3KLWA

Crystal structure of primosomal replication protein n from bordetella pertussis. northeast structural genomics consortium target ber132.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of primosomal replication protein n from Bordetella pertussis. northeast structural genomics consortium target ber132.
rcsb
source organism Bordetella pertussis
molecule tags Dna binding protein
total genus 13
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3klwA00
5M3MH 1KXLA 2WFWA 1I50H 1N33L 1N36Q 1CSPA 4FDBA 1EFWA 4BY1G 3S2HH 3U4VA 3RLFA 2NVQH 4GLAC 4UP8A 2F4VL 3M4PA 2BH2A 1I5FA 1L0WA 4OWXB 4B3RQ 4JBWA 5GAEC 4B3SQ 1XMOL 2CKZB 4LF4L 2K5VA 1CUKA 4GN5A 1QZGA 3A0JA 3GTMH 1WFQA 4A75A 4A93H 3PUWA 2OQ0A 3KF6B 1S40A 3CC2A 1KRSA 2VS1A 1P8LA 2CQOA 5FLMH 3K7AH 1BVSA 3GTLH 1L1OC 2RF4A 1VQPA 1U5KA 1NMFA 3PGZA 4A3BG 1K3RA 1O7IA 4A3MG 2CWAA 1J6QA 1OXTA 3PUZA 1VQLA 4LF8L 3GTPH 3S1QH 3DM3A 1VQFA 1WJJA 3AFQA 4JI8L 2UU9Q 2NN6I 3BJUA 3EN2A 4YCUA 1FJGL 1KAWA 3NELA 4DV2L 2XTIA 3M85A 2YYZA 3MEFA 1YNXA 5GAGC 3L2PA 3I2ZA 3D0FA 1VQIA 3CF5A 5LMUQ 4DV3Q 4P74A 3JAMc 2R7ZH 5E7NA 4POFA 1AE3A 2ZTDA 1M1KC 3IRBA 1Y1WG 3STBC 3PO3H 4XTCS 1VQKA 1XNQL 1V43A 4LFBL 1YJ9A 3RZDH 4LUZA 5IE8A 4IFDI 4JI7L 2YTVA 4ME3A 1HNZL 1H95A 4R4OA 3B6YA 1S3OA 2ZTCA 2NVXH 5JEAG 4JI3Q 1X55A 4LF6L 2K75A 4YWKA 1HR0Q 1IXRA 2JA5H 1JMCA 5IWAL 4IJHA 2LXJA 3ULJA 4AYBG 1V9PA 5C3EG 1I3QH 2WB1E 4QJFA 1SFOH 3S24A 3VDYA 1WI5A 4YY3L 4JI0L 4A3BH 3FP9A 3K0XA 3CCQA 4A3MH 1QVGA 1K9MC 4JYAL 4DAYB 2KBNA 2LSSA 1SROA 2DUDA 4L5QA 4B3MQ 2Q2IA 4AIMA 1UE6A 4L5TA 5C4XG 2MO1A 2QA4A 3ER0A 1LUZA 3J81j 1XJVA 2OWOA 1MKHA 4IPHA 4DR4L 1QVFA 2R7FA 4LUOA 4PZ6A 3J81i 5FJ8H 1N34L 2A8VA 1YBYA 4C3HH 4DV1Q 4IPDA 1GO3E 2JA6H 1IBKQ 2B3GA 2MQHA 3KJPA 3CMEA 3KF8B 4IFDJ 1QVCA 1TWCH 1XPRA 4DV4Q 4LF7Q 5C0XG 3K8AA 1X3GA 2Z6KA 1JE5A 4PG3A 4YHHL 3KDFA 4DV0Q 4PZ7A 4DK3C 3CCUA 1B8AA 2ID0A 3D31A 1UEBA 4GN3B 4JI2L 2UUCL 1FL0A 1C9OA 2WP8J 4DUZQ 4X66Q 1E3PA 4DR5L 2Y0SG 4LF9L 1JJCB 2R7DA 1JT8A 4HIKA 4A3IH 1IBLQ 3CAMA 4DR3Q 3NENA 3H3VH 5GADC 3CP0A 1YZ6A 4GLVB 5FLXc 1HZBA 4HIDA 5AJ3L 1XMOQ 2WAQG 4H02A 4PZ8A 4R4IA 2JA9A 4P73A 1K83H 3F2DA 4JI6L 2ATWA 2PQAA 1S72A 1EWIA 2KCMA 3RR5A 4NXNQ 1L2FA 4NXML 2L15A 4OO1I 4EX5A 3PSIA 1W2BA 1HNXQ 2HQLA 4DR6Q 4GNXB 1PH7A 3S1NH 5C4JH 1QZHA 3M3YH 4X62Q 4BA2I 3G4SA 2N8NA 2FXQA 4GOPA 3CPFA 5LMNQ 4DV2Q 3LGJA 2RHQB 1KC8C 4KHZA 3RN2A 1CKOA 1OTCA 5M5WH 4K0KL 2AWOA 3W1BA 2ZJQA 2GVAA 1NBWA 1D7QA 2PMZE 1C7YA 3CW2C 2VQFL 1PH8A 2UUAL 2HIVA 1FGUA 1W3SA 4LFAL 2UXCQ 1VQAA 1DGSA 4A76A 3HOYG 4UY8C 2ZM6Q 1VQDA 4LF5L 4QIWE 4R4QA 4A3EG 1KHIA 1SR3A 3HKZE 3OTOL 4IOCA 1KD1C 3S14H 3UDFA 3S17H 4DR7Q 1JJ2A 3DLLA 1VQGA 4LW1A 1D8LA 1EYGA 1SLJA 5JJKA 4A3LH 1GVPA 3I7FA 1E22A 1Q12A 4X64L 2R92G 1X6OA 3RN5A 2H5XA 2IHEA 1Q1BA 2PNHA 5GROA 2VQEL 2BA1A 3PO2G 4DV7L 3CQZH 3Q8DA 2HHHQ 4A3CH 3W1GA 4YCVA 4DAMA 1K0RA 1QUQA 2YV5A 3KFUA 1IBML 2VUMG 3I4MG 1K8AC 4JI1Q 1WYDA 4AQYL 4BY7G 3GTQH 1PYBA 5J3BA 4DR4Q 3F8TA 1UE1A 1Q82C 4A3JH 4IO9A 4GN4B 1UE7A 1C0AA 3AYHB 4GKKL 2JA8H 1OXVA 1VQ7A 2JA7G 3AEVA 1T9HA 3CCMA 2K5NA 1PH1A 1PA6A 4YHHQ 1HZCA 4JI4L 1CKMA 2I5LX 3HOZG 1MJEA 2D62A 5IYCG 1PH6A 2UUBL 1NY4A 1GKHA 4YCWA 2UUCQ 2JK8A 4BY1H 2K5HA 4O2DA 5IYBG 5IYDG 1SMXA 2UXDL 1X3EA 1YVCA 4JBJA 1K73C 4OX9L 1XNRQ 4JV5Q 3J80i 1RL2A 1A62A 1Q1EA 3HKSA 5BR8L 3I55A 3I4OA 1YHBA 3EBEA 2IT1A 3HOWG 1YHAA 1E24A 4GKJL 4KHPQ 3UE0A 4DR1Q 3PO2H 1SN8A 3J7ZC 3UDGA 4DV5L 1TWGH 2B63G 4EQ5A 2UXBL 1J5EQ 4JI6Q 2A1AA 3CC7A 2HT1A 1L1OA 1N32L 4NXMQ 3I4MH 4LFCL 4O0AA 4R4TA 3KJOA 1VQ9A 2N49A 3ICEA 2ZJPA 4A3GG 2EQSA 1WCMG 3RLOA 4X65Q 2WB1G 4MNOA 2E2IH 3TRZA 5JJLA 1LYLA 4JBMA 4C3IH 1JJGA 4DV6Q 3I4NG 5GAHC 2GVBA 3RNUA 2JA7H 3K7UC 4B3RL 3GTJH 4B3TL 4B3SL 2OQKA 3GTKH 4K0KQ 1LTLA 4JI5Q 1TWAH 4BBSG 3KYHC 1Y1WH 3ZJYC 1E7ZA 1VQEA 4UPAA 3CC4A 5C44G 5IYBH 1UWVA 2VQFQ 4A3KG 3ULLA 5IYDH 2YTYA 3CD6A 3S15H 3WWVA 1JB7A 3S2DH 4JOIA 3KDFB 4A3DG 4RMFA 2AKWB 1XTDA 4GNXC 2MFIA 2JEBI 3HOWH 2DGYA 1N33Q 3TEHB 2VNUD 4DUYL 4C2MH 2UU9L 2B63H 4MTNA 1TWHH 2F4VQ 1YI2A 5C3EH 3GO5A 3CCSA 5JJIA 4LF4Q 3PIPA 2F3IA 1GM5A 2RHSB 1PVOA 2K4KA 3M4OH 1HZ9A 4DV7Q 4Y52H 1BKBA 1X56A 1WCMH 3S16H 2ES2A 1X54A 4JG2A 5C4XH 2PQAB 1GD7A 3HOVG 3UE1A 1Q8KA 2Z0SA 1VCIA 1XMQL 3L7ZC 1IBMQ 1ASZA 2OTLA 1CKNA 3PCOB 3TQYA 2AMCB 2NVTH 1B7YB 4AQYQ 1CSQA 1VQJA 3KLWA 1PHJA 4LF8Q 2OCEA 4JI8Q 4JCVE 4MZ9A 4RG1A 4A3FG 2Q2UA 5M3MG 1FJGQ 3H3VI 4BBSH 1EOVA 5GQOA 2YTXA 2ZTEA 1HH2P 1G51A 2NN6G 4JI3L 2KCTA 4LWCA 2D0OA 5IP9G 4GOPB 3T1YL 1PH5A 3M4QA 1HR0L 2A19A 1I6HH 1N9WA 1VQCA 1OXXK 3RZOH 3JC66 4A3DH 4JI4Q 3NBHB 4HJ7A 4QQBX 4BA1I 4QGUA 1YJNA 2PI2A 1KRTA 5M5XH 1XNQQ 2EXDA 4LFBQ 4HJAA 1Y1VG 3M9BA 5H1SE 3CMAA 3GTOH 