3KLWA

Crystal structure of primosomal replication protein n from bordetella pertussis. northeast structural genomics consortium target ber132.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of primosomal replication protein n from Bordetella pertussis. northeast structural genomics consortium target ber132.
rcsb
source organism Bordetella pertussis
molecule tags Dna binding protein
total genus 13
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3klwA00
2UUBL 4BBRH 1KXLA 2LXJA 1VQ6A 1HNWQ 2E5LQ 1W3SA 3GTLH 4JI2Q 3PF4A 4IOAA 1QVCA 3PUYA 4LFCL 2BH2A 4OONA 5M3FH 4DAYB 2JQOA 4DV4L 1XMQQ 1SN8A 3CCMA 5IWAQ 1Q46A 2R6GA 3IRBA 1PYBA 2ZJPA 3J80i 4A3MG 1B70B 2YTYA 2UUCL 3E9IA 1VQ5A 2ASBA 1K8AC 2IHEA 1I3QH 1LM0A 2R93H 3A5UA 4TVAB 1N33Q 3KFUA 2E8GA 5C3EG 4AIMA 3GD7A 1PH8A 4LF9Q 4RG1A 3EN2A 1HR0L 1B8AA 3M3YH 2D0PA 3CAMA 4JI7L 4BXXH 3W5OA 4YHHL 1M90C 2I5MX 3HOUG 4DR2L 4R4OA 4R4IA 4P71A 1UWVA 3H0GH 4AH6A 5IT9c 4HIKA 3OTOQ 4A3EH 4A3BH 1HZ9A 1AE2A 1KAWA 2ES2A 4A3GG 3B6YA 2HHHQ 3HKZG 2JA5H 3W1BA 3L7ZC 2EXDA 2PMZE 4B3SQ 4IPHA 3GTOH 3I4NH 3KOJA 1A8VA 3PV0A 1Q12A 1WYDA 5IYCH 1XPRA 4YY3Q 2KCTA 5M5WH 4YCVA 4J15A 3WWVA 3M4PA 4HJ5A 1LTLA 4UPAA 3RZOH 1VQNA 4IPCA 1UE5A 4C3IH 4JI6Q 1YJNA 1YEZA 1I94L 4LF8L 1TWHH 2D62A 4GKKQ 3I4MH 1OXSC 3CC2A 1X6OA 2OTJA 5BR8Q 2GVBA 4DR1L 1Q86C 4TQUS 1QZHA 1VQDA 2DGYA 2UUAQ 4JI4L 4H02A 1PH9A 2OTLA 1CUKA 4LUZA 2ZM6Q 4A3KG 1VQLA 1MJCA 3PSIA 2Z6KA 3FKIH 4R1JA 2MO0A 1HNXQ 1VQ4A 5J3BA 2HIXA 2Y0SE 1VCIA 3PUXA 2WAQE 3PUZA 4YCUA 4GKJQ 1AH9A 2PQAB 1X3FA 4LFAL 1PH2A 3PF5A 1BVSA 4QY7A 1K9MC 1I5FA 2JA6G 3ERSX 5IP7H 1IXRA 4IJHA 1XJVA 2R7FA 4KLKA 1YVCA 2IX0A 2F52A 2K75A 3GO5A 4DUZQ 1U0LA 3J7ZC 4A93H 4LNQA 4JG2A 3KF6B 1K83H 2ZTCA 4JOIA 1NMFA 2CCZA 2YU9H 3KF6A 2IX1A 1L1OB 2NVYH 3S1RH 5AJ3Q 1X55A 4AYBE 2CFMA 2HT1A 2KHIA 4JI5Q 4OXPA 4X6AH 4B3MQ 2AWOA 1Y1WG 1JJCB 4OWTB 3CCVA 5JJLA 1TXYA 5JEAJ 4QGUA 4A3IH 1E1TA 1VQ8A 4GNXC 2VUMG 3M4OH 4LF4Q 1PFSA 3A74A 4C3HH 4L5RC 4P74A 5IYDG 2MO1A 4JV5Q 3G6EA 4JI8L 1NMGA 2UU9Q 4JBWA 3A0JA 3HOZG 1HNZL 1E22A 3KLWA 5HY6A 3ULPA 2OWOA 3GTMH 1WCMG 3RLOA 1GM5A 4KI0A 3MXNB 3HOVH 3CPFA 1CKNA 2YTVA 4IFDJ 4DV0Q 4BBSH 3CC7A 2K5VA 1N36Q 3M9BA 3HOWH 1G6PA 3JAMi 3EIVA 2NZHA 2MNAA 3S24A 1E24A 4GS3A 2NZOA 4A4IA 1IBMQ 5FLMH 1J5EL 1V1QA 2CWAA 1K73C 1V43A 4DV2Q 4P75A 5LMNW 4DUYQ 1JJ2A 4LFBL 2CWPA 4R4TA 1Y1VH 1RIPA 2AWNA 3H3VI 3CD6A 2K52A 3M7NA 4BA2I 2KHJA 4LUOA 4DR4Q 2JEBI 1SMXA 2VQFQ 4X65Q 1X3EA 1IBLL 2E2HH 3M4QA 2UXDQ 3D0FA 1CSPA 5H1SE 1IBKQ 1XNQQ 2H5XA 3G4SA 2JA7H 4HJ9A 5LMNQ 1HNWL 4EQ5A 2NN6I 4GLAC 3F2BA 5FJ8G 1DGSA 1UE1A 2E5LL 3UDIA 4JI2L 4A3CG 4GN3B 1EOVA 2NVTH 3CF5A 1ASZA 1XMQL 1L2FA 3PO3G 1HJPA 5IWAL 1PYSB 1C0AA 4JI4Q 2WFWA 3L0OA 3PGZA 3TQYA 1V9PA 3UDFA 2ZJQA 5GAGC 1QVFA 4JC0A 3K0XA 4A3LG 3L2PA 1L0WA 4GOPC 5M5XH 1N33L 2BA0A 3M85A 4IFDI 3NELA 4LF7Q 4O2DA 1JB7A 4LF9L 1JT8A 3F2CA 1NBWA 4JBMA 4A3MH 4AYBG 1C7YA 4DV7Q 3STBD 1Y14B 3ICEA 2R92G 2AKWB 4GNXB 5IYBG 3S2DH 2B63G 3PUVA 4JOIC 3U4VA 3J81c 3OTOL 4HJ7A 4GNXA 2R7DA 1JMCA 4A3DG 2HHHL 4A3FH 4B3SL 5C0XJ 3EBEA 1G291 2R7ZH 1Q1EA 3CQZH 2JA9A 1GKHA 4BBRG 1U5KA 5GAHC 1KC8C 5C44H 2WP8J 2YTXA 4C2MH 4YY3L 1T9HA 4POGA 4OWXB 5M3FG 4JI6L 4A3JH 1EQQA 1PH3A 4DR6Q 4GKKL 3CCEA 1A0IA 3S1MH 4X62Q 1FJGQ 2HQLA 2NN6G 5DLQE 5BR8L 4NXNQ 2B29A 2JA8H 4X64Q 1XPUA 4JBJA 3U58A 4YWKA 5M5YH 5GADC 2UUAL 5JEAG 2XTIA 1EQRA 1EUJA 3GTJH 4BY1H 2ZM6L 2R93G 1UE6A 3I7FA 4L5SA 3UE0A 3CMEA 2XGTA 4WJ4A 1HZAA 1VQCA 3S1QH 4XIGS 1N32Q 1XMOQ 1HNXL 4BXXG 2PI2E 3K80C 3Q8DA 4R4CA 4Y52H 3AQQA 4PZ7A 5GQOA 5C4XH 4A3EG 3PIPA 1UE7A 3H0GG 1NY4A 4IFDG 4DV3Q 4GKJL 2F3IA 3KF8B 2VQEQ 4A3BG 4DR3Q 1VQAA 4UY8C 3GDEA 4WJ3M 1S40A 4K0KQ 3RR5A 2JA5G 3BZCA 4OWWB 3I4NG 4DUZL 3T1HQ 3OW2A 3I4OA 1YI2A 1VQKA 3HOYH 5K36G 5IYCG 5C0XI 2UXBQ 4EX5A 1Z9FA 1YJWA 4DK6C 4GOPA 5AJ3L 1OTCA 1H95A 2IT1A 2N78A 1K3RA 4JI5L 3I55A 4B3ML 3I4MG 1Q8KA 1EIYB 5LMUL 1GO3E 1WJJA 5C4JH 4AQYQ 5IP9G 3DM3A 2F4VQ 2ZJRA 4FDBA 4JI0L 4QJFA 3K7UC 1SFOH 3T1YQ 1EFWA 4LF4L 4P73A 4JV5L 2VS1A 2UU9L 1E1OA 3FKIG 3TREA 4JI3Q 1ASYA 1NTGA 2K50A 5GROA 1Y1WH 1QZGA 4UP8A 3S1NH 4DV0L 1QVGA 4NB3A 5EAYA 4O0AA 1N36L 2BH8A 1N34Q 1SR3A 5IP7G 1IBML 4HJAA 1PHJA 3PO2H 1TWAH 4DV2L 4YWLA 4DUYL 3AFQA 4UP7A 4UP9A 2Z0SA 4HIMA 4A93G 3RLNA 1CKNB 1SRUA 2GN5A 4HJ8A 5JJIA 3AEVA 4BY7H 3CP0A 3HOXH 2VQFL 3CCQA 1PA6A 2N8NA 2I5HA 1EIFA 2KCMA 1VQEA 5M3MH 2QA4A 4DAMA 1P16A 3CCLA 1I6HH 1IBKL 2UXDL 1XNQL 1GVPA 5C0XG 1YHBA 3K7AH 4DK3C 5LMNL 4GN4B 4DR5Q 3F1ZA 4IO9A 4A3IG 4JI1Q 4QIWE 4B3RQ 1IZ6A 1JE5A 4PZ6A 4DV1Q 3SGIA 1YBYA 1LUZA 4RMFA 2RCNA 3J81j 4JBKA 1C9OA 1N9WA 1VQJA 3BZKA 4C3JH 2N3SA 1SROA 3PUWA 2OQ0A 1QUQB 1VQPA 2FXQA 1XNRQ 3U4ZA 1QUQA 3HOVG 4Y7NH 2PI2A 1PV4A 4NXMQ 1OXXK 4BBSG 4IPGA 3HKZE 1HNZQ 4DKAC 2ZTDA 2NVQH 3HOWG 2Y0SG 3KJOA 4GLXA 1X3GA 2AHOB 3BJUA 3RN2A 1YIJA 2WAQG 4LWCA 1KQSA 5FLMG 2I0QA 4LF7L 4JYAQ 1YHQA 1Q1BA 4MNOA 4X66Q 2Q2TA 3CC4A 2CKZB 4DV7L 1HZBA 2A19A 1VQMA 3GTQH 1Y1VG 3KDFA 3TS0A 2YV5A 1Q7YC 4APVA 4NPSA 3CCRA 1KL9A 4LF6Q 4HIDA 3OYYA 1HH2P 2JA7G 1WOCA 4PG3A 3K81C 4LF5Q 3TRZA 1PH6A 3NENA 1YJ9A 4DV5Q 1OXUA 3FP9A 1PH4A 2Q2UA 3CCSA 4DR6L 4L5QA 3RN5A 4KHPQ 5C3EH 4X62L 1FJGL 4MZ9A 1E3PA 3UDGA 4NXNL 4OX9Q 2A8VA 2LXKA 2JEAI 3H3VH 3GTGH 4X64L 4DV6Q 4QQBX 3HOUH 1X65A 2D0OA 3PIOA 3FHWA 2ATWA 2UXCQ 2VNUD 4DR7Q 1EWIA 3NBHB 1KRTA 4XTCS 3AFPA 2NVXH 3DLLA 4B3TQ 4A3GH 3G48A 3H15A 1MJEA 1N32L 1XMOL 1X9NA 2VY3A 2L15A 3TS2A 2UUBQ 1CKOA 1KHIA 3K8AA 1OXVA 4LUVA 4OO1I 4DV3L 3S14H 2VQEL 1E7ZA 2KENA 2YYZA 4DR3L 1W2BA 1IYJB 1L1OC 2JE6I 1B7YB 4ME3A 1XTDA 3JAMc 1S3OA 4LFCQ 3CXCA 4K0KL 1PH5A 1FVIA 4DV4Q 3ZJYC 1M1KC 2MFIA 3F8TA 4A3FG 1SE8A 1HR0W 2R7ZG 1S72A 1BBUA 1RL2A 1TWFH 2EQSA 2N49A 3T1HL 5C44G 2UUCQ 3AYHB 1A63A 2UXBL 3NEMA 1CKMA 3RNUA 4A75A 1VQIA 1UEBA 4PMWA 4A3KH 4A3JG 3A5ZB 2VL6A 5ELNA 1VQOA 1G51A 1MKHA 1HR0Q 2RHSB 2JA8G 4JI7Q 2K5NA 4AQYL 3MEFA 4YHHQ 3CW2C 2QEXA 2F4VL 4DR2Q 1VQHA 2CQOA 4BY1G 4GOPB 3T1YL 2OCEA 1J6QA 2C35B 4GN5A 2QGQA 4L5TA 3ULLA 4DNIA 1YITA 1VQFA 3KJPA 2JA6H 4JI3L 4P72A 2IY5B 3I56A 2OQKA 3JC66 1O7IA 2ALYB 5IP9H 2PNHA 5C4XG 1VQ7A 4GLVB 2ZTEA 2K14A 1N34L 5JJKA 2DUDA 2JJQA 3HKSA 3KYHC 3UE1A 2KBNA 1AE3A 4LF8Q 1I94Q 4BA1I 1YHAA 4MTNA 2WB1E 3STBC 1NJIC 2LSSA 4OO1G 4LW1A 4YWMA 2EIFA 3HOYG 3J80c 4DR1Q 5GAEC 1VQBA 1K8GA 3GTPH 2VUMH 4IOCA 2PQAA 5IE8A 3CCUA 5HGQA 4HIOA 1TWCH 2AMCB 5IYDH 3U50C 3HOZH 1A62A 2E2JH 1X56A 1JJGA 1EYGA 4DR5L 1WFQA 1WCMH 1Q82C 1GD7A 2K4KA 1YNXA 3J81i 4JI1L 2Q2IA 3W1GA 1KIXA 1P8LA 4B3RL 3ER0A 4DR4L 1L1OA 4LFAQ 4DV1L 4X65L 3S15H 2VW9A 1PH7A 3CMAA 4IPDA 5LMUQ 1XNRL 4ALPA 4NXML 1R9TH 3ULJA 2A1AA 2HIVA 1K0RA 3CPWA 3RLFA 4JI0Q 1YZ6A 4POFA 3I2ZA 4JYAL 1X54A 2ID0A 3PO2G 1IL2A 4X66L 1PVOA 3HFZB 5ELOA 5FLXc 3S16H 3LGJA 3S17H 2B3GA 2GVAA 4A3CH 1OXTA 2JK8A 5FJ8H 2RF4A 1D8LA 4BY7G 1Q81C 3GTKH 3HOXG 3F2DA 3RZDH 1CSQA 1I50H 4LF6L 3E0EA 1KRSA 5M3MG 2RHQB 4DPGA 1N8RC 3J7A5 3PO3H 4JI8Q 1FGUA 2E2IH 1SLJA 2Q2HA 1MIUA 4PZ8A 4KHZA 4QL5A 3UDXA 3VDYA 1NE3A 3KDFB 4LF5L 1FL0A 2VZAA 4DV5L 1BBWA 1VQGA 4IJLA 4A3LH 1LYLA 1Z47A 5E7NA 4KHPL 2MQHA 2V1CC 4R4QA 1TWGH 1XPOA 3D31A 4A76A 1J5EQ 4OX9L 1VS0A 4DV6L 1HZCA 3BU2A 1PH1A 3CCJA 4LFBQ 2K5HA 2WB1G 2R92H 1WI5A 4YCWA 5IYBH 2B63H 2UXCL 2I5LX 3PCOB 5IY0A 4DR7L 3TEHB 4B3TL 2BA1A 3E9HA 1KD1C 4A3DH 1D7QA 1VQ9A 1BKBA 3S2HH 1IBLQ 2Z6KC 4JCVE 3G71A 2IHFA
chains in the Genus database with same CATH superfamily
1DJRD 1GJXA 2E5LQ 2HDMA 1A3VA 3BZDB 1JR0D 4OONA 5M3FH 2E75C 1XMQQ 4GZYC 5FLXE 4DAYA 1DYQA 4RGTA 2NN6H 4K5WA 2ZJPA 1B70B 1PYWD 5EPKA 1FNVA 3DEOA 4I65A 2DY8A 2HDLA 1TWGB 2R93H 3EQLC 4TVAB 3A5UA 3TP6A 2E8GA 3GD7A 3DM1A 4RG1A 1HR0L 4BXXH 1ZYRD 4JI7L 5KYIA 4EGVA 2AUJD 2I5MX 2JN4A 1PTOF 4A3EH 1UWVA 1EZ8A 2XIWA 5JVG3 1AE2A 2ES2A 4A3GG 3B6YA 1SYBA 4NKLA 3HKZG 2EXDA 2PMZE 3GTOH 4IPHA 1A8VA 1Q12A 3NTKA 5IYCH 2QDLA 3QR8A 5M5WH 4J15A 3WWVA 1VQNA 1YJNA 1JCKB 1NR2A 1TWHH 4GKKQ 3HZXA 1RTOA 1X6OA 2OTJA 1PRTD 2GVBA 2EVBA 1QZHA 1VQDA 4IALA 4UDUC 2DGYA 3M3YB 4JPBW 1MJCA 2PW5A 2MO0A 1BNZA 1SMYC 1JQYD 1BVSA 1RD9D 3J81L 3I4NB 3L9AX 2R7FA 1Y8NB 2F52A 2L12A 3FDTA 3GO5A 3KLRA 1U0LA 2XN9C 4A93H 3QWNA 4C3IB 2ZTCA 2YU9H 1VF5C 4DXFA 3NUCA 2NVYH 5NUCA 1I4PA 4AYBE 3A55A 4B3MQ 3H91A 1YNJC 1PFBA 4OWTB 1GUOA 3CCVA 1FNUA 3BVGA 5I9PA 2XVSA 5IYDG 1B4OA 2UU9Q 2Q8RE 1UNSA 1X3PA 1HNZL 1E22A 5JPMC 5A2QL 5HY6A 3ULPA 2JSOA 1MHWC 3M9BA 3HOZB 2MNAA 4A4IA 1ZKOA 1J5EL 1V1QA 1JJ2A 1AP0A 2ICEC 4LFBL 2CWPA 1Y1VH 5EPJA 2K52A 1D5MC 4X65Q 2E2HH 3A8IE 1R9TB 1WTWA 4C3JG 1XNQQ 1C48A 1EYDA 1HCZA 3TP8A 1HNWL 4A3CG 2DNEA 3F2BA 4G7ZC 1DGSA 4JI2L 3UDIA 4EQOA 4GN3B 1EOVA 2NVTH 1SNQA 4B9XA 1L2FA 3W2DA 5T1GA 5CMDA 1QJOA 1PYSB 1DOLA 2Z1CA 4RGNA 1CT1D 3TQYA 1QVFA 2X6GA 2WAQB 3MTSA 2Z9HA 4A3LG 3L2PA 1L0WA 1N33L 2EY5A 5CBAE 3NELA 4LF7Q 4LF9L 3VR6A 1STBA 3F2CA 1JT8A 4DV7Q 1Y14B 2MP1A 3QO2A 5IYBG 4FF2A 4JOIC 4RKBA 3U4VA 3J81c 3A7LA 4HJ7A 4WJWA 2EJFC 3T13A 4A3DG 1O7YA 2R7ZH 1G291 3C1FA 1KC8C 1U5KA 5C44H 4C2MH 1SNPA 3I72A 2YTXA 1KDCA 3S2HB 3P20A 4G7HC 4A3JH 1EQQA 3S1MH 4XT3B 2PQEA 5BR8L 2B29A 4X64Q 1G2SA 3A56A 4YWKA 5M5YH 2D2CC 2DY7A 2PW7A 5M3FB 1J8IA 5ISRA 3W3AA 1EQRA 4CKCA 5EKKA 2ZM6L 2P5ZX 3QG1A 1LT3D 1CZWA 3PQIA 4TKOB 5KGUA 1N32Q 1G2TA 3MEHA 2PI2E 1VMPA 3K80C 4R4CA 4PZ7A 5D3IB 5G3LF 3BS1A 1LTBD 1DZ1A 5BN3A 2F3VA 1TKWB 2JA5G 4U68A 1ESRA 1GUTA 2Q8TA 4OO1H 3T1HQ 3OW2A 1VQKA 