32Q 1N33L 5BN4A 1PTOF 1XNRQ 1LUZA 3BINA 3SR1A 2JP1A 4YY3L 3CQZH 3JAMi 5DNFA 5FO9B 5C3EG 2WGSA 3D4DA 3M7NA 3Q22A 4MM3A 3AEFB 3KUCB 4P1BC 2E2IH 2WV6D 2C60A 3EVQA 4LNQA 3ZJUA 3P20A 1VJKA 2O5JC 4IUMB 4KJOA 1GC7A 4GXBA 1WGYA 4PYUA 1K53A 4LF5Q 4DBGA 3W1SA 4XT3B 2C5LC 3ZRCA 3V96A 3L17A 1UF0A 3HOVG 2LVPA 2IX3A 2J4XA 3KH0A 1IBXA 3S1RH 1A8VA 1QOGA 3VFKA 1XCTL 4ZHPA 1XO3A 3M4QA 5EQ0A 1YVCA 2NBWB 1QB5D 3Q8CA 4A4IA 4MIUA 1U4PA 3Q8EA 3E0JA 1J8CA 2K6AA 4IZ8A 4JBWA 3Q23A 3NWTA 3OWEB 3GTOH 2ZTEA 3MC0B 2D10A 2FUG1 1CKNB 1NUCA 1OXUA 4IPHA 1WMHB 2FMMA 1LGRA 4K7SA 4E3CA 1BCPB 5CYUA 1XPRA 1D8LA 1L2FA 3NELA 2MWSB 3TEXA 4EQPA 4W9HA 2DNEA 4OEMB 3I5JC 1HQMC 1SBBB 2VXWA 4JG2A 1JWMD 1JROA 5DCNA 1D5XC 3T8MA 3A56A 2M8SA 4HDQA 1KDBA 1XX8A 4N6EB 3H94A 5CC4A 1EY4A 4G57A 3J7YW 2DYMA 1G6JA 2E2HB 5C5MA 4DAYB 4BBSG 4Q0FA 2KENA 2H88B 3A0JA 3U52E 1Y8NB 4ZRPA 1Z47A 3EN2A 5C4HA 1KRTA 1B7YB 4KKTA 2ZVNA 1KJTA 3TP6A 4R3DA 1I5FA 3M3JA 1SE3A 3BK2A 4LJPB 4ANXA 3VR9B 2ASQA 2MP2A 3J81j 5GROA 4XZ4A 1WJNA 4K0KL 3K0XA 1R4MB 3PUZA 2SDFA 2EDGA 3V2TA 2AWTA 4LNFA 3PS6A 4URKA 2LFNA 4CDDC 3Q3NC 1BO0A 3QAQA 5A2QE 3NS8A 2CH4A 1JW9D 3CHBD 3OJ4B 4GIVA 1HZ9A 4DR3Q 1XLOA 2MSED 2JX5A 3E5SA 3QG1A 4BKTA 3S15H 1IZ6A 4L5TA 1ENFA 4HEDA 5IY0A 2JXTA 2WXQA 4YWLA 3W1BA 2XVSA 1E7UA 1TY0A 4NPSA 2GB1A 2JA6G 1TS5A 3PTFC 3W1SC 5BO4B 4FBJB 1CZPA 1B9RA 2N3SA 3AMUA 3X0WA 5IE8A 4PG3A 2MNAA 2Y0SE 4DV4Q 1P1AA 3Q6BA 5IYCG 1STEA 2N88A 3A7AB 2V1CC 2M1MA 2PW9A 3APCA 4CQNA 1HNWL 3RR5A 3UE1A 4JBKA 3H7PA 3RULA 2JJQA 4FJYA 3E6ZX 2OWOA 3DVNV 5JVG3 3PSEB 3PHXB 2KXJA 4HXDA 5BYQA 3KUZA 4A55A 1SNCA 2OXPA 2V9HA 2BH8A 4IOAA 3IRBA 1JC7A 1IBMQ 2B3GA 4EQNA 2WAQG 4GS3A 4I7ZC 3NENA 2JEAI 3VTUA 1JMCA 1QVCA 1N9WA 4A93G 2G1EA 1GJXA 4BBSH 4XDXA 2K50A 4BBRG 3PVLA 4DV3L 1IYVA 2JQRB 1TKEA 3PT2B 2E2JB 5DLQE 3I70A 1VQNA 3C1EA 1VQFA 1UAPA 3VR6A 5I9OA 4B3TQ 4XWTA 1H9RA 3AQQA 2ZPYA 4C7YA 4K6LA 3ZTCA 2CQAA 4BY1B 4KX6B 5EKIA 2R93G 2K01A 4BA1I 1WXAA 3NEMA 1QVFA 1VS0A 4XC2A 1YX6B 2I5LX 1YHQA 2ZJRA 1WE7A 2NMQA 3MTNB 3C1FA 4UPAA 1G8ZD 3AXCA 1KH0A 4LTUA 3ZIMA 5I9PA 1NCVA 1VMPA 1SE9A 2EQSA 2K5VA 4DU9A 3D32A 3QARA 3NY5A 4WWNA 3RFZB 3PRZA 3O13A 4DV7Q 2OCEA 1AFPA 3TEYA 4YTNB 1DOLA 1YBYA 1PXUA 1I42A 5IYCH 5IGFA 2WLBA 3ABVB 1QE6A 1KF6B 3DXJC 1K8AC 2FNJB 1UE1A 5J1ZA 4H13C 2B2UA 1K28A 4FLHA 1NYQA 1VQ4A 3VTVA 4A3JG 4USAA 4OX9Q 4K6DA 5DPRA 1EUJA 4A3DH 3VVWB 3DBLB 3L9AX 3W3AA 3U9SA 1TS2A 4FF4A 4TUUA 4DAVA 1HHVA 4BZAA 2JXMB 4R8NA 1P3QU 5I6WA 2DUDA 2EY2A 4BBRH 1KXLA 1PGAA 3A9JB 4DQOC 1YJJA 3K57A 3NZSA 2LJIA 2O2VB 2OT2A 4FULA 1V9PA 4ALPA 4IWQA 1R4NI 5A2QL 5E6NA 4A9AA 1MIUA 1HJPA 4EOYA 2E3TA 4HROA 4F7ZA 1VQJA 2L12A 3NE5B 1QF6A 3KLSX 3D4RA 1I3QH 1V80A 2OJWA 4H2AA 2R93H 1B2TA 1JRPA 4F1SA 1DOXA 4ZAIA 2G3QB 4QGUA 2KHWB 1DXMA 4JLCA 5EAYA 2IGDA 4P2CB 3GTPB 4IJHA 3S9WA 1PH2A 4C3IB 3GQBA 1XLPA 2HT1A 4JCVE 5M3FH 4KJNA 4FF2A 4ARCA 3EFUA 1MG8A 1PRTF 2E6XA 2KMAA 4ASWC 1I35A 2IX0A 2AUKA 3RT3B 5M3MB 2QDFA 1X65A 2K8CA 3D4WA 4OGQC 3ZNZB 4K8IA 5IWAL 4PMCA 2V4DA 4HCPB 3LGJA 3QWNA 4ZRIA 3GE8C 2BOSA 2L83A 3TDQA 1WTRA 3HM3A 1LACA 4Q5VA 4POGA 4DNTB 1MGSA 4A3JH 1XMOQ 1N63A 4XT1B 5EE9A 4IUUA 1RODA 1GUWA 1P7FA 1E1OA 4DR1L 3A33B 4Z9CB 1C76A 4YSZB 1J5EQ 4NMZA 1SYCA 1CQFA 3B6YA 4A3IB 3M4OH 2L0TA 2R2QA 3KLRA 2ZNVC 5LMNQ 4KK7A 1VZ8A 1FXTB 4A6QA 4ABNA 1WRDB 1Q5WB 4QL5A 4JE3B 4J6IA 2WKDA 4DDGD 3MEHA 4F8MA 1M4VA 2ACZB 1PFMA 3AE1B 2LUMA 1X1MA 3TZDA 1FGUA 5E4WC 3RZDH 4RWSC 5D94A 3WWVA 4RNAA 3MC9A 2V0GA 4DAMA 4P16A 2DENB 1B1ZA 3VUXA 2LEKA 3DWAA 3VXWA 1GKHA 3DEPA 1Q8IA 1GB4A 1MJEA 4R4TA 2OOBB 2H4OA 1SYDA 3SK5A 4RHRA 1WCMB 2BT6A 1VDVA 2FXQA 5M5WB 4MACA 1JQYD 2KAJA 3HKZB 4AIMA 4OO1H 2K8BA 3DBHB 4ZUJA 4WQMA 4FHJA 1UZXB 2XSCA 2NVQB 2N7EA 3QIJA 3A8KE 2J0MA 2Q2UA 4QJFA 4ZKBB 3V61A 2WACA 1OEYJ 5KIXA 2LXAA 4UP9A 3EC8A 1NNXA 1ASZA 3I4MG 1N61A 3MAQA 5FR6A 3WAMA 1LLRD 1F2YA 2N1WA 4K5WA 3T51B 5A35A 3ZTDA 3VDYA 1K51A 3ONSA 1PTOB 1HZBA 4CKEA 1VQOA 1WJ4A 1IBLL 2N78A 4EVOA 1J0GA 3EUB2 2K5HA 3ZNHB 4FP5D 4Y7NB 3IT6B 2NVYB 1MJDA 3GTJH 1BUVT 2NWGA 1XYIA 4AJWA 4BOSC 2DGYA 3UE0A 2VZAA 1E2VA 2QCZA 2REXA 3EJIA 4PMBA 3MC8A 1GOZA 2GVAA 4LDTB 1H8CA 2UUCQ 2MP2B 2JWUA 2XEWA 4JK1C 4TRDA 1KRHA 2D62A 4KZCA 4CGYB 3IG3A 1KNAA 4WQOB 2IWHA 2K1FA 1EWCA 4RHSA 1WZ0A 4J3OD 1TWFB 3AULA 1QOHA 4ITKA 4J8QA 1AWDA 1KRSA 3PLUA 4ZRJA 1ZPSA 1I6HH 2AQ3B 4DV2L 1L4DB 3S24A 4NP5A 2QKIC 2SAKA 4JYAL 2AYOB 3W5OA 2N9PC 5KHOA 1YJ1A 3OYYA 1OFFA 3UI2A 2A19A 1ML0D 4DV5L 2RPQA 3DBSA 5CGKA 1TKGA 2RSOA 4KN7C 2D0PA 3W5VB 4CJ1B 2SOBA 4N9PA 1FJGQ 2WP8J 3Q0AA 5G2NA 