3T1HL 3BZKA 4JI7Q 2E2HH 2VZAA 3BZCA 1HNZQ 1PH4A 1HR0W 4IFDG 4IOAA 3ERSX 1V1QA 2EIFA 4P75A 1E1OA 3HFZB 4DV1L 4DK6C 4GKJQ 1IBKL 3CXCA 3CPWA 4LF6Q 3HKZG 4DV4L 1Q81C 2QGQA 5IWAQ 1M90C 4LF7L 1VQ6A 1R9TH 2JEAI 3HOVH 5JEAJ 4JI0Q 2NVYH 2CWPA 3E9IA 4YY3Q 4OWWB 2E5LL 1RIPA 1N32Q 4R4CA 4P71A 3H15A 4IJLA 2R7ZG 1VQ4A 4JYAQ 1IL2A 5EAYA 2BH8A 3S1RH 1AE2A 4DUZL 1VQMA 4X66L 2ZJRA 3OYYA 1MJCA 1G291 1Z9FA 3PO3G 1QUQB 1YEZA 2MO0A 1FVIA 1IBLL 4DR3L 2LXKA 4ALPA 1K8GA 3NEMA 2XGTA 4BBRG 2IX0A 5IP9H 1N8RC 1N34Q 3E0EA 2VL6A 1X3FA 4IPCA 5IP7G 4B3TQ 3KF6A 3HOUG 1Y14B 1VS0A 3U58A 2I5MX 3I56A 2YU9H 1I94L 4NXNL 4OWTB 3UDXA 3HOYH 5ELOA 1HNWL 2JA5G 3CCJA 1Y1VH 1B70B 1EUJA 1TWFH 4HJ8A 2IX1A 4A3EH 3TS2A 1PYSB 4JI2Q 5C0XJ 3JAMi 3HOXG 3G6EA 1HNXL 5IY0A 4WJ3M 4DR6L 4HIMA 4DR5Q 3CCLA 2JJQA 4LF9Q 1TXYA 2I5HA 4GS3A 4HJ5A 4X62L 3PIOA 4DUYQ 3SGIA 1PH2A 2R92H 4UP9A 4Y7NH 5LMNL 4DR2L 4DPGA 3AQQA 3PUXA 5AJ3Q 1P16A 5FJ8G 1XPOA 3H0GG 4XIGS 4DNIA 2JA6G 3FHWA 2KENA 3OW2A 3ULPA 1YITA 1KIXA 3U4ZA 2B29A 2K14A 2VUMH 3J80c 2UXCL 2Z6KC 3FKIG 1BBWA 2F52A 4BY7H 1BBUA 2BA0A 2KHJA 1EIYB 2ZM6L 1L1OB 3PUYA 3I4NH 1XMQQ 4OO1G 1X65A 2N3SA 4BBRH 3A5UA 4L5SA 4JOIC 4AH6A 2E8GA 2AHOB 5IP7H 5IT9c 5LMNW 3E9HA 1N36L 4DR7L 3HOUH 4AYBE 3PUVA 1EQQA 4KLKA 4BXXG 3STBD 1WOCA 3K81C 3KOJA 4A3IG 1VQOA 1KQSA 4QY7A 1A63A 3T1YQ 1VQHA 3F1ZA 2N78A 4UP7A 1OXSC 5M3FG 5IYCH 3HOZH 1PV4A 1PFSA 2ASBA 3HOXH 1Q86C 2K52A 5K36G 1YJWA 2GN5A 2HHHL 2UUAQ 2AWNA 4WJ4A 3EIVA 3MXNB 1Q46A 2CFMA 4LFAQ 3TREA 3UDIA 1XPUA 3J81c 1NTGA 4QL5A 1ASYA 1VQ8A 1A0IA 1U0LA 4LF5Q 4JI1L 4TQUS 1PH3A 1EIFA 1OXUA 3OTOQ 3T1HQ 2VW9A 1X9NA 4L5RC 2C35B 4YWMA 1MIUA 1Q7YC 4A4IA 2HIXA 3H0GH 4JC0A 4GOPC 4X64Q 4HIOA 3A74A 4DV3L 5LMUL 4HJ9A 4NPSA 2Y0SE 3FKIH 4LUVA 2VQEQ 1VQNA 4A3GH 1HJPA 4OONA 1IYJB 3TS0A 2E5LQ 3GDEA 3F2CA 2R93G 2Q2HA 4APVA 1NMGA 5DLQE 4BXXH 2JQOA 2K50A 2WAQE 1YHQA 3F2BA 2ALYB 1XNRL 4JV5L 2JE6I 5HGQA 3G48A 2NZHA 3CCVA 4LNQA 2V1CC 1CKNB 3W5OA 4DKAC 5M3FH 4GKKQ 4KHPL 4IPGA 4DR1L 1YIJA 1SE8A 4P72A 1NE3A 4YWLA 1VQ5A 5HY6A 5C44H 4A3KH 2QEXA 1AH9A 4NB3A 4POGA 3CCRA 1J5EL 4A3LG 1I94Q 1Z47A 1HNWQ 4J15A 2VY3A 3G71A 2I0QA 2R6GA 4A93G 2PI2E 4GNXA 2UUBQ 3BU2A 1G6PA 3A5ZB 2RCNA 1HZAA 2IY5B 4B3ML 4A3CG 2KHIA 2E2JH 4GLXA 4X65L 5FLMG 1UE5A 2UXDQ 4OXPA 4X6AH 4OX9Q 4C3JH 4PMWA 3AFPA 3L0OA 3K80C 4TVAB 1EQRA 2NZOA 1PH9A 4DV6L 3J7A5 3PV0A 5BR8Q 2MNAA 1LM0A 4JBKA 3PF4A 4DR2Q 3PF5A 3M7NA 3RLNA 5ELNA 2OTJA 5C0XI 4DV5Q 4JI5L 1KL9A 2IHFA 4A3JG 1A8VA 1SRUA 2UXBQ 3CCEA 3GD7A 1VQBA 2JA8G 4R1JA 4DV0L 2R93H 1NJIC 4LFCQ 5M5YH 3U50C 2CCZA 1IZ6A 4KI0A 3GTGH 3S1MH 1E1TA 2Q2TA 2D0PA 4A3FH
chains in the Genus database with same CATH superfamily
5M3MH 1I50H 1RTOA 1CSPA 3P7JA 3U4VA 3RLFA 4GLAC 2F4VL 1CZGA 5DAUA 4B3RQ 3J81E 4RKBA 2K5VA 2JXMB 1QZGA 3A0JA 4F7XA 5I9PA 5KEEA 5G3LD 1P8LA 2CQOA 4C1NK 4ILWA 1L1OC 1VQPA 5D3IB 4RAUC 1DOLA 3GV6A 5KGUA 1VQLA 2EE1A 2QCPX 1VQFA 2L9HA 3H94A 3MTSA 1FJGL 3HOUB 1HPCA 2YYZA 3KUPA 4QB4A 1SDFA 3D0FA 2B2WC 2EYJA 5A2QL 2R7ZH 4POFA 4MIUA 1DM0B 3IRBA 3K5MA 4LJZC 1LT3D 1VQKA 4ZYSA 3D8GA 4C56C 4FF2A 1B3QA 4QF4A 4JI3Q 2K75A 1HR0Q 4K2KA 2QDBA 4KD4A 5IWAL 4IJHA 3ULJA 2X69A 1SFOH 4JI0L 3S24A 4A3BH 3FP9A 1K8OA 3K0XA 3DEPA 1SROA 2DUDA 4L5QA 5ISRA 3LWUA 4WORA 1S4ZA 1XJVA 3J81j 1QVFA 2BDOA 4C3HH 3VYTA 4IPDA 1F2YA 4WJWA 1PZID 1YNND 3T4AC 3KJPA 1JR0D 1RD9D 1XPRA 4A3KB 3VA5A 4LF7Q 5C0XG 1K83B 2Z6KA 4XT1B 4YHHL 1AFPA 2QDLA 5BN5A 2SOBA 4DK3C 1B8AA 1WTVA 4X3KA 4F87A 2VXWA 1NUCA 4NKLA 4DAVA 3NENA 3ND9A 1TT2A 1YZ6A 3VR5A 2IW3A 4GLVB 4MHEA 1FGBD 3NQIA 4H02A 4CKEA 2NYZD 3F2DA 3NP8A 3HRZC 2PQAA 2KCMA 5IGGA 4EX5A 3PSIA 1W2BA 5M5YB 1T5XD 4HCSA 1E2VA 2WIIB 1QZHA 3KK7A 5M3MB 3M3YH 3S1NH 3S14B 2N8NA 4DV2Q 2RHQB 4KY7A 1TKWB 3NBHA 2GVAA 2F0KA 2PMZE 4H44C 1PH8A 3E0JA 2Q8TA 4LFAL 1DGSA 3HOYG 2DN8A 1VQDA 1XYIA 4LF5L 2KCNA 2Z9HA 3BYYB 1KHIA 4IOCA 1EYCA 1WTRA 4LW1A 3GQBA 1SLJA 2E75C 3J80L 1GVPA 1E22A 1Q12A 3HG9A 3MHBA 5JOBA 2RDFA 3RN5A 3EJIA 4OEMB 1Q1BA 2PNHA 1T5EA 4IALA 4B9WA 3T13A 1IBML 1JCKB 1KDBA 4X3UA 4DR4Q 1SBBB 1Q82C 2HCCA 4A3JH 3N6RA 4X3SA 3I70A 1YNJC 1A2UA 5EKKA 3QG1A 1PH1A 4JI4L 1SFOB 4KHVA 2HUGA 3VR2A 1MJEA 4A3BB 2UUBL 2SDFA 2UUCQ 2HDLA 4BY1H 2NWGA 1QCBD 1PTOC 3URYA 1SMXA 2UXDL 4OX9L 4JV5Q 1TY0A 2MUYA 2EVBA 2IT1A 4C3HB 3UDGA 1TWGH 2B63G 2F03A 2A1AA 3CC7A 3DUZA 1LLRD 1O7ZA 2R61A 4O0AA 4A3GG 3ICEA 2ZJPA 2EQSA 1W6JA 3RLOA 4X65Q 2K28A 3TRZA 4JBMA 1STEA 1XWEA 4B3RL 4B3TL 3GTKH 5BN4A 4K0KQ 2XWBB 4IUQA 4BWGB 1Y1WH 3CC4A 1VQEA 4NW2A 4A3KG 3FPPA 5IYBH 3ULLA 4FF3A 2ICEC 4JOIA 3KDFB 1AEXA 4RMFA 3V96A 1EQTA 3ONAB 2MFIA 3DXJC 1N33Q 1TS3A 5JEAH 3S1NB 4HMJA 3M3YB 3C1FA 4C3JG 1PFNA 5C3EH 3GO5A 2PZWA 2OF1A 3HGBA 2F3IA 1PVOA 5EKLA 