2MUYA 4GOPA 3OHXC 1OTCA 1X32A 1K3RA 1TVXA 2KQ3A 4RGMA 1B3AA 3OIPA 5LMUL 1GO3E 1WJJA 4AQYQ 2AQ2B 5KIXA 4JI0L 4QJFA 4P73A 4X3TA 1LV9A 4JI3Q 5C4XB 1Y1WH 5IODA 1QVGA 4NB3A 4X3SA 5EAYA 1PZJD 1N36L 5COYA 3TN2A 1I4XA 5CV9A 3VR3A 1ZYRC 4CKBA 5IP7G 1IBML 1HFGA 3OPOA 2K5DA 3H94A 5ELEA 5JJIA 1JOOA 5EKIA 4BY7H 1JWMD 2VQFL 5E4WC 5ELDA 1G8ZD 3VA5A 1U9RA 3MFYA 1EIFA 2F3WA 1EIHA 1F9QA 2RQXA 1P16A 2IL8A 3MWYW 3SK8A 2UXDL 4GN4B 4A3IG 1IZ6A 4PZ6A 4JBKA 1LUZA 2RCNA 3K0YA 1PRTC 4JI4L 1LABA 1VQJA 3DMUA 2N3SA 3A54A 2OQ0A 1QUQA 4NXMQ 2PCFB 1DXMA 4CJ0B 3NWSA 1NNXA 3KJOA 3RN2A 2F0DA 3BJUA 1AZPA 1V1OA 1YIJA 5FLMG 5IIFA 5D65A 1U4LA 4CBVA 1KNAA 3GTQH 3KDFA 4XDXA 1GUSA 2YV5A 5J1ZA 1U4PA 1KL9A 4LF6Q 4HIDA 3K7AB 5T1IA 1QG7A 2JA7G 4LF5Q 3TRZA 3AB9A 2HCCA 3ND8A 4DV5Q 1OXUA 2Q2UA 1ENCA 4KHVA 3D6CA 4L5QA 4F88A 4X62L 3UDGA 4DNTB 3HOUH 2K1BA 1X3QA 1QE6A 2WV6D 3BDLA 2VNUD 2NVXH 1SYFA 3DLLA 4BS9A 3OMGA 1QNUA 2L15A 1MGSA 1CKOA 2K7VA 1OXVA 1TS3A 2A6HD 4G7OC 4DV3L 1IKMA 1NCVA 1IYJB 1ESFA 1B7YB 4K0KL 1PH5A 2MFIA 1SE8A 3O13A 3AYHB 4DGZA 1A63A 2UXBL 3ND9A 3CHBD 5C3EB 4ZK9B 2TSSA 1UEBA 2KCCA 1F77A 2R7ZB 4JK1C 5C44B 3PIP3 2RDGA 1HR0Q 2WIIB 2JA8G 4JI7Q 3MEFA 5K36H 1E0BA 2F4VL 5C4ZA 4GOPB 2OCEA 4L5TA 1VQFA 4P72A 3IFDA 2EZVA 1A2TA 2IY5B 3JC66 1K3BC 1O7IA 3A8JE 1VQ7A 5JJKA 3E6ZX 2JJQA 3HKSA 2B8GA 4CDFC 4K5VA 4MTNA 2WB1E 3DWQA 1A15A 1NUCA 1TY0A 3J7YW 2K5WA 2PQAA 3CCUA 4HIOA 4RA8A 3U50C 4KD3A 4K8IA 1WCMH 1GD7A 5EGTA 2JA6B 1P8LA 5IT9L 2J0TD 4X65L 3S15H 1H9RA 3BYTB 2B39A 2VW9A 1U4RA 3IFTA 3V96A 4I7AA 2F0MA 3RLFA 1WTOA 1YZ6A 2A6ED 1Y8PB 2FJ2A 1SE3A 1Y1WB 5I6WA 2ID0A 1B9NA 2OXPA 3OWFA 3LGJA 4EQPA 2B3GA 2JK8A 5FJ8H 2RF4A 1CSQA 3TBIB 2EYJA 3E0EA 2L4NA 3K6OA 1OO9B 1HNZQ 2RSOA 3KDFB 1SNCA 1KDAA 1BBWA 1VQGA 1Z47A 4KHPL 2MQHA 2V1CC 4R4QA 1TWGH 4KKTA 1J5EQ 3HS0C 1VS0A 2PNRC 1BR9A 4LFBQ 4ZUIA 1EU4A 2UXCL 1SYDA 4DR7L 2CW0D 1RODA 2BA1A 3E9HA 4B3TL 3WOEA 1I6VC 4JCVE 3KK7A 2UUBL 3RZDB 5KNBA 1HNWQ 1W3SA 2PZWA 4JI2Q 1QVCA 3PUYA 2E2IB 2BH2A 2F0WA 1LTSD 3CCMA 1Q46A 2R6GA 1PYBA 2A68D 2IW3A 1STGA 3DEPA 4A3MG 2B2YA 5JEAH 5LHY1 1N33Q 4LF9Q 3M3YH 2D0PA 3R8BA 5HURA 4YHHL 2G9DA 4DR2L 4HIKA 5IT9c 4AH6A 1S5ED 2FMCA 4IFDH 1HZ9A 1NAPA 1J9OA 4BBRB 4CGYB 5DM63 3I4NH 4ODGA 1MSHA 1G91A 1XPRA 1BCPD 1LTLA 4UPAA 4C3IH 1UE5A 4LF8L 1SNMA 2D62A 1R4QB 1XTCD 2NUCA 1CQVA 1HA6A 5BR8Q 2N88A 4H02A 2ZM6Q 4G4KA 3EVQA 3PSIA 2EE1A 3FKIH 4R1JA 1LTRD 3TMEA 5J3BA 2MJ8A 4PQXA 2Y0SE 1XXGA 3PUXA 4K6DA 1AH9A 2PQAB 1X3FA 3D4WA 4RCOA 4QY7A 1K9MC 3R2IA 3F2UA 1XJVA 2IX0A 2K75A 4PMCA 4LNQA 4JG2A 5DAUA 5CORA 3I4MB 1TY2A 4FNFA 2KHIA 5EKLA 4X6AH 2EY2A 2A6HC 5DEHA 1JJCB 4XQNA 4MIUA 2E74C 4QGUA 1V8QA 2VUMG 3SEBA 1PFSA 4L5RC 1TS5A 3HOZG 4XYOA 5FO7B 1TQOA 1PZKD 2CHBD 3KLWA 5CGKA 4KI0A 2YTVA 4BBSH 3CC7A 2K5VA 1CHQD 1N36Q 1G6PA 1HUNA 2NZHA 4KKUA 3E3XA 4GS3A 1IBMQ 5LL6X 3NQTA 3NWTA 3LX0A 3S1RB 5CBEE 2XRQD 3S9WA 4BA2I 4DR4Q 2JEBI 2VQFQ 4OGQC 1IBLL 4F8MA 3M4QA 1WTPA 2I46A 2UXDQ 5H1SE 4G57A 4KY6A 4QMGA 4C3HB 1UE1A 3NE5B 5IOCA 3PO3G 3HOVB 2NTSA 2SEBD 3Q24A 2RVLA 4JI4Q 3L0OA 2ZJQA 3HOWB 4CJ1B 2DJGC 4JC0A 1W6KA 3K0XA 4FYDA 3ERQA 4GOPC 3SK5A 3D4DA 3I4LA 4JBMA 3ICEA 2R92G 3H6MA 4GNXB 1QOHA 1SAPA 1JWUD 2R61A 5C0XJ 4B3SL 3PMFA 2JA9A 2F1MA 3EJIA 2WP8J 1E2ZA 2B2VA 2A6EC 2E76C 1IYVA 1T9HA 5C3WA 5M3FG 4JI6L 4CDCC 3NBHA 3CCEA 1A0IA 4X62Q 2NN6G 1SYEA 4ZYSA 4JBJA 3MXGA 2UUAL 1F9RA 1M8AA 2R93G 1QB5D 2PO4A 1HZAA 4XIGS 3S2DB 4BXXG 2ZT9C 3Q8DA 3AQQA 5C4XH 4A3EG 3PIPA 2EDGA 4GKJL 4DV3Q 5C6AA 2QF7A 4A3FB 1DCZA 4WJ3M 3CQZB 1S40A 4K0KQ 3T53B 4DUZL 5EPLA 5IGFA 3I4OA 4R8IA 4K14A 5IYCG 2CW0C 2UXBQ 1Z9FA 1YJWA 3NK9A 1ENFA 4Q0FA 5AJ3L 5EBCA 1HFNA 2N78A 2HCIA 4JI5L 3I55A 1KLUD 1A3UA 4BY1B 2F4VQ 3IKJA 4FDBA 3KBGA 1EFWA 4LF4L 2VS1A 1SNDA 3M4YA 2A68C 4X3KA 3LNNA 4P2CB 2K50A 4IUPA 2F0FA 1QCBD 1I4QA 1PRTF 1ILPA 2AQ1B 3FKIB 2XWBB 1L0YB 4V190 3HOYB 3JAML 3CRKC 2B2UC 4DUYL 3AFQA 4HCSA 4UP9A 2Z0SA 4A93G 3RLNA 2GN5A 3AEVA 2QKIC 1PA6A 3NXWA 1Y8OB 3SR1A 1EY6A 1GHJA 5M3MH 1U4MA 1DOKA 4ZQ3A 4DAMA 1VMCA 3CCLA 1IBKL 1GVPA 2EPBA 5C0XG 3K7AH 1BCPC 4IO9A 1LT4D 1EL0A 1WVLA 4QIWE 1B50A 4Q5VA 1YBYA 3S1NB 1XWEA 4ILWA 3X3MA 1C9OA 3BZKA 4C3JH 1VQPA 2FXQA 4QUCA 1OXXK 2F0OA 2JXMB 4CKEA 4IPGA 3K5NA 2K28A 5IGGA 2QW7A 4KD4A 3PO2B 1R4PB 2Y0SG 1SDFA 1X3GA 2AHOB 3M7NA 4LWCA 2I0QA 4KN7C 1CTMA 5FK9C 3CC4A 2CKZB 4BBSB 2A19A 1EWCA 3HOXB 1Y1VG 3TS0A 3G6JB 1Q7YC 1B9MA 3H09A 4APVA 4NPSA 3J80L 1EY4A 1JB3A 1I6HB 2DJFC 4RWSC 2NZ1D 4NDXA 1UEAB 2O4XA 1Q3LA 1YJ9A 3FP9A 1PH4A 3CCSA 1ET9A 3RN5A 4KHPQ 5C3EH 1FJGL 2F0TA 4MZ9A 1E3PA 2JEAI 2LXKA 4O42A 4R8NA 1D5XC 4HEDA 2ATWA 3MZ5A 3FPPA 2UXCQ 5I6YA 4DR7Q 1GUGA 3NBHB 4B3TQ 4XTCS 3H15A 1MJEA 3LWUA 2EJGC 2UUBQ 3IAYA 3GV3A 1B53A 5FLXL 4RH6A 3S14H 2VQEL 2KENA 4DR3L 1W2BA 1FR3A 2JE6I 1EOTA 1IW7D 1UUPA 3JAMc 1S3OA 3ZJYC 4DK0A 2VXWA 2R7ZG 5ELFA 2N49A 1C8CA 2EQSA 5C44G 3NEMA 3RNUA 3RD4A 1VQIA 3CKIB 4A3KH 4A3JG 1ZEQX 3A5ZB 2VL6A 1WTQA 1T5EA 2ZXOA 3BYYB 5ELNA 1VQOA 1WD0A 2RHSB 1JOQA 2F0IA 2K04A 3P7JA 4YHHQ 2QEXA 4A3GB 4DR2Q 3HKZB 3T1YL 1J6QA 2C35B 2B2WA 4GN5A 1S5DD 3KJPA 2JA6H 4ZLTF 1K0SA 1EU3A 2OQKA 1Z6HA 5IGDA 2PNHA 2O5IC 2K14A 3SDZA 2F0JA 3KYHC 1TWFB 3UE1A 4KV6A 4LF8Q 3NPPA 3ONAB 3OIQA 4OO1G 1ML0D 2LSSA 4LW1A 2EYOA 2EIFA 3J80c 4IUUA 1K8GA 4DFAA 3GTPH 3NTIA 1LACA 5IE8A 2Z4IA 3WDNA 4J6HA 1RDPD 4ZRZA 4DR5L 1WFQA 3OW7A 1CM9A 3J81i 4JI1L 2Q2IA 1Z7TA 3ER0A 4DR4L 2QCPX 3R93A 5I9OA 1TT2A 2XNAC 2BE5D 3AU7A 5I4DA 4IURA 3CMAA 4IPDA 1LT6D 2NWGA 4WRDA 2B2YC 2HIVA 3DWPA 4OELB 1SNOA 4POFA 1MD2D 3V2TA 4JYAL 1PMRA 1X54A 1IL2A 1A2UA 5C5LA 3K57A 3SE0A 5FLXc 3SK4A 1VF7A 2GVAA 5E4XA 4BY7G 1Q81C 3RZDH 4C1NK 5K5PA 3J7A5 1N8RC 2X6LA 3QOLA 2RKSA 2E2IH 2Q2HA 1XYIA 2K01A 4H13C 3VDYA 4XT1B 5C5MA 1LTID 3V05A 5M3MB 2RBMA 1XPOA 4U673 4RHSA 3D31A 4OX9L 3VR4A 3KBXA 1PH1A 1F2MA 1GUWA 2B63H 4K2LA 4FF1A 2HQEA 1K8MA 4C3JB 1KD1C 1D7QA 1VQ9A 1BKBA 1IBLQ 3K58A 2WINB 3S17B 1XX8A 3NP8A 2IHFA 2FFKB 4BBRH 1VQ6A 3PF4A 3SHLA 3S1QB 2JQOA 3M7GA 3TDQA 4DV4L 1SN8A 3IRBA 3J80i 2UUCL 2YTYA 2WKDA 5L37A 1CA6A 2ASBA 1K8AC 2IHEA 1I3QH 1SBBB 1CA5A 3K5OA 3OWEB 3KFUA 2EYMA 2A73B 4B9WA 3GV6A 4H7BA 1B8AA 1QNKA 3W5OA 3SK6A 1M90C 3C3LA 3HOUG 1DONA 4R4OA 4R4IA 4P71A 3H0GH 4A3BH 1KAWA 5E3FA 5M9OA 4KJNA 3L7ZC 1KNEA 4B3SQ 3GTLB 1HQRD 3KOJA 1B1ZA 5ELBA 3PV0A 4L8JA 1WYDA 4LK1C 2KCTA 1H9MA 4YCVA 1HTLD 2CQAA 3M4PA 4HJ5A 2ZXPA 4JI6Q 1YEZA 1I94L 4TSSA 3I4MH 1E2WA 4DN4M 3S14B 1W6JA 2MGSA 4TQUS 3VR5A 3MXUA 1Q86C 4XQJA 2UUAQ 4TRDA 3KF8A 1PH9A 2OTLA 2EYFA 4IN3A 4QUFA 3GQBA 2B2TA 2HIXA 1VCIA 3CRLC 4IQZA 4A3KB 2WAQE 4ZKBB 4YCUA 4GKJQ 2JA5B 3PF5A 4HSPA 1I5FA 1TS2A 2SOBA 3ERSX 3VA7A 1IXRA 4KLKA 1YVCA 5J39A 4DUZQ 4HSVA 1GUNA 3KF6B 3RZOB 4OIKA 4JOIA 1NMFA 3S1RH 5AJ3Q 3I70A 3MVVA 2CFMA 2F0LA 2M00A 2HT1A 4JI5Q 5I2XA 2AWOA 2QILA 1BBXC 1PTOH 1KDBA 3VYSA 1TXYA 3C2PA 1IW7C 5JEAJ 1E1TA 4LF4Q 4C3HH 3G6EA 4JI8L 2L9HA 4JBWA 3A0JA 3EFXD 2RSNA 3LWEA 3FEWX 2OWOA 3GTPB 1SEBD 1WCMG 3RLOA 3HOVH 1STNA 2B2VC 1CKNA 4IFDJ 3TZUA 1F2LA 4HAEA 3URYA 3HOWH 3S24A 1E24A 1WTHA 1EY9A 2BCOA 1K83B 4FXDA 2PMZB 1V43A 4P75A 5LMNW 4DUYQ 1IKLA 2KEDA 1PFMA 4R4TA 1HXYD 2PPBC 2AWNA 3H3VI 3CD6A 1EY5A 1SMXA 1I4RA 5CV5A 3D0FA 1CSPA 1IBKQ 2RA4A 5C3XA 2FHTA 4HJ9A 3M4OB 4HCEA 4EQ5A 2NN6I 5FJ8G 1EZ6A 3EA6A 1HTPA 3CF5A 1CZGA 5JOBA 3GTMB 1HJPA 5IWAL 1PFNA 3N52A 2F0HA 3PGZA 1V9PA 3UDFA 5GAGC 2M2LA 4XQQA 1IL8A 2BA0A 1EEID 4O2DA 1E2VA 1JB7A 4KK7A 4DU9A 4A3MH 3S2DH 3OTOL 1D1KA 2L1BA 4GNXA 1HRJA 2BE5C 2HHHL 2JA7B 4AYBB 4A3FH 3HEJA 3EBEA 3I8ZA 3CQZH 5GAHC 2B63B 1EFID 1TR5A 4YY3L 3A8KE 4POGA 1RTNA 4OWXB 2RDHA 4CDDC 1KTKA 1PH3A 1FJGQ 5CV6A 5M5XB 1YNJD 5GADC 3Q6SA 3MFGA 1TU2B 2XTIA 5JEAG 4BY1H 1EUJA 2LKVA 4RHRA 4K6LA 2EOTA 2QEJC 3I7FA 3UE0A 1VQCA 1HNXL 4OL7A 1I3QB 1MI2A 1F2YA 3VYUA 1NY4A 4IFDG 2F3IA 3KF8B 2VQEQ 4DR3Q 2A5HA 3GDEA 4KY7A 2HUGA 3BZCA 3L3OC 4QB4A 5IGCA 1G6ZA 3I4NG 3H0GB 3J81E 1GOZA 3TP5A 3HOYH 4A3BB 5C0XI 4EX5A 4Z9CB 2J7ZA 1O78A 2KJXA 4C3IG 1H95A 2IT1A 4KY5A 4HN7A 1Q8KA 2CVRA 3GTJB 5IP9G 5KYLA 1JE4A 3X3NA 2ZJRA 1EY8A 3T1YQ 4JV5L 3QB3A 1BCPF 3FKIG 3TREA 2OT2A 1ASYA 1NTGA 3OSOA 1QZGA 4UP8A 3S1NH 4FP5D 4DV0L 5A2QE 4JW0A 4O0AA 2O2LD 2BH8A 1H9SB 4HJAA 3PO2H 1TWAH 4K5XA 4DV2L 4YWLA 1STEA 4UP7A 4HIMA 5JJZA 1CKNB 1HHVA 4ABNA 4HJ8A 1SJED 2A69D 3CCQA 3HOXH 1RJTA 2KECA 1VQEA 4HR7B 5C4JB 2BOSA 1I6HH 4DK3C 5LMNL 4DR5Q 1Y69U 3F1ZA 4JI1Q 1SE4A 4MHEA 3MHBA 3SGIA 1KLGD 1PTOB 4N9PA 4RMFA 2K32A 1SROA 1BF4A 1EWHA 3U4ZA 1PV4A 5DNFA 2H4OA 4BBSG 5CC4A 2F0UA 1DM0B 1EYCA 4RFBA 2C5CA 4EQNA 1KQSA 2WAQG 4FVMA 4JYAQ 2FINB 2RDFA 4X3UA 1YHQA 3AMUA 1Q1BA 4MTKA 1L0XB 2Q2TA 1VQMA 1HZBA 4IUQA 4R9WA 3BDCA 1B44D 5ELCA 3FVQA 3CCRA 3UI2A 2B2WC 2XSCA 1PTOD 1WOCA 4PG3A 2LS01 3K81C 5HGTA 1NR4A 3NENA 2K05A 4PMBA 4DR6L 2IWHA 1S5CD 2SDFA 4OEMB 2A8VA 4NXNL 4OX9Q 3H3VH 2NVQB 1UAPA 4QQBX 1D2BA 2ICIA 1X65A 3PIOA 3FHWA 1EWIA 1KRTA 2PZTA 4A3GH 3AFPA 1XMOL 2JYOA 2Z6BA 1KHIA 4LUVA 3P1HA 4OO1I 2KA7A 3ZYYX 4QF4A 2AUKA 4ME3A 1XTDA 3CXCA 4A3MB 4MN3A 1PRTB 5AFWA 4DV4Q 2WACA 1TWFH 3SXHA 2UUCQ 5CV4A 1T5XD 4PMWA 5TSSA 3GTGB 1BOSA 4N8FA 1G51A 1MKHA 2F0EA 3D8GA 2HD3A 2K5NA 1CHPD 3CW2C 2QDBA 1VQHA 2CQOA 4DNIA 1YITA 4PNYA 4IZ8A 1CK1A 3I56A 1STAA 5C4XG 4EVOA 2AQ3B 3D4RA 1EY7A 2ZTEA 4H0LC 1N34L 2DUDA 3J7AV 2KBNA 1I94Q 3QOJA 3U9OA 4KJOA 1D5ZC 5GAEC 1VQBA 4ZKCB 2L11A 1V1PB 1CFMA 5HGQA 3NTHA 1WTVA 5IYDH 2M9VA 1A62A 2NYZD 