1B9NA 2NPTA 1BQQT 4KY7A 2KN5A 3H7PB 1P98A 1SNPA 4XQJA 4M0WA 4WURA 1HUNA 2OEDA 3HOXG 2O5IC 4A3MB 2F0EA 1FFUA 5H8YE 1FL0A 3I4MH 1YN4A 1C8CA 1ZGUB 2QDBA 5DPSA 3PV1A 3TUOA 3HOZH 2FIFA 1MHXA 3VA5A 4JI8L 5IIFA 1QCBD 1YN3A 1R4QB 2KWDA 5IOIA 1CJEA 3R2IA 4WAFA 1VLBA 3ULJA 1NBWA 1DONA 3LX0A 1PUTA 4LFBL 2VUMB 2KQ4X 3QC8B 1F2LA 1SE2A 3FILA 3VR2A 3OWFA 4PS7A 2MCNB 3J7AV 4PT5A 4JI4Q 3NQIA 3TP7A 2CJNA 4S0RA 1GHKA 3AEBB 1R4PB 1S3SG 1WX9A 3A4SC 5FK9C 4LF8Q 3N1ZC 1NE3A 2EYPA 4XYOA 2D07B 3PZ8A 1U5KA 2L32A 4A3FG 4LW1A 3HOUB 3DBLI 2AWNA 5CV6A 2ZM6Q 5K5PA 3P63A 1VR9A 1KD1C 1DGJA 4ANUA 4GNXB 3P7JA 4X57B 2NN6G 2TSSA 4GLXA 3AE2B 3PO0A 4WWMA 2F4VQ 3M95A 1E1TA 1A3UA 2EY6A 2KX0A 3HHMA 3KQ4A 2XGTA 3SHQA 1LTRD 1NI3A 1B8AA 4MSMB 3CCUA 3HOWB 1C0AA 4JI6L 4XQNA 4A3PA 2PNRC 4LNNA 2JYOA 4QQBX 1VQAA 2PTLA 3SEBA 4FO2A 1WH3A 1BDOA 4YL8A 2Q2HA 3RMHA 5C3WA 4DR2Q 2Q2IA 4LFCQ 1JOQA 1WFYA 3DCGA 4XWWA 3NWSA 1ISNA 1O7LA 2I1JA 5LHY1 4HIOA 2IDYA 5ELBA 3TEZA 2PYKA 4RM8A 1NR2A 2HQLA 1V8QA 4F87A 1E10A 5CMDA 1ICFB 5LMUL 3OIPA 1YX5B 2HIVA 3CCEA 3HVDA 4JWUC 3Q6SA 5EBCA 3ULLA 4LJZC 1HTLD 1CKNA 1HZCA 1WMHA 3TP8A 1XF5L 3KYDD 3I90A 4HKZE 3JYUA 1Q81C 4KGRA 4G4KA 1JICA 2RQXA 2D11A 4C00A 1WXQA 4LCDE 2E2DC 1ESFA 1CK1A 2Q8RE 2R92B 1TKWB 4IPCA 5IGDA 2K5PA 2LUEA 2UUCL 4DAYA 3TMEA 3CCVA 1W6KA 4ZRKA 1Y1VG 4O1NA 2JRHA 3O65B 2WU5B 2F0JA 3OTOL 3H15A 1CZGA 3GTKB 4YHHQ 2KQ3A 1MJCA 1UEBA 4A3BG 4CJ2C 2DNFA 2W82A 1UBIA 3RLOA 2NN6H 1T5EA 3PZDA 3DUZA 1I94L 3I4NB 4LFAL 2EYOA 3AU7A 1OQYA 2XNAC 3HKSA 1B53A 1ZXTA 4F7XA 2WXLA 2WXKA 3SFEB 4LF4L 3DOWA 5DM63 2Z9HA 1Y56A 1YMHE 2KJRA 2JE6I 3M85A 3MXPA 1SFOB 4FXKC 2PPHA 5KHQA 4M1UB 4HCNB 3VYUA 1LT3D 3BWUD 3RYTA 3N52A 3ZJVA 4GLVB 2JZ3B 4W9DA 1V97A 3PGEA 4GZYC 4J15A 4JX1C 1VQBA 4BKGA 3I4LA 2QGQA 4MTKA 4C56C 3FEWX 3VA7A 1J7AA 1VRAB 4R4OA 2INPE 3BDLA 2J53A 1K3RA 2QHOA 4JIOU 4IJLA 2I46A 2F0WA 4DNRB 3T16A 3B1LX 4X65Q 3IFDA 1UWXA 3P4PB 4BBNF 1SYBA 1FM0D 4HVBA 2UXDQ 4LUZA 5KEEA 2H5XA 1WFQA 2UXCL 4A8XC 1AARA 1UWVA 4ACFA 4P75A 2PLPA 3NZUA 3VRBB 3NRZA 2J0TD 1BNZA 4WWOA 1BCPC 1NDDA 3PUVA 2QA4A 1V1PB 5KNDA 5BR8Q 3RN2A 2KDIA 4WJPA 1OGWA 4B3ML 2HHHQ 3CC2A 2KNBA 4ZQ3A 4LJOB 2C5CA 2QEXA 1IXRA 4KD3A 3WOFA 1LFDA 2QC8A 1VQHA 4LF6Q 4YXDB 4FADA 1FRRA 2GVBA 2NBFA 1N33Q 2HJ8A 1EWHA 3AYHB 1Q86C 3N3KB 2ZXPA 2EELA 4L1BA 4YY3Q 1WR6E 1Q90A 2HCIA 3JAME 1MSHA 4US9A 1PRTB 3PUXA 3A1QB 1MD2D 1S5ED 1ZDXA 2NVTB 4DN4M 2CS4A 4LFCL 4OW0A 4G11A 2PVGC 5T8IA 3HIZA 3DHHC 3FKYA 2JRIB 4MGZE 2CR5A 3BDCA 1VQPA 2HTHA 3CPWA 4NW2A 2Q8TA 3C2PA 2LI5A 1SMYD 4L5QA 1HFGA 4MEMA 4BY7G 1M90C 3KJOA 2G9DA 1HTOA 2RDGA 1A2UA 2QJLA 3L54A 4AQ7A 3PO3G 2ZCCA 1FIQA 3SDZA 1MI2A 3CCMA 2EYFA 1T3QA 3BK1A 2RF4A 3FKIG 4PV1C 1L6VA 2PE9A 2EOTA 4O42A 2AX5A 4R1JA 3MXUA 3DVNU 3H8HA 4NJCA 4A20A 1B3QA 2AUJD 2VQFL 3ONAB 1EF1A 4FXGC 2IHEA 3HOYB 5IA7A 3I91A 4X66L 2Q5WD 1GO3E 2HDLA 1P8LA 2WB1G 1M94A 2YEPF 4XGAB 5G55A 3SXHA 4JBJA 4HIKA 1EY9A 4K8JA 3H3VI 4MT5A 3WANA 1A6XA 1EWIA 1EU4A 2ICIA 4A3EH 4IKGA 3A9JA 4NKLA 5GADC 2BA0A 1QT9A 4GLSC 2N49A 2RHQB 4DA2A 4US8A 2VB2X 4HSVA 1HTPA 4KY6A 2JA5B 4S3SA 3M3YB 3L16A 1Z7TA 3MHZA 1U4RA 4KV6A 2KMMA 1Q1BA 4A3KG 3H9DA 2KDEB 4AYBG 3GE3C 4C3JH 3JC66 2UWQA 4H02A 4IURA 3IBEA 2ALYB 2WIIB 1SB3C 2AL3A 1WJ6A 4WAAA 2SEBD 4BAXA 5JXVA 5L95C 4OELB 3MZ5A 3SGIA 1F1HA 4OWXB 4OHJA 2NBUA 4B6WA 1A70A 4FN2A 1KC8C 3NK9A 4K0KQ 4XQQA 1N5XA 1QG7A 3I9V1 3VUWA 4MN3A 5G5GA 2IL8A 2LGDA 2Z1CA 3CP0A 2WXIA 5BMIA 1NTGA 4CKBA 4BY7H 2X6LA 2ZTCA 2JSVX 1P16A 1PVOA 1FFVA 1HZAA 2QMTA 4GU2A 3PO3H 4NJ6A 2DN8A 3NBHB 4P6VF 3E9SA 2UXBL 3R2TA 3FKIH 4X3TA 3PO2B 5C4XB 1JALA 4RGMA 3J80L 2LSSA 4M0WB 4IWPA 2HCCA 2AWOA 2WP9B 1U9RA 2K32A 1G6PA 3CU7A 3MTSA 3OSOA 2JT4B 2O6VD 3A54A 4P7IA 3VYRA 4LF9L 4HTHA 1HNWQ 1II3A 1L7YA 2WXOA 1MKHA 1V1QA 1EOTA 4GN5A 4I65A 2CQOA 1GUSA 5BR8L 1WD0A 2KTRB 1GUTA 5DEHA 1HQRD 1WGHA 1QZEA 1WJUA 3VR8B 1PZKD 1CKMA 1BXTA 3KWLA 5AFWA 1X3EA 4KHZA 5GAEC 1K83H 5IN7A 2VY3A 5KNBA 4X3KA 3JAML 3T1HL 2ON8A 4XYQA 3P75A 3AN1A 5CV9A 4A3KH 1V8CA 4JW0A 2AQ1B 3U50C 2BW2A 2MBOA 3K9PB 4EZLA 3APFA 1IW7D 2E74C 4DV3Q 1B44D 4WIPA 2QEJC 3V3XA 1TWAH 2RSNA 1F9QA 3R3MA 4DR7L 1EIGA 1C4PA 1JMLA 4DK0A 2PE6B 1TWCH 4YCWA 5M9OA 3Q2AC 4M02A 1KAWA 1X32A 3M4PA 3GTMH 3TSSA 1T0YA 3SFDB 3WAOA 3E56A 1PYWD 2XWJB 2EMTA 1TJEA 1L5PA 4JWSC 1Q8KA 3G4SA 1RKNA 2MO1A 3F2DA 1Y1WB 5FO7B 4LMQD 1LTID 5H1SE 2B76B 2EKIA 4AUQC 4TV3A 1XEEA 4DK5A 3IKJA 3V6EB 4WJ3M 1Z5SB 4I6PA 4ARIA 3HKZE 1T9HA 1VMCA 3QO2A 2WXRA 1FVIA 1SE4A 3GO5A 4HN7A 2BF8B 1X54A 2LS01 1FO4A 1EZ6A 2F3VA 1N36L 1T0RC 2QDLA 1W3SA 