1HZ9A 2XWJB 1BKBA 1HTLD 1LTSD 1X56A 5I6WA 1VMCA 3S16H 4EQOA 2Y0SB 1XMQL 3L7ZC 5M5XB 5IGDA 2OTLA 3TQYA 2NVTH 2K05A 2LMCB 4LF8Q 1CSQA 1VQJA 2OCEA 5JVH3 1PRTD 2F0OA 4K8IA 5M3MG 1EOVA 3SK8A 3Q0AA 2YTXA 2ZTEA 4JI3L 1G51A 1PH5A 3EQLC 4LWCA 5IP9G 1HR0L 4E6IA 1N9WA 2WKDA 1F2LA 5AFWA 4Z9CB 3RZOH 3JC66 4A3DH 3IAYA 2KECA 2PW7A 5FOBB 1YJNA 2EY6A 1SYFA 3D4DA 2EXDA 4HJAA 2RDGA 3M9BA 4TSSA 3GTOH 3D4RA 4JI7Q 1B9MA 4CDCC 5KNDA 1ZYRC 2FJ2A 3BZCA 4IOAA 1IW7D 4IFDG 1O80A 3ERSX 1E1OA 3HFZB 4A3JB 4DK6C 4GKJQ 4H0LC 1EY5A 1JQYD 4LF6Q 4LF7L 2QGQA 3OOCA 1M90C 1KLUD 3HOVH 2NVYH 2CWPA 1ONLA 3E9IA 1IKLA 4IZ8A 2K5WA 2R7ZG 1G2SA 4G7ZC 1IL2A 2GA4B 1CK1A 3OYYA 1G291 4I7AA 1Z9FA 3WOFA 1GUNA 1FVIA 1DD2A 2NN6H 2LXKA 4K6LA 1SYEA 1K8GA 3I4NG 1N8RC 4ZUJA 2K32A 3DWAA 5I2XA 4IPCA 3KF6A 4ZK9B 2HCIA 1TWGB 3CRKC 3T53B 5EPJA 1U4PA 4N8X1 5ELOA 1Y1VH 4HJ8A 4A3EH 2HQEA 4IUPA 5FLXE 5C0XJ 4KN4C 2WINB 1EEFD 3K59A 1WTQA 2A6EC 2JJQA 4LF9Q 3MAQA 4G4KA 1JORA 4CGYB 1KNAA 5C5LA 2P5ZX 1TY2A 4I65A 4DPGA 1FYCA 1D6EC 5AJ3Q 2QILA 1P16A 3A56A 5IGCA 3H0GG 4DNIA 1EYDA 4ZKCB 3MZ5A 1Y1WB 3ULPA 1JB3A 3DHQA 5JPNC 2G9DA 3QO2A 2Z6KC 1Y8NB 2EOTA 3FKIG 2F52A 4XYOA 2BA0A 4BY7H 1SMYC 1ICFB 1BCPC 1X65A 2N3SA 4BBRH 3C2PA 1PZKD 1PMRA 4FO2A 5LMNW 4AH6A 5IT9c 5IP7H 4AYBE 3PUVA 4BXXG 3K81C 1KQSA 2K03A 4QY7A 2F1MA 1ET9A 5C3EB 3HOZH 1AZPA 3CRLC 2IWHA 2KUMA 2UUAQ 2O4XA 3MXNB 1I4PA 1XPUA 3A8JE 3S16B 1IYVA 1NTGA 2WB1B 3TBIB 1VQ8A 1OXUA 3OTOQ 3QWNA 2NVTB 4HCEA 1X9NA 1S5ED 4YWMA 1ESRA 5CV7A 4JC0A 4X64Q 5ELCA 2Y0SE 4LUVA 2VQEQ 4OONA 2PYKA 4A3DB 1QILA 5ELEA 4JVZA 1I4RA 4ZUIA 1NMGA 2JQOA 3F2BA 2ALYB 4JV5L 2JE6I 3OW7A 3G48A 3GTOB 1F9QA 1CKNB 4P2CB 2WAQB 3RUZA 2J4XA 4GKKQ 4IPGA 1BUVT 1SE8A 4YWLA 1WTHA 5C44H 3VYUA 1Y8PB 2Z6BA 3CCRA 4XDXA 5D3DA 1HNWQ 1C48A 2F0IA 3HOVB 2NVYB 4GNXA 3PIO3 5J39A 2IY5B 4ODGA 4X65L 3BZDB 4OXPA 3AFPA 5C4HA 4TVAB 2NZOA 3H91A 1MHWC 1DJRD 3S2HB 3PV0A 2MNAA 4JBKA 1LM0A 4IUNA 2XRQD 3A54A 1EIHA 4A3JG 4J8QA 4KKUA 2JSOA 2ZXOA 3GD7A 3GTMB 1LACA 4R1JA 2R93H 1NJIC 4LFCQ 1Y1VB 1IZ6A 4KI0A 1E2WA 3V2TA 2A69D 4A3FH 1N33L 1N36Q 3GTPB 4BY1G 3M4PA 4B08A 1L0WA 3HKZB 1HRJA 5EPLA 4A93H 5C3XA 2M9VA 3NWTA 3GTLH 5COYA 4A3MG 2CWAA 4DK0A 1J6QA 1HXYD 3C46A 4BBRB 4LF8L 1CQVA 3S1QH 3AFQA 2NN6I 1Q3LA 4YCUA 1KAWA 3M85A 2XVSA 1YNXA 3L2PA 2ENBA 1B44D 3I2ZA 1VQIA 5LMUQ 2PW5A 2AQ2B 2JA5B 2QW7A 5E7NA 1M1KC 1I3QB 4LMQD 3NPPA 1Y1WG 2Z4HA 1ILQA 3RZDH 3NUCA 3DWQA 4JI7L 3BDCA 1SYGA 4ME3A 1STBA 2FFKB 4HSPA 2NVXH 1SNCA 5JEAG 4LF6L 5ELFA 1IXRA 2SEBD 1JMCA 1JWUD 1F9RA 5C3EG 1I4HA 2WB1E 2F0LA 3NK9A 3CCQA 1QVGA 2KBNA 2LSSA 4KK7A 1YNNC 2Q2IA 1B50A 1LABA 3BVGA 4L5TA 2MO1A 1LUZA 4DXGA 2OWOA 1MKHA 3J81i 2K01A 1YBYA 1C4QA 4KD3A 2B3GA 3KF8B 4IFDJ 3IKJA 4PG3A 4ZLTF 4OIKA 4DV0Q 2JYOA 4PZ7A 1U4LA 1TS4A 1UEBA 2ZXPA 1FL0A 2QF7A 4DUZQ 1EY7A 4N8FA 4LF9L 5LHY1 2EYMA 1WTOA 4N9TA 4XQJA 4HIDA 5AJ3L 4XXEA 1XMOQ 2WAQG 5K36H 2RDHA 1K83H 5HGTA 2OXPA 4UAIA 1S72A 3OWEB 2K04A 1EWIA 2L5TA 1PFMA 3VR4A 2CH4W 2R93B 4OO1I 4TRDA 2M2LA 1HNXQ 2KEEA 2HQLA 1STGA 4I7ZC 1SXTA 3LWEA 4BA2I 4X62Q 3HZXA 2FXQA 5KIXA 4U68A 4M1UB 1STAA 3CPFA 3LGJA 2DY8A 3T56B 1CKOA 1OTCA 3P75A 5G3LF 4CHTB 5M5WH 3W1BA 1ZKOA 1NBWA 3NTHA 4A93B 2VQFL 2UUAL 3KLRA 1VQAA 3QOJA 3GTLB 3S14H 4A3EG 1SR3A 3OTOL 3HKZE 1KD1C 3KBGA 1JJ2A 2CW0D 3S1QB 1VQGA 1EYGA 1HUMA 4A3LH 3I7FA 4X64L 5D14A 3PMFA 2D5DA 1JWMD 2RKSA 4CJ0B 1OO9B 2IHEA 1BDOA 2VQEL 1A3TA 1LT4D 5IT9L 4DV7L 3OWFA 5C5MA 2HHHQ 4A3CH 1D2BA 3W1GA 1RHPA 1QUQA 2YV5A 1K8AC 2EYFA 4JI1Q 4DXFA 1WYDA 3RZDB 4AQYL 4BY7G 2F0MA 4GN4B 4GKKL 2L0CA 2NVXB 3QIAA 2F0VA 1CM9A 1OXVA 1T9HA 3LX0A 1R4PB 2K5NA 3CCMA 1PA6A 4JPBW 2EYHA 2EY5A 3HOZG 1STNA 1PH6A 3I3CA 4ZAIA 2K5HA 1K73C 4JBJA 1XNRQ 2E2IB 1Q1EA 1U4MA 3HKSA 5HURA 1CZWA 1E24A 3PO2H 1SN8A 3J7ZC 5DM73 1R4QB 1ILPA 1FR3A 1EEID 4JI6Q 3FEWX 2HT1A 1N32L 4NXMQ 2B2UA 2HD3A 3K0YA 4LFCL 3I4MH 2PQEA 2N49A 1V1PB 3T16A 1WCMG 5JJLA 2RCFA 4DV6Q 5GAHC 2JA7H 1SJED 3K7UC 3GTJH 1LTLA 4JI5Q 3ZJYC 4UPAA 1H9SB 2L12A 5C44G 5IYDH 3FRPB 4FNFA 2B8GA 4GNXC 1QWYA 2LY7A 2RA4A 2JEBI 3HOWH 2VNUD 3QJYA 4WRDA 3SXHA 1S5BD 1TWHH 1YI2A 3CCSA 1HFGA 5M5WB 4RKLA 1VDZA 3NBIA 2ES2A 1CA6A 4JG2A 5E1FA 3QOLA 4HMIA 2JP1A 3DMUA 1B7YB 3KBXA 3JAME 3QB3A 4MZ9A 4RG1A 4A3FG 4BBSH 1G6ZA 3T1YL 4GOPB 1I6HH 3M4QA 4IUVA 1OXXK 3E5SA 2CHBD 2EYLA 2OEOA 4QQBX 1HQRD 5LL6X 2PI2A 5IGFA 5M5XH 4BS9A 4LFBQ 3TP8A 1SNPA 4HR7B 2E2HH 1HNZQ 3AMUA 4RWSC 1V1QA 4RA8A 2EIFA 2QEJC 2KVMA 2BE5C 3CXCA 3CPWA 4JW0A 1Q81C 5JEAJ 1KNEA 4YY3Q 4OWWB 2E5LL 1RIPA 4P71A 2EYPA 4DN4M 3H15A 1VQ4A 1HCZA 4DUZL 5CBAE 4HEDA 4IN3A 1KDCA 2MO0A 2IPKD 2Z4IA 2C9OA 2IX0A 4DFAA 3E0EA 2F0GA 3MVVA 3HOUG 1B3AA 3TP5A 2FHTA 3MWYW 1Y14B 4HAEA 3PO2B 2I5MX 3I56A 1I94L 3UDXA 