1X56A 4J8QA 4HMIA 1EYGA 2MHVA 1ICFB 2K4KA 1KIXA 4C1NI 3W1GA 4B3RL 1L1OA 2XWJB 4DV1L 3FPUB 4QCLA 1TIID 3NHHA 2LY7A 3D3RA 5C0XH 1C4QA 1XNRL 4ALPA 3ULJA 2A1AA 2J4XA 2LMCB 1JC7A 1K0RA 3CPWA 1S4ZA 1LT5D 4F87A 3I2ZA 1Q8IA 1RCVD 4RKLA 1FYCA 1GXDC 3N6RA 4X66L 3HFZB 5ELOA 2VUMB 3S17H 1IHZA 3MA2B 3MXNA 4A3CH 1TWCB 2IX3A 2KEEA 3F2DA 2E2JB 1TWAB 4XYQA 2RCFA 5JVH3 5M3MG 1KRSA 2RHQB 1EEFD 4JI8Q 4V0BA 1SLJA 3S1QH 2VZAA 4WORA 2V4DA 4IJLA 4A3LH 1LYLA 4HMJA 1D6EC 4DV6L 1HZCA 4NW2A 3CCJA 3G7LA 2K5HA 5IYBH 2I5LX 5IY0A 2NTTA 5I2YA 4A3DH 3S16B 3A7AB 1H9JA 4DK1A 2WB1B 3GTKB 1I50B 1O80A 2B2TC 2LXJA 1KXLA 3GTLH 3PO3B 4IOAA 1HA5A 4LFCL 2K6AA 4DAYB 4DAPA 5IWAQ 3NBIA 1B2TA 3T16A 3VYTA 3K5LA 5G3LD 1PDQA 2XRSD 3E9IA 2A69C 1VQ5A 3T51B 3SVMA 1LM0A 2EYLA 4FF3A 5C3EG 3Q23A 4AIMA 3BVZA 1PH8A 2R92B 3EN2A 3CAMA 5IGBA 1QILA 3DHQA 2G5DA 3HRZC 3OTOQ 4ZAIA 1BXTA 1AW7A 2L55A 2HHHQ 4ZUJA 3W1BA 2JA5H 1RF2D 5C4HA 4M8AA 5FO9B 1EY0A 4LJZC 3MXPA 1EYAA 2N55A 4O1NA 3I91A 4YY3Q 1A6XA 4DF7A 1I4GA 1LTAD 3RZOH 4IPCA 3HG9A 4Y7NB 1FGBD 1ZXTA 4RGOS 3C46A 1OXSC 3CC2A 3RMHA 3T56B 1RKNA 1K8OA 4DR1L 2R93B 2CH4W 1EQTA 5DM73 1CUKA 4LUZA 4CDEC 4A3KG 1VQLA 1EIGA 1PTOC 2Z6KA 4S3SA 4A3EB 1HNXQ 1VQ4A 1MBYA 3PUZA 2KVMA 4LFAL 1PH2A 3GTOB 2JA6G 5IP7H 4IJHA 1JICA 1II3A 4N9TA 4OHJA 1SE2A 4RAUC 5M5WB 5IT9E 3J7ZC 3E0JA 1K83H 2CCZA 2IX1A 1GHKA 3KF6A 1HQMC 1TWHB 1L1OB 2KUMA 4ME5A 1X55A 4OXPA 1SJHD 1Y1WG 4C56C 5JJLA 4A3IH 1VQ8A 4GNXC 1QWYA 1AZQA 3M4OH 4IUVA 1S5BD 2E2DC 2SNSA 3A74A 3KLSA 4P74A 5KNCA 2MO1A 4JV5Q 2F0SA 1NMGA 1F9PA 4M1UB 5FOBB 3T4AC 1WTXA 3GTMH 1GM5A 1H9KA 3MXNB 3CPFA 1B3QA 1WTRA 1HPCA 4DV0Q 1A3TA 4ZCKA 2O5JC 3JAMi 3EIVA 4YIJA 4A93B 1ILQA 2NZOA 3Q0AA 5FLMH 2CWAA 1K73C 2YU9B 1STHA 4DV2Q 1JOKA 2NVYB 2FMMA 1RIPA 2KHJA 4LUOA 4KMUC 1X3EA 3QIAA 2H5XA 3G4SA 2JA7H 2OEOA 5LMNQ 4GLAC 2E5LL 3VR2A 1DOMA 1ASZA 1XMQL 1ET6A 1C0AA 4LMQD 5BN4A 2R3ZA 2WFWA 1SYCA 4RCNA 1RHPA 2Y0SB 1KABA 2GA4B 4FO2A 5M5XH 5E1FA 3M85A 4IFDI 1Y1VB 1NBWA 4AYBG 1C7YA 3PIO3 3STBD 1DD2A 2AKWB 1VDZA 4BWGB 2B63G 3PUVA 2E2HB 2F0NA 2R7DA 3E5SA 4FXKC 1JMCA 4B08A 1WD1A 2B2UA 1Q1EA 1GKHA 2BDNA 4BBRG 2NVTB 3BG3A 4A3DB 3P75A 4DR6Q 2EYHA 4GKKL 4NP5A 2HQLA 5DLQE 3MAQA 4NXNQ 3U9SA 2JA8H 1XPUA 3U58A 2H1EA 3ITPA 1EQVA 4ULLA 5JPNC 5FO8B 2X69A 3GTJH 1UE6A 4L5SA 4JVZA 3CMEA 1IYUA 1D1IA 1BQQT 2XGTA 4WJ4A 2F4IA 3GP7A 1XMOQ 2LFNA 2EY1A 4Y52H 5KRUA 5GQOA 1UE7A 3H0GG 2VB3X 3OOCA 4A3BG 1VQAA 4UY8C 3RR5A 1LO5D 4C2MB 4OWWB 2PZUA 2BDOA 5JAVA 1F9SA 1YI2A 5K36G 4A3JB 1LLRD 1SYGA 1YNND 3S1MB 4DK6C 2F0GA 4XXEA 4L6TB 1BDOA 1CQFA 3HGBA 4B3ML 2F0PA 3I4MG 1EIYB 5M5YB 3TSSA 5C4JH 3DM3A 2I07B 1LTTD 2EY6A 1SFOH 3K7UC 4H44C 2UU9L 3J7AF 1E1OA 5GROA 1PLFA 1SSOA 1N34Q 4KKSA 3OMCA 3K5MA 3BDOA 1SR3A 1H9SA 3CU7A 1PHJA 4FXGC 5EBDA 1SRUA 1JORA 1AN8A 5EQ0A 3CP0A 3MC0B 2N8NA 2I5HA 1FNWA 3TZDA 2KCMA 2QA4A 1ENAA 1XNQL 4K8JA 4I7ZC 1YHBA 3I90A 1PXUA 4B3RQ 1JE5A 4C3HG 1KAAA 1M4VA 4N8X1 5A35A 4DV1Q 4E6IA 2WKCA 3J81j 3I3CA 2CH4A 1N9WA 3PUWA 1CI3M 1QUQB 4A3IB 4IUNA 1XNRQ 3HOVG 3IL8A 3C1EA 2PI2A 4Y7NH 5BN5A 2EYPA 3HKZE 2D5DA 4DKAC 2ZTDA 2NVQH 1Q90A 3HOWG 2SNMA 5LL6S 2TMPA 3WOFA 5FKAC 4GLXA 1MSGA 4LF7L 3H3VC 1JWSD 2IPKD 3R2TA 4X66Q 4MNOA 4DV7L 3TP7A 4BY7B 3KUPA 1O7ZA 1I4HA 1AEXA 1S5FD 5CV8A 2Q8IB 4DXGA 2IJ0A 3OYYA 2OF1A 1HH2P 1F2ZA 1PH6A 3HP3A 3D6WA 2KOLA 1SMYD 2Z8LA 3GTGH 1O7LA 4X64L 4K2KA 4DV6Q 3DWAA 2K5QA 2D0OA 3KLSX 3Q22A 3GTQB 5KEEA 2PYKA 3G48A 1N32L 1X9NA 2VY3A 3TS2A 5CYUA 1BCPB 3K8AA 2G9HD 1E7ZA 2VB2X 2YYZA 2Z4HA 1L1OC 4LFCQ 5J22A 1FVIA 1M1KC 3F8TA 5CR3A 4A3FG 1HR0W 4FF4A 1S72A 1BBUA 1RL2A 2NBFA 3T1HL 2F03A 4L63B 1CKMA 4QIWB 4F7XA 4A75A 2EJMA 3HOUB 4KN4C 3R3OA 4AQYL 1TS4A 2NVXB 4PV1C 3K59A 2NB0A 4DA2A 4BY1G 3ULLA 2QGQA 2DN8A 2JA8B 4JI3L 4CHTB 2K33A 2ALYB 2L5TA 5IP9H 1LTGD 4GLVB 2ENBA 4KTAA 3VYRA 3RUZA 1AE3A 4OIJA 4BA1I 1YHAA 3STBC 1NJIC 4WFN3 2C9OA 5KNDA 3DXJC 4DAVA 4YWMA 3HOYG 4DR1Q 3JAME 5CV7A 2VUMH 4IOCA 3DUZA 4NMZA 4HTHA 1V1PA 1TWCH 2AMCB 4UAIA 1BUVT 2F0KA 3HOZH 2D9UA 2ZXRA 2E2JH 1JJGA 3NSWA 4UHVA 5D14A 1Q82C 1YNXA 5IGEA 4LFAQ 1K28A 1PH7A 3I73A 5LMUQ 3FMCA 4NXML 2MPMA 1R9TH 1SFOB 2F0VA 4DNRB 1ICWA 3BVMA 4JI0Q 1AFPA 1PZID 2KHSA 4LAAA 1SXTA 3PO2G 1PVOA 2EXZA 2L0CA 2B8FA 4CJ2C 3S16H 1OXTA 4IUTA 1D8LA 3GTKH 3HOXG 2DNCA 1I50H 4LF6L 1STYA 2KCNA 3FRPB 3PO3H 4DPGA 3NQIA 1WCMB 1FGUA 3J80E 4QL5A 1MIUA 1FD7D 4KHZA 4PZ8A 1HUMA 1ONLA 1NE3A 2JP1A 3UDXA 4LF5L 1BO0A 1YNNC 1FL0A 5D3DA 3S15B 4DV5L 2F0QA 2K03A 5E7NA 4A76A 2A74C 1NSNS 5F2DA 3BU2A 2WB1G 2R92H 1WI5A 4YCWA 4J1MA 3PCOB 3TEHB 3S2HH 3QJYA 2Z6KC 3EROA 4ID6A 3G71A 5EJWA
chains in the Genus database with same CATH topology
2UUBL 4BBRH 1KXLA 2LXJA 1VQ6A 1HNWQ 2E5LQ 1W3SA 3GTLH 4JI2Q 3PF4A 4IOAA 1QVCA 3PUYA 4LFCL 2BH2A 4OONA 5M3FH 4DAYB 2JQOA 4DV4L 1XMQQ 1SN8A 3CCMA 5IWAQ 1Q46A 2R6GA 3IRBA 1PYBA 2ZJPA 3J80i 4A3MG 1B70B 2YTYA 2UUCL 3E9IA 1VQ5A 2ASBA 1K8AC 2IHEA 1I3QH 1LM0A 2R93H 3A5UA 4TVAB 1N33Q 3KFUA 2E8GA 5C3EG 4AIMA 3GD7A 1PH8A 4LF9Q 4RG1A 3EN2A 1HR0L 1B8AA 3M3YH 2D0PA 3CAMA 4JI7L 4BXXH 3W5OA 4YHHL 1M90C 2I5MX 3HOUG 4DR2L 4R4OA 4R4IA 4P71A 1UWVA 3H0GH 4AH6A 5IT9c 4HIKA 3OTOQ 4A3EH 4A3BH 1HZ9A 1AE2A 1KAWA 2ES2A 4A3GG 3B6YA 2HHHQ 3HKZG 2JA5H 3W1BA 3L7ZC 2EXDA 2PMZE 4B3SQ 4IPHA 3GTOH 3I4NH 3KOJA 1A8VA 3PV0A 1Q12A 1WYDA 5IYCH 1XPRA 4YY3Q 2KCTA 5M5WH 4YCVA 4J15A 3WWVA 3M4PA 4HJ5A 1LTLA 4UPAA 3RZOH 1VQNA 4IPCA 1UE5A 4C3IH 4JI6Q 1YJNA 1YEZA 1I94L 4LF8L 1TWHH 2D62A 4GKKQ 3I4MH 1OXSC 3CC2A 1X6OA 2OTJA 5BR8Q 2GVBA 4DR1L 1Q86C 4TQUS 1QZHA 1VQDA 2DGYA 2UUAQ 4JI4L 4H02A 1PH9A 2OTLA 1CUKA 4LUZA 2ZM6Q 4A3KG 1VQLA 1MJCA 3PSIA 2Z6KA 3FKIH 4R1JA 2MO0A 1HNXQ 1VQ4A 5J3BA 2HIXA 2Y0SE 1VCIA 3PUXA 2WAQE 3PUZA 4YCUA 4GKJQ 1AH9A 2PQAB 1X3FA 4LFAL 1PH2A 3PF5A 1BVSA 4QY7A 1K9MC 1I5FA 2JA6G 3ERSX 5IP7H 1IXRA 4IJHA 1XJVA 2R7FA 4KLKA 1YVCA 2IX0A 2F52A 2K75A 3GO5A 4DUZQ 1U0LA 3J7ZC 4A93H 4LNQA 4JG2A 3KF6B 1K83H 2ZTCA 4JOIA 1NMFA 2CCZA 2YU9H 3KF6A 2IX1A 1L1OB 2NVYH 3S1RH 5AJ3Q 1X55A 4AYBE 2CFMA 2HT1A 2KHIA 4JI5Q 4OXPA 4X6AH 4B3MQ 2AWOA 1Y1WG 1JJCB 4OWTB 3CCVA 5JJLA 1TXYA 5JEAJ 4QGUA 4A3IH 1E1TA 1VQ8A 4GNXC 2VUMG 3M4OH 4LF4Q 1PFSA 3A74A 4C3HH 4L5RC 4P74A 5IYDG 2MO1A 4JV5Q 3G6EA 4JI8L 1NMGA 2UU9Q 4JBWA 3A0JA 3HOZG 1HNZL 1E22A 3KLWA 5HY6A 3ULPA 2OWOA 3GTMH 1WCMG 3RLOA 1GM5A 4KI0A 3MXNB 3HOVH 3CPFA 1CKNA 2YTVA 4IFDJ 4DV0Q 4BBSH 3CC7A 2K5VA 1N36Q 3M9BA 3HOWH 1G6PA 3JAMi 3EIVA 2NZHA 2MNAA 3S24A 1E24A 4GS3A 2NZOA 4A4IA 1IBMQ 5FLMH 1J5EL 1V1QA 2CWAA 1K73C 1V43A 4DV2Q 4P75A 5LMNW 4DUYQ 1JJ2A 4LFBL 2CWPA 4R4TA 1Y1VH 1RIPA 2AWNA 3H3VI 3CD6A 2K52A 3M7NA 4BA2I 2KHJA 4LUOA 4DR4Q 2JEBI 1SMXA 2VQFQ 4X65Q 1X3EA 1IBLL 2E2HH 3M4QA 2UXDQ 3D0FA 1CSPA 5H1SE 1IBKQ 1XNQQ 2H5XA 3G4SA 2JA7H 4HJ9A 5LMNQ 1HNWL 4EQ5A 2NN6I 4GLAC 3F2BA 5FJ8G 1DGSA 1UE1A 2E5LL 3UDIA 4JI2L 4A3CG 4GN3B 1EOVA 2NVTH 3CF5A 1ASZA 1XMQL 1L2FA 3PO3G 1HJPA 5IWAL 1PYSB 1C0AA 4JI4Q 2WFWA 3L0OA 3PGZA 3TQYA 1V9PA 3UDFA 2ZJQA 5GAGC 1QVFA 4JC0A 3K0XA 4A3LG 3L2PA 1L0WA 4GOPC 5M5XH 1N33L 2BA0A 3M85A 4IFDI 3NELA 4LF7Q 4O2DA 1JB7A 4LF9L 1JT8A 3F2CA 1NBWA 4JBMA 4A3MH 4AYBG 1C7YA 4DV7Q 3STBD 1Y14B 3ICEA 2R92G 2AKWB 4GNXB 5IYBG 3S2DH 2B63G 3PUVA 4JOIC 3U4VA 3J81c 3OTOL 4HJ7A 4GNXA 2R7DA 1JMCA 4A3DG 2HHHL 4A3FH 4B3SL 5C0XJ 3EBEA 1G291 2R7ZH 1Q1EA 3CQZH 2JA9A 1GKHA 4BBRG 1U5KA 5GAHC 1KC8C 5C44H 2WP8J 2YTXA 4C2MH 4YY3L 1T9HA 4POGA 4OWXB 5M3FG 4JI6L 4A3JH 1EQQA 1PH3A 4DR6Q 4GKKL 3CCEA 1A0IA 3S1MH 4X62Q 1FJGQ 2HQLA 2NN6G 5DLQE 5BR8L 4NXNQ 2B29A 2JA8H 4X64Q 1XPUA 4JBJA 3U58A 4YWKA 5M5YH 5GADC 2UUAL 5JEAG 2XTIA 1EQRA 1EUJA 3GTJH 4BY1H 2ZM6L 2R93G 1UE6A 3I7FA 4L5SA 3UE0A 3CMEA 2XGTA 4WJ4A 1HZAA 1VQCA 3S1QH 4XIGS 1N32Q 1XMOQ 1HNXL 4BXXG 2PI2E 3K80C 3Q8DA 4R4CA 4Y52H 3AQQA 4PZ7A 5GQOA 5C4XH 4A3EG 3PIPA 1UE7A 3H0GG 1NY4A 4IFDG 4DV3Q 4GKJL 2F3IA 3KF8B 2VQEQ 4A3BG 4DR3Q 1VQAA 4UY8C 3GDEA 4WJ3M 1S40A 4K0KQ 3RR5A 2JA5G 3BZCA 4OWWB 3I4NG 4DUZL 3T1HQ 3OW2A 3I4OA 1YI2A 1VQKA 3HOYH 5K36G 5IYCG 5C0XI 2UXBQ 4EX5A 1Z9FA 1YJWA 4DK6C 4GOPA 5AJ3L 1OTCA 1H95A 2IT1A 2N78A 1K3RA 4JI5L 3I55A 4B3ML 3I4MG 1Q8KA 1EIYB 5LMUL 1GO3E 1WJJA 5C4JH 4AQYQ 5IP9G 3DM3A 2F4VQ 2ZJRA 4FDBA 4JI0L 4QJFA 3K7UC 1SFOH 3T1YQ 1EFWA 4LF4L 4P73A 4JV5L 2VS1A 2UU9L 1E1OA 3FKIG 3TREA 4JI3Q 1ASYA 1NTGA 2K50A 5GROA 1Y1WH 1QZGA 4UP8A 3S1NH 4DV0L 1QVGA 4NB3A 5EAYA 4O0AA 1N36L 2BH8A 1N34Q 1SR3A 5IP7G 1IBML 4HJAA 1PHJA 3PO2H 1TWAH 4DV2L 4YWLA 4DUYL 3AFQA 4UP7A 4UP9A 2Z0SA 4HIMA 4A93G 3RLNA 1CKNB 1SRUA 2GN5A 4HJ8A 5JJIA 3AEVA 4BY7H 3CP0A 3HOXH 2VQFL 3CCQA 1PA6A 2N8NA 2I5HA 1EIFA 2KCMA 1VQEA 5M3MH 2QA4A 4DAMA 1P16A 3CCLA 1I6HH 1IBKL 2UXDL 1XNQL 1GVPA 5C0XG 1YHBA 3K7AH 4DK3C 5LMNL 4GN4B 4DR5Q 3F1ZA 4IO9A 4A3IG 4JI1Q 4QIWE 4B3RQ 1IZ6A 1JE5A 4PZ6A 4DV1Q 3SGIA 1YBYA 1LUZA 4RMFA 2RCNA 3J81j 4JBKA 1C9OA 1N9WA 1VQJA 3BZKA 4C3JH 2N3SA 1SROA 3PUWA 2OQ0A 1QUQB 1VQPA 2FXQA 1XNRQ 3U4ZA 1QUQA 3HOVG 4Y7NH 2PI2A 1PV4A 4NXMQ 1OXXK 4BBSG 4IPGA 3HKZE 1HNZQ 4DKAC 2ZTDA 2NVQH 3HOWG 2Y0SG 3KJOA 4GLXA 1X3GA 2AHOB 3BJUA 3RN2A 1YIJA 2WAQG 4LWCA 1KQSA 5FLMG 2I0QA 4LF7L 4JYAQ 1YHQA 1Q1BA 4MNOA 4X66Q 2Q2TA 3CC4A 2CKZB 4DV7L 1HZBA 2A19A 1VQMA 3GTQH 1Y1VG 3KDFA 3TS0A 2YV5A 1Q7YC 4APVA 4NPSA 3CCRA 1KL9A 4LF6Q 4HIDA 3OYYA 1HH2P 2JA7G 1WOCA 4PG3A 3K81C 4LF5Q 3TRZA 1PH6A 3NENA 1YJ9A 4DV5Q 1OXUA 3FP9A 1PH4A 2Q2UA 3CCSA 4DR6L 4L5QA 3RN5A 4KHPQ 5C3EH 4X62L 1FJGL 4MZ9A 1E3PA 