2D5GA 2L1BA 1WTHA 1L4ZB 2B29A 2K04A 2MA9B 4ZDVA 1J7BA 1LYLA 3AFQA 4RMAA 2EPBA 3M4YA 4ZOHC 3J7AF 2AL6A 2QW7A 4QAYA 1SSNA 2B3AA 2V4LA 2YYZA 3I3CA 2B2VC 1E7ZA 2YU9B 4IFDI 1WGDA 1Y8RC 2RMMA 2WS3B 1STYA 1Y14B 1N8RC 2XK5B 2K39A 3BZDB 4IC7B 4KGTA 2MUYA 2KCNA 2L55A 3CCRA 3S16B 2LHDA 5CR3A 2XRQD 3M62B 4HDOA 1ILPA 1X56A 2BB5A 3VUYA 1IYUA 2LGXA 1CZWA 4CO7A 3U2SC 2BKRB 3KF8B 5C3EB 5J18A 3RUIB 1SR3A 2JXXA 1SIJA 4N9F4 1ET9A 3R8BA 3H7SA 2EZVA 3HFZB 4AH6A 4JV5L 1T5XD 1I6VC 3I72A 1F2RC 5D65A 4GB9A 2D3GA 2JZZA 2J52A 1KLUD 1TIID 1BF4A 2PKOA 2VZKD 3H6MA 2F0FA 3NTKA 4R4IA 5EBDA 4A76A 1EY5A 1W6JA 5GAHC 3F2BA 3S1QB 3QOJA 3OIQA 2WX0A 1BT0A 1BBXC 2L0CA 4BXXH 3NSWA 1NI2A 2IGHA 3HOVB 2OJRA 4C3HG 1CA6A 3ZNGC 1JQ4A 3ZW3A 3S15B 4HJGE 2R7ZB 3V6CB 4RGTA 2PMZB 2I07B 3G6JB 4XDCA 4GN3B 4L6TB 2SNSA 1U0LA 1PFSA 2EJMA 2KUMA 1WI5A 5IWAQ 1VQ9A 2Y5CA 1XD3B 3H6NA 1B9MA 4OXPA 3ZQ4A 1S4ZA 1NAPA 3JW0X 4AWJA 2BYFA 3C19A 1TVXA 2NR2A 3A4RA 4W9FA 1ESRA 1TQOA 4HRSA 1PFNA 4EGVA 4G7HC 4B95A 4GOPB 4A3DG 3HS0C 3J81i 1LT5D 5EPJA 4DR1Q 3CC7A 2NVXH 2DYBA 1I4HA 3PF4A 3RZOB 1Q0WB 4QIWB 1UE6A 2FUHB 4MELA 3AEEB 2DLBA 3NVYA 2I1KA 2KZRA 2WDRB 4DK6C 3I56A 1UBQA 1PTOC 1ZP0B 1VQ8A 1S5CD 3ERQA 3C8YA 1G2SA 4ZYSA 2C7MB 3WCQA 4ZHOA 2FBWB 3ZUNA 2YTVA 3UF8A 1U4LA 5C4JB 3J80c 4GNXA 3S1NB 1GUAB 2DBYA 1ONLA 1T6BX 5E7NA 2CHZA 1E9MA 2YTXA 5HFYA 3C0RB 1A0IA 1V1OA 1JORA 2WNMA 3H0GB 3DWQA 5E1FA 1IYFA 4IN3A 1TT2A 1HH2P 1Y69U 4GGQA 5C0XI 3PF5A 4ANVA 5M3FG 3NP8A 3PV0A 4FA6A 3ERSX 4JI2L 4C3HH 1V43A 4DWFA 4BY1H 1CA5A 2ZXRA 4AOFA 4RGOS 5LL6S 2JA6B 1TR5A 4FXCA 2A8VA 3JAMc 4PZ7A 5F2DA 3H91A 4WFN3 4QCLA 3I55A 3T9LA 1YIWA 4EE2A 1EIYB 2VS1A 1CMXB 3FMCA 1TY2A 2EJGC 2Z8LA 1R9TB 3EHVA 3R3OA 4KDIC 4CKCA 4JBMA 1K3BC 5I2XA 1XPOA 3PRMB 1UE5A 4OONA 3CF5A 2UUBL 1LM8B 3LWUA 3B2FA 4OZCA 2FHTA 1XTCD 2K28A 4P72A 4K7UA 3BVGA 2B2WA 4K5VA 1Y8OB 1IBKL 2GBJA 2KFKB 3N20C 3PHWB 1L0WA 3SDLC 3K58A 4L5RC 3ITPA 4KIKB 2KN4A 3SE0A 4RM9A 4IG7B 2GLSA 4A93B 1AZQA 2D9UA 2KKCA 3U30A 1X9NA 3CCSA 3ZLZA 2GBKA 2KQ7A 1IBLQ 1TWGH 4PS8A 1STBA 3GDEA 1L1OB 3DM3A 2M56B 4HJAA 1WM3A 4NXML 2K03A 1BVSA 1G2TA 1E8ZA 3NHHA 3K80C 4UP8A 1WM2A 5ISRA 4C1NK 1ZXHA 5M5XB 4IUPA 4A3IG 3S2HB 2KJHB 4IDIA 2PZWA 3FP9A 3NQTA 2EIFA 1O78A 3MXNA 4LNIA 4MGYE 2YTYA 1PTOD 3S2DB 2Z59B 2A6EC 1FEHA 2PZUA 3RN9C 2N9EB 4OVUA 1PH5A 4IUQA 1E5WA 3HVZA 2IJ0A 4LF7L 2JK8A 1D2BA 1MPEA 2INNE 2WDQB 4DV2Q 3ZGZA 2W3RA 5DPWA 4DHJD 5BYRA 1RD9D 4JYAQ 1SNMA 4DPGA 2EXDA 3HG9A 4OO1G 2LVOA 3MWYW 3DDCB 4MGKE 4IUNA 1AEXA 1PH1A 3S14B 4DV5Q 2ZVOA 1G291 3I7FA 2JUOA 5LNK1 1AZPA 2WXFA 2EYLA 2K9XA 4IALA 2R7FA 2K8HA 2KANA 1T0QC 2MJ8A 1AH9A 3RNAC 1XTDA 1ZDVA 4K3CA 5M3MH 3VTWA 4KI0A 1EY7A 1WCMG 3HRDD 1KQSA 3CW2C 4A3JB 2B2UC 1ZUD2 1IUEA 1HUMA 5HURA 4NPNA 4R4QA 1SYFA 4MH8A 3UQBA 2MX2A 2XTIA 4TVAB 3DWPA 1SRUA 5C44B 2KOXA 4JI8Q 4Q2JA 2ZCBA 3NHEB 5BYSA 4KTAA 3DWGC 3ER0A 3TCAA 1YEZA 1V1PA 1E7PB 1EF5A 2A73B 3UDFA 1D5MC 1ET6A 4LFBQ 1C78A 2GI9A 5AZGA 2UU9L 2B2WC 1PDXA 1WE6A 2BB6A 2VH1A 3W5UB 4UHVA 4IM3A 3CCQA 4WJ4A 3AEAB 3T56B 3J9CA 4A3IH 3UDXA 4HCEA 1IL2A 2F52A 3ND8A 2IZVB 1BKBA 2A69C 4KKUA 4B9WA 2N9XA 1K0SA 4KD4A 1E0BA 2IT1A 2MP1A 4N8FA 3A1QA 3OLMD 2EJFC 4NDXA 1TWHB 3PPAA 3GTLH 1Q10A 1ICWA 2N9KA 3SK4A 3K9OB 1WD1A 2L0FA 3X3MA 1I4XA 2KC2A 1WIAA 2M2LA 3A55A 3HM6X 4MJSB 1TTNA 1XLNA 3L0WB 1RYJA 4DGZA 3KUDB 1NSNS 4JI6Q 2A6ED 2FCQA 2KCCA 2EE1A 4IUTA 3K7UC 5FO8B 4BKSA 3KYCD 1WRIA 1GD7A 1C4AA 4IOCA 2L1AA 3C46A 3KDFA 4MTNA 3L7ZC 1NEKB 1WCMH 2A74C 2VQEL 5M5WH 5T1GA 4X3SA 5LMUQ 1WX7A 3HOZG 1KNEA 2BCOA 1UELA 2MJDA 3OJ3A 1ZYRC 1QLBB 2Y0SG 2NVQH 1YJIA 3PQIA 3GTQH 4EQOA 3BY4B 3H1UA 3RNGC 2M00A 1XMQL 2LXJA 3NXWA 2FE8A 1WTQA 3G7LA 2JYEA 3E3XA 4N9TA 1RLFA 5D2MB 3Q8FA 4J1MA 4GKKL 1PMRA 1HNXL 1SIFA 1E8YA 2WU2B 4XE0A 1JB7A 3Q3JA 4HJ9A 2CHWA 1A62A 2FAZA 4DNIA 1PTOH 4CYEA 2NTSA 3OTOQ 4CDEC 4QMGA 2BDOA 1GNUA 4GOCA 4Y7NH 2NVYH 2CHBD 4RMFA 1WTVA 1Q1OA 2EMSA 2WYQA 2QSDA 4K14A 4L63B 1E8WA 2YVCA 4IM0A 1E3PA 1I94Q 3KBGA 3JSVB 4LFAQ 1WTWA 2EKEC 2NCNA 1PZJD 1N6ZA 1PRTC 2A69D 2JYTA 4TSSA 3HOUG 2K25A 4LF4Q 2OF1A 4M8MA 1F2MA 2B2TA 4TMAB 2MJEA 1ZKOA 3AE7B 3DVGX 1CFMA 1CQVA 4C2MB 1YITA 1E6EB 1V81A 2K22A 3NBHA 3VDZA 1OXTA 1L2NA 1TWFH 2KMCA 3VYTA 1KL9A 2K5DA 2NYZD 5D3IB 4DR5Q 4NQKE 4PNYA 3QX1A 4HWIB 3V60A 5J17A 5CORA 5C4ZA 3HOWG 5E6JA 4FHKA 4OIJA 1E8XA 4HLEA 2RR9A 1UE7A 1KLGD 5J2RA 2MLBA 2Z4IA 2HUGA 5JEAH 1ZE3D 3TJPA 5LXHA 2KTRA 5DAUA 3LJ3A 2IPKD 3B2GA 1N60A 1WSPA 2KA7A 2UUAL 2CHXA 2ZW1A 2UXCQ 2K7VA 2VH2A 4EKUA 2JWZA 1JCKB 4A3MH 2ZPNA 1D7QA 3NZ3A 1I4GA 2F1MA 