1D1KA 1TWFH 1MSHA 4G7OC 3I4MB 3TS2A 1HNXL 3SK6A 3UI2A 4HIMA 4DR5Q 2I5HA 4HJ5A 4X62L 1IHZA 4DUYQ 2R92H 4QUCA 4UP9A 4Y7NH 2TMPA 4DR2L 2B2YC 1B53A 3VA7A 2JA7B 3GTJB 1XPOA 2A68C 4CJ1B 3FHWA 1DCZA 3VYRA 3FPUB 2KENA 3DWPA 1YITA 2B29A 2K14A 2VUMH 3CU7A 1BBUA 2KHJA 3F2UA 1L1OB 3PUYA 2FINB 1GHJA 3HP3A 4X3TA 4PMCA 3E9HA 3HOWB 1ESFA 2SNSA 5KYIA 1TWHB 3KOJA 2G9HD 4AYBB 4UP7A 2EY2A 1PFSA 4R8NA 1SYBA 3HOXH 1Q86C 2WV6D 5K36G 2HHHL 4WJ4A 3EIVA 1Q46A 3Q23A 3V05A 1A3UA 2PZUA 1PRTF 2B2TA 4K8JA 3NTIA 1A0IA 1U0LA 4RCOA 4JI1L 3T1HQ 1VF7A 4DGZA 4Q0FA 4A4IA 4CKCA 1PFBA 1BXTA 3C1EA 1LT6D 4BBSB 3A74A 4R8IA 3BVZA 1TS5A 4NPSA 1I6HB 2FMCA 4RGTA 1X3QA 4L63B 2Q2HA 1I4QA 4EQNA 5K5PA 1H9RA 4R9WA 1XNRL 4FF1A 3DEOA 3CCVA 2E2HB 4DKAC 3W5OA 5M3FH 4PV1C 2LFNA 3K6OA 4P72A 1VQ5A 3FVQA 3X3NA 1HQMC 1SE2A 4POGA 4A3LG 3SK5A 4HTHA 1M8AA 2F0FA 1PRTB 1H9JA 1RODA 3BU2A 2KOLA 1G6PA 3A5ZB 2RCNA 5FO8B 2EYOA 4A3CG 1UE5A 3L0OA 3J7A5 1EQRA 4DV6L 2B2VC 5BR8Q 1HA6A 2NVQB 1WVLA 3M7NA 1SNDA 5ELNA 1EZ6A 2OTJA 1CA5A 4JI5L 2IHFA 1SRUA 2UXBQ 1B4OA 3MXGA 1AZQA 3EA6A 4OGQC 1ET6A 1SYDA 1TWFB 2MGSA 2CCZA 2H1EA 5E4WC 1E1TA 3MA2B 2D0PA 3I73A 3OMCA 2RSNA 2EPBA 2A6HC 2AQ1B 1K8MA 4FDBA 5JAVA 3S2HH 2R92B 1SNQA 1I5FA 4OWXB 4OL7A 4Y7NB 5GAEC 1IKMA 2NTSA 1CUKA 3GTMH 5A2QE 5CORA 1A3VA 4FXGC 2F0HA 5FLMH 1HHVA 2VUMB 3K7AH 1WTWA 3W2DA 2RF4A 2MHVA 2B2UC 4A3BG 1K3RA 1O7IA 4JK1C 4LK1C 1H9KA 1MGSA 3GTPH 3PUZA 5IIFA 1V8QA 4V0BA 3DM3A 4ME5A 2UU9Q 3EN2A 4DV2L 3NELA 2XTIA 4H13C 2CVRA 3MEFA 5J1ZA 3CF5A 4DV3Q 4C3HG 3BG3A 3ITPA 1SSOA 1I4XA 3HOXB 1AN8A 1GXDC 4NP5A 3A7LA 3STBC 3PO3H 1V43A 4C1NI 4LFBL 1YNJD 2VB2X 4WFN3 2I07B 5KNCA 2YTVA 1HNZL 4CDFC 2KA7A 1S3OA 4ZCKA 1DOKA 2EY1A 4YWKA 5JVG3 2JA5H 4KMUC 2LXJA 4AYBG 3CKIB 4RHRA 1I3QH 4NDXA 4YY3L 3Q22A 3L3OC 1K9MC 1QJOA 4DAYB 1RCVD 1SEBD 4ULLA 4CBVA 4B3MQ 4AIMA 2QA4A 3IL8A 5IGEA 3J7YW 1U9RA 5IODA 4DR4L 4MTKA 5M3FB 2MQHA 3CMEA 3BS1A 4M8AA 3AU7A 4DV4Q 1RTNA 3K8AA 1JE5A 3KDFA 4OO1H 3CCUA 2ID0A 2UUCL 3K5OA 1C9OA 2WP8J 5I6YA 4DR5L 1LTBD 2Y0SG 4FP5D 1CHQD 3NWSA 3EVQA 4A3IH 1IBLQ 4KY6A 3H3VH 5GADC 3J7AV 1LTRD 5FLXc 1X32A 1U4RA 1HZBA 5L37A 1GUWA 4PZ8A 2JA9A 4ZQ3A 1KTKA 2ATWA 1BOSA 3E3XA 4NXNQ 3RR5A 3O13A 1SAPA 2BDNA 2HDMA 1EFID 4DR6Q 1II3A 3S17B 4RHSA 5LMNQ 1BBXC 3J80E 3RN2A 4K0KL 4DK1A 2ZJQA 2K5QA 4S3SA 2A5HA 1C7YA 3CW2C 1LT5D 3CQZB 4L6TB 1FGUA 1W3SA 2O5IC 2UXCQ 4A76A 3K7AB 2ZM6Q 2F0EA 2NZ1D 4QIWE 2NUCA 4R4QA 3UDFA 4DF7A 1FNVA 3GTQB 3J7AF 2LKVA 2F0WA 2R92G 1X6OA 2K5DA 2H5XA 1ICWA 5GROA 2BA1A 1ZYRD 3Q8DA 1EWCA 3KFUA 3PO3B 2VUMG 1NR2A 3R2IA 1CHPD 2IL8A 1ZEQX 3F8TA 1TIID 3L9AX 1C0AA 3OIQA 1VQ7A 1A2TA 1IYUA 2EJGC 1JWSD 2L55A 4YHHQ 1CKMA 2IX3A 3RD4A 2D62A 3TP6A 1C8CA 1GKHA 2JK8A 5EPKA 5IYBG 2SNMA 1EY6A 1X3EA 1EU4A 4MN3A 2B2TC 1RL2A 5BR8L 3I4OA 4XYQA 3EBEA 1YHAA 4XQNA 4GKJL 4KHPQ 3UE0A 1G2TA 4ZRZA 2A6ED 2UXBL 3GP7A 1I6VC 4K5VA 1B9NA 3KJOA 1VQ9A 3S15B 2WB1G 4MNOA 2E2IH 1JJGA 4C3IH 2B2YA 2PCFB 1W6KA 4A3IB 1GUOA 3ZYYX 2F4IA 4C2MB 3MXUA 1SMYD 1DYQA 1BCPD 2OQKA 1WTXA 1TWAH 4J1MA 3MXNA 1E7ZA 1EY0A 3MFYA 3H09A 3M4OB 1UWVA 3BVMA 4KJOA 3CD6A 3S2DH 4A3DG 1XTDA 1BCPB 2CH4A 2Z1CA 3DM1A 4IUTA 4K5XA 3AB9A 1D5XC 3TEHB 2A74C 2UU9L 2B63H 3OHXC 3D6WA 2RBMA 2PO4A 1RKNA 1VMPA 4LF4Q 5T1IA 2M00A 2K4KA 3R2TA 4IURA 5I9OA 3MXPA 5C4XH 2PQAB 1GD7A 3HOVG 1Q8KA 1IBMQ 4TKOB 1ASZA 1DOMA 1CKNA 3PCOB 3VR6A 2AMCB 1PHJA 3KLWA 1Q8IA 2K1BA 4JI8Q 2ICIA 2Q2UA 3H3VI 1HH2P 2NN6G 2D0OA 1SNOA 2A19A 2DNEA 3NE5B 1VQCA 1L0YB 1S5DD 4JI4Q 3NBHB 4HJ7A 3WOEA 2FMMA 5CMDA 1LTID 3U9OA 3G7LA 1EIGA 5D65A 1XNQQ 1Y1VG 5H1SE 1HA5A 2JN4A 2VZAA 1HR0W 1J8IA 4O42A 5ELDA 1NR4A 2RSOA 3HKZG 3Q6SA 4DV4L 1Z7TA 1R9TH 2JEAI 2EXZA 4KJNA 3HOYB 2F0QA 4JYAQ 3SDZA 1TQOA 5EAYA 2ZJRA 1F9PA 4OIJA 2B2VA 2PPBC 3PO3G 3A8KE 3QR8A 1YEZA 1IBLL 3NEMA 1ML0D 2XGTA 3PQIA 4BBRG 5IP9H 1E0BA 4EQPA 1N34Q 1A6XA 2RQXA 5IP7G 3SEBA 4ID6A 4B3TQ 5EQ0A 3R3OA 1VS0A 3TZDA 2Q8IB 1EYAA 1JE4A 4NXNL 1HNWL 2JA5G 3FMCA 4RCNA 1B70B 1EUJA 3U9SA 4DNTB 2IX1A 3FDTA 4JI2Q 3G6EA 3JAMi 4WJ3M 4DR6L 2F0SA 2F0DA 4IFDH 3NHHA 4GS3A 5FKAC 1K28A 2MJ8A 1BQQT 4C3IB 5LMNL 4Q5VA 2F0JA 3PUXA 2G5DA 4CJ2C 1TWAB 4XIGS 4DAPA 3W3AA 1O7YA 2ZT9C 3U4ZA 2UXCL 1GOZA 5FLXL 4DU9A 1EIYB 2ZM6L 3MEHA 1UEAB 1XMQQ 2MPMA 4CKBA 3I4NH 4OO1G 3S2DB 1PYWD 3A55A 2AHOB 1N36L 2LS01 3EROA 2PNRC 4K5WA 2B63B 3SVMA 1WOCA 3IFTA 3TZUA 1VQOA 4A3IG 1A63A 3K57A 3F1ZA 2N78A 1OXSC 5BN3A 1QB5D 1LTGD 5IYCH 1DZ1A 2KHSA 4A3GB 5FO7B 1YJWA 2CFMA 3TREA 3J81c 4FF4A 5C4XB 2BCOA 1ASYA 1PH3A 1CT1D 1EIFA 3D6CA 3A8IE 4L5RC 2A73B 1MIUA 3K5NA 3KF8A 1Q7YC 2HIXA 3H0GH 2DNCA 4KY5A 4PQXA 5CV8A 5LMUL 4HJ9A 1V1OA 3FKIH 3X3MA 1XXGA 1HJPA 1KLGD 2DY7A 3OPOA 1PRTC 3TS0A 3F2CA 1D5MC 1TS2A 5M9OA 2R93G 4APVA 5DLQE 