3UDGA 4NXNL 4OX9Q 2A8VA 2LXKA 2JEAI 3H3VH 3GTGH 4X64L 4DV6Q 4QQBX 3HOUH 1X65A 2D0OA 3PIOA 3FHWA 2ATWA 2UXCQ 2VNUD 4DR7Q 1EWIA 3NBHB 1KRTA 4XTCS 3AFPA 2NVXH 3DLLA 4B3TQ 4A3GH 3G48A 3H15A 1MJEA 1N32L 1XMOL 1X9NA 2VY3A 2L15A 3TS2A 2UUBQ 1CKOA 1KHIA 3K8AA 1OXVA 4LUVA 4OO1I 4DV3L 3S14H 2VQEL 1E7ZA 2KENA 2YYZA 4DR3L 1W2BA 1IYJB 1L1OC 2JE6I 1B7YB 4ME3A 1XTDA 3JAMc 1S3OA 4LFCQ 3CXCA 4K0KL 1PH5A 1FVIA 4DV4Q 3ZJYC 1M1KC 2MFIA 3F8TA 4A3FG 1SE8A 1HR0W 2R7ZG 1S72A 1BBUA 1RL2A 1TWFH 2EQSA 2N49A 3T1HL 5C44G 2UUCQ 3AYHB 1A63A 2UXBL 3NEMA 1CKMA 3RNUA 4A75A 1VQIA 1UEBA 4PMWA 4A3KH 4A3JG 3A5ZB 2VL6A 5ELNA 1VQOA 1G51A 1MKHA 1HR0Q 2RHSB 2JA8G 4JI7Q 2K5NA 4AQYL 3MEFA 4YHHQ 3CW2C 2QEXA 2F4VL 4DR2Q 1VQHA 2CQOA 4BY1G 4GOPB 3T1YL 2OCEA 1J6QA 2C35B 4GN5A 2QGQA 4L5TA 3ULLA 4DNIA 1YITA 1VQFA 3KJPA 2JA6H 4JI3L 4P72A 2IY5B 3I56A 2OQKA 3JC66 1O7IA 2ALYB 5IP9H 2PNHA 5C4XG 1VQ7A 4GLVB 2ZTEA 2K14A 1N34L 5JJKA 2DUDA 2JJQA 3HKSA 3KYHC 3UE1A 2KBNA 1AE3A 4LF8Q 1I94Q 4BA1I 1YHAA 4MTNA 2WB1E 3STBC 1NJIC 2LSSA 4OO1G 4LW1A 4YWMA 2EIFA 3HOYG 3J80c 4DR1Q 5GAEC 1VQBA 1K8GA 3GTPH 2VUMH 4IOCA 2PQAA 5IE8A 3CCUA 5HGQA 4HIOA 1TWCH 2AMCB 5IYDH 3U50C 3HOZH 1A62A 2E2JH 1X56A 1JJGA 1EYGA 4DR5L 1WFQA 1WCMH 1Q82C 1GD7A 2K4KA 1YNXA 3J81i 4JI1L 2Q2IA 3W1GA 1KIXA 1P8LA 4B3RL 3ER0A 4DR4L 1L1OA 4LFAQ 4DV1L 4X65L 3S15H 2VW9A 1PH7A 3CMAA 4IPDA 5LMUQ 1XNRL 4ALPA 4NXML 1R9TH 3ULJA 2A1AA 2HIVA 1K0RA 3CPWA 3RLFA 4JI0Q 1YZ6A 4POFA 3I2ZA 4JYAL 1X54A 2ID0A 3PO2G 1IL2A 4X66L 1PVOA 3HFZB 5ELOA 5FLXc 3S16H 3LGJA 3S17H 2B3GA 2GVAA 4A3CH 1OXTA 2JK8A 5FJ8H 2RF4A 1D8LA 4BY7G 1Q81C 3GTKH 3HOXG 3F2DA 3RZDH 1CSQA 1I50H 4LF6L 3E0EA 1KRSA 5M3MG 2RHQB 4DPGA 1N8RC 3J7A5 3PO3H 4JI8Q 1FGUA 2E2IH 1SLJA 2Q2HA 1MIUA 4PZ8A 4KHZA 4QL5A 3UDXA 3VDYA 1NE3A 3KDFB 4LF5L 1FL0A 2VZAA 4DV5L 1BBWA 1VQGA 4IJLA 4A3LH 1LYLA 1Z47A 5E7NA 4KHPL 2MQHA 2V1CC 4R4QA 1TWGH 1XPOA 3D31A 4A76A 1J5EQ 4OX9L 1VS0A 4DV6L 1HZCA 3BU2A 1PH1A 3CCJA 4LFBQ 2K5HA 2WB1G 2R92H 1WI5A 4YCWA 5IYBH 2B63H 2UXCL 2I5LX 3PCOB 5IY0A 4DR7L 3TEHB 4B3TL 2BA1A 3E9HA 1KD1C 4A3DH 1D7QA 1VQ9A 1BKBA 3S2HH 1IBLQ 2Z6KC 4JCVE 3G71A 2IHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB L;  4BBR H;  1KXL A;  2LXJ A;  1VQ6 A;  1HNW Q;  2E5L Q;  1W3S A;  3GTL H;  4JI2 Q;  3PF4 A;  4IOA A;  1QVC A;  3PUY A;  4LFC L;  2BH2 A;  4OON A;  5M3F H;  4DAY B;  2JQO A;  4DV4 L;  1XMQ Q;  1SN8 A;  3CCM A;  5IWA Q;  1Q46 A;  2R6G A;  3IRB A;  1PYB A;  2ZJP A;  3J80 i;  4A3M G;  1B70 B;  2YTY A;  2UUC L;  3E9I A;  1VQ5 A;  2ASB A;  1K8A C;  2IHE A;  1I3Q H;  1LM0 A;  2R93 H;  3A5U A;  4TVA B;  1N33 Q;  3KFU A;  2E8G A;  5C3E G;  4AIM A;  3GD7 A;  1PH8 A;  4LF9 Q;  4RG1 A;  3EN2 A;  1HR0 L;  1B8A A;  3M3Y H;  2D0P A;  3CAM A;  4JI7 L;  4BXX H;  3W5O A;  4YHH L;  1M90 C;  2I5M X;  3HOU G;  4DR2 L;  4R4O A;  4R4I A;  4P71 A;  1UWV A;  3H0G H;  4AH6 A;  5IT9 c;  4HIK A;  3OTO Q;  4A3E H;  4A3B H;  1HZ9 A;  1AE2 A;  1KAW A;  2ES2 A;  4A3G G;  3B6Y A;  2HHH Q;  3HKZ G;  2JA5 H;  3W1B A;  3L7Z C;  2EXD A;  2PMZ E;  4B3S Q;  4IPH A;  3GTO H;  3I4N H;  3KOJ A;  1A8V A;  3PV0 A;  1Q12 A;  1WYD A;  5IYC H;  1XPR A;  4YY3 Q;  2KCT A;  5M5W H;  4YCV A;  4J15 A;  3WWV A;  3M4P A;  4HJ5 A;  1LTL A;  4UPA A;  3RZO H;  1VQN A;  4IPC A;  1UE5 A;  4C3I H;  4JI6 Q;  1YJN A;  1YEZ A;  1I94 L;  4LF8 L;  1TWH H;  2D62 A;  4GKK Q;  3I4M H;  1OXS C;  3CC2 A;  1X6O A;  2OTJ A;  5BR8 Q;  2GVB A;  4DR1 L;  1Q86 C;  4TQU S;  1QZH A;  1VQD A;  2DGY A;  2UUA Q;  4JI4 L;  4H02 A;  1PH9 A;  2OTL A;  1CUK A;  4LUZ A;  2ZM6 Q;  4A3K G;  1VQL A;  1MJC A;  3PSI A;  2Z6K A;  3FKI H;  4R1J A;  2MO0 A;  1HNX Q;  1VQ4 A;  5J3B A;  2HIX A;  2Y0S E;  1VCI A;  3PUX A;  2WAQ E;  3PUZ A;  4YCU A;  4GKJ Q;  1AH9 A;  2PQA B;  1X3F A;  4LFA L;  1PH2 A;  3PF5 A;  1BVS A;  4QY7 A;  1K9M C;  1I5F A;  2JA6 G;  3ERS X;  5IP7 H;  1IXR A;  4IJH A;  1XJV A;  2R7F A;  4KLK A;  1YVC A;  2IX0 A;  2F52 A;  2K75 A;  3GO5 A;  4DUZ Q;  1U0L A;  3J7Z C;  4A93 H;  4LNQ A;  4JG2 A;  3KF6 B;  1K83 H;  2ZTC A;  4JOI A;  1NMF A;  2CCZ A;  2YU9 H;  3KF6 A;  2IX1 A;  1L1O B;  2NVY H;  3S1R H;  5AJ3 Q;  1X55 A;  4AYB E;  2CFM A;  2HT1 A;  2KHI A;  4JI5 Q;  4OXP A;  4X6A H;  4B3M Q;  2AWO A;  1Y1W G;  1JJC B;  4OWT B;  3CCV A;  5JJL A;  1TXY A;  5JEA J;  4QGU A;  4A3I H;  1E1T A;  1VQ8 A;  4GNX C;  2VUM G;  3M4O H;  4LF4 Q;  1PFS A;  3A74 A;  4C3H H;  4L5R C;  4P74 A;  5IYD G;  2MO1 A;  4JV5 Q;  3G6E A;  4JI8 L;  1NMG A;  2UU9 Q;  4JBW A;  3A0J A;  3HOZ G;  1HNZ L;  1E22 A;  3KLW A;  5HY6 A;  3ULP A;  2OWO A;  3GTM H;  1WCM G;  3RLO A;  1GM5 A;  4KI0 A;  3MXN B;  3HOV H;  3CPF A;  1CKN A;  2YTV A;  4IFD J;  4DV0 Q;  4BBS H;  3CC7 A;  2K5V A;  1N36 Q;  3M9B A;  3HOW H;  1G6P A;  3JAM i;  3EIV A;  2NZH A;  2MNA A;  3S24 A;  1E24 A;  4GS3 A;  2NZO A;  4A4I A;  1IBM Q;  5FLM H;  1J5E L;  1V1Q A;  2CWA A;  1K73 C;  1V43 A;  4DV2 Q;  4P75 A;  5LMN W;  4DUY Q;  1JJ2 A;  4LFB L;  2CWP A;  4R4T A;  1Y1V H;  1RIP A;  2AWN A;  3H3V I;  3CD6 A;  2K52 A;  3M7N A;  4BA2 I;  2KHJ A;  4LUO A;  4DR4 Q;  2JEB I;  1SMX A;  2VQF Q;  4X65 Q;  1X3E A;  1IBL L;  2E2H H;  3M4Q A;  2UXD Q;  3D0F A;  1CSP A;  5H1S E;  1IBK Q;  1XNQ Q;  2H5X A;  3G4S A;  2JA7 H;  4HJ9 A;  5LMN Q;  1HNW L;  4EQ5 A;  2NN6 I;  4GLA C;  3F2B A;  5FJ8 G;  1DGS A;  1UE1 A;  2E5L L;  3UDI A;  4JI2 L;  4A3C G;  4GN3 B;  1EOV A;  2NVT H;  3CF5 A;  1ASZ A;  1XMQ L;  1L2F A;  3PO3 G;  1HJP A;  5IWA L;  1PYS B;  1C0A A;  4JI4 Q;  2WFW A;  3L0O A;  3PGZ A;  3TQY A;  1V9P A;  3UDF A;  2ZJQ A;  5GAG C;  1QVF A;  4JC0 A;  3K0X A;  4A3L G;  3L2P A;  1L0W A;  4GOP C;  5M5X H;  1N33 L;  2BA0 A;  3M85 A;  4IFD I;  3NEL A;  4LF7 Q;  4O2D A;  1JB7 A;  4LF9 L;  1JT8 A;  3F2C A;  1NBW A;  4JBM A;  4A3M H;  4AYB G;  1C7Y A;  4DV7 Q;  3STB D;  1Y14 B;  3ICE A;  2R92 G;  2AKW B;  4GNX B;  5IYB G;  3S2D H;  2B63 G;  3PUV A;  4JOI C;  3U4V A;  3J81 c;  3OTO L;  4HJ7 A;  4GNX A;  2R7D A;  1JMC A;  4A3D G;  2HHH L;  4A3F H;  4B3S L;  5C0X J;  3EBE A;  1G29 1;  2R7Z H;  1Q1E A;  3CQZ H;  2JA9 A;  1GKH A;  4BBR G;  1U5K A;  5GAH C;  1KC8 C;  5C44 H;  2WP8 J;  2YTX A;  4C2M H;  4YY3 L;  1T9H A;  4POG A;  4OWX B;  5M3F G;  4JI6 L;  4A3J H;  1EQQ A;  1PH3 A;  4DR6 Q;  4GKK L;  3CCE A;  1A0I A;  3S1M H;  4X62 Q;  1FJG Q;  2HQL A;  2NN6 G;  5DLQ E;  5BR8 L;  4NXN Q;  2B29 A;  2JA8 H;  4X64 Q;  1XPU A;  4JBJ A;  3U58 A;  4YWK A;  5M5Y H;  5GAD C;  2UUA L;  5JEA G;  2XTI A;  1EQR A;  1EUJ A;  3GTJ H;  4BY1 H;  2ZM6 L;  2R93 G;  1UE6 A;  3I7F A;  4L5S A;  3UE0 A;  3CME A;  2XGT A;  4WJ4 A;  1HZA A;  1VQC A;  3S1Q H;  4XIG S;  1N32 Q;  1XMO Q;  1HNX L;  4BXX G;  2PI2 E;  3K80 C;  3Q8D A;  4R4C A;  4Y52 H;  3AQQ A;  4PZ7 A;  5GQO A;  5C4X H;  4A3E G;  3PIP A;  1UE7 A;  3H0G G;  1NY4 A;  4IFD G;  4DV3 Q;  4GKJ L;  2F3I A;  3KF8 B;  2VQE Q;  4A3B G;  4DR3 Q;  1VQA A;  4UY8 C;  3GDE A;  4WJ3 M;  1S40 A;  4K0K Q;  3RR5 A;  2JA5 G;  3BZC A;  4OWW B;  3I4N G;  4DUZ L;  3T1H Q;  3OW2 A;  3I4O A;  1YI2 A;  1VQK A;  3HOY H;  5K36 G;  5IYC G;  5C0X I;  2UXB Q;  4EX5 A;  1Z9F A;  1YJW A;  4DK6 C;  4GOP A;  5AJ3 L;  1OTC A;  1H95 A;  2IT1 A;  2N78 A;  1K3R A;  4JI5 L;  3I55 A;  4B3M L;  3I4M G;  1Q8K A;  1EIY B;  5LMU L;  1GO3 E;  1WJJ A;  5C4J H;  4AQY Q;  5IP9 G;  3DM3 A;  2F4V Q;  2ZJR A;  4FDB A;  4JI0 L;  4QJF A;  3K7U C;  1SFO H;  3T1Y Q;  1EFW A;  4LF4 L;  4P73 A;  4JV5 L;  2VS1 A;  2UU9 L;  1E1O A;  3FKI G;  3TRE A;  4JI3 Q;  1ASY A;  1NTG A;  2K50 A;  5GRO A;  1Y1W H;  1QZG A;  4UP8 A;  3S1N H;  4DV0 L;  1QVG A;  4NB3 A;  5EAY A;  4O0A A;  1N36 L;  2BH8 A;  1N34 Q;  1SR3 A;  5IP7 G;  1IBM L;  4HJA A;  1PHJ A;  3PO2 H;  1TWA H;  4DV2 L;  4YWL A;  4DUY L;  3AFQ A;  4UP7 A;  4UP9 A;  2Z0S A;  4HIM A;  4A93 G;  3RLN A;  1CKN B;  1SRU A;  2GN5 A;  4HJ8 A;  5JJI A;  3AEV A;  4BY7 H;  3CP0 A;  3HOX H;  2VQF L;  3CCQ A;  1PA6 A;  2N8N A;  2I5H A;  1EIF A;  2KCM A;  1VQE A;  5M3M H;  2QA4 A;  4DAM A;  1P16 A;  3CCL A;  1I6H H;  1IBK L;  2UXD L;  1XNQ L;  1GVP A;  5C0X G;  1YHB A;  3K7A H;  4DK3 C;  5LMN L;  4GN4 B;  4DR5 Q;  3F1Z A;  4IO9 A;  4A3I G;  4JI1 Q;  4QIW E;  4B3R Q;  1IZ6 A;  1JE5 A;  4PZ6 A;  4DV1 Q;  3SGI A;  1YBY A;  1LUZ A;  4RMF A;  2RCN A;  3J81 j;  4JBK A;  1C9O A;  1N9W A;  1VQJ A;  3BZK A;  4C3J H;  2N3S A;  1SRO A;  3PUW A;  2OQ0 A;  1QUQ B;  1VQP A;  2FXQ A;  1XNR Q;  3U4Z A;  1QUQ A;  3HOV G;  4Y7N H;  2PI2 A;  1PV4 A;  4NXM Q;  1OXX K;  4BBS G;  4IPG A;  3HKZ E;  1HNZ Q;  4DKA C;  2ZTD A;  2NVQ H;  3HOW G;  2Y0S G;  3KJO A;  4GLX A;  1X3G A;  2AHO B;  3BJU A;  3RN2 A;  1YIJ A;  2WAQ G;  4LWC A;  1KQS A;  5FLM G;  2I0Q A;  4LF7 L;  4JYA Q;  1YHQ A;  1Q1B A;  4MNO A;  4X66 Q;  2Q2T A;  3CC4 A;  2CKZ B;  4DV7 L;  1HZB A;  2A19 A;  1VQM A;  3GTQ H;  1Y1V G;  3KDF A;  3TS0 A;  2YV5 A;  1Q7Y C;  4APV A;  4NPS A;  3CCR A;  1KL9 A;  4LF6 Q;  4HID A;  3OYY A;  1HH2 P;  2JA7 G;  1WOC A;  4PG3 A;  3K81 C;  4LF5 Q;  3TRZ A;  1PH6 A;  3NEN A;  1YJ9 A;  4DV5 Q;  1OXU A;  3FP9 A;  1PH4 A;  2Q2U A;  3CCS A;  4DR6 L;  4L5Q A;  3RN5 A;  4KHP Q;  5C3E H;  4X62 L;  1FJG L;  4MZ9 A;  1E3P A;  3UDG A;  4NXN L;  4OX9 Q;  2A8V A;  2LXK A;  2JEA I;  3H3V H;  3GTG H;  4X64 L;  4DV6 Q;  4QQB