2MQJA 3S17H 4JOIA 4PZ8A 4JI0L 3IAM1 1ZYRD 2KWCA 4HJ5A 5TSSA 4PMWA 3Q8BA 1F52A 4R9WA 4B3MQ 2EYHA 4RFBA 2VUMH 3A9KA 3EA6A 2R7DA 3K81C 1YI2A 1YZ6A 3ML9A 1PDQA 3IL8A 2BTEA 1ZOYB 2CW0C 3EIVA 1X55A 2RHSB 3A8JE 2R92G 2J42A 1YNJC 1H9MA 5ELFA 2V1YA 2Z6KA 3SK8A 1UWMA 3VHTC 2GA4B 5C1ZA 4X62L 1LT6D 2F0LA 2KJXA 2ZJDA 4WWPA 1EYDA 1KTKA 3HOUH 3KUPA 3K7AB 5FLXE 2PIAA 3GD7A 1DOKA 3CMMB 5BMGA 1B3AA 4GLAC 5JJZA 1A3TA 5GAGC 1M1KC 2D3CA 1HCZA 1LTAD 1AP0A 2BBCA 2G9HD 2KOLA 1PH4A 1TU2B 1EL0A 4GKJL 3NVZA 1CT1D 4OIKA 4QY7A 1XLQA 4EEWA 3ZNID 3AFPA 3OG5A 4RF1A 4ZRQA 5HKHA 2JA7G 3CSFA 3UIOB 3N9YC 2WXMA 4G7OC 3SU8X 1PRTD 4B9KA 3RI7C 3HOWH 2LXCA 4F8CB 3R7RA 4U68A 1S5FD 3QJYA 3TEWA 1QUQA 1STHA 3HOXB 1AN8A 3KF6B 4A3GG 3M63B 3PIPA 1S40A 4H44C 5JEAJ 5M5YB 3PCOB 2G5DA 1QNUA 3TP5A 2C35B 1L0VB 2QILA 5J22A 2VQFQ 1UGMA 4N8X1 4CBVA 2CU1A 3F2CA 1RRBA 4X66Q 2EY1A 5FLMG 4O0AA 4G3XB 1W2BA 2RDFA 4KLKA 3QR8A 2Q2TA 4DK1A 4LUVA 1HE8A 2PO4A 1PH3A 4V0BA 2XK5A 3ALBA 1STAA 1O7IA 1SLJA 1V5TA 2IY0B 3L13A 1SE8A 2GBMA 3NG0A 5K36G 3Q69A 1S72A 2ZNVB 3RNBC 2GMIC 2L05A 2L8JA 3AE3B 3NVWA 4A3FB 3KF8A 3MXNB 1WTOA 4ODGA 2R92H 2BPSA 1UGJA 2B2YA 2FFKB 1V9JA 4M8NA 3RUZA 2KT7A 4O2DA 2Q8IB 2R3ZA 2SNMA 3U4ZA 4X64L 4IOIE 1S5BD 1TKYA 3GTKH 2AKWB 2B39A 2NZ1D 2LWPA 1SJED 3I63C 4ZCKA 1KDCA 2CW0D 2HJ1A 3AI5A 1V6EA 1X3QA 3J7ZC 2J0KA 1L0XB 5EE1A 1Z9FA 1YNJD 4DR5L 2FCMA 1HXYD 2WINB 2JA7H 3UGBB 4YSXB 2OQKA 3I8ZA 2PMZE 5JPNC 3ULPA 2B63G 4YCVA 5L37A 4LWCA 3QWZB 4HPPA 2WXHA 3AEVA 2UXBQ 2INDC 3KFUA 4FF3A 4A3GH 2A68C 2FCSA 2KDFB 1WYWB 4DXAB 1LTSD 4TKNA 4II3B 2AMCB 4QF4A 2VB3X 4DR4L 1JWUD 3J80E 1EQRA 4RA8A 1PV4A 2BE5C 1F77A 4GOPA 4YIJA 4LF9Q 4DAPA 1NMFA 5FLMH 4A3LH 4DR6L 1C1YB 3QHTA 5ELCA 1LTLA 2F0KA 1JE5A 3VR5A 3P4SB 2K1BA 4A3EG 2JN4A 3K6OA 2RDBC 2OEOA 3QK0A 4QIWE 5KYLA 1GM5A 2IX1A 1IPGA 4R4CA 1D6EC 2ES2A 5K36H 2IYDB 4OVVA 2JA8G 4M01A 2JF5A 1Y1VB 4YT0B 1RTNA 3T1HQ 2M4NA 4K7WA 1BBWA 4C3JG 1I7HA 2KX3A 5FLXL 5G3LD 1CI3M 4A3BB 2K05A 2Z6BA 4C1NI 1KM7A 1P0RA 3AU4A 2ENBA 2D0OA 4ICUA 3UQAA 2DHZA 4NXNL 3F2UA 2DX5B 2L76A 3U7ZA 1DYQA 3SD5A 4DR7Q 4UY8C 3ENEA 3J7A5 2X69A 3DVGY 1QOAA 3TMPB 3OAWA 3MHSD 4YCUA 3GOEA 4DUYL 1GVPA 5L83A 4DDID 5CV5A 4D2KA 1JOKA 3M9BA 1K8GA 2B63H 4KDLB 1K8RB 3GTGB 4W9CA 4PK1A 3LYYA 2KDMA 1NYRA 1YD8U 2NVTH 1JR0D 1D1KA 3IHPC 2NS5A 4X3UA 2KTFA 1U4MA 2ZJQA 3KDFB 4MZ9A 1B50A 1X3PA 3SR6A 4RAUC 4JQWC 4K3BA 5EGTA 4DUZL 2IY1B 2LMCA 3AM9A 1EY8A 1AE3A 2K6DB 1QKZA 2WHIA 1N36Q 5EE3A 2OHFA 2A6HC 1RDPD 1IKLA 4KN4C 3TZUA 4IFDJ 2E76C 3EECA 4NJ7A 3PLVA 2ZTDA 3CRKC 5JPMC 4XXEA 2CVRA 2F0GA 5ELNA 2KFKA 2A68D 2E75C 2GBRA 1JOOA 1V5OA 3MVVA 4GOPC 1Q46A 4KIKA 1QOFA 1RWSA 4DV1L 3HOYH 2JA8H 4AQYL 1D3ZA 1D1IA 1X6OA 2HQEA 1TGZB 1PZID 2BE5D 4BFRA 1DOIA 3BG3A 1L1OA 3DMUA 1ROEA 1BCPD 5IT9E 3CPFA 1YQBA 4FF1A 3S1MH 1AW7A 3BIID 4JPSA 1WX8A 3BU2A 1Q12A 5CV4A 4YWMA 2JA5H 3AH7A 2LD9A 5EJWA 1FNWA 1VQ7A 4JV5Q 1IGDA 5FKAC 2F0TA 4W9GA 1BR9A 1EYCA 3T4AC 1PGXA 5AZHA 3FAHA 4WJOA 2PQAA 4PZ6A 4LAAA 2VNUD 1YNTE 2LJ5A 4P73A 3TN2A 2ATWA 1YOVB 2YLMA 1TYGB 3M7GA 3OPOA 4JI3L 4XYCA 4BY7B 3K5OA 2MBEA 5E3FA 1E90A 1I50H 2V3PA 1F2ZA 2N4FA 2R61A 4IQZA 3EFCA 1SROA 5EKLA 1VQCA 5EPLA 4IPDA 1MHWC 3MXGA 1PQSA 3U9OA 2X38A 3B08A 4II2B 1FXAA 3ZDTA 4G50A 1PGBA 5C4XH 3PO2H 4KSKC 2JY6A 1Q3LA 2WB1B 1XXGA 5IKCM 3FPPA 4FVMA 2J7ZA 2G45B 5C23A 1O80A 2ZT9C 3AV8A 4HK2A 5I4DA 3I4OA 4IW0A 2M19A 1I4RA 2NVUI 3CMAA 1FRDA 2PCFB 1FGBD 3J81E 1TIFA 3C3LA 1QNKA 1WR1A 4S17A 2OTLA 2LFIA 2AQ2B 5JJKA 4APVA 2C9WB 4B3RL 1VZ6A 1L6UA 2A6HD 1K83B 4I6LB 3ZDMC 1KOTA 1B70B 3TBLD 1FNVA 4P71A 3A9KB 2AHOB 4XTCS 4A3KB 2IO0B 1KAAA 3FHWA 3GB1A 3T1YL 4WJQA 4ULLA 4AYBB 3RNUA 1AYFA 5FJ8G 3CQZB 1XNQL 2DZJA 4HSPA 4JL9A 5HGTA 3DQVA 3DHGC 3F1ZA 2KQSA 5C0XJ 1EY0A 1F9SA 4DK3C 3P1MA 3DLLA 2E2IB 1NVID 2Y5PA 5IP4D 2FJ2A 4ZK9B 1HEZE 3CWIA 4HPLB 1JJGA 2FINB 3CC4A 1K8MA 4OL7A 4EQ5A 2UU7A 3N1YC 4L23A 1TWCB 3ICEA 3GTMB 4DV0L 1IHZA 5D14A 4WRDA 4MJSA 1YJNA 4IPGA 3D6CA 3OOCA 3K5MA 4BXXG 2PW7A 1K9MC 2FCNA 2N9LA 3AE9B 3ETRA 3AMZA 1OXXK 3UDIA 4EZKA 3EGRA 4JI2Q 4XX5A 3S1RB 3NS1A 2NN6I 4PS3A 4AJYB 5E4XA 5E6OA 4JI5L 3K5LA 4KHPL 3KOJA 3T13A 3DEOA 1G91A 5IGCA 1YHBA 3K59A 3JVZX 4FJVB 1G51A 1QUQB 2JVCA 2ASBA 1Y1WH 4KVGB 2HE7A 1PFBA 1MG4A 1CHQD 2E8GA 4CDCC 5FLXc 4V190 2IBIB 2X8XX 1H9SA 1KHIA 1D5ZC 3APDA 3GTOB 4GN1A 4DV6L 2R7ZG 1SGHA 2LASA 1WGRA 1A2TA 3DBRB 3WOEA 2UUBQ 4HIMA 3IFWB 4UAIA 5IT9L 2K3UA 3VYSA 5JAVA 3D6WA 1R7SA 2WKCA 3HGBA 1N34L 4K81A 1IBKQ 4KHVA 4GDKA 2BVCA 4W9KA 3BVZA 1MHHE 1HNZL 2NTTA 5CV7A 1WXVA 1A5RA 3KJPA 3W2DA 4HIDA 