4BXXH 4J6HA 1MSGA 2ZXRA 2NZHA 4C3JB 2E74C 2V1CC 3BYTB 2L4NA 4KHPL 1EY9A 1EU3A 2EJMA 4NB3A 2QEXA 1F77A 1NCVA 1Z47A 4J15A 2VY3A 2H4OA 1R9TB 1IW7C 4A93G 2PI2E 2E2JH 4GLXA 4X6AH 5DNFA 4PMWA 4YIJA 4B9XA 1I50B 3K80C 4N9PA 4KKSA 3PF5A 3RLNA 3T51B 4DV5Q 1A8VA 1VQBA 4DV0L 3NXWA 4RFBA 3HS0C 3GTGH 3S1MH 1UNSA 1KXLA 2WFWA 3CHBD 1EFWA 2NVQH 1CTMA 4UP8A 2BH2A 5E3FA 3MC0B 4JBWA 4B3SQ 1XMOL 2CKZB 4LF4L 4GN5A 1WFQA 4A75A 3PUWA 2OQ0A 3KF6B 1KABA 1S40A 1L0XB 3CC2A 2X6LA 2R7ZB 1KRSA 1S5FD 2VS1A 5CV6A 3NSWA 1HTPA 3OMGA 1BVSA 2J0TD 1F2ZA 1U5KA 1NMFA 2VB3X 3PGZA 3I4NB 1OXTA 5A35A 5CBEE 4UHVA 3TN2A 5JJZA 4JI8L 1WJJA 4V190 3BJUA 5KNBA 3GV3A 3I90A 1MD2D 5GAGC 4C3IG 1EQVA 4P74A 3JAMc 1GHKA 4OHJA 1K3BC 2O2LD 4FXDA 1AE3A 2ZTDA 1J9OA 3D4WA 1LTTD 4IUUA 1JOKA 2AUKA 4XTCS 1XNQL 4ZKBB 2CQAA 1ENAA 1YJ9A 4LUZA 5IE8A 4IFDI 2F3VA 1LTAD 1KDAA 4CDDC 5IGBA 1H95A 4HN7A 4R4OA 3B6YA 1PLFA 2ZTCA 2EDGA 1HFNA 1QNKA 3H0GB 1X55A 1CI3M 5KYLA 1AP0A 2K7VA 1V1PA 1V9PA 4QJFA 3FKIB 3VDYA 1WI5A 1BF4A 3WDNA 1WD0A 2V4DA 4A3MH 1B2TA 4JYAL 4L8JA 5C6AA 2F0UA 1EOTA 1UE6A 5C4XG 3OSOA 3I8ZA 3ER0A 4FVMA 4IPHA 2QKIC 2R7FA 4LUOA 4PZ6A 1H9MA 1PZJD 5FJ8H 1N34L 2A8VA 4DV1Q 1GO3E 2JA6H 4DNRB 1IBKQ 1H9SA 1QVCA 1TWCH 1SE4A 5EJWA 1X3GA 1EWHA 3I4LA 3D31A 4GN3B 4JI2L 4QCLA 1PTOH 4X66Q 1E3PA 1GUGA 1JJCB 2R7DA 2E2JB 1JT8A 4HIKA 1GUTA 3CAMA 4DR3Q 5EKIA 2XNAC 5J22A 3CP0A 2BOSA 5T1GA 4R4IA 2KEDA 4P73A 4LAAA 1NSNS 4JI6L 1L2FA 4NXML 2L15A 1JOOA 1XTCD 3GTGB 5ELBA 3S1MB 4GNXB 1PH7A 1D1IA 1Q90A 5C4JH 3G4SA 4GOPA 2XRSD 2B8FA 1KC8C 4KHZA 2D2CC 2AWOA 2A69C 2N55A 1D7QA 1SJHD 5IT9E 1QNUA 2E76C 4CDEC 2EZVA 1TVXA 2HIVA 1Y8OB 1F2MA 2RVLA 4UY8C 1M4VA 5CR3A 3A7AB 1GUSA 3S17H 4DR7Q 3DLLA 3LNNA 1D8LA 4QIWB 5JJKA 1ENCA 2WACA 1PXUA 3VYSA 1AW7A 4F8MA 3PO2G 3CQZH 3TSSA 5F2DA 2BE5D 2F0PA 4YCVA 4DAMA 1K0RA 3ND8A 5CYUA 3I4MG 4BY1B 3P1HA 3GTQH 1PYBA 4XQQA 4NMZA 5J3BA 1PTOF 1UE1A 3R93A 4IO9A 1UE7A 3AYHB 5FK9C 3J81L 2JA8H 2JA7G 4IQZA 3AEVA 1EY4A 1RF2D 3TMEA 5EBCA 1HZCA 2I5LX 5IYCG 1NY4A 4YCWA 5C4ZA 3K58A 4A3MB 3VR3A 3I91A 4O2DA 1HUNA 1SNMA 5IYDG 5CC4A 4F88A 1BR9A 2IJ0A 1YVCA 3J80i 1A62A 3I55A 1S5CD 3NTKA 1TR5A 3PIP3 3H3VC 1YHBA 3HOWG 2Q8RE 2KQ3A 4DR1Q 1D5ZC 2JA6B 4DV5L 1PTOD 3GTKB 3SHLA 4EQ5A 1PDQA 1J5EQ 4RH6A 1ENFA 1JOQA 1TWCB 1L1OA 4FXKC 3SK4A 2KCCA 2AUJD 3H6MA 4R4TA 1FD7D 1F9SA 2A68D 3MFGA 1PTOB 1NAPA 4KKTA 2K6AA 2L11A 1LYLA 4OELB 3K5LA 2GVBA 2B2WA 3RNUA 4B3SL 1MI2A 3RMHA 3KYHC 4KTAA 4BBSG 2R3ZA 3P20A 4H7BA 1DXMA 2VQFQ 2YTYA 3S15H 3WWVA 1JB7A 4KV6A 4G57A 2AKWB 5DEHA 2F0NA 5FO9B 1QOHA 2DGYA 1STYA 4DUYL 2XN9C 3I72A 5C4JB 4C2MH 1O7LA 4MTNA 2F4VQ 4U673 3TDQA 5JJIA 1BNZA 1G8ZD 3PIPA 1GM5A 2RHSB 3BDOA 1MBYA 3G6JB 3M4OH 3S9WA 4DV7Q 4Y52H 2EJFC 1WCMH 3RZOB 1X54A 4XT3B 4O1NA 3UE1A 1O78A 1EZ8A 2Z0SA 1VCIA 5CV9A 3SR1A 4AQYQ 2O5JC 4JCVE 5DM63 1FJGQ 5GQOA 5C0XH 1IL8A 2KCTA 2F0TA 1QE6A 3NQTA 2KJXA 5I2YA 2CW0C 2D9UA 4BA1I 4QGUA 1KRTA 1NNXA 3CMAA 2WKCA 3JAML 3BZKA 3T1HL 1A15A 1PH4A 2OT2A 5KRUA 2F3WA 4P75A 4DV1L 5JPMC 3SE0A 2NBFA 3M4YA 3E6ZX 1IBKL 4RGOS 2JA8B 5IWAQ 1VQ6A 1RDPD 2X6GA 4JI0Q 1N32Q 4RGMA 4R4CA 4IJLA 1EL0A 4HSVA 1G91A 1XX8A 4A3EB 2BH8A 3S1RH 1AE2A 1VQMA 4X66L 2L1BA 2TSSA 1MJCA 4FYDA 1QUQB 4K6DA 4DR3L 4ALPA 3N52A 2VL6A 1X3FA 1SE3A 2XIWA 1GJXA 4ABNA 4QUFA 2A6HD 3U58A 2YU9H 1LO5D 4OWTB 5IOCA 3HOYH 4RGNA 3KLSA 1KAAA 3CCJA 4K2LA 5I4DA 2PZTA 1PYSB 1CQFA 3HOXG 4BY7B 5IY0A 3R8BA 3CCLA 1TXYA 3PIOA 1BCPF 1FNWA 3SGIA 5C3WA 1PH2A 3EFXD 1TU2B 5E4XA 3AQQA 5FJ8G 4DA2A 2JA6G 3HOZB 1KIXA 3OW2A 1VF5C 3J80c 1STHA 1BBWA 1CFMA 2N88A 3A5UA 3C3LA 4L5SA 2Z8LA 4JOIC 1UUPA 2E8GA 4DR7L 2AQ3B 3HOUH 1WD1A 1SYCA 1EQQA 4KLKA 1UAPA 5CGKA 3STBD 2J7ZA 3T1YQ 1JICA 1VQHA 5LL6S 5CV4A 1EY8A 1BO0A 1QG7A 4PMBA 4EGVA 5M3FG 1JC7A 1PV4A 2ASBA 2B39A 4DAYA 3Q24A 2K52A 2GN5A 2AWNA 4LFAQ 1WCMB 2I46A 3UDIA 4QL5A 4LF5Q 4TQUS 4K14A 2VW9A 5NUCA 4QMGA 2C35B 3BDLA 5TSSA 4GOPC 1X3PA 4HIOA 3IFDA 4DV3L 2NB0A 5C44B 4G7HC 4A3GH 1VQNA 4UDUC 1IYJB 5EBDA 2MP1A 2E5LQ 3GDEA 1Y69U 5CV5A 1Z6HA 2C5CA 2K50A 2WAQE 1YHQA 5HGQA 4LNQA 3KLSX 4PNYA 1RJTA 4DR1L 1YIJA 1NE3A 3M7GA 5HY6A 4A3KH 1AH9A 1J5EL 4GZYC 2XSCA 1I94Q 2DJFC 3G71A 2I0QA 2R6GA 1DONA 3D3RA 2K33A 2UUBQ 1HZAA 4B3ML 3HEJA 2KHIA 3S1RB 5FLMG 1FNUA 2UXDQ 4A3FB 4OX9Q 4C3JH 4EVOA 1LV9A 1PH9A 2E2DC 5EGTA 3PF4A 4DR2Q 3ERQA 3TP7A 5C0XI 2DJGC 2NTTA 3OIPA 1B1ZA 1KL9A 3CCEA 1K0SA 4KN7C 2YU9B 2JA8G 1ZXTA 5M5YH 3U50C 2PMZB 1WTPA 1I4GA 2Q2TA 1E2ZA
chains in the Genus database with same CATH topology