X;  3HOU H;  1X65 A;  2D0O A;  3PIO A;  3FHW A;  2ATW A;  2UXC Q;  2VNU D;  4DR7 Q;  1EWI A;  3NBH B;  1KRT A;  4XTC S;  3AFP A;  2NVX H;  3DLL A;  4B3T Q;  4A3G H;  3G48 A;  3H15 A;  1MJE A;  1N32 L;  1XMO L;  1X9N A;  2VY3 A;  2L15 A;  3TS2 A;  2UUB Q;  1CKO A;  1KHI A;  3K8A A;  1OXV A;  4LUV A;  4OO1 I;  4DV3 L;  3S14 H;  2VQE L;  1E7Z A;  2KEN A;  2YYZ A;  4DR3 L;  1W2B A;  1IYJ B;  1L1O C;  2JE6 I;  1B7Y B;  4ME3 A;  1XTD A;  3JAM c;  1S3O A;  4LFC Q;  3CXC A;  4K0K L;  1PH5 A;  1FVI A;  4DV4 Q;  3ZJY C;  1M1K C;  2MFI A;  3F8T A;  4A3F G;  1SE8 A;  1HR0 W;  2R7Z G;  1S72 A;  1BBU A;  1RL2 A;  1TWF H;  2EQS A;  2N49 A;  3T1H L;  5C44 G;  2UUC Q;  3AYH B;  1A63 A;  2UXB L;  3NEM A;  1CKM A;  3RNU A;  4A75 A;  1VQI A;  1UEB A;  4PMW A;  4A3K H;  4A3J G;  3A5Z B;  2VL6 A;  5ELN A;  1VQO A;  1G51 A;  1MKH A;  1HR0 Q;  2RHS B;  2JA8 G;  4JI7 Q;  2K5N A;  4AQY L;  3MEF A;  4YHH Q;  3CW2 C;  2QEX A;  2F4V L;  4DR2 Q;  1VQH A;  2CQO A;  4BY1 G;  4GOP B;  3T1Y L;  2OCE A;  1J6Q A;  2C35 B;  4GN5 A;  2QGQ A;  4L5T A;  3ULL A;  4DNI A;  1YIT A;  1VQF A;  3KJP A;  2JA6 H;  4JI3 L;  4P72 A;  2IY5 B;  3I56 A;  2OQK A;  3JC6 6;  1O7I A;  2ALY B;  5IP9 H;  2PNH A;  5C4X G;  1VQ7 A;  4GLV B;  2ZTE A;  2K14 A;  1N34 L;  5JJK A;  2DUD A;  2JJQ A;  3HKS A;  3KYH C;  3UE1 A;  2KBN A;  1AE3 A;  4LF8 Q;  1I94 Q;  4BA1 I;  1YHA A;  4MTN A;  2WB1 E;  3STB C;  1NJI C;  2LSS A;  4OO1 G;  4LW1 A;  4YWM A;  2EIF A;  3HOY G;  3J80 c;  4DR1 Q;  5GAE C;  1VQB A;  1K8G A;  3GTP H;  2VUM H;  4IOC A;  2PQA A;  5IE8 A;  3CCU A;  5HGQ A;  4HIO A;  1TWC H;  2AMC B;  5IYD H;  3U50 C;  3HOZ H;  1A62 A;  2E2J H;  1X56 A;  1JJG A;  1EYG A;  4DR5 L;  1WFQ A;  1WCM H;  1Q82 C;  1GD7 A;  2K4K A;  1YNX A;  3J81 i;  4JI1 L;  2Q2I A;  3W1G A;  1KIX A;  1P8L A;  4B3R L;  3ER0 A;  4DR4 L;  1L1O A;  4LFA Q;  4DV1 L;  4X65 L;  3S15 H;  2VW9 A;  1PH7 A;  3CMA A;  4IPD A;  5LMU Q;  1XNR L;  4ALP A;  4NXM L;  1R9T H;  3ULJ A;  2A1A A;  2HIV A;  1K0R A;  3CPW A;  3RLF A;  4JI0 Q;  1YZ6 A;  4POF A;  3I2Z A;  4JYA L;  1X54 A;  2ID0 A;  3PO2 G;  1IL2 A;  4X66 L;  1PVO A;  3HFZ B;  5ELO A;  5FLX c;  3S16 H;  3LGJ A;  3S17 H;  2B3G A;  2GVA A;  4A3C H;  1OXT A;  2JK8 A;  5FJ8 H;  2RF4 A;  1D8L A;  4BY7 G;  1Q81 C;  3GTK H;  3HOX G;  3F2D A;  3RZD H;  1CSQ A;  1I50 H;  4LF6 L;  3E0E A;  1KRS A;  5M3M G;  2RHQ B;  4DPG A;  1N8R C;  3J7A 5;  3PO3 H;  4JI8 Q;  1FGU A;  2E2I H;  1SLJ A;  2Q2H A;  1MIU A;  4PZ8 A;  4KHZ A;  4QL5 A;  3UDX A;  3VDY A;  1NE3 A;  3KDF B;  4LF5 L;  1FL0 A;  2VZA A;  4DV5 L;  1BBW A;  1VQG A;  4IJL A;  4A3L H;  1LYL A;  1Z47 A;  5E7N A;  4KHP L;  2MQH A;  2V1C C;  4R4Q A;  1TWG H;  1XPO A;  3D31 A;  4A76 A;  1J5E Q;  4OX9 L;  1VS0 A;  4DV6 L;  1HZC A;  3BU2 A;  1PH1 A;  3CCJ A;  4LFB Q;  2K5H A;  2WB1 G;  2R92 H;  1WI5 A;  4YCW A;  5IYB H;  2B63 H;  2UXC L;  2I5L X;  3PCO B;  5IY0 A;  4DR7 L;  3TEH B;  4B3T L;  2BA1 A;  3E9H A;  1KD1 C;  4A3D H;  1D7Q A;  1VQ9 A;  1BKB A;  3S2H H;  1IBL Q;  2Z6K C;  4JCV E;  3G71 A;  2IHF A; 
#chains in the Genus database with same CATH topology
 1DJR D;  1GJX A;  2E5L Q;  2HDM A;  1A3V A;  3BZD B;  1JR0 D;  4OON A;  5M3F H;  2E75 C;  1XMQ Q;  4GZY C;  5FLX E;  4DAY A;  1DYQ A;  4RGT A;  2NN6 H;  4K5W A;  2ZJP A;  1B70 B;  1PYW D;  5EPK A;  1FNV A;  3DEO A;  4I65 A;  2DY8 A;  2HDL A;  1TWG B;  2R93 H;  3EQL C;  4TVA B;  3A5U A;  3TP6 A;  2E8G A;  3GD7 A;  3DM1 A;  4RG1 A;  1HR0 L;  4BXX H;  1ZYR D;  4JI7 L;  5KYI A;  4EGV A;  2AUJ D;  2I5M X;  2JN4 A;  1PTO F;  4A3E H;  1UWV A;  1EZ8 A;  2XIW A;  5JVG 3;  1AE2 A;  2ES2 A;  4A3G G;  3B6Y A;  1SYB A;  4NKL A;  3HKZ G;  2EXD A;  2PMZ E;  3GTO H;  4IPH A;  1A8V A;  1Q12 A;  3NTK A;  5IYC H;  2QDL A;  3QR8 A;  5M5W H;  4J15 A;  3WWV A;  1VQN A;  1YJN A;  1JCK B;  1NR2 A;  1TWH H;  4GKK Q;  3HZX A;  1RTO A;  1X6O A;  2OTJ A;  1PRT D;  2GVB A;  2EVB A;  1QZH A;  1VQD A;  4IAL A;  4UDU C;  2DGY A;  3M3Y B;  4JPB W;  1MJC A;  2PW5 A;  2MO0 A;  1BNZ A;  1SMY C;  1JQY D;  1BVS A;  1RD9 D;  3J81 L;  3I4N B;  3L9A X;  2R7F A;  1Y8N B;  2F52 A;  2L12 A;  3FDT A;  3GO5 A;  3KLR A;  1U0L A;  2XN9 C;  4A93 H;  3QWN A;  4C3I B;  2ZTC A;  2YU9 H;  1VF5 C;  4DXF A;  3NUC A;  2NVY H;  5NUC A;  1I4P A;  4AYB E;  3A55 A;  4B3M Q;  3H91 A;  1YNJ C;  1PFB A;  4OWT B;  1GUO A;  3CCV A;  1FNU A;  3BVG A;  5I9P A;  2XVS A;  5IYD G;  1B4O A;  2UU9 Q;  2Q8R E;  1UNS A;  1X3P A;  1HNZ L;  1E22 A;  5JPM C;  5A2Q L;  5HY6 A;  3ULP A;  2JSO A;  1MHW C;  3M9B A;  3HOZ B;  2MNA A;  4A4I A;  1ZKO A;  1J5E L;  1V1Q A;  1JJ2 A;  1AP0 A;  2ICE C;  4LFB L;  2CWP A;  1Y1V H;  5EPJ A;  2K52 A;  1D5M C;  4X65 Q;  2E2H H;  3A8I E;  1R9T B;  1WTW A;  4C3J G;  1XNQ Q;  1C48 A;  1EYD A;  1HCZ A;  3TP8 A;  1HNW L;  4A3C G;  2DNE A;  3F2B A;  4G7Z C;  1DGS A;  4JI2 L;  3UDI A;  4EQO A;  4GN3 B;  1EOV A;  2NVT H;  1SNQ A;  4B9X A;  1L2F A;  3W2D A;  5T1G A;  5CMD A;  1QJO A;  1PYS B;  1DOL A;  2Z1C A;  4RGN A;  1CT1 D;  3TQY A;  1QVF A;  2X6G A;  2WAQ B;  3MTS A;  2Z9H A;  4A3L G;  3L2P A;  1L0W A;  1N33 L;  2EY5 A;  5CBA E;  3NEL A;  4LF7 Q;  4LF9 L;  3VR6 A;  1STB A;  3F2C A;  1JT8 A;  4DV7 Q;  1Y14 B;  2MP1 A;  3QO2 A;  5IYB G;  4FF2 A;  4JOI C;  4RKB A;  3U4V A;  3J81 c;  3A7L A;  4HJ7 A;  4WJW A;  2EJF C;  3T13 A;  4A3D G;  1O7Y A;  2R7Z H;  1G29 1;  3C1F A;  1KC8 C;  1U5K A;  5C44 H;  4C2M H;  1SNP A;  3I72 A;  2YTX A;  1KDC A;  3S2H B;  3P20 A;  4G7H C;  4A3J H;  1EQQ A;  3S1M H;  4XT3 B;  2PQE A;  5BR8 L;  2B29 A;  4X64 Q;  1G2S A;  3A56 A;  4YWK A;  5M5Y H;  2D2C C;  2DY7 A;  2PW7 A;  5M3F B;  1J8I A;  5ISR A;  3W3A A;  1EQR A;  4CKC A;  5EKK A;  2ZM6 L;  2P5Z X;  3QG1 A;  1LT3 D;  1CZW A;  3PQI A;  4TKO B;  5KGU A;  1N32 Q;  1G2T A;  3MEH A;  2PI2 E;  1VMP A;  3K80 C;  4R4C A;  4PZ7 A;  5D3I B;  5G3L F;  3BS1 A;  1LTB D;  1DZ1 A;  5BN3 A;  2F3V A;  1TKW B;  2JA5 G;  4U68 A;  1ESR A;  1GUT A;  2Q8T A;  4OO1 H;  3T1H Q;  3OW2 A;  1VQK A;  2MUY A;  4GOP A;  3OHX C;  1OTC A;  1X32 A;  1K3R A;  1TVX A;  2KQ3 A;  4RGM A;  1B3A A;  3OIP A;  5LMU L;  1GO3 E;  1WJJ A;  4AQY Q;  2AQ2 B;  5KIX A;  4JI0 L;  4QJF A;  4P73 A;  4X3T A;  1LV9 A;  4JI3 Q;  5C4X B;  1Y1W H;  5IOD A;  1QVG A;  4NB3 A;  4X3S A;  5EAY A;  1PZJ D;  1N36 L;  5COY A;  3TN2 A;  1I4X A;  5CV9 A;  3VR3 A;  1ZYR C;  4CKB A;  5IP7 G;  1IBM L;  1HFG A;  3OPO A;  2K5D A;  3H94 A;  5ELE A;  5JJI A;  1JOO A;  5EKI A;  4BY7 H;  1JWM D;  2VQF L;  5E4W C;  5ELD A;  1G8Z D;  3VA5 A;  1U9R A;  3MFY A;  1EIF A;  2F3W A;  1EIH A;  1F9Q A;  2RQX A;  1P16 A;  2IL8 A;  3MWY W;  3SK8 A;  2UXD L;  4GN4 B;  4A3I G;  1IZ6 A;  4PZ6 A;  4JBK A;  1LUZ A;  2RCN A;  3K0Y A;  1PRT C;  4JI4 L;  1LAB A;  1VQJ A;  3DMU A;  2N3S A;  3A54 A;  2OQ0 A;  1QUQ A;  4NXM Q;  2PCF B;  1DXM A;  4CJ0 B;  3NWS A;  1NNX A;  3KJO A;  3RN2 A;  2F0D A;  3BJU A;  1AZP A;  1V1O A;  1YIJ A;  5FLM G;  5IIF A;  5D65 A;  1U4L A;  4CBV A;  1KNA A;  3GTQ H;  3KDF A;  4XDX A;  1GUS A;  2YV5 A;  5J1Z A;  1U4P A;  1KL9 A;  4LF6 Q;  4HID A;  3K7A B;  5T1I A;  1QG7 A;  2JA7 G;  4LF5 Q;  3TRZ A;  3AB9 A;  2HCC A;  3ND8 A;  4DV5 Q;  1OXU A;  2Q2U A;  1ENC A;  4KHV A;  3D6C A;  4L5Q A;  4F88 A;  4X62 L;  3UDG A;  4DNT B;  3HOU H;  2K1B A;  1X3Q A;  1QE6 A;  2WV6 D;  3BDL A;  2VNU D;  2NVX H;  1SYF A;  3DLL A;  4BS9 A;  3OMG A;  1QNU A;  2L15 A;  1MGS A;  1CKO A;  2K7V A;  1OXV A;  1TS3 A;  2A6H D;  4G7O C;  4DV3 L;  1IKM A;  1NCV A;  1IYJ B;  1ESF A;  1B7Y B;  4K0K L;  1PH5 A;  2MFI A;  1SE8 A;  3O13 A;  3AYH B;  4DGZ A;  1A63 A;  2UXB L;  3ND9 A;  3CHB D;  5C3E B;  4ZK9 B;  2TSS A;  1UEB A;  2KCC A;  1F77 A;  2R7Z B;  4JK1 C;  5C44 B;  3PIP 3;  2RDG A;  1HR0 Q;  2WII B;  2JA8 G;  4JI7 Q;  3MEF A;  5K36 H;  1E0B A;  2F4V L;  5C4Z A;  4GOP B;  2OCE A;  4L5T A;  1VQF A;  4P72 A;  3IFD A;  2EZV A;  1A2T A;  2IY5 B;  3JC6 6;  1K3B C;  1O7I A;  3A8J E;  1VQ7 A;  5JJK A;  3E6Z X;  2JJQ A;  3HKS A;  2B8G A;  4CDF C;  4K5V A;  4MTN A;  2WB1 E;  3DWQ A;  1A15 A;  1NUC A;  1TY0 A;  3J7Y W;  2K5W A;  2PQA A;  3CCU A;  4HIO A;  4RA8 A;  3U50 C;  4KD3 A;  4K8I A;  1WCM H;  1GD7 A;  5EGT A;  2JA6 B;  1P8L A;  5IT9 L;  2J0T D;  4X65 L;  3S15 H;  1H9R A;  3BYT B;  2B39 A;  2VW9 A;  1U4R A;  3IFT A;  3V96 A;  4I7A A;  2F0M A;  3RLF A;  1WTO A;  1YZ6 A;  2A6E D;  1Y8P B;  2FJ2 A;  1SE3 A;  1Y1W B;  5I6W A;  2ID0 A;  1B9N A;  2OXP A;  3OWF A;  3LGJ A;  4EQP A;  2B3G A;  2JK8 A;  5FJ8 H;  2RF4 A;  1CSQ A;  3TBI B;  2EYJ A;  3E0E A;  2L4N A;  3K6O A;  1OO9 B;  1HNZ Q;  2RSO A;  3KDF B;  1SNC A;  1KDA A;  1BBW A;  1VQG A;  1Z47 A;  4KHP L;  2MQH A;  2V1C C;  4R4Q A;  1TWG H;  4KKT A;  1J5E Q;  3HS0 C;  1VS0 A;  2PNR C;  1BR9 A;  4LFB Q;  4ZUI A;  1EU4 A;  2UXC L;  1SYD A;  4DR7 L;  2CW0 D;  1ROD A;  2BA1 A;  3E9H A;  4B3T L;  3WOE A;  1I6V C;  4JCV E;  3KK7 A;  2UUB L;  3RZD B;  5KNB A;  1HNW Q;  1W3S A;  2PZW A;  4JI2 Q;  1QVC A;  3PUY A;  2E2I B;  2BH2 A;  2F0W A;  1LTS D;  3CCM A;  1Q46 A;  2R6G A;  1PYB A;  2A68 D;  2IW3 A;  1STG A;  3DEP A;  4A3M G;  2B2Y A;  5JEA H;  5LHY 1;  1N33 Q;  4LF9 Q;  3M3Y H;  2D0P A;  3R8B A;  5HUR A;  4YHH L;  2G9D A;  4DR2 L;  4HIK A;  5IT9 