2KHJA 5FJ8H 1O7YA 3Q3FA 4B0MA 2KVZA 1E0ZA 1P7EA 2A4ZA 2R2OA 4WJNA 4NZLB 2MJ3A 2BDNA 2YU9H 3K0YA 2IHFA 2E2HH 4NXMQ 1N62A 2MO0A 1JWSD 4TQUS 3L2PA 1Q82C 1MSGA 5IGGA 4N58A 2L9HA 2GRIA 3KK7A 3CD6A 1EO6A 2XBBC 4HJKA 4C7ZA 3EROA 1DCZA 4B3SL 2RBMA 1EWYC 3S16H 4MDKE 3JSVA 2Z4HA 1WXMA 2JZPA 4KKIA 2KBNA 1Q7YC 5AJ3L 2KO3A 3G48A 1QJOA 3N30A 3RNFC 1ENCA 5C3EH 4QB4A 1VCBA 1EQTA 4BY1G 1DOYA 4LF7Q 2CKZB 1HR0W 2G4DB 2F3WA 3TS0A 1WGKA 5NUCA 3N32A 1XT9B 4YWKA 3H0GG 2KVRA 4GSWA 5EE0A 5KGUA 4G0NB 1XWEA 1ZEQX 1C79A 1J9OA 1H95A 2CWPA 1EM7A 3S1QH 2DY7A 2BQQA 4L8JA 2O6VB 3BDOA 3V05A 1IGCA 3HOVH 3CXCA 2QF7A 4JI1L 4FDBA 2DJGC 3J81L 4XDDA 2K5QA 5I2YA 1K50A 2R7ZH 3PIO3 1OTRB 2LGYA 3TRZA 1EEID 3AE5B 2OQ0A 3P1HA 1HR0L 1VQKA 4A75A 4L5SA 2MEKA 4U673 3ECIA 1SN8A 3RD4A 1WWTA 2PI2A 2A5UA 2HDEA 2PI2E 2F0VA 2BYVE 4KMUC 1IP9A 3SHLA 3TIXA 2NVXB 1UH6A 4TQ1A 1RFKA 4BBSB 3LB8C 5KNCA 1VCIA 2JU6X 4C4VB 3TBIB 4K1RB 4P74A 2UU9Q 1V49A 4FJZA 1OTCA 3RZOH 5BMHA 2F4IA 4HPMB 2JSOA 5IP7G 1B4OA 2HIXA 4A90A 1N32L 3E9IA 4NB3A 2F0DA 5IODA 3PMFA 1XNRL 5EKKA 2E2JH 3RMKC 3D8GA 2DAJA 4KZ0A 4DHZB 2D2CC 1EFID 3HEJA 1HFNA 2XN9C 2L11A 3OMCA 3LXFA 5H92C 2K52A 5C4JH 3S1NH 3QCAA 4HR7B 3PIOA 4HJ7A 3W9CB 3BYYB 3URYA 1GG3A 2D2QA 1RFAA 4C3HB 1WYDA 1AE2A 1EEFD 3WAPA 3H0GH 5C3XA 1SYEA 3EBEA 4IO9A 1KLVA 4LF5L 4H0LC 1TT5B 4MSQB 4C3IG 4RGNA 4FNFA 4K2KA 5HY6A 1OXVA 3H3VC 2JEBI 2M9VA 2LMCB 1GC6A 2RDHA 2WXPA 2PQEA 3KF6A 5M3MG 1G6ZA 1C4QA 5CHWA 1H9KA 2L5TA 3HK0A 1RL2A 3F8TA 4ID6A 2JA6H 4KKSA 1STGA 2B8FA 2VQEQ 2KHSA 3HRZC 5TR5A 5HHDG 2WAQB 1RCVD 4REZA 4A3DB 2B8GA 2I0QA 3A5UA 5C3JB 1VQ6A 4K5XA 3CKIB 3IAS1 1R9TH 3NUCA 1F9PA 1GB1A 1EFWA 1VD2A 2CJOA 3L3OC 1WJJA 3VR3A 4BBRB 4JI7Q 1XMQQ 1NENB 1XJVA 4JPBW 1Z2MA 5JZEB 4L2YA 3DM1A 1BOSA 1GHJA 1JRUA 3PREA 3LWEA 2CH4W 4GKKQ 5CBEE 1WZ3A 1TWGB 2XRSD 5IP7H 1HNXQ 1PFDA 5C44G 1YHAA 3RZFA 3E9HA 3ZKJC 3T3NA 4Y52H 4B0EA 4IWOA 1SNQA 3K5NA 1I3QB 4A93H 3MJ5A 3U7DA 2R93B 2VZKB 3E0EA 4GNXC 3PUYA 2KEDA 5FOBB 3GV3A 3QB3A 4DFAA 1H9JA 2PQAB 1WI0A 3FDTA 5M3FB 5M5XH 1LXDA 4OVZA 1LABA 3S2HH 5E6PA 4C80A 3T53B 4MH0E 4LDTD 4BS9A 1I4QA 2EYJA 1WY8A 4DXGA 5IT9c 3GTPH 3S2DH 1CUKA 4C3IH 5HGQA 4DR3L 1JJ2A 2BS2B 2MBHA 2A1AA 2YEPB 3PUWA 3W1GA 1HA6A 3NJTA 5GXGB 3ND9A 4UDUC 3MFYA 2BGFA 3AE8B 1DD2A 2I38A 1S5DD 4ZUIA 4DV4L 3KBXA 3HKZG 4GDLB 2W9NA 4NY0A 3S14H 2ZXOA 4YTMB 1DOMA 4E6IA 2PVOD 5BN3A 4FYDA 2BA1A 1E7VA 3M4OB 2ZZPB 1HA5A 2DNCA 2G4SA 2Y3AA 2ZEQA 1IBML 1F9JA 4NNJB 3QJZA 2MRPA 5T1IA 1YNNC 3A5ZB 2UUAQ 2O2LD 1V2YA 2EVBA 1A3VA 2MFIA 3R7QA 1UEAB 3WA0A 2Z0SA 1FCCC 4CDFC 1FXIA 1SYGA 5C44H 2IO2B 2F0MA 4UP7A 4JI0Q 3AU5A 3ML8A 1UNSA 3DBRI 3RZDB 4OZBA 2L52A 2NB0A 3GZNB 1BUIC 2MQHA 4DXFA 2RPVA 3CSTA 4NAWB 2BKFA 3DHQA 4W9JA 3SK6A 1KIXA 2RA4A 2CU3A 1F0ZA 1IL8A 3G6EA 3J81c 2GBNA 1JE4A 4B3TL 3OW7A 4RCOA 3EQLC 3GTLB 4KV2A 4X62Q 1K8OA 4QUFA 5ELEA 2C7HA 3PGZA 4MM3B 1TZ1A 4ME3A 2Z0DB 5IO9A 3VQIA 2F0OA 3Q3MC 3RLNA 3ZXRA 1ZW7A 2VL6A 1K52A 3UI3A 1V86A 1YQ3B 1TWHH 3A74A 2HD3A 5AZFA 2L4NA 1P9DU 2FIDA 4GKJQ 2KEEA 3D31A 5CHVC 4GMVA 2KWVB 1PH7A 5CX3A 4DV7L 2KVMA 1FNUA 1H9SB 1VDZA 1WOCA 2KCMA 3CRLC 3KVFB 1J6QA 1SEBD 1IBXB 2DZMA 2MHVA 3HZXA 1UD7A 1E22A 2WXNA 2YV5A 3FVQA 5CTRC 5JEAG 3RN5A 2NBVB 1Y8PB 1XCQL 1C9FA 4JI7L 1R4MI 3WALA 2P5ZX 1QZGA 1S3OA 2K4KA 2F0PA 1A63A 4OX9L 3GTQB 1C4CA 2C7NB 4A3MG 5IOCA 2JQOA 5ELDA 3IVFA 3CCJA 4GDKB 2WXGA 1GUOA 3W1YA 4KY5A 5IAAC 4B08A 2WXJA 3GTJB 3Q3OC 1EY6A 2KECA 3BS1A 1FYCA 1KDAA 4BVUC 2VUMG 2D3BA 5D7GA 1O7ZA 4BA2I 3RNCC 1WXSA 1SNOA 2L3ZA 3QA8A 1YNND 4DKAC 4ME5A 3CF6E 2XIWA 5FR3A 5G3LF 1EIHA 3MP9A 2I5MX 2KK8A 5BN5A 3P4RB 2JA9A 4HAEA 2KDBA 2ICEC 3VH3B 4E71A 4OZAA 3STBC 1I6HB 4X64Q 2L00B 4WORA 3GV6A 4IM2A 5COYA 5JJLA 4DHJB 5C6AA 1STNA 5IGBA 1SSOA 1EUVB 1TZOA 3ZVVA 2N8NA 2BWES 5J3BA 3KWVA 1SNDA 5GMVA 4MGIE 1FCLA 3MHBA 2Y5BB 4KKJA 4LLGM 1EOVA 1C3TA 1E2WA 1WTPA 2KC1A 3AEGB 1T0SC 1VQ5A 3BYTB 2BH2A 1N5WA 5CHFA 1CKOA 1FPYA 3IAYA 2RCNA 4C2MH 2LY7A 2GOWA 3I4MB 1XQQA 1EIFA 2CKHB 5LMNW 3H3VH 3U8ZA 2V3NA 3HOZB 3VAWA 1EYGA 3U58A 2WDTB 3NBIA 4JVZA 3U4VA 3L0OA 1OO9B 2WB1E 2Y0SB 4EX5A 5IGEA 2W3SA 4DR4Q 3QIAA 3CIRB 3DWMA 3GS2A 3HUIA 3KW5B 1XMOL 4HEA1 3RCZA 4B9XA 2J0JA 4DR6Q 2K75A 5DPTA 5I6YA 4M8AA 1MBYA 5AUKA 1DGSA 3PIP3 5JVH3 4G7ZC 1J5EL 2HTME 4LK1C 5LLIA 1ENAA 4BWGB 3S17B 4HKQA 1FD6A 2AEHA 2JPHA 1DJRD 2N0SB 5LMNL 1LQBA 1JT8A 2NZHA 4AYBE 2O4XA 5CV8A 1PH9A 3RD2A 2L7RA 3HP3A 3FPUB 4HCSA 3CCLA 1MI0A 3AE4B 2IW3A 2CCZA 2NZOA 1BCPF 3A8IE 2BS3B 3FC4A 4AP4C 3AECB 3PZ7A 1PYBA 2MPMA 4RKBA 3MEFA 3L08A 1GJZA 3PRPB 4LUOA 4NXNQ 