5M3MH 1KXLA 2WFWA 1I50H 1N33L 1N36Q 1CSPA 4FDBA 1EFWA 4BY1G 3S2HH 3U4VA 3RLFA 2NVQH 4GLAC 4UP8A 2F4VL 3M4PA 2BH2A 1I5FA 1L0WA 4OWXB 4B3RQ 4JBWA 5GAEC 4B3SQ 1XMOL 2CKZB 4LF4L 2K5VA 1CUKA 4GN5A 1QZGA 3A0JA 3GTMH 1WFQA 4A75A 4A93H 3PUWA 2OQ0A 3KF6B 1S40A 3CC2A 1KRSA 2VS1A 1P8LA 2CQOA 5FLMH 3K7AH 1BVSA 3GTLH 1L1OC 2RF4A 1VQPA 1U5KA 1NMFA 3PGZA 4A3BG 1K3RA 1O7IA 4A3MG 2CWAA 1J6QA 1OXTA 3PUZA 1VQLA 4LF8L 3GTPH 3S1QH 3DM3A 1VQFA 1WJJA 3AFQA 4JI8L 2UU9Q 2NN6I 3BJUA 3EN2A 4YCUA 1FJGL 1KAWA 3NELA 4DV2L 2XTIA 3M85A 2YYZA 3MEFA 1YNXA 5GAGC 3L2PA 3I2ZA 3D0FA 1VQIA 3CF5A 5LMUQ 4DV3Q 4P74A 3JAMc 2R7ZH 5E7NA 4POFA 1AE3A 2ZTDA 1M1KC 3IRBA 1Y1WG 3STBC 3PO3H 4XTCS 1VQKA 1XNQL 1V43A 4LFBL 1YJ9A 3RZDH 4LUZA 5IE8A 4IFDI 4JI7L 2YTVA 4ME3A 1HNZL 1H95A 4R4OA 3B6YA 1S3OA 2ZTCA 2NVXH 5JEAG 4JI3Q 1X55A 4LF6L 2K75A 4YWKA 1HR0Q 1IXRA 2JA5H 1JMCA 5IWAL 4IJHA 2LXJA 3ULJA 4AYBG 1V9PA 5C3EG 1I3QH 2WB1E 4QJFA 1SFOH 3S24A 3VDYA 1WI5A 4YY3L 4JI0L 4A3BH 3FP9A 3K0XA 3CCQA 4A3MH 1QVGA 1K9MC 4JYAL 4DAYB 2KBNA 2LSSA 1SROA 2DUDA 4L5QA 4B3MQ 2Q2IA 4AIMA 1UE6A 4L5TA 5C4XG 2MO1A 2QA4A 3ER0A 1LUZA 3J81j 1XJVA 2OWOA 1MKHA 4IPHA 4DR4L 1QVFA 2R7FA 4LUOA 4PZ6A 3J81i 5FJ8H 1N34L 2A8VA 1YBYA 4C3HH 4DV1Q 4IPDA 1GO3E 2JA6H 1IBKQ 2B3GA 2MQHA 3KJPA 3CMEA 3KF8B 4IFDJ 1QVCA 1TWCH 1XPRA 4DV4Q 4LF7Q 5C0XG 3K8AA 1X3GA 2Z6KA 1JE5A 4PG3A 4YHHL 3KDFA 4DV0Q 4PZ7A 4DK3C 3CCUA 1B8AA 2ID0A 3D31A 1UEBA 4GN3B 4JI2L 2UUCL 1FL0A 1C9OA 2WP8J 4DUZQ 4X66Q 1E3PA 4DR5L 2Y0SG 4LF9L 1JJCB 2R7DA 1JT8A 4HIKA 4A3IH 1IBLQ 3CAMA 4DR3Q 3NENA 3H3VH 5GADC 3CP0A 1YZ6A 4GLVB 5FLXc 1HZBA 4HIDA 5AJ3L 1XMOQ 2WAQG 4H02A 4PZ8A 4R4IA 2JA9A 4P73A 1K83H 3F2DA 4JI6L 2ATWA 2PQAA 1S72A 1EWIA 2KCMA 3RR5A 4NXNQ 1L2FA 4NXML 2L15A 4OO1I 4EX5A 3PSIA 1W2BA 1HNXQ 2HQLA 4DR6Q 4GNXB 1PH7A 3S1NH 5C4JH 1QZHA 3M3YH 4X62Q 4BA2I 3G4SA 2N8NA 2FXQA 4GOPA 3CPFA 5LMNQ 4DV2Q 3LGJA 2RHQB 1KC8C 4KHZA 3RN2A 1CKOA 1OTCA 5M5WH 4K0KL 2AWOA 3W1BA 2ZJQA 2GVAA 1NBWA 1D7QA 2PMZE 1C7YA 3CW2C 2VQFL 1PH8A 2UUAL 2HIVA 1FGUA 1W3SA 4LFAL 2UXCQ 1VQAA 1DGSA 4A76A 3HOYG 4UY8C 2ZM6Q 1VQDA 4LF5L 4QIWE 4R4QA 4A3EG 1KHIA 1SR3A 3HKZE 3OTOL 4IOCA 1KD1C 3S14H 3UDFA 3S17H 4DR7Q 1JJ2A 3DLLA 1VQGA 4LW1A 1D8LA 1EYGA 1SLJA 5JJKA 4A3LH 1GVPA 3I7FA 1E22A 1Q12A 4X64L 2R92G 1X6OA 3RN5A 2H5XA 2IHEA 1Q1BA 2PNHA 5GROA 2VQEL 2BA1A 3PO2G 4DV7L 3CQZH 3Q8DA 2HHHQ 4A3CH 3W1GA 4YCVA 4DAMA 1K0RA 1QUQA 2YV5A 3KFUA 1IBML 2VUMG 3I4MG 1K8AC 4JI1Q 1WYDA 4AQYL 4BY7G 3GTQH 1PYBA 5J3BA 4DR4Q 3F8TA 1UE1A 1Q82C 4A3JH 4IO9A 4GN4B 1UE7A 1C0AA 3AYHB 4GKKL 2JA8H 1OXVA 1VQ7A 2JA7G 3AEVA 1T9HA 3CCMA 2K5NA 1PH1A 1PA6A 4YHHQ 1HZCA 4JI4L 1CKMA 2I5LX 3HOZG 1MJEA 2D62A 5IYCG 1PH6A 2UUBL 1NY4A 1GKHA 4YCWA 2UUCQ 2JK8A 4BY1H 2K5HA 4O2DA 5IYBG 5IYDG 1SMXA 2UXDL 1X3EA 1YVCA 4JBJA 1K73C 4OX9L 1XNRQ 4JV5Q 3J80i 1RL2A 1A62A 1Q1EA 3HKSA 5BR8L 3I55A 3I4OA 1YHBA 3EBEA 2IT1A 3HOWG 1YHAA 1E24A 4GKJL 4KHPQ 3UE0A 4DR1Q 3PO2H 1SN8A 3J7ZC 3UDGA 4DV5L 1TWGH 2B63G 4EQ5A 2UXBL 1J5EQ 4JI6Q 2A1AA 3CC7A 2HT1A 1L1OA 1N32L 4NXMQ 3I4MH 4LFCL 4O0AA 4R4TA 3KJOA 1VQ9A 2N49A 3ICEA 2ZJPA 4A3GG 2EQSA 1WCMG 3RLOA 4X65Q 2WB1G 4MNOA 2E2IH 3TRZA 5JJLA 1LYLA 4JBMA 4C3IH 1JJGA 4DV6Q 3I4NG 5GAHC 2GVBA 3RNUA 2JA7H 3K7UC 4B3RL 3GTJH 4B3TL 4B3SL 2OQKA 3GTKH 4K0KQ 1LTLA 4JI5Q 1TWAH 4BBSG 3KYHC 1Y1WH 3ZJYC 1E7ZA 1VQEA 4UPAA 3CC4A 5C44G 5IYBH 1UWVA 2VQFQ 4A3KG 3ULLA 5IYDH 2YTYA 3CD6A 3S15H 3WWVA 1JB7A 3S2DH 4JOIA 3KDFB 4A3DG 4RMFA 2AKWB 1XTDA 4GNXC 2MFIA 2JEBI 3HOWH 2DGYA 1N33Q 3TEHB 2VNUD 4DUYL 4C2MH 2UU9L 2B63H 4MTNA 1TWHH 2F4VQ 1YI2A 5C3EH 3GO5A 3CCSA 5JJIA 4LF4Q 3PIPA 2F3IA 1GM5A 2RHSB 1PVOA 2K4KA 3M4OH 1HZ9A 4DV7Q 4Y52H 1BKBA 1X56A 1WCMH 3S16H 2ES2A 1X54A 4JG2A 5C4XH 2PQAB 1GD7A 3HOVG 3UE1A 1Q8KA 2Z0SA 1VCIA 1XMQL 3L7ZC 1IBMQ 1ASZA 2OTLA 1CKNA 3PCOB 3TQYA 2AMCB 2NVTH 1B7YB 4AQYQ 1CSQA 1VQJA 3KLWA 1PHJA 4LF8Q 2OCEA 4JI8Q 4JCVE 4MZ9A 4RG1A 4A3FG 2Q2UA 5M3MG 1FJGQ 3H3VI 4BBSH 1EOVA 5GQOA 2YTXA 2ZTEA 1HH2P 1G51A 2NN6G 4JI3L 2KCTA 4LWCA 2D0OA 5IP9G 4GOPB 3T1YL 1PH5A 3M4QA 1HR0L 2A19A 1I6HH 1N9WA 1VQCA 1OXXK 3RZOH 3JC66 4A3DH 4JI4Q 3NBHB 4HJ7A 4QQBX 4BA1I 4QGUA 1YJNA 2PI2A 1KRTA 5M5XH 1XNQQ 2EXDA 4LFBQ 4HJAA 1Y1VG 3M9BA 5H1SE 3CMAA 3GTOH 3T1HL 3BZKA 4JI7Q 2E2HH 2VZAA 3BZCA 1HNZQ 1PH4A 1HR0W 4IFDG 4IOAA 3ERSX 1V1QA 2EIFA 4P75A 1E1OA 3HFZB 4DV1L 4DK6C 4GKJQ 1IBKL 3CXCA 3CPWA 4LF6Q 3HKZG 4DV4L 1Q81C 2QGQA 5IWAQ 1M90C 4LF7L 1VQ6A 1R9TH 2JEAI 3HOVH 5JEAJ 4JI0Q 2NVYH 2CWPA 3E9IA 4YY3Q 4OWWB 2E5LL 1RIPA 1N32Q 4R4CA 4P71A 3H15A 4IJLA 2R7ZG 1VQ4A 4JYAQ 1IL2A 5EAYA 2BH8A 3S1RH 1AE2A 4DUZL 1VQMA 4X66L 2ZJRA 3OYYA 1MJCA 1G291 1Z9FA 3PO3G 1QUQB 1YEZA 2MO0A 1FVIA 1IBLL 4DR3L 2LXKA 4ALPA 1K8GA 3NEMA 2XGTA 4BBRG 2IX0A 5IP9H 1N8RC 1N34Q 3E0EA 2VL6A 1X3FA 4IPCA 5IP7G 4B3TQ 3KF6A 3HOUG 1Y14B 1VS0A 3U58A 2I5MX 3I56A 2YU9H 1I94L 4NXNL 4OWTB 3UDXA 3HOYH 5ELOA 1HNWL 2JA5G 3CCJA 1Y1VH 1B70B 1EUJA 1TWFH 4HJ8A 2IX1A 4A3EH 