c;  4AH6 A;  1S5E D;  2FMC A;  4IFD H;  1HZ9 A;  1NAP A;  1J9O A;  4BBR B;  4CGY B;  5DM6 3;  3I4N H;  4ODG A;  1MSH A;  1G91 A;  1XPR A;  1BCP D;  1LTL A;  4UPA A;  4C3I H;  1UE5 A;  4LF8 L;  1SNM A;  2D62 A;  1R4Q B;  1XTC D;  2NUC A;  1CQV A;  1HA6 A;  5BR8 Q;  2N88 A;  4H02 A;  2ZM6 Q;  4G4K A;  3EVQ A;  3PSI A;  2EE1 A;  3FKI H;  4R1J A;  1LTR D;  3TME A;  5J3B A;  2MJ8 A;  4PQX A;  2Y0S E;  1XXG A;  3PUX A;  4K6D A;  1AH9 A;  2PQA B;  1X3F A;  3D4W A;  4RCO A;  4QY7 A;  1K9M C;  3R2I A;  3F2U A;  1XJV A;  2IX0 A;  2K75 A;  4PMC A;  4LNQ A;  4JG2 A;  5DAU A;  5COR A;  3I4M B;  1TY2 A;  4FNF A;  2KHI A;  5EKL A;  4X6A H;  2EY2 A;  2A6H C;  5DEH A;  1JJC B;  4XQN A;  4MIU A;  2E74 C;  4QGU A;  1V8Q A;  2VUM G;  3SEB A;  1PFS A;  4L5R C;  1TS5 A;  3HOZ G;  4XYO A;  5FO7 B;  1TQO A;  1PZK D;  2CHB D;  3KLW A;  5CGK A;  4KI0 A;  2YTV A;  4BBS H;  3CC7 A;  2K5V A;  1CHQ D;  1N36 Q;  1G6P A;  1HUN A;  2NZH A;  4KKU A;  3E3X A;  4GS3 A;  1IBM Q;  5LL6 X;  3NQT A;  3NWT A;  3LX0 A;  3S1R B;  5CBE E;  2XRQ D;  3S9W A;  4BA2 I;  4DR4 Q;  2JEB I;  2VQF Q;  4OGQ C;  1IBL L;  4F8M A;  3M4Q A;  1WTP A;  2I46 A;  2UXD Q;  5H1S E;  4G57 A;  4KY6 A;  4QMG A;  4C3H B;  1UE1 A;  3NE5 B;  5IOC A;  3PO3 G;  3HOV B;  2NTS A;  2SEB D;  3Q24 A;  2RVL A;  4JI4 Q;  3L0O A;  2ZJQ A;  3HOW B;  4CJ1 B;  2DJG C;  4JC0 A;  1W6K A;  3K0X A;  4FYD A;  3ERQ A;  4GOP C;  3SK5 A;  3D4D A;  3I4L A;  4JBM A;  3ICE A;  2R92 G;  3H6M A;  4GNX B;  1QOH A;  1SAP A;  1JWU D;  2R61 A;  5C0X J;  4B3S L;  3PMF A;  2JA9 A;  2F1M A;  3EJI A;  2WP8 J;  1E2Z A;  2B2V A;  2A6E C;  2E76 C;  1IYV A;  1T9H A;  5C3W A;  5M3F G;  4JI6 L;  4CDC C;  3NBH A;  3CCE A;  1A0I A;  4X62 Q;  2NN6 G;  1SYE A;  4ZYS A;  4JBJ A;  3MXG A;  2UUA L;  1F9R A;  1M8A A;  2R93 G;  1QB5 D;  2PO4 A;  1HZA A;  4XIG S;  3S2D B;  4BXX G;  2ZT9 C;  3Q8D A;  3AQQ A;  5C4X H;  4A3E G;  3PIP A;  2EDG A;  4GKJ L;  4DV3 Q;  5C6A A;  2QF7 A;  4A3F B;  1DCZ A;  4WJ3 M;  3CQZ B;  1S40 A;  4K0K Q;  3T53 B;  4DUZ L;  5EPL A;  5IGF A;  3I4O A;  4R8I A;  4K14 A;  5IYC G;  2CW0 C;  2UXB Q;  1Z9F A;  1YJW A;  3NK9 A;  1ENF A;  4Q0F A;  5AJ3 L;  5EBC A;  1HFN A;  2N78 A;  2HCI A;  4JI5 L;  3I55 A;  1KLU D;  1A3U A;  4BY1 B;  2F4V Q;  3IKJ A;  4FDB A;  3KBG A;  1EFW A;  4LF4 L;  2VS1 A;  1SND A;  3M4Y A;  2A68 C;  4X3K A;  3LNN A;  4P2C B;  2K50 A;  4IUP A;  2F0F A;  1QCB D;  1I4Q A;  1PRT F;  1ILP A;  2AQ1 B;  3FKI B;  2XWB B;  1L0Y B;  4V19 0;  3HOY B;  3JAM L;  3CRK C;  2B2U C;  4DUY L;  3AFQ A;  4HCS A;  4UP9 A;  2Z0S A;  4A93 G;  3RLN A;  2GN5 A;  3AEV A;  2QKI C;  1PA6 A;  3NXW A;  1Y8O B;  3SR1 A;  1EY6 A;  1GHJ A;  5M3M H;  1U4M A;  1DOK A;  4ZQ3 A;  4DAM A;  1VMC A;  3CCL A;  1IBK L;  1GVP A;  2EPB A;  5C0X G;  3K7A H;  1BCP C;  4IO9 A;  1LT4 D;  1EL0 A;  1WVL A;  4QIW E;  1B50 A;  4Q5V A;  1YBY A;  3S1N B;  1XWE A;  4ILW A;  3X3M A;  1C9O A;  3BZK A;  4C3J H;  1VQP A;  2FXQ A;  4QUC A;  1OXX K;  2F0O A;  2JXM B;  4CKE A;  4IPG A;  3K5N A;  2K28 A;  5IGG A;  2QW7 A;  4KD4 A;  3PO2 B;  1R4P B;  2Y0S G;  1SDF A;  1X3G A;  2AHO B;  3M7N A;  4LWC A;  2I0Q A;  4KN7 C;  1CTM A;  5FK9 C;  3CC4 A;  2CKZ B;  4BBS B;  2A19 A;  1EWC A;  3HOX B;  1Y1V G;  3TS0 A;  3G6J B;  1Q7Y C;  1B9M A;  3H09 A;  4APV A;  4NPS A;  3J80 L;  1EY4 A;  1JB3 A;  1I6H B;  2DJF C;  4RWS C;  2NZ1 D;  4NDX A;  1UEA B;  2O4X A;  1Q3L A;  1YJ9 A;  3FP9 A;  1PH4 A;  3CCS A;  1ET9 A;  3RN5 A;  4KHP Q;  5C3E H;  1FJG L;  2F0T A;  4MZ9 A;  1E3P A;  2JEA I;  2LXK A;  4O42 A;  4R8N A;  1D5X C;  4HED A;  2ATW A;  3MZ5 A;  3FPP A;  2UXC Q;  5I6Y A;  4DR7 Q;  1GUG A;  3NBH B;  4B3T Q;  4XTC S;  3H15 A;  1MJE A;  3LWU A;  2EJG C;  2UUB Q;  3IAY A;  3GV3 A;  1B53 A;  5FLX L;  4RH6 A;  3S14 H;  2VQE L;  2KEN A;  4DR3 L;  1W2B A;  1FR3 A;  2JE6 I;  1EOT A;  1IW7 D;  1UUP A;  3JAM c;  1S3O A;  3ZJY C;  4DK0 A;  2VXW A;  2R7Z G;  5ELF A;  2N49 A;  1C8C A;  2EQS A;  5C44 G;  3NEM A;  3RNU A;  3RD4 A;  1VQI A;  3CKI B;  4A3K H;  4A3J G;  1ZEQ X;  3A5Z B;  2VL6 A;  1WTQ A;  1T5E A;  2ZXO A;  3BYY B;  5ELN A;  1VQO A;  1WD0 A;  2RHS B;  1JOQ A;  2F0I A;  2K04 A;  3P7J A;  4YHH Q;  2QEX A;  4A3G B;  4DR2 Q;  3HKZ B;  3T1Y L;  1J6Q A;  2C35 B;  2B2W A;  4GN5 A;  1S5D D;  3KJP A;  2JA6 H;  4ZLT F;  1K0S A;  1EU3 A;  2OQK A;  1Z6H A;  5IGD A;  2PNH A;  2O5I C;  2K14 A;  3SDZ A;  2F0J A;  3KYH C;  1TWF B;  3UE1 A;  4KV6 A;  4LF8 Q;  3NPP A;  3ONA B;  3OIQ A;  4OO1 G;  1ML0 D;  2LSS A;  4LW1 A;  2EYO A;  2EIF A;  3J80 c;  4IUU A;  1K8G A;  4DFA A;  3GTP H;  3NTI A;  1LAC A;  5IE8 A;  2Z4I A;  3WDN A;  4J6H A;  1RDP D;  4ZRZ A;  4DR5 L;  1WFQ A;  3OW7 A;  1CM9 A;  3J81 i;  4JI1 L;  2Q2I A;  1Z7T A;  3ER0 A;  4DR4 L;  2QCP X;  3R93 A;  5I9O A;  1TT2 A;  2XNA C;  2BE5 D;  3AU7 A;  5I4D A;  4IUR A;  3CMA A;  4IPD A;  1LT6 D;  2NWG A;  4WRD A;  2B2Y C;  2HIV A;  3DWP A;  4OEL B;  1SNO A;  4POF A;  1MD2 D;  3V2T A;  4JYA L;  1PMR A;  1X54 A;  1IL2 A;  1A2U A;  5C5L A;  3K57 A;  3SE0 A;  5FLX c;  3SK4 A;  1VF7 A;  2GVA A;  5E4X A;  4BY7 G;  1Q81 C;  3RZD H;  4C1N K;  5K5P A;  3J7A 5;  1N8R C;  2X6L A;  3QOL A;  2RKS A;  2E2I H;  2Q2H A;  1XYI A;  2K01 A;  4H13 C;  3VDY A;  4XT1 B;  5C5M A;  1LTI D;  3V05 A;  5M3M B;  2RBM A;  1XPO A;  4U67 3;  4RHS A;  3D31 A;  4OX9 L;  3VR4 A;  3KBX A;  1PH1 A;  1F2M A;  1GUW A;  2B63 H;  4K2L A;  4FF1 A;  2HQE A;  1K8M A;  4C3J B;  1KD1 C;  1D7Q A;  1VQ9 A;  1BKB A;  1IBL Q;  3K58 A;  2WIN B;  3S17 B;  1XX8 A;  3NP8 A;  2IHF A;  2FFK B;  4BBR H;  1VQ6 A;  3PF4 A;  3SHL A;  3S1Q B;  2JQO A;  3M7G A;  3TDQ A;  4DV4 L;  1SN8 A;  3IRB A;  3J80 i;  2UUC L;  2YTY A;  2WKD A;  5L37 A;  1CA6 A;  2ASB A;  1K8A C;  2IHE A;  1I3Q H;  1SBB B;  1CA5 A;  3K5O A;  3OWE B;  3KFU A;  2EYM A;  2A73 B;  4B9W A;  3GV6 A;  4H7B A;  1B8A A;  1QNK A;  3W5O A;  3SK6 A;  1M90 C;  3C3L A;  3HOU G;  1DON A;  4R4O A;  4R4I A;  4P71 A;  3H0G H;  4A3B H;  1KAW A;  5E3F A;  5M9O A;  4KJN A;  3L7Z C;  1KNE A;  4B3S Q;  3GTL B;  1HQR D;  3KOJ A;  1B1Z A;  5ELB A;  3PV0 A;  4L8J A;  1WYD A;  4LK1 C;  2KCT A;  1H9M A;  4YCV A;  1HTL D;  2CQA A;  3M4P A;  4HJ5 A;  2ZXP A;  4JI6 Q;  1YEZ A;  1I94 L;  4TSS A;  3I4M H;  1E2W A;  4DN4 M;  3S14 B;  1W6J A;  2MGS A;  4TQU S;  3VR5 A;  3MXU A;  1Q86 C;  4XQJ A;  2UUA Q;  4TRD A;  3KF8 A;  1PH9 A;  2OTL A;  2EYF A;  4IN3 A;  4QUF A;  3GQB A;  2B2T A;  2HIX A;  1VCI A;  3CRL C;  4IQZ A;  4A3K B;  2WAQ E;  4ZKB B;  4YCU A;  4GKJ Q;  2JA5 B;  3PF5 A;  4HSP A;  1I5F A;  1TS2 A;  2SOB A;  3ERS X;  3VA7 A;  1IXR A;  4KLK A;  1YVC A;  5J39 A;  4DUZ Q;  4HSV A;  1GUN A;  3KF6 B;  3RZO B;  4OIK A;  4JOI A;  1NMF A;  3S1R H;  5AJ3 Q;  3I70 A;  3MVV A;  2CFM A;  2F0L A;  2M00 A;  2HT1 A;  4JI5 Q;  5I2X A;  2AWO A;  2QIL A;  1BBX C;  1PTO H;  1KDB A;  3VYS A;  1TXY A;  3C2P A;  1IW7 C;  5JEA J;  1E1T A;  4LF4 Q;  4C3H H;  3G6E A;  4JI8 L;  2L9H A;  4JBW A;  3A0J A;  3EFX D;  2RSN A;  3LWE A;  3FEW X;  2OWO A;  3GTP B;  1SEB D;  1WCM G;  3RLO A;  3HOV H;  1STN A;  2B2V C;  1CKN A;  4IFD J;  3TZU A;  1F2L A;  4HAE A;  3URY A;  3HOW H;  3S24 A;  1E24 A;  1WTH A;  1EY9 A;  2BCO A;  1K83 B;  4FXD A;  2PMZ B;  1V43 A;  4P75 A;  5LMN W;  4DUY Q;  1IKL A;  2KED A;  1PFM A;  4R4T A;  1HXY D;  2PPB C;  2AWN A;  3H3V I;  3CD6 A;  1EY5 A;  1SMX A;  1I4R A;  5CV5 A;  3D0F A;  1CSP A;  1IBK Q;  2RA4 A;  5C3X A;  2FHT A;  4HJ9 A;  3M4O B;  4HCE A;  4EQ5 A;  2NN6 I;  5FJ8 G;  1EZ6 A;  3EA6 A;  1HTP A;  3CF5 A;  1CZG A;  5JOB A;  3GTM B;  1HJP A;  5IWA L;  1PFN A;  3N52 A;  2F0H A;  3PGZ A;  1V9P A;  3UDF A;  5GAG C;  2M2L A;  4XQQ A;  1IL8 A;  2BA0 A;  1EEI D;  4O2D A;  1E2V A;  1JB7 A;  4KK7 A;  4DU9 A;  4A3M H;  3S2D H;  3OTO L;  1D1K A;  2L1B A;  4GNX A;  1HRJ A;  2BE5 C;  2HHH L;  2JA7 B;  4AYB B;  4A3F H;  3HEJ A;  3EBE A;  3I8Z A;  3CQZ H;  5GAH C;  2B63 B;  1EFI D;  1TR5 A;  4YY3 L;  3A8K E;  4POG A;  1RTN A;  4OWX B;  2RDH A;  4CDD C;  1KTK A;  1PH3 A;  1FJG Q;  5CV6 A;  5M5X B;  1YNJ D;  5GAD C;  3Q6S A;  3MFG A;  1TU2 B;  2XTI A;  5JEA G;  4BY1 H;  1EUJ A;  2LKV A;  4RHR A;  4K6L A;  2EOT A;  2QEJ C;  3I7F A;  3UE0 A;  1VQC A;  1HNX L;  4OL7 A;  1I3Q B;  1MI2 A;  1F2Y A;  3VYU A;  1NY4 A;  4IFD G;  2F3I A;  3KF8 B;  2VQE Q;  4DR3 Q;  2A5H A;  3GDE A;  4KY7 A;  2HUG A;  3BZC A;  3L3O C;  4QB4 A;  5IGC A;  1G6Z A;  3I4N G;  3H0G B;  3J81 E;  1GOZ A;  3TP5 A;  3HOY H;  4A3B B;  5C0X I;  4EX5 A;  4Z9C B;  2J7Z A;  1O78 A;  2KJX A;  4C3I G;  1H95 A;  2IT1 A;  4KY5 A;  4HN7 A;  1Q8K A;  2CVR A;  3GTJ B;  5IP9 G;  5KYL A;  1JE4 A;  3X3N A;  2ZJR A;  1EY8 A;  3T1Y Q;  4JV5 L;  3QB3 A;  1BCP F;  3FKI G;  3TRE A;  2OT2 A;  1ASY A;  1NTG A;  3OSO A;  1QZG A;  4UP8 A;  3S1N H;  4FP5 D;  4DV0 L;  5A2Q E;  4JW0 A;  4O0A A;  2O2L D;  2BH8 A;  1H9S B;  4HJA A;  3PO2 H;  1TWA H;  4K5X A;  4DV2 L;  4YWL A;  1STE A;  4UP7 A;  4HIM A;  5JJZ A;  1CKN B;  1HHV A;  4ABN A;  4HJ8 A;  1SJE D;  2A69 D;  3CCQ A;  3HOX H;  1RJT A;  2KEC A;  1VQE A;  4HR7 B;  5C4J B;  2BOS A;  1I6H H;  4DK3 C;  5LMN L;  4DR5 Q;  1Y69 U;  3F1Z A;  4JI1 Q;  1SE4 A;  4MHE A;  3MHB A;  3SGI A;  1KLG D;  1PTO B;  4N9P A;  4RMF A;  2K32 