2MHJA 2KLCA 1QWYA 1VQLA 3LNNA 1LT4D 4ZKCB 1NJIC 1YQ4B 3GP7A 3A7LA 1YJ9A 1L0YB 3I4NG 1QQRA 2PNHA 1RAXA 5D6JB 1SMXA 2ONQA 2VRRB 4DUYQ 1GUNA 2B2TC 5IYBG 3Q8DA 1JB3A 3STBD 2M17A 1VQMA 4MNOA 3K7AH 2W54A 3TL5A 2R6GA 3FRPB 1EZ8A 1X3FA 1NMGA 2CWAA 4ILWA 2K6QA 1LV9A 1VQDA 3OMGA 2KHIA 2IY5B 5KYIA 2KD0A 2WX1A 1WF9A 4MHEA 4KGSA 1SAPA 1TXYA 4R8IA 4DUZQ 1SXTA 2K5WA 4J6HA 1ACCA 3L4PA 4A3LG 3Q8AA 2LXKA 2L15A 5JHBA 4JC0A 1CTMA 2D5DA 1M8AA 2A5HA 2BYEA 1I4PA 3KLSA 3QQ8B 3ZRFA 5EPKA 1MVKA 4BKSD 1HPCA 4IFDG 4RG1A 3HOXH 1YNXA 1QZHA 2WQYB 3UDGA 1WYGA 2EXZA 1PHJA 2M0AA 3NUHB 5M5YH 2DJFC 1J8IA 2F0IA 4W9IA 4F88A 3G71A 3NPPA 2V4IB 3P4QB 1HTQA 4DV1Q 4JOIC 3TS2A 1IYJB 4AQYQ 1EU3A 1KABA 3Q24A 2RKSA 3AE6B 2E5LQ 2M0XA 1VF7A 4PYZA 3EFXD 1FMAD 5CBAE 1U4AA 2EY5A 3R93A 4HJ8A 2LGIA 2TMPA 4RKLA 1IKMA 1NBFC 1OQRA 3BZKA 2K14A 4RCNA 3DHIC 1CSPA 2Z6KC 3PSIA 4A3FH 2PJHA 5HG2A 2KLGA 3I4NH 3CAMA 3TEHB 3AB5A 4I7AA 5EDSA 1SF0A 1LO5D 4TQ0A 5IYBH 3R66C
chains in the Genus database with same CATH topology
3RPFC 1SMYC 5DM73 2QIEB 2ZW0A 4H7BA 1QF6A 2JA7B 5HI1A 2EYMA 1VZ7A 1RHPA 1GUGA 1CHPD 1RM6C 4CJ0B 2HDMA 2DWQA 2NUCA 4A3GB 1F2RI 3T3OA 2PPBC 3ZYYX 4YTPB 1C48A 4OO1I 1UUPA 4IFDH 2N55A 3OHXC 2F03A 2K33A 4ZLTF 2W55A 2WDVB 1J7CA 3NTIA 1Z6HA 1RTOA 1DM0B 3X3NA 3VR4A 1KFYB 2MH7A 5G5HA 1QOBA 3U4EG 2H1EA 2KACA 4K2LA 4QUCA 1TS4A 2PMVA 3MA2B 4ZRZA 4YSYB 1QILA 4NAMA 1A15A 1FR3A 3NVVA 5C0XG 2B2YC 5KRUA 1SDFA 1YN5A 4WH4A 1OXSC 1NR4A 2RVLA 1EQVA 2X6GA 1ILQA 4HMJA 1JWBD 2I2YA 3I57A 5J39A 4LK0M 2DY8A 2LHEA 1Q1EA 2B63B 4WJWA 1GAQB 1LTGD 4AS1A 1GPXA 1E2ZA 5MPOA 2F0HA 1CM9A 1LTTD 2IGGA 4FXDA 2DYOA 1VF5C 5LL6X 2BYTA 2FMCA 2LKVA 1ZXIA 3B9JA 4A3EB 2PZTA 1HRJA 4DF7A 4RH6A 1SJHD 2H89B 3VRAB 2JA8B 3N6RA 4C3JB 1JWAD 1IW7C 1RF2D 1PLFA 1LTBD 3S1MB 3RLFA 5C0XH 2F0QA 2F0NA 3NTHA 5C2TB 5D3DA 5JOBA 3AEDB 5C5LA 3H09A 3ZJTA 3PO3B 3SVMA 1DZ1A 1BMLC 3QOLA 3FKIB 4YWGG 2C9OA 2K0PA 1I50B 1F9RA 4CHTB 2XWBB 4TKOB 2F0SA 3WDNA 3IXSA 4PQXA 1FD7D 2MGSA 2PW5A 1HZ5A 3IFTA 2N7JA 2ID0A 1C77A 4N59A 4IUVA 1EYAA 1WVLA 3P42A 2F0UA 2BS4B 3BVMA 5AUIA 2B2VA 3AB9A 4RF0A 1WTXA 1OQQA 1TS3A 3D3RA 1D4BA 3I73A 1RJTA 4HMIA 3IT4B 1TWAB 1GXDC 3FILB 4XIGS 1HZ6A 2QCPX 3MFGA 5BN4A 1PTOF 3SR1A 2JP1A 5DNFA 5FO9B 3D4DA 3M7NA 3Q22A 3AEFB 2WV6D 3EVQA 3ZJUA 3P20A 1VJKA 2O5JC 4KJOA 1K53A 3W1SA 4XT3B 3V96A 2IX3A 2J4XA 1IBXA 1QOGA 1XCTL 4ZHPA 1XO3A 5EQ0A 1QB5D 3Q8CA 4MIUA 1U4PA 3Q8EA 3E0JA 2K6AA 4IZ8A 4JBWA 3Q23A 3NWTA 3OWEB 3MC0B 2FUG1 1OXUA 1NUCA 2FMMA 1BCPB 5CYUA 3TEXA 4EQPA 2DNEA 1HQMC 1SBBB 2VXWA 1JWMD 1JROA 1D5XC 3A56A 1KDBA 1XX8A 4N6EB 3H94A 5CC4A 1EY4A 4G57A 3J7YW 2DYMA 2E2HB 5C5MA 3U52E 4Q0FA 2H88B 1Y8NB 4ZRPA 1Z47A 5C4HA 4KKTA 4R3DA 3TP6A 1SE3A 3BK2A 3VR9B 3PUZA 2SDFA 2EDGA 3V2TA 2LFNA 1BO0A 5A2QE 1JW9D 3CHBD 1XLOA 2JX5A 3E5SA 3QG1A 2JXTA 1ENFA 4HEDA 2WXQA 2XVSA 1TY0A 2GB1A 1TS5A 1CZPA 1B9RA 3AMUA 4CQNA 1STEA 2N88A 3A7AB 2PW9A 3E6ZX 5JVG3 5BYQA 4A55A 1SNCA 2OXPA 1JC7A 4EQNA 4I7ZC 2JEAI 2G1EA 1GJXA 4XDXA 1IYVA 2JQRB 1TKEA 2E2JB 3I70A 3C1EA 3VR6A 1UAPA 5I9OA 4XWTA 1H9RA 4C7YA 4K6LA 2CQAA 4BY1B 4KX6B 5EKIA 2K01A 4BA1I 2NMQA 3C1FA 1G8ZD 1KH0A 4LTUA 5I9PA 1NCVA 1VMPA 4DU9A 3RFZB 3O13A 1AFPA 3TEYA 4YTNB 1DOLA 1PXUA 5IGFA 2WLBA 3ABVB 1QE6A 1KF6B 3DXJC 5J1ZA 4H13C 2B2UA 1NYQA 4USAA 4K6DA 3L9AX 3W3AA 3U9SA 1TS2A 4FF4A 4DAVA 1HHVA 2JXMB 4R8NA 5I6WA 1PGAA 2EY2A 4DQOC 1YJJA 3K57A 2LJIA 2OT2A 5A2QL 4A9AA 2E3TA 4HROA 2L12A 3NE5B 3KLSX 3D4RA 4H2AA 1B2TA 1JRPA 1DOXA 4ZAIA 1DXMA 2IGDA 4P2CB 3GTPB 3S9WA 1XLPA 4C3IB 3GQBA 4KJNA 4FF2A 4ARCA 1PRTF 2E6XA 2IX0A 2AUKA 5M3MB 3D4WA 4OGQC 4K8IA 4PMCA 2V4DA 3QWNA 2BOSA 2L83A 3TDQA 1WTRA 1LACA 4Q5VA 4DNTB 1MGSA 1N63A 4XT1B 5EE9A 4IUUA 1RODA 1GUWA 1P7FA 4Z9CB 1C76A 4YSZB 4NMZA 1SYCA 1CQFA 4A3IB 3KLRA 4KK7A 1VZ8A 4A6QA 4ABNA 4JE3B 2WKDA 3MEHA 4F8MA 1M4VA 2ACZB 1PFMA 3AE1B 2LUMA 3TZDA 5E4WC 4RWSC 4RNAA 2V0GA 4P16A 1B1ZA 2LEKA 3DWAA 3DEPA 1Q8IA 1GB4A 2H4OA 1SYDA 3SK5A 4RHRA 1WCMB 2BT6A 1VDVA 5M5WB 4MACA 1JQYD 2KAJA 3HKZB 4OO1H 4ZUJA 4WQMA 2XSCA 2NVQB 3A8KE 4ZKBB 2WACA 5KIXA 1N61A 3MAQA 1LLRD 1F2YA 4K5WA 3T51B 5A35A 1K51A 1PTOB 4CKEA 4EVOA 3EUB2 4FP5D 4Y7NB 3IT6B 2NVYB 1BUVT 2NWGA 1XYIA 1E2VA 3EJIA 4PMBA 1GOZA 2JWUA 4JK1C 4TRDA 1KRHA 2D62A 4CGYB 1KNAA 2IWHA 1EWCA 4RHSA 4J3OD 1TWFB 1QOHA 4ITKA 4J8QA 1AWDA 1ZPSA 2AQ3B 1L4DB 4NP5A 2QKIC 2SAKA 1OFFA 3UI2A 1ML0D 5CGKA 1TKGA 2RSOA 4KN7C 3W5VB 4CJ1B 2SOBA 4N9PA 2WP8J 3Q0AA 1B9NA 1BQQT 4KY7A 1SNPA 4XQJA 4M0WA 4WURA 1HUNA 2OEDA 2O5IC 4A3MB 2F0EA 1FFUA 5H8YE 1YN4A 1C8CA 2QDBA 3TUOA 