3TS2A 1PYSB 4JI2Q 5C0XJ 3JAMi 3HOXG 3G6EA 1HNXL 5IY0A 4WJ3M 4DR6L 4HIMA 4DR5Q 3CCLA 2JJQA 4LF9Q 1TXYA 2I5HA 4GS3A 4HJ5A 4X62L 3PIOA 4DUYQ 3SGIA 1PH2A 2R92H 4UP9A 4Y7NH 5LMNL 4DR2L 4DPGA 3AQQA 3PUXA 5AJ3Q 1P16A 5FJ8G 1XPOA 3H0GG 4XIGS 4DNIA 2JA6G 3FHWA 2KENA 3OW2A 3ULPA 1YITA 1KIXA 3U4ZA 2B29A 2K14A 2VUMH 3J80c 2UXCL 2Z6KC 3FKIG 1BBWA 2F52A 4BY7H 1BBUA 2BA0A 2KHJA 1EIYB 2ZM6L 1L1OB 3PUYA 3I4NH 1XMQQ 4OO1G 1X65A 2N3SA 4BBRH 3A5UA 4L5SA 4JOIC 4AH6A 2E8GA 2AHOB 5IP7H 5IT9c 5LMNW 3E9HA 1N36L 4DR7L 3HOUH 4AYBE 3PUVA 1EQQA 4KLKA 4BXXG 3STBD 1WOCA 3K81C 3KOJA 4A3IG 1VQOA 1KQSA 4QY7A 1A63A 3T1YQ 1VQHA 3F1ZA 2N78A 4UP7A 1OXSC 5M3FG 5IYCH 3HOZH 1PV4A 1PFSA 2ASBA 3HOXH 1Q86C 2K52A 5K36G 1YJWA 2GN5A 2HHHL 2UUAQ 2AWNA 4WJ4A 3EIVA 3MXNB 1Q46A 2CFMA 4LFAQ 3TREA 3UDIA 1XPUA 3J81c 1NTGA 4QL5A 1ASYA 1VQ8A 1A0IA 1U0LA 4LF5Q 4JI1L 4TQUS 1PH3A 1EIFA 1OXUA 3OTOQ 3T1HQ 2VW9A 1X9NA 4L5RC 2C35B 4YWMA 1MIUA 1Q7YC 4A4IA 2HIXA 3H0GH 4JC0A 4GOPC 4X64Q 4HIOA 3A74A 4DV3L 5LMUL 4HJ9A 4NPSA 2Y0SE 3FKIH 4LUVA 2VQEQ 1VQNA 4A3GH 1HJPA 4OONA 1IYJB 3TS0A 2E5LQ 3GDEA 3F2CA 2R93G 2Q2HA 4APVA 1NMGA 5DLQE 4BXXH 2JQOA 2K50A 2WAQE 1YHQA 3F2BA 2ALYB 1XNRL 4JV5L 2JE6I 5HGQA 3G48A 2NZHA 3CCVA 4LNQA 2V1CC 1CKNB 3W5OA 4DKAC 5M3FH 4GKKQ 4KHPL 4IPGA 4DR1L 1YIJA 1SE8A 4P72A 1NE3A 4YWLA 1VQ5A 5HY6A 5C44H 4A3KH 2QEXA 1AH9A 4NB3A 4POGA 3CCRA 1J5EL 4A3LG 1I94Q 1Z47A 1HNWQ 4J15A 2VY3A 3G71A 2I0QA 2R6GA 4A93G 2PI2E 4GNXA 2UUBQ 3BU2A 1G6PA 3A5ZB 2RCNA 1HZAA 2IY5B 4B3ML 4A3CG 2KHIA 2E2JH 4GLXA 4X65L 5FLMG 1UE5A 2UXDQ 4OXPA 4X6AH 4OX9Q 4C3JH 4PMWA 3AFPA 3L0OA 3K80C 4TVAB 1EQRA 2NZOA 1PH9A 4DV6L 3J7A5 3PV0A 5BR8Q 2MNAA 1LM0A 4JBKA 3PF4A 4DR2Q 3PF5A 3M7NA 3RLNA 5ELNA 2OTJA 5C0XI 4DV5Q 4JI5L 1KL9A 2IHFA 4A3JG 1A8VA 1SRUA 2UXBQ 3CCEA 3GD7A 1VQBA 2JA8G 4R1JA 4DV0L 2R93H 1NJIC 4LFCQ 5M5YH 3U50C 2CCZA 1IZ6A 4KI0A 3GTGH 3S1MH 1E1TA 2Q2TA 2D0PA 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M H;  1KXL A;  2WFW A;  1I50 H;  1N33 L;  1N36 Q;  1CSP A;  4FDB A;  1EFW A;  4BY1 G;  3S2H H;  3U4V A;  3RLF A;  2NVQ H;  4GLA C;  4UP8 A;  2F4V L;  3M4P A;  2BH2 A;  1I5F A;  1L0W A;  4OWX B;  4B3R Q;  4JBW A;  5GAE C;  4B3S Q;  1XMO L;  2CKZ B;  4LF4 L;  2K5V A;  1CUK A;  4GN5 A;  1QZG A;  3A0J A;  3GTM H;  1WFQ A;  4A75 A;  4A93 H;  3PUW A;  2OQ0 A;  3KF6 B;  1S40 A;  3CC2 A;  1KRS A;  2VS1 A;  1P8L A;  2CQO A;  5FLM H;  3K7A H;  1BVS A;  3GTL H;  1L1O C;  2RF4 A;  1VQP A;  1U5K A;  1NMF A;  3PGZ A;  4A3B G;  1K3R A;  1O7I A;  4A3M G;  2CWA A;  1J6Q A;  1OXT A;  3PUZ A;  1VQL A;  4LF8 L;  3GTP H;  3S1Q H;  3DM3 A;  1VQF A;  1WJJ A;  3AFQ A;  4JI8 L;  2UU9 Q;  2NN6 I;  3BJU A;  3EN2 A;  4YCU A;  1FJG L;  1KAW A;  3NEL A;  4DV2 L;  2XTI A;  3M85 A;  2YYZ A;  3MEF A;  1YNX A;  5GAG C;  3L2P A;  3I2Z A;  3D0F A;  1VQI A;  3CF5 A;  5LMU Q;  4DV3 Q;  4P74 A;  3JAM c;  2R7Z H;  5E7N A;  4POF A;  1AE3 A;  2ZTD A;  1M1K C;  3IRB A;  1Y1W G;  3STB C;  3PO3 H;  4XTC S;  1VQK A;  1XNQ L;  1V43 A;  4LFB L;  1YJ9 A;  3RZD H;  4LUZ A;  5IE8 A;  4IFD I;  4JI7 L;  2YTV A;  4ME3 A;  1HNZ L;  1H95 A;  4R4O A;  3B6Y A;  1S3O A;  2ZTC A;  2NVX H;  5JEA G;  4JI3 Q;  1X55 A;  4LF6 L;  2K75 A;  4YWK A;  1HR0 Q;  1IXR A;  2JA5 H;  1JMC A;  5IWA L;  4IJH A;  2LXJ A;  3ULJ A;  4AYB G;  1V9P A;  5C3E G;  1I3Q H;  2WB1 E;  4QJF A;  1SFO H;  3S24 A;  3VDY A;  1WI5 A;  4YY3 L;  4JI0 L;  4A3B H;  3FP9 A;  3K0X A;  3CCQ A;  4A3M H;  1QVG A;  1K9M C;  4JYA L;  4DAY B;  2KBN A;  2LSS A;  1SRO A;  2DUD A;  4L5Q A;  4B3M Q;  2Q2I A;  4AIM A;  1UE6 A;  4L5T A;  5C4X G;  2MO1 A;  2QA4 A;  3ER0 A;  1LUZ A;  3J81 j;  1XJV A;  2OWO A;  1MKH A;  4IPH A;  4DR4 L;  1QVF A;  2R7F A;  4LUO A;  4PZ6 A;  3J81 i;  5FJ8 H;  1N34 L;  2A8V A;  1YBY A;  4C3H H;  4DV1 Q;  4IPD A;  1GO3 E;  2JA6 H;  1IBK Q;  2B3G A;  2MQH A;  3KJP A;  3CME A;  3KF8 B;  4IFD J;  1QVC A;  1TWC H;  1XPR A;  4DV4 Q;  4LF7 Q;  5C0X G;  3K8A A;  1X3G A;  2Z6K A;  1JE5 A;  4PG3 A;  4YHH L;  3KDF A;  4DV0 Q;  4PZ7 A;  4DK3 C;  3CCU A;  1B8A A;  2ID0 A;  3D31 A;  1UEB A;  4GN3 B;  4JI2 L;  2UUC L;  1FL0 A;  1C9O A;  2WP8 J;  4DUZ Q;  4X66 Q;  1E3P A;  4DR5 L;  2Y0S G;  4LF9 L;  1JJC B;  2R7D A;  1JT8 A;  4HIK A;  4A3I H;  1IBL Q;  3CAM A;  4DR3 Q;  3NEN A;  3H3V H;  5GAD C;  3CP0 A;  1YZ6 A;  4GLV B;  5FLX c;  1HZB A;  4HID A;  5AJ3 L;  1XMO Q;  2WAQ G;  4H02 A;  4PZ8 A;  4R4I A;  2JA9 A;  4P73 A;  1K83 H;  3F2D A;  4JI6 L;  2ATW A;  2PQA A;  1S72 A;  1EWI A;  2KCM A;  3RR5 A;  4NXN Q;  1L2F A;  4NXM L;  2L15 A;  4OO1 I;  4EX5 A;  3PSI A;  1W2B A;  1HNX Q;  2HQL A;  4DR6 Q;  4GNX B;  1PH7 A;  3S1N H;  5C4J H;  1QZH A;  