A;  1SRO A;  1BF4 A;  1EWH A;  3U4Z A;  1PV4 A;  5DNF A;  2H4O A;  4BBS G;  5CC4 A;  2F0U A;  1DM0 B;  1EYC A;  4RFB A;  2C5C A;  4EQN A;  1KQS A;  2WAQ G;  4FVM A;  4JYA Q;  2FIN B;  2RDF A;  4X3U A;  1YHQ A;  3AMU A;  1Q1B A;  4MTK A;  1L0X B;  2Q2T A;  1VQM A;  1HZB A;  4IUQ A;  4R9W A;  3BDC A;  1B44 D;  5ELC A;  3FVQ A;  3CCR A;  3UI2 A;  2B2W C;  2XSC A;  1PTO D;  1WOC A;  4PG3 A;  2LS0 1;  3K81 C;  5HGT A;  1NR4 A;  3NEN A;  2K05 A;  4PMB A;  4DR6 L;  2IWH A;  1S5C D;  2SDF A;  4OEM B;  2A8V A;  4NXN L;  4OX9 Q;  3H3V H;  2NVQ B;  1UAP A;  4QQB X;  1D2B A;  2ICI A;  1X65 A;  3PIO A;  3FHW A;  1EWI A;  1KRT A;  2PZT A;  4A3G H;  3AFP A;  1XMO L;  2JYO A;  2Z6B A;  1KHI A;  4LUV A;  3P1H A;  4OO1 I;  2KA7 A;  3ZYY X;  4QF4 A;  2AUK A;  4ME3 A;  1XTD A;  3CXC A;  4A3M B;  4MN3 A;  1PRT B;  5AFW A;  4DV4 Q;  2WAC A;  1TWF H;  3SXH A;  2UUC Q;  5CV4 A;  1T5X D;  4PMW A;  5TSS A;  3GTG B;  1BOS A;  4N8F A;  1G51 A;  1MKH A;  2F0E A;  3D8G A;  2HD3 A;  2K5N A;  1CHP D;  3CW2 C;  2QDB A;  1VQH A;  2CQO A;  4DNI A;  1YIT A;  4PNY A;  4IZ8 A;  1CK1 A;  3I56 A;  1STA A;  5C4X G;  4EVO A;  2AQ3 B;  3D4R A;  1EY7 A;  2ZTE A;  4H0L C;  1N34 L;  2DUD A;  3J7A V;  2KBN A;  1I94 Q;  3QOJ A;  3U9O A;  4KJO A;  1D5Z C;  5GAE C;  1VQB A;  4ZKC B;  2L11 A;  1V1P B;  1CFM A;  5HGQ A;  3NTH A;  1WTV A;  5IYD H;  2M9V A;  1A62 A;  2NYZ D;  1X56 A;  4J8Q A;  4HMI A;  1EYG A;  2MHV A;  1ICF B;  2K4K A;  1KIX A;  4C1N I;  3W1G A;  4B3R L;  1L1O A;  2XWJ B;  4DV1 L;  3FPU B;  4QCL A;  1TII D;  3NHH A;  2LY7 A;  3D3R A;  5C0X H;  1C4Q A;  1XNR L;  4ALP A;  3ULJ A;  2A1A A;  2J4X A;  2LMC B;  1JC7 A;  1K0R A;  3CPW A;  1S4Z A;  1LT5 D;  4F87 A;  3I2Z A;  1Q8I A;  1RCV D;  4RKL A;  1FYC A;  1GXD C;  3N6R A;  4X66 L;  3HFZ B;  5ELO A;  2VUM B;  3S17 H;  1IHZ A;  3MA2 B;  3MXN A;  4A3C H;  1TWC B;  2IX3 A;  2KEE A;  3F2D A;  2E2J B;  1TWA B;  4XYQ A;  2RCF A;  5JVH 3;  5M3M G;  1KRS A;  2RHQ B;  1EEF D;  4JI8 Q;  4V0B A;  1SLJ A;  3S1Q H;  2VZA A;  4WOR A;  2V4D A;  4IJL A;  4A3L H;  1LYL A;  4HMJ A;  1D6E C;  4DV6 L;  1HZC A;  4NW2 A;  3CCJ A;  3G7L A;  2K5H A;  5IYB H;  2I5L X;  5IY0 A;  2NTT A;  5I2Y A;  4A3D H;  3S16 B;  3A7A B;  1H9J A;  4DK1 A;  2WB1 B;  3GTK B;  1I50 B;  1O80 A;  2B2T C;  2LXJ A;  1KXL A;  3GTL H;  3PO3 B;  4IOA A;  1HA5 A;  4LFC L;  2K6A A;  4DAY B;  4DAP A;  5IWA Q;  3NBI A;  1B2T A;  3T16 A;  3VYT A;  3K5L A;  5G3L D;  1PDQ A;  2XRS D;  3E9I A;  2A69 C;  1VQ5 A;  3T51 B;  3SVM A;  1LM0 A;  2EYL A;  4FF3 A;  5C3E G;  3Q23 A;  4AIM A;  3BVZ A;  1PH8 A;  2R92 B;  3EN2 A;  3CAM A;  5IGB A;  1QIL A;  3DHQ A;  2G5D A;  3HRZ C;  3OTO Q;  4ZAI A;  1BXT A;  1AW7 A;  2L55 A;  2HHH Q;  4ZUJ A;  3W1B A;  2JA5 H;  1RF2 D;  5C4H A;  4M8A A;  5FO9 B;  1EY0 A;  4LJZ C;  3MXP A;  1EYA A;  2N55 A;  4O1N A;  3I91 A;  4YY3 Q;  1A6X A;  4DF7 A;  1I4G A;  1LTA D;  3RZO H;  4IPC A;  3HG9 A;  4Y7N B;  1FGB D;  1ZXT A;  4RGO S;  3C46 A;  1OXS C;  3CC2 A;  3RMH A;  3T56 B;  1RKN A;  1K8O A;  4DR1 L;  2R93 B;  2CH4 W;  1EQT A;  5DM7 3;  1CUK A;  4LUZ A;  4CDE C;  4A3K G;  1VQL A;  1EIG A;  1PTO C;  2Z6K A;  4S3S A;  4A3E B;  1HNX Q;  1VQ4 A;  1MBY A;  3PUZ A;  2KVM A;  4LFA L;  1PH2 A;  3GTO B;  2JA6 G;  5IP7 H;  4IJH A;  1JIC A;  1II3 A;  4N9T A;  4OHJ A;  1SE2 A;  4RAU C;  5M5W B;  5IT9 E;  3J7Z C;  3E0J A;  1K83 H;  2CCZ A;  2IX1 A;  1GHK A;  3KF6 A;  1HQM C;  1TWH B;  1L1O B;  2KUM A;  4ME5 A;  1X55 A;  4OXP A;  1SJH D;  1Y1W G;  4C56 C;  5JJL A;  4A3I H;  1VQ8 A;  4GNX C;  1QWY A;  1AZQ A;  3M4O H;  4IUV A;  1S5B D;  2E2D C;  2SNS A;  3A74 A;  3KLS A;  4P74 A;  5KNC A;  2MO1 A;  4JV5 Q;  2F0S A;  1NMG A;  1F9P A;  4M1U B;  5FOB B;  3T4A C;  1WTX A;  3GTM H;  1GM5 A;  1H9K A;  3MXN B;  3CPF A;  1B3Q A;  1WTR A;  1HPC A;  4DV0 Q;  1A3T A;  4ZCK A;  2O5J C;  3JAM i;  3EIV A;  4YIJ A;  4A93 B;  1ILQ A;  2NZO A;  3Q0A A;  5FLM H;  2CWA A;  1K73 C;  2YU9 B;  1STH A;  4DV2 Q;  1JOK A;  2NVY B;  2FMM A;  1RIP A;  2KHJ A;  4LUO A;  4KMU C;  1X3E A;  3QIA A;  2H5X A;  3G4S A;  2JA7 H;  2OEO A;  5LMN Q;  4GLA C;  2E5L L;  3VR2 A;  1DOM A;  1ASZ A;  1XMQ L;  1ET6 A;  1C0A A;  4LMQ D;  5BN4 A;  2R3Z A;  2WFW A;  1SYC A;  4RCN A;  1RHP A;  2Y0S B;  1KAB A;  2GA4 B;  4FO2 A;  5M5X H;  5E1F A;  3M85 A;  4IFD I;  1Y1V B;  1NBW A;  4AYB G;  1C7Y A;  3PIO 3;  3STB D;  1DD2 A;  2AKW B;  1VDZ A;  4BWG B;  2B63 G;  3PUV A;  2E2H B;  2F0N A;  2R7D A;  3E5S A;  4FXK C;  1JMC A;  4B08 A;  1WD1 A;  2B2U A;  1Q1E A;  1GKH A;  2BDN A;  4BBR G;  2NVT B;  3BG3 A;  4A3D B;  3P75 A;  4DR6 Q;  2EYH A;  4GKK L;  4NP5 A;  2HQL A;  5DLQ E;  3MAQ A;  4NXN Q;  3U9S A;  2JA8 H;  1XPU A;  3U58 A;  2H1E A;  3ITP A;  1EQV A;  4ULL A;  5JPN C;  5FO8 B;  2X69 A;  3GTJ H;  1UE6 A;  4L5S A;  4JVZ A;  3CME A;  1IYU A;  1D1I A;  1BQQ T;  2XGT A;  4WJ4 A;  2F4I A;  3GP7 A;  1XMO Q;  2LFN A;  2EY1 A;  4Y52 H;  5KRU A;  5GQO A;  1UE7 A;  3H0G G;  2VB3 X;  3OOC A;  4A3B G;  1VQA A;  4UY8 C;  3RR5 A;  1LO5 D;  4C2M B;  4OWW B;  2PZU A;  2BDO A;  5JAV A;  1F9S A;  1YI2 A;  5K36 G;  4A3J B;  1LLR D;  1SYG A;  1YNN D;  3S1M B;  4DK6 C;  2F0G A;  4XXE A;  4L6T B;  1BDO A;  1CQF A;  3HGB A;  4B3M L;  2F0P A;  3I4M G;  1EIY B;  5M5Y B;  3TSS A;  5C4J H;  3DM3 A;  2I07 B;  1LTT D;  2EY6 A;  1SFO H;  3K7U C;  4H44 C;  2UU9 L;  3J7A F;  1E1O A;  5GRO A;  1PLF A;  1SSO A;  1N34 Q;  4KKS A;  3OMC A;  3K5M A;  3BDO A;  1SR3 A;  1H9S A;  3CU7 A;  1PHJ A;  4FXG C;  5EBD A;  1SRU A;  1JOR A;  1AN8 A;  5EQ0 A;  3CP0 A;  3MC0 B;  2N8N A;  2I5H A;  1FNW A;  3TZD A;  2KCM A;  2QA4 A;  1ENA A;  1XNQ L;  4K8J A;  4I7Z C;  1YHB A;  3I90 A;  1PXU A;  4B3R Q;  1JE5 A;  4C3H G;  1KAA A;  1M4V A;  4N8X 1;  5A35 A;  4DV1 Q;  4E6I A;  2WKC A;  3J81 j;  3I3C A;  2CH4 A;  1N9W A;  3PUW A;  1CI3 M;  1QUQ B;  4A3I B;  4IUN A;  1XNR Q;  3HOV G;  3IL8 A;  3C1E A;  2PI2 A;  4Y7N H;  5BN5 A;  2EYP A;  3HKZ E;  2D5D A;  4DKA C;  2ZTD A;  2NVQ H;  1Q90 A;  3HOW G;  2SNM A;  5LL6 S;  2TMP A;  3WOF A;  5FKA C;  4GLX A;  1MSG A;  4LF7 L;  3H3V C;  1JWS D;  2IPK D;  3R2T A;  4X66 Q;  4MNO A;  4DV7 L;  3TP7 A;  4BY7 B;  3KUP A;  1O7Z A;  1I4H A;  1AEX A;  1S5F D;  5CV8 A;  2Q8I B;  4DXG A;  2IJ0 A;  3OYY A;  2OF1 A;  1HH2 P;  1F2Z A;  1PH6 A;  3HP3 A;  3D6W A;  2KOL A;  1SMY D;  2Z8L A;  3GTG H;  1O7L A;  4X64 L;  4K2K A;  4DV6 Q;  3DWA A;  2K5Q A;  2D0O A;  3KLS X;  3Q22 A;  3GTQ B;  5KEE A;  2PYK A;  3G48 A;  1N32 L;  1X9N A;  2VY3 A;  3TS2 A;  5CYU A;  1BCP B;  3K8A A;  2G9H D;  1E7Z A;  2VB2 X;  2YYZ A;  2Z4H A;  1L1O C;  4LFC Q;  5J22 A;  1FVI A;  1M1K C;  3F8T A;  5CR3 A;  4A3F G;  1HR0 W;  4FF4 A;  1S72 A;  1BBU A;  1RL2 A;  2NBF A;  3T1H L;  2F03 A;  4L63 B;  1CKM A;  4QIW B;  4F7X A;  4A75 A;  2EJM A;  3HOU B;  4KN4 C;  3R3O A;  4AQY L;  1TS4 A;  2NVX B;  4PV1 C;  3K59 A;  2NB0 A;  4DA2 A;  4BY1 G;  3ULL A;  2QGQ A;  2DN8 A;  2JA8 B;  4JI3 L;  4CHT B;  2K33 A;  2ALY B;  2L5T A;  5IP9 H;  1LTG D;  4GLV B;  2ENB A;  4KTA A;  3VYR A;  3RUZ A;  1AE3 A;  4OIJ A;  4BA1 I;  1YHA A;  3STB C;  1NJI C;  4WFN 3;  2C9O A;  5KND A;  3DXJ C;  4DAV A;  4YWM A;  3HOY G;  4DR1 Q;  3JAM E;  5CV7 A;  2VUM H;  4IOC A;  3DUZ A;  4NMZ A;  4HTH A;  1V1P A;  1TWC H;  2AMC B;  4UAI A;  1BUV T;  2F0K A;  3HOZ H;  2D9U A;  2ZXR A;  2E2J H;  1JJG A;  3NSW A;  4UHV A;  5D14 A;  1Q82 C;  1YNX A;  5IGE A;  4LFA Q;  1K28 A;  1PH7 A;  3I73 A;  5LMU Q;  3FMC A;  4NXM L;  2MPM A;  1R9T H;  1SFO B;  2F0V A;  4DNR B;  1ICW A;  3BVM A;  4JI0 Q;  1AFP A;  1PZI D;  2KHS A;  4LAA A;  1SXT A;  3PO2 G;  1PVO A;  2EXZ A;  2L0C A;  2B8F A;  4CJ2 C;  3S16 H;  1OXT A;  4IUT A;  1D8L A;  3GTK H;  3HOX G;  2DNC A;  1I50 H;  4LF6 L;  1STY A;  2KCN A;  3FRP B;  3PO3 H;  4DPG A;  3NQI A;  1WCM B;  1FGU A;  3J80 E;  4QL5 A;  1MIU A;  1FD7 D;  4KHZ A;  4PZ8 A;  1HUM A;  1ONL A;  1NE3 A;  2JP1 A;  3UDX A;  4LF5 L;  1BO0 A;  1YNN C;  1FL0 A;  5D3D A;  3S15 B;  4DV5 L;  2F0Q A;  2K03 A;  5E7N A;  4A76 A;  2A74 C;  1NSN S;  5F2D A;  3BU2 A;  2WB1 G;  2R92 H;  1WI5 A;  4YCW A;  4J1M A;  3PCO B;  3TEH B;  3S2H H;  3QJY A;  2Z6K C;  3ERO A;  4ID6 A;  3G71 A;  5EJW A; 
#chains in the Genus database with same CATH homology