1MHXA 3VA5A 5IIFA 1YN3A 1QCBD 2KWDA 1R4QB 1CJEA 3R2IA 4WAFA 1VLBA 1DONA 3LX0A 1PUTA 2VUMB 2KQ4X 1F2LA 1SE2A 3FILA 3VR2A 3OWFA 3J7AV 4PT5A 3NQIA 3TP7A 2CJNA 1GHKA 3AEBB 1R4PB 5FK9C 2EYPA 4XYOA 3PZ8A 2L32A 3HOUB 3P63A 2AWNA 5CV6A 5K5PA 1VR9A 1DGJA 3P7JA 2NN6G 2TSSA 3AE2B 3PO0A 4WWMA 1A3UA 2EY6A 3KQ4A 1LTRD 1NI3A 3HOWB 4XQNA 2PNRC 2JYOA 2PTLA 3SEBA 4FO2A 1BDOA 3RMHA 5C3WA 1JOQA 4XWWA 3NWSA 1O7LA 5LHY1 2IDYA 3TEZA 5ELBA 2PYKA 1NR2A 1V8QA 4F87A 1E10A 5CMDA 3OIPA 3HVDA 4JWUC 3Q6SA 5EBCA 4LJZC 1HTLD 3TP8A 1XF5L 3I90A 4HKZE 4KGRA 4G4KA 1JICA 2RQXA 1WXQA 2E2DC 1ESFA 1CK1A 2Q8RE 2R92B 1TKWB 5IGDA 2K5PA 4DAYA 3TMEA 1W6KA 4O1NA 2WU5B 2F0JA 1CZGA 3GTKB 2KQ3A 4CJ2C 2W82A 2NN6H 1T5EA 3DUZA 3I4NB 2EYOA 3AU7A 2XNAC 1B53A 1ZXTA 4F7XA 2WXLA 2WXKA 3SFEB 5DM63 1Y56A 1YMHE 2JE6I 3M85A 3MXPA 1SFOB 4FXKC 4M1UB 3VYUA 1LT3D 3BWUD 3N52A 3ZJVA 1V97A 4GZYC 4JX1C 3I4LA 2INPE 4C56C 1VRAB 3FEWX 3VA7A 1J7AA 3BDLA 2J53A 2I46A 2F0WA 4DNRB 3T16A 3IFDA 1UWXA 3P4PB 1SYBA 1FM0D 5KEEA 4A8XC 2PLPA 3VRBB 3NRZA 2J0TD 1BNZA 1BCPC 3PUVA 1V1PB 5KNDA 4ZQ3A 2C5CA 4KD3A 3WOFA 4YXDB 1FRRA 2NBFA 1EWHA 2ZXPA 2EELA 4L1BA 1Q90A 2HCIA 3JAME 1MSHA 4US9A 1PRTB 3PUXA 1MD2D 1S5ED 1ZDXA 2NVTB 4DN4M 4OW0A 2PVGC 5T8IA 3BDCA 4NW2A 2Q8TA 3C2PA 1SMYD 1HFGA 2G9DA 2RDGA 1A2UA 2QJLA 4AQ7A 1FIQA 3SDZA 1MI2A 2EYFA 1T3QA 3BK1A 4PV1C 1L6VA 2EOTA 4O42A 2AX5A 3MXUA 3H8HA 4NJCA 2AUJD 3ONAB 4FXGC 3HOYB 3I91A 2Q5WD 2HDLA 2YEPF 3SXHA 4MT5A 1EY9A 4K8JA 1A6XA 1EU4A 2ICIA 4NKLA 1QT9A 2BA0A 4GLSC 4US8A 4DA2A 2VB2X 4HSVA 1HTPA 4KY6A 2JA5B 4S3SA 3M3YB 1Z7TA 3MHZA 1U4RA 4KV6A 2KMMA 1Q1BA 4IURA 2WIIB 1SB3C 2SEBD 5JXVA 3MZ5A 4OHJA 1A70A 3NK9A 3I9V1 4XQQA 1N5XA 1QG7A 4MN3A 5G5GA 2IL8A 5BMIA 2Z1CA 2WXIA 4CKBA 2X6LA 2JSVX 1FFVA 4P6VF 2QMTA 2DN8A 3E9SA 3R2TA 4X3TA 3PO2B 5C4XB 1JALA 4RGMA 3J80L 2HCCA 2AWOA 2WP9B 1U9RA 2K32A 3CU7A 3MTSA 3OSOA 3A54A 3VYRA 4HTHA 1II3A 2WXOA 1EOTA 4I65A 1GUSA 1WD0A 1GUTA 5DEHA 1HQRD 3VR8B 1PZKD 1BXTA 3KWLA 5AFWA 4KHZA 5KNBA 4X3KA 3JAML 2ON8A 4XYQA 3P75A 3AN1A 5CV9A 1V8CA 2AQ1B 2BW2A 1IW7D 2E74C 1B44D 4WIPA 2QEJC 3V3XA 2RSNA 1F9QA 1EIGA 1C4PA 1JMLA 4DK0A 5M9OA 3SFDB 1X32A 3TSSA 3E56A 1PYWD 2XWJB 1TJEA 1L5PA 4JWSC 1RKNA 2B76B 2EKIA 1Y1WB 5FO7B 4LMQD 1LTID 1XEEA 3IKJA 4ARIA 3QO2A 1VMCA 2WXRA 1SE4A 3GO5A 4HN7A 2LS01 1FO4A 1EZ6A 2F3VA 2D5GA 2L1BA 1L4ZB 2K04A 1J7BA 2EPBA 3M4YA 4ZOHC 3J7AF 1SSNA 2YYZA 3I3CA 2B2VC 2YU9B 4IFDI 2RMMA 2WS3B 1STYA 3BZDB 4KGTA 2MUYA 2KCNA 2L55A 3S16B 2LHDA 5CR3A 2XRQD 1ILPA 2BB5A 1IYUA 1CZWA 3U2SC 5C3EB 1SIJA 1ET9A 3R8BA 2EZVA 1T5XD 1I6VC 3I72A 1F2RC 5D65A 2PKOA 2J52A 1KLUD 1TIID 1BF4A 2VZKD 3H6MA 2F0FA 3NTKA 5EBDA 1EY5A 1W6JA 3S1QB 3QOJA 3OIQA 1BBXC 2L0CA 2IGHA 3NSWA 3HOVB 4C3HG 1CA6A 1JQ4A 3S15B 4HJGE 2R7ZB 4RGTA 2PMZB 2I07B 3G6JB 4XDCA 4L6TB 2SNSA 2EJMA 2KUMA 2Y5CA 3ZQ4A 1B9MA 1S4ZA 1NAPA 1TVXA 1ESRA 1TQOA 4HRSA 1PFNA 4EGVA 4G7HC 3HS0C 1LT5D 5EPJA 1I4HA 3RZOB 4QIWB 3AEEB 2DLBA 3NVYA 2WDRB 1PTOC 1ZP0B 3C8YA 1S5CD 3ERQA 1G2SA 4ZYSA 3WCQA 4ZHOA 2FBWB 1U4LA 5C4JB 3S1NB 2DBYA 1ONLA 1T6BX 1E9MA 5HFYA 1V1OA 1JORA 2WNMA 3H0GB 3DWQA 5E1FA 4IN3A 1TT2A 1Y69U 5C0XI 3NP8A 3PV0A 1V43A 1CA5A 2ZXRA 4RGOS 5LL6S 2JA6B 1TR5A 4FXCA 5F2DA 3H91A 4WFN3 4QCLA 4EE2A 3FMCA 1TY2A 2EJGC 2Z8LA 1R9TB 3R3OA 4CKCA 5I2XA 3B2FA 3LWUA 4OZCA 2FHTA 1XTCD 2K28A 3BVGA 2B2WA 4K5VA 1Y8OB 3K58A 3ITPA 2KN4A 3SE0A 4A93B 1AZQA 2D9UA 1STBA 2M56B 2K03A 1G2TA 3NHHA 5ISRA 4C1NK 1ZXHA 5M5XB 4IUPA 4IDIA 3S2HB 2PZWA 3NQTA 1O78A 3MXNA 1PTOD 3S2DB 2A6EC 1FEHA 2PZUA 4IUQA 3HVZA 2IJ0A 1D2BA 1MPEA 2INNE 2WDQB 3ZGZA 2W3RA 5BYRA 1RD9D 1SNMA 3HG9A 4OO1G 3MWYW 4IUNA 1AEXA 3S14B 1G291 1AZPA 2WXFA 2EYLA 2K9XA 4IALA 2MJ8A 1ZDVA 4KI0A 1EY7A 3HRDD 4A3JB 2B2UC 1ZUD2 1IUEA 1HUMA 5HURA 1SYFA 4MH8A 3DWPA 5C44B 4Q2JA 5BYSA 4KTAA 3DWGC 1V1PA 1E7PB 2A73B 2GI9A 1D5MC 1ET6A 1C78A 2B2WC 1PDXA 2BB6A 3W5UB 3AEAB 3T56B 3J9CA 4HCEA 3ND8A 2A69C 4KKUA 4B9WA 4KD4A 1E0BA 2IT1A 2MP1A 2EJFC 4NDXA 1TWHB 2N9KA 1Q10A 1ICWA 3SK4A 1WD1A 3X3MA 1I4XA 2M2LA 3A55A 1XLNA 1RYJA 4DGZA 1NSNS 2A6ED 2KCCA 2EE1A 4IUTA 5FO8B 1WRIA 1C4AA 2L1AA 3C46A 1NEKB 3L7ZC 2A74C 5T1GA 4X3SA 1KNEA 2BCOA 2MJDA 1ZYRC 1QLBB 1YJIA 4EQOA 2M00A 3NXWA 2FE8A 1WTQA 3G7LA 2JYEA 4N9TA 3Q8FA 4J1MA 1PMRA 2WU2B 4XE0A 1PTOH 2NTSA 4QMGA 2BDOA 2CHBD 1WTVA 2QSDA 4K14A 4L63B 3KBGA 1WTWA 1PZJD 1PRTC 2A69D 2JYTA 4TSSA 2OF1A 1F2MA 2B2TA 4TMAB 2MJEA 1ZKOA 3AE7B 1CFMA 1CQVA 4C2MB 1E6EB 2K22A 3NBHA 1OXTA 3VYTA 2K5DA 2NYZD 5D3IB 4PNYA 5CORA 5C4ZA 5E6JA 4OIJA 1KLGD 2Z4IA 2HUGA 5JEAH 1ZE3D 5DAUA 2IPKD 3B2GA 