 2UUB L;  4BBR H;  1KXL A;  2LXJ A;  1VQ6 A;  1HNW Q;  2E5L Q;  1W3S A;  3GTL H;  4JI2 Q;  3PF4 A;  4IOA A;  1QVC A;  3PUY A;  4LFC L;  2BH2 A;  4OON A;  5M3F H;  4DAY B;  2JQO A;  4DV4 L;  1XMQ Q;  1SN8 A;  3CCM A;  5IWA Q;  1Q46 A;  2R6G A;  3IRB A;  1PYB A;  2ZJP A;  3J80 i;  4A3M G;  1B70 B;  2YTY A;  2UUC L;  3E9I A;  1VQ5 A;  2ASB A;  1K8A C;  2IHE A;  1I3Q H;  1LM0 A;  2R93 H;  3A5U A;  4TVA B;  1N33 Q;  3KFU A;  2E8G A;  5C3E G;  4AIM A;  3GD7 A;  1PH8 A;  4LF9 Q;  4RG1 A;  3EN2 A;  1HR0 L;  1B8A A;  3M3Y H;  2D0P A;  3CAM A;  4JI7 L;  4BXX H;  3W5O A;  4YHH L;  1M90 C;  2I5M X;  3HOU G;  4DR2 L;  4R4O A;  4R4I A;  4P71 A;  1UWV A;  3H0G H;  4AH6 A;  5IT9 c;  4HIK A;  3OTO Q;  4A3E H;  4A3B H;  1HZ9 A;  1AE2 A;  1KAW A;  2ES2 A;  4A3G G;  3B6Y A;  2HHH Q;  3HKZ G;  2JA5 H;  3W1B A;  3L7Z C;  2EXD A;  2PMZ E;  4B3S Q;  4IPH A;  3GTO H;  3I4N H;  3KOJ A;  1A8V A;  3PV0 A;  1Q12 A;  1WYD A;  5IYC H;  1XPR A;  4YY3 Q;  2KCT A;  5M5W H;  4YCV A;  4J15 A;  3WWV A;  3M4P A;  4HJ5 A;  1LTL A;  4UPA A;  3RZO H;  1VQN A;  4IPC A;  1UE5 A;  4C3I H;  4JI6 Q;  1YJN A;  1YEZ A;  1I94 L;  4LF8 L;  1TWH H;  2D62 A;  4GKK Q;  3I4M H;  1OXS C;  3CC2 A;  1X6O A;  2OTJ A;  5BR8 Q;  2GVB A;  4DR1 L;  1Q86 C;  4TQU S;  1QZH A;  1VQD A;  2DGY A;  2UUA Q;  4JI4 L;  4H02 A;  1PH9 A;  2OTL A;  1CUK A;  4LUZ A;  2ZM6 Q;  4A3K G;  1VQL A;  1MJC A;  3PSI A;  2Z6K A;  3FKI H;  4R1J A;  2MO0 A;  1HNX Q;  1VQ4 A;  5J3B A;  2HIX A;  2Y0S E;  1VCI A;  3PUX A;  2WAQ E;  3PUZ A;  4YCU A;  4GKJ Q;  1AH9 A;  2PQA B;  1X3F A;  4LFA L;  1PH2 A;  3PF5 A;  1BVS A;  4QY7 A;  1K9M C;  1I5F A;  2JA6 G;  3ERS X;  5IP7 H;  1IXR A;  4IJH A;  1XJV A;  2R7F A;  4KLK A;  1YVC A;  2IX0 A;  2F52 A;  2K75 A;  3GO5 A;  4DUZ Q;  1U0L A;  3J7Z C;  4A93 H;  4LNQ A;  4JG2 A;  3KF6 B;  1K83 H;  2ZTC A;  4JOI A;  1NMF A;  2CCZ A;  2YU9 H;  3KF6 A;  2IX1 A;  1L1O B;  2NVY H;  3S1R H;  5AJ3 Q;  1X55 A;  4AYB E;  2CFM A;  2HT1 A;  2KHI A;  4JI5 Q;  4OXP A;  4X6A H;  4B3M Q;  2AWO A;  1Y1W G;  1JJC B;  4OWT B;  3CCV A;  5JJL A;  1TXY A;  5JEA J;  4QGU A;  4A3I H;  1E1T A;  1VQ8 A;  4GNX C;  2VUM G;  3M4O H;  4LF4 Q;  1PFS A;  3A74 A;  4C3H H;  4L5R C;  4P74 A;  5IYD G;  2MO1 A;  4JV5 Q;  3G6E A;  4JI8 L;  1NMG A;  2UU9 Q;  4JBW A;  3A0J A;  3HOZ G;  1HNZ L;  1E22 A;  3KLW A;  5HY6 A;  3ULP A;  2OWO A;  3GTM H;  1WCM G;  3RLO A;  1GM5 A;  4KI0 A;  3MXN B;  3HOV H;  3CPF A;  1CKN A;  2YTV A;  4IFD J;  4DV0 Q;  4BBS H;  3CC7 A;  2K5V A;  1N36 Q;  3M9B A;  3HOW H;  1G6P A;  3JAM i;  3EIV A;  2NZH A;  2MNA A;  3S24 A;  1E24 A;  4GS3 A;  2NZO A;  4A4I A;  1IBM Q;  5FLM H;  1J5E L;  1V1Q A;  2CWA A;  1K73 C;  1V43 A;  4DV2 Q;  4P75 A;  5LMN W;  4DUY Q;  1JJ2 A;  4LFB L;  2CWP A;  4R4T A;  1Y1V H;  1RIP A;  2AWN A;  3H3V I;  3CD6 A;  2K52 A;  3M7N A;  4BA2 I;  2KHJ A;  4LUO A;  4DR4 Q;  2JEB I;  1SMX A;  2VQF Q;  4X65 Q;  1X3E A;  1IBL L;  2E2H H;  3M4Q A;  2UXD Q;  3D0F A;  1CSP A;  5H1S E;  1IBK Q;  1XNQ Q;  2H5X A;  3G4S A;  2JA7 H;  4HJ9 A;  5LMN Q;  1HNW L;  4EQ5 A;  2NN6 I;  4GLA C;  3F2B A;  5FJ8 G;  1DGS A;  1UE1 A;  2E5L L;  3UDI A;  4JI2 L;  4A3C G;  4GN3 B;  1EOV A;  2NVT H;  3CF5 A;  1ASZ A;  1XMQ L;  1L2F A;  3PO3 G;  1HJP A;  5IWA L;  1PYS B;  1C0A A;  4JI4 Q;  2WFW A;  3L0O A;  3PGZ A;  3TQY A;  1V9P A;  3UDF A;  2ZJQ A;  5GAG C;  1QVF A;  4JC0 A;  3K0X A;  4A3L G;  3L2P A;  1L0W A;  4GOP C;  5M5X H;  1N33 L;  2BA0 A;  3M85 A;  4IFD I;  3NEL A;  4LF7 Q;  4O2D A;  1JB7 A;  4LF9 L;  1JT8 A;  3F2C A;  1NBW A;  4JBM A;  4A3M H;  4AYB G;  1C7Y A;  4DV7 Q;  3STB D;  1Y14 B;  3ICE A;  2R92 G;  2AKW B;  4GNX B;  5IYB G;  3S2D H;  2B63 G;  3PUV A;  4JOI C;  3U4V A;  3J81 c;  3OTO L;  4HJ7 A;  4GNX A;  2R7D A;  1JMC A;  4A3D G;  2HHH L;  4A3F H;  4B3S L;  5C0X J;  3EBE A;  1G29 1;  2R7Z H;  1Q1E A;  3CQZ H;  2JA9 A;  1GKH A;  4BBR G;  1U5K A;  5GAH C;  1KC8 C;  5C44 H;  2WP8 J;  2YTX A;  4C2M H;  4YY3 L;  1T9H A;  4POG A;  4OWX B;  5M3F G;  4JI6 L;  4A3J H;  1EQQ A;  1PH3 A;  4DR6 Q;  4GKK L;  3CCE A;  1A0I A;  3S1M H;  4X62 Q;  1FJG Q;  2HQL A;  2NN6 G;  5DLQ E;  5BR8 L;  4NXN Q;  2B29 A;  2JA8 H;  4X64 Q;  1XPU A;  4JBJ A;  3U58 A;  4YWK A;  5M5Y H;  5GAD C;  2UUA L;  5JEA G;  2XTI A;  1EQR A;  1EUJ A;  3GTJ H;  4BY1 H;  2ZM6 L;  2R93 G;  1UE6 A;  3I7F A;  4L5S A;  3UE0 A;  3CME A;  2XGT A;  4WJ4 A;  1HZA A;  1VQC A;  3S1Q H;  4XIG S;  1N32 Q;  1XMO Q;  1HNX L;  4BXX G;  2PI2 E;  3K80 C;  3Q8D A;  4R4C A;  4Y52 H;  3AQQ A;  4PZ7 A;  5GQO A;  5C4X H;  4A3E G;  3PIP A;  1UE7 A;  3H0G G;  1NY4 A;  4IFD G;  4DV3 Q;  4GKJ L;  2F3I A;  3KF8 B;  2VQE Q;  4A3B G;  4DR3 Q;  1VQA A;  4UY8 C;  3GDE A;  4WJ3 M;  1S40 A;  4K0K Q;  3RR5 A;  2JA5 G;  3BZC A;  4OWW B;  3I4N G;  4DUZ L;  3T1H Q;  3OW2 A;  3I4O A;  1YI2 A;  1VQK A;  3HOY H;  5K36 G;  5IYC G;  5C0X I;  2UXB Q;  4EX5 A;  1Z9F A;  1YJW A;  4DK6 C;  4GOP A;  5AJ3 L;  1OTC A;  1H95 A;  2IT1 A;  2N78 A;  1K3R A;  4JI5 L;  3I55 A;  4B3M L;  3I4M G;  1Q8K A;  1EIY B;  5LMU L;  1GO3 E;  1WJJ A;  5C4J H;  4AQY Q;  5IP9 G;  3DM3 A;  2F4V Q;  2ZJR A;  4FDB A;  4JI0 L;  4QJF A;  3K7U C;  1SFO H;  3T1Y Q;  1EFW A;  4LF4 L;  4P73 A;  4JV5 L;  2VS1 A;  2UU9 L;  1E1O A;  3FKI G;  3TRE A;  4JI3 Q;  1ASY A;  1NTG A;  2K50 A;  5GRO A;  1Y1W H;  1QZG A;  4UP8 A;  3S1N H;  4DV0 L;  1QVG A;  4NB3 A;  5EAY A;  4O0A A;  1N36 L;  2BH8 A;  1N34 Q;  1SR3 A;  5IP7 G;  1IBM L;  4HJA A;  1PHJ A;  3PO2 H;  1TWA H;  4DV2 L;  4YWL A;  4DUY L;  3AFQ A;  4UP7 A;  4UP9 A;  2Z0S A;  4HIM A;  4A93 G;  3RLN A;  1CKN B;  1SRU A;  2GN5 A;  4HJ8 A;  5JJI A;  3AEV A;  4BY7 H;  3CP0 A;  3HOX H;  2VQF L;  3CCQ A;  1PA6 A;  2N8N A;  2I5H A;  1EIF A;  2KCM A;  1VQE A;  5M3M H;  2QA4 A;  4DAM A;  1P16 A;  3CCL A;  1I6H H;  1IBK L;  2UXD L;  1XNQ L;  1GVP A;  5C0X G;  1YHB A;  3K7A H;  4DK3 C;  5LMN L;  4GN4 B;  4DR5 Q;  3F1Z A;  4IO9 A;  4A3I G;  4JI1 Q;  4QIW E;  4B3R Q;  1IZ6 A;  1JE5 A;  4PZ6 A;  4DV1 Q;  3SGI A;  1YBY A;  1LUZ A;  4RMF A;  2RCN A;  3J81 j;  4JBK A;  1C9O A;  1N9W A;  1VQJ A;  3BZK A;  4C3J H;  2N3S A;  1SRO A;  3PUW A;  2OQ0 A;  1QUQ B;  1VQP A;  2FXQ A;  1XNR Q;  3U4Z A;  1QUQ A;  3HOV G;  4Y7N H;  2PI2 A;  1PV4 A;  4NXM Q;  1OXX K;  4BBS G;  4IPG A;  3HKZ E;  1HNZ Q;  4DKA C;  2ZTD A;  2NVQ H;  3HOW G;  2Y0S G;  3KJO A;  4GLX A;  1X3G A;  2AHO B;  3BJU A;  3RN2 A;  1YIJ A;  2WAQ G;  4LWC A;  1KQS A;  5FLM G;  2I0Q A;  4LF7 L;  4JYA Q;  1YHQ A;  1Q1B A;  4MNO A;  4X66 Q;  2Q2T A;  3CC4 A;  2CKZ B;  4DV7 L;  1HZB A;  2A19 A;  1VQM A;  3GTQ H;  1Y1V G;  3KDF A;  3TS0 A;  2YV5 A;  1Q7Y C;  4APV A;  4NPS A;  3CCR A;  1KL9 A;  4LF6 Q;  4HID A;  3OYY A;  1HH2 P;  2JA7 G;  1WOC A;  4PG3 A;  3K81 C;  4LF5 Q;  3TRZ A;  1PH6 A;  3NEN A;  1YJ9 A;  4DV5 Q;  1OXU A;  3FP9 A;  1PH4 A;  2Q2U A;  3CCS A;  4DR6 L;  4L5Q A;  3RN5 A;  4KHP Q;  5C3E H;  4X62 L;  1FJG L;  4MZ9 A;  1E3P A;  3UDG A;  4NXN L;  4OX9 Q;  2A8V A;  2LXK A;  2JEA I;  3H3V H;  3GTG H;  4X64 L;  4DV6 Q;  4QQB X;  3HOU H;  1X65 A;  2D0O A;  3PIO A;  3FHW A;  2ATW A;  2UXC Q;  2VNU D;  4DR7 Q;  1EWI A;  3NBH B;  1KRT A;  4XTC S;  3AFP A;  2NVX H;  3DLL A;  4B3T Q;  4A3G H;  3G48 A;  3H15 A;  1MJE A;  1N32 L;  1XMO L;  1X9N A;  2VY3 A;  2L15 A;  3TS2 A;  2UUB Q;  1CKO A;  1KHI A;  3K8A A;  1OXV A;  4LUV A;  4OO1 I;  4DV3 L;  3S14 H;  2VQE L;  1E7Z A;  2KEN A;  2YYZ A;  4DR3 L;  1W2B A;  1IYJ B;  1L1O C;  2JE6 I;  1B7Y B;  4ME3 A;  1XTD A;  3JAM c;  1S3O A;  4LFC Q;  3CXC A;  4K0K L;  1PH5 A;  1FVI A;  4DV4 Q;  3ZJY C;  1M1K C;  2MFI A;  3F8T A;  4A3F G;  1SE8 A;  1HR0 W;  2R7Z G;  1S72 A;  1BBU A;  1RL2 A;  1TWF H;  2EQS A;  2N49 A;  3T1H L;  5C44 G;  2UUC Q;  3AYH B;  1A63 A;  2UXB L;  3NEM A;  1CKM A;  3RNU A;  4A75 A;  1VQI A;  1UEB A;  4PMW A;  4A3K H;  4A3J G;  3A5Z B;  2VL6 A;  5ELN A;  1VQO A;  1G51 A;  1MKH A;  1HR0 Q;  2RHS B;  2JA8 G;  4JI7 Q;  2K5N A;  4AQY L;  3MEF A;  4YHH Q;  3CW2 C;  2QEX A;  2F4V L;  4DR2 Q;  1VQH A;  2CQO A;  4BY1 G;  4GOP B;  3T1Y L;  2OCE A;  1J6Q A;  2C35 B;  4GN5 A;  2QGQ A;  4L5T A;  3ULL A;  4DNI A;  1YIT A;  1VQF A;  3KJP A;  2JA6 H;  4JI3 L;  4P72 A;  2IY5 B;  3I56 A;  2OQK A;  3JC6 6;  1O7I A;  2ALY B;  5IP9 H;  2PNH A;  5C4X G;  1VQ7 A;  4GLV B;  2ZTE A;  2K14 A;  1N34 L;  5JJK A;  2DUD A;  2JJQ A;  3HKS A;  3KYH C;  3UE1 A;  2KBN A;  1AE3 A;  4LF8 Q;  1I94 Q;  4BA1 I;  1YHA A;  4MTN A;  2WB1 E;  3STB C;  1NJI C;  2LSS A;  4OO1 G;  4LW1 A;  4YWM A;  2EIF A;  3HOY G;  3J80 c;  4DR1 Q;  5GAE C;  1VQB A;  1K8G A;  3GTP H;  2VUM H;  4IOC A;  2PQA A;  5IE8 A;  3CCU A;  5HGQ A;  4HIO A;  1TWC H;  2AMC B;  5IYD H;  3U50 C;  3HOZ H;  1A62 A;  2E2J H;  1X56 A;  1JJG A;  1EYG A;  4DR5 L;  1WFQ A;  1WCM H;  1Q82 C;  1GD7 A;  2K4K A;  1YNX A;  3J81 i;  4JI1 L;  2Q2I A;  3W1G A;  1KIX A;  1P8L A;  4B3R L;  3ER0 A;  4DR4 L;  1L1O A;  4LFA Q;  4DV1 L;  4X65 L;  3S15 H;  2VW9 A;  1PH7 A;  3CMA A;  4IPD A;  5LMU Q;  1XNR L;  4ALP A;  4NXM L;  1R9T H;  3ULJ A;  2A1A A;  2HIV A;  1K0R A;  3CPW A;  3RLF A;  4JI0 Q;  1YZ6 A;  4POF A;  3I2Z A;  4JYA L;  1X54 A;  2ID0 A;  3PO2 G;  1IL2 A;  4X66 L;  1PVO A;  3HFZ B;  5ELO A;  5FLX c;  3S16 H;  3LGJ A;  3S17 H;  2B3G A;  2GVA A;  4A3C H;  1OXT A;  2JK8 A;  5FJ8 H;  2RF4 A;  1D8L A;  4BY7 G;  1Q81 C;  3GTK H;  3HOX G;  3F2D A;  3RZD H;  1CSQ A;  1I50 H;  4LF6 L;  3E0E A;  1KRS A;  5M3M G;  2RHQ B;  4DPG A;  1N8R C;  3J7A 5;  3PO3 H;  4JI8 Q;  1FGU A;  2E2I H;  1SLJ A;  2Q2H A;  1MIU A;  4PZ8 A;  4KHZ A;  4QL5 A;  3UDX A;  3VDY A;  1NE3 A;  3KDF B;  4LF5 L;  1FL0 A;  2VZA A;  4DV5 L;  1BBW A;  1VQG A;  4IJL A;  4A3L H;  1LYL A;  1Z47 A;  5E7N A;  4KHP L;  2MQH A;  2V1C C;  4R4Q A;  1TWG H;  1XPO A;  3D31 A;  4A76 A;  1J5E Q;  4OX9 L;  1VS0 A;  4DV6 L;  1HZC A;  3BU2 A;  1PH1 A;  3CCJ A;  4LFB Q;  2K5H A;  2WB1 G;  2R92 H;  1WI5 A;  4YCW A;  5IYB H;  2B63 H;  2UXC L;  2I5L X;  3PCO B;  5IY0 A;  4DR7 L;  3TEH B;  4B3T L;  2BA1 A;  3E9H A;  1KD1 C;  4A3D H;  1D7Q A;  1VQ9 A;  1BKB A;  3S2H H;  1IBL Q;  2Z6K C;  4JCV E;  3G71 A;  2IHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...