1N60A 1WSPA 2KA7A 2ZW1A 2K7VA 1JCKB 3NZ3A 1I4GA 2F1MA 3IAM1 1ZYRD 5TSSA 4PMWA 3Q8BA 4R9WA 2EYHA 4RFBA 3EA6A 2BTEA 1PDQA 3IL8A 1ZOYB 2CW0C 3A8JE 2J42A 1YNJC 1H9MA 5ELFA 3SK8A 1UWMA 2GA4B 1LT6D 2F0LA 2KJXA 1EYDA 1KTKA 2PIAA 3KUPA 3K7AB 5FLXE 5BMGA 3GD7A 1DOKA 1B3AA 5JJZA 1A3TA 1HCZA 1LTAD 1AP0A 2BBCA 2G9HD 2KOLA 5LNK1 1TU2B 1EL0A 3NVZA 1CT1D 4OIKA 1XLQA 4RF1A 4ZRQA 3N9YC 2WXMA 4G7OC 1PRTD 4U68A 1S5FD 3QJYA 3TEWA 1STHA 3HOXB 1AN8A 4H44C 5JEAJ 5M5YB 3TP5A 1QNUA 1L0VB 2QILA 5J22A 4CBVA 2EY1A 2RDFA 4DK1A 2PO4A 4V0BA 1STAA 5K36G 3Q69A 3AE3B 3NVWA 4A3FB 3KF8A 1WTOA 4ODGA 1UGJA 2B2YA 2FFKB 3RUZA 2Q8IB 2R3ZA 2SNMA 4IOIE 1S5BD 1TKYA 2B39A 2NZ1D 1SJED 1KDCA 2CW0D 1X3QA 1L0XB 5EE1A 1YNJD 1HXYD 2WINB 4YSXB 3I8ZA 5JPNC 2WXHA 4FF3A 2A68C 1LTSD 4QF4A 2VB3X 1JWUD 3J80E 4RA8A 2BE5C 1F77A 4IKGA 4YIJA 4DAPA 5ELCA 2F0KA 3VR5A 3P4SB 2K1BA 3K6OA 2OEOA 5KYLA 2IX1A 1D6EC 5K36H 1Y1VB 4YT0B 1RTNA 4C3JG 1I7HA 5FLXL 5G3LD 1CI3M 4A3BB 2K05A 4C1NI 2ENBA 3F2UA 3U7ZA 1DYQA 2X69A 1QOAA 5CV5A 4D2KA 1JOKA 3GTGB 3LYYA 2KDMA 1NYRA 1JR0D 1D1KA 4X3UA 1U4MA 1B50A 1X3PA 3SR6A 4RAUC 5EGTA 2LMCA 3AM9A 1EY8A 1QKZA 5EE3A 2OHFA 2A6HC 1RDPD 1IKLA 4KN4C 3TZUA 4IFDJ 2E76C 3CRKC 5JPMC 4XXEA 2CVRA 2F0GA 2A68D 2E75C 1JOOA 3MVVA 1QOFA 1RWSA 1D1IA 2HQEA 1PZID 2BE5D 1DOIA 3BG3A 3DMUA 1ROEA 1BCPD 5IT9E 4FF1A 1AW7A 3BIID 4JPSA 1Q12A 5CV4A 3AH7A 5EJWA 1FNWA 1IGDA 5FKAC 2F0TA 1BR9A 1EYCA 3T4AC 1PGXA 3FAHA 4LAAA 2VNUD 1YNTE 3TN2A 1TYGB 3M7GA 3OPOA 4BY7B 3K5OA 5E3FA 2V3PA 1F2ZA 2R61A 4IQZA 5EKLA 5EPLA 3MXGA 3U9OA 2X38A 1FXAA 1PGBA 1Q3LA 2WB1B 1XXGA 3FPPA 4FVMA 2J7ZA 1O80A 2ZT9C 3AV8A 5I4DA 2M19A 1I4RA 1FRDA 2PCFB 1FGBD 3J81E 3C3LA 1QNKA 2LFIA 2AQ2B 1VZ6A 1L6UA 2A6HD 1K83B 1FNVA 3GB1A 3NUHB 4XTCS 4A3KB 1KAAA 4ULLA 4AYBB 1AYFA 3CQZB 4HSPA 5HGTA 5C0XJ 1EY0A 1F9SA 3P1MA 2E2IB 1NVID 2Y5PA 2FJ2A 4ZK9B 1HEZE 3CWIA 2FINB 1K8MA 4OL7A 4L23A 1TWCB 3GTMB 1IHZA 5D14A 4WRDA 3K5MA 3D6CA 3OOCA 2N9LA 2PW7A 3AE9B 3ETRA 3AMZA 1OXXK 3EGRA 3S1RB 3NS1A 2NN6I 5E4XA 3K5LA 3T13A 3DEOA 1G91A 5IGCA 3K59A 1PFBA 1CHQD 4V190 1H9SA 1D5ZC 3GTOB 1A2TA 3WOEA 4UAIA 5IT9L 2K3UA 3VYSA 5JAVA 3D6WA 1R7SA 2WKCA 3HGBA 4KHVA 3BVZA 1MHHE 2NTTA 5CV7A 3W2DA 1O7YA 4B0MA 1E0ZA 1P7EA 4NZLB 2MJ3A 2BDNA 3K0YA 1N62A 1JWSD 4TQUS 1MSGA 5IGGA 4N58A 2L9HA 2GRIA 3KK7A 4C7ZA 3EROA 1DCZA 2RBMA 1EWYC 2Z4HA 2JZPA 4KKIA 1QJOA 1ENCA 4QB4A 1EQTA 1DOYA 2F3WA 1WGKA 5NUCA 5EE0A 5KGUA 1XWEA 1ZEQX 1C79A 1J9OA 1EM7A 2DY7A 4L8JA 3BDOA 3V05A 1IGCA 2QF7A 3J81L 4XDDA 2K5QA 5I2YA 1K50A 3PIO3 1EEID 3AE5B 3P1HA 2MEKA 4U673 3RD4A 1WWTA 2HDEA 2F0VA 4KMUC 3SHLA 2NVXB 4TQ1A 1RFKA 4BBSB 3LB8C 5KNCA 1VCIA 2JU6X 3TBIB 5BMHA 2F4IA 2JSOA 1B4OA 4A90A 5IODA 2F0DA 3PMFA 5EKKA 3D8GA 2D2CC 1EFID 3HEJA 1HFNA 2XN9C 2L11A 3OMCA 3LXFA 5H92C 4HR7B 3W9CB 3BYYB 3URYA 4C3HB 1EEFD 5C3XA 1SYEA 4H0LC 4C3IG 4RGNA 4FNFA 4K2KA 1OXVA 3H3VC 2JEBI 2M9VA 2LMCB 2RDHA 2WXPA 2PQEA 1G6ZA 1C4QA 1H9KA 2L5TA 4ID6A 4KKSA 1STGA 2B8FA 2KHSA 3HRZC 5HHDG 2WAQB 1RCVD 4REZA 4A3DB 2B8GA 5C3JB 4K5XA 3CKIB 3IAS1 3NUCA 1F9PA 1GB1A 2CJOA 3L3OC 3VR3A 4BBRB 1NENB 4L2YA 3DM1A 1BOSA 1GHJA 3LWEA 5CBEE 1TWGB 2XRSD 1PFDA 3T3NA 4B0EA 1SNQA 3K5NA 1I3QB 3MJ5A 2R93B 2VZKB 3PUYA 2KEDA 5FOBB 3GV3A 3QB3A 4DFAA 1H9JA 3FDTA 5M3FB 4OVZA 4C80A 1LABA 3T53B 4BS9A 1I4QA 2EYJA 4DXGA 2BS2B 2YEPB 3PUWA 1HA6A 5GXGB 3ND9A 4UDUC 3MFYA 3AE8B 1DD2A 2I38A 1S5DD 4ZUIA 3KBXA 4GDLB 2ZXOA 4YTMB 1DOMA 4E6IA 2PVOD 5BN3A 4FYDA 2BA1A 3M4OB 1HA5A 2DNCA 2Y3AA 5T1IA 1YNNC 2O2LD 2EVBA 1A3VA 1UEAB 1FCCC 1FXIA 1SYGA 2F0MA 1UNSA 3RZDB 4OZBA 2L52A 2NB0A 1BUIC 4DXFA 4NAWB 2RPVA 3DHQA 1F0ZA 3SK6A 2CU3A 2RA4A 1IL8A 1JE4A 3OW7A 4RCOA 3EQLC 3GTLB 1K8OA 4QUFA 5ELEA 4MM3B 3VQIA 2F0OA 1K52A 3UI3A 1YQ3B 2L4NA 2KEEA 3D31A 2KVMA 1FNUA 1H9SB 1VDZA 3CRLC 1SEBD 1IBXB 2MHVA 3HZXA 2WXNA 3FVQA 5JEAG 1Y8PB 1XCQL 1C9FA 2F0PA 1C4CA 3GTQB 5IOCA 5ELDA 4GDKB 2WXGA 1GUOA 4KY5A 4B08A 2WXJA 3GTJB 1EY6A 2KECA 3BS1A 1FYCA 1KDAA 5D7GA 1O7ZA 4BA2I 1SNOA 1YNND 4ME5A 5FR3A 2XIWA 5G3LF 1EIHA 3MP9A 5BN5A 3P4RB 4HAEA 2ICEC 4OZAA 1I6HB 4WORA 3GV6A 5COYA 5C6AA 1STNA 5IGBA 1SSOA 1TZOA 3KWVA 1SNDA 1FCLA 3MHBA 4KKJA 4LLGM 1E2WA 1WTPA 3AEGB 3BYTB 1N5WA 3IAYA 2LY7A 3I4MB 2V3NA 3HOZB 3NBIA 1OO9B 2Y0SB 5IGEA 2W3SA 3HUIA 3GS2A 3QIAA 3CIRB 3DWMA 4HEA1 4B9XA 5I6YA 4M8AA 1MBYA 5AUKA 3PIP3 5JVH3 4G7ZC 2HTME 4LK1C 1ENAA 4BWGB 3S17B 4HKQA 1FD6A 1DJRD 2N0SB 2O4XA 5CV8A 3HP3A 3FPUB 4HCSA 1MI0A 3AE4B 2IW3A 1BCPF 3A8IE 2BS3B 3FC4A 3AECB 3PZ7A 2MPMA 4RKBA 1QWYA 1LT4D 3LNNA 4ZKCB 1YQ4B 3GP7A 3A7LA 1L0YB 1QQRA 2ONQA