3M3Y H;  4X62 Q;  4BA2 I;  3G4S A;  2N8N A;  2FXQ A;  4GOP A;  3CPF A;  5LMN Q;  4DV2 Q;  3LGJ A;  2RHQ B;  1KC8 C;  4KHZ A;  3RN2 A;  1CKO A;  1OTC A;  5M5W H;  4K0K L;  2AWO A;  3W1B A;  2ZJQ A;  2GVA A;  1NBW A;  1D7Q A;  2PMZ E;  1C7Y A;  3CW2 C;  2VQF L;  1PH8 A;  2UUA L;  2HIV A;  1FGU A;  1W3S A;  4LFA L;  2UXC Q;  1VQA A;  1DGS A;  4A76 A;  3HOY G;  4UY8 C;  2ZM6 Q;  1VQD A;  4LF5 L;  4QIW E;  4R4Q A;  4A3E G;  1KHI A;  1SR3 A;  3HKZ E;  3OTO L;  4IOC A;  1KD1 C;  3S14 H;  3UDF A;  3S17 H;  4DR7 Q;  1JJ2 A;  3DLL A;  1VQG A;  4LW1 A;  1D8L A;  1EYG A;  1SLJ A;  5JJK A;  4A3L H;  1GVP A;  3I7F A;  1E22 A;  1Q12 A;  4X64 L;  2R92 G;  1X6O A;  3RN5 A;  2H5X A;  2IHE A;  1Q1B A;  2PNH A;  5GRO A;  2VQE L;  2BA1 A;  3PO2 G;  4DV7 L;  3CQZ H;  3Q8D A;  2HHH Q;  4A3C H;  3W1G A;  4YCV A;  4DAM A;  1K0R A;  1QUQ A;  2YV5 A;  3KFU A;  1IBM L;  2VUM G;  3I4M G;  1K8A C;  4JI1 Q;  1WYD A;  4AQY L;  4BY7 G;  3GTQ H;  1PYB A;  5J3B A;  4DR4 Q;  3F8T A;  1UE1 A;  1Q82 C;  4A3J H;  4IO9 A;  4GN4 B;  1UE7 A;  1C0A A;  3AYH B;  4GKK L;  2JA8 H;  1OXV A;  1VQ7 A;  2JA7 G;  3AEV A;  1T9H A;  3CCM A;  2K5N A;  1PH1 A;  1PA6 A;  4YHH Q;  1HZC A;  4JI4 L;  1CKM A;  2I5L X;  3HOZ G;  1MJE A;  2D62 A;  5IYC G;  1PH6 A;  2UUB L;  1NY4 A;  1GKH A;  4YCW A;  2UUC Q;  2JK8 A;  4BY1 H;  2K5H A;  4O2D A;  5IYB G;  5IYD G;  1SMX A;  2UXD L;  1X3E A;  1YVC A;  4JBJ A;  1K73 C;  4OX9 L;  1XNR Q;  4JV5 Q;  3J80 i;  1RL2 A;  1A62 A;  1Q1E A;  3HKS A;  5BR8 L;  3I55 A;  3I4O A;  1YHB A;  3EBE A;  2IT1 A;  3HOW G;  1YHA A;  1E24 A;  4GKJ L;  4KHP Q;  3UE0 A;  4DR1 Q;  3PO2 H;  1SN8 A;  3J7Z C;  3UDG A;  4DV5 L;  1TWG H;  2B63 G;  4EQ5 A;  2UXB L;  1J5E Q;  4JI6 Q;  2A1A A;  3CC7 A;  2HT1 A;  1L1O A;  1N32 L;  4NXM Q;  3I4M H;  4LFC L;  4O0A A;  4R4T A;  3KJO A;  1VQ9 A;  2N49 A;  3ICE A;  2ZJP A;  4A3G G;  2EQS A;  1WCM G;  3RLO A;  4X65 Q;  2WB1 G;  4MNO A;  2E2I H;  3TRZ A;  5JJL A;  1LYL A;  4JBM A;  4C3I H;  1JJG A;  4DV6 Q;  3I4N G;  5GAH C;  2GVB A;  3RNU A;  2JA7 H;  3K7U C;  4B3R L;  3GTJ H;  4B3T L;  4B3S L;  2OQK A;  3GTK H;  4K0K Q;  1LTL A;  4JI5 Q;  1TWA H;  4BBS G;  3KYH C;  1Y1W H;  3ZJY C;  1E7Z A;  1VQE A;  4UPA A;  3CC4 A;  5C44 G;  5IYB H;  1UWV A;  2VQF Q;  4A3K G;  3ULL A;  5IYD H;  2YTY A;  3CD6 A;  3S15 H;  3WWV A;  1JB7 A;  3S2D H;  4JOI A;  3KDF B;  4A3D G;  4RMF A;  2AKW B;  1XTD A;  4GNX C;  2MFI A;  2JEB I;  3HOW H;  2DGY A;  1N33 Q;  3TEH B;  2VNU D;  4DUY L;  4C2M H;  2UU9 L;  2B63 H;  4MTN A;  1TWH H;  2F4V Q;  1YI2 A;  5C3E H;  3GO5 A;  3CCS A;  5JJI A;  4LF4 Q;  3PIP A;  2F3I A;  1GM5 A;  2RHS B;  1PVO A;  2K4K A;  3M4O H;  1HZ9 A;  4DV7 Q;  4Y52 H;  1BKB A;  1X56 A;  1WCM H;  3S16 H;  2ES2 A;  1X54 A;  4JG2 A;  5C4X H;  2PQA B;  1GD7 A;  3HOV G;  3UE1 A;  1Q8K A;  2Z0S A;  1VCI A;  1XMQ L;  3L7Z C;  1IBM Q;  1ASZ A;  2OTL A;  1CKN A;  3PCO B;  3TQY A;  2AMC B;  2NVT H;  1B7Y B;  4AQY Q;  1CSQ A;  1VQJ A;  3KLW A;  1PHJ A;  4LF8 Q;  2OCE A;  4JI8 Q;  4JCV E;  4MZ9 A;  4RG1 A;  4A3F G;  2Q2U A;  5M3M G;  1FJG Q;  3H3V I;  4BBS H;  1EOV A;  5GQO A;  2YTX A;  2ZTE A;  1HH2 P;  1G51 A;  2NN6 G;  4JI3 L;  2KCT A;  4LWC A;  2D0O A;  5IP9 G;  4GOP B;  3T1Y L;  1PH5 A;  3M4Q A;  1HR0 L;  2A19 A;  1I6H H;  1N9W A;  1VQC A;  1OXX K;  3RZO H;  3JC6 6;  4A3D H;  4JI4 Q;  3NBH B;  4HJ7 A;  4QQB X;  4BA1 I;  4QGU A;  1YJN A;  2PI2 A;  1KRT A;  5M5X H;  1XNQ Q;  2EXD A;  4LFB Q;  4HJA A;  1Y1V G;  3M9B A;  5H1S E;  3CMA A;  3GTO H;  3T1H L;  3BZK A;  4JI7 Q;  2E2H H;  2VZA A;  3BZC A;  1HNZ Q;  1PH4 A;  1HR0 W;  4IFD G;  4IOA A;  3ERS X;  1V1Q A;  2EIF A;  4P75 A;  1E1O A;  3HFZ B;  4DV1 L;  4DK6 C;  4GKJ Q;  1IBK L;  3CXC A;  3CPW A;  4LF6 Q;  3HKZ G;  4DV4 L;  1Q81 C;  2QGQ A;  5IWA Q;  1M90 C;  4LF7 L;  1VQ6 A;  1R9T H;  2JEA I;  3HOV H;  5JEA J;  4JI0 Q;  2NVY H;  2CWP A;  3E9I A;  4YY3 Q;  4OWW B;  2E5L L;  1RIP A;  1N32 Q;  4R4C A;  4P71 A;  3H15 A;  4IJL A;  2R7Z G;  1VQ4 A;  4JYA Q;  1IL2 A;  5EAY A;  2BH8 A;  3S1R H;  1AE2 A;  4DUZ L;  1VQM A;  4X66 L;  2ZJR A;  3OYY A;  1MJC A;  1G29 1;  1Z9F A;  3PO3 G;  1QUQ B;  1YEZ A;  2MO0 A;  1FVI A;  1IBL L;  4DR3 L;  2LXK A;  4ALP A;  1K8G A;  3NEM A;  2XGT A;  4BBR G;  2IX0 A;  5IP9 H;  1N8R C;  1N34 Q;  3E0E A;  2VL6 A;  1X3F A;  4IPC A;  5IP7 G;  4B3T Q;  3KF6 A;  3HOU G;  1Y14 B;  1VS0 A;  3U58 A;  2I5M X;  3I56 A;  2YU9 H;  1I94 L;  4NXN L;  4OWT B;  3UDX A;  3HOY H;  5ELO A;  1HNW L;  2JA5 G;  3CCJ A;  1Y1V H;  1B70 B;  1EUJ A;  1TWF H;  4HJ8 A;  2IX1 A;  4A3E H;  3TS2 A;  1PYS B;  4JI2 Q;  5C0X J;  3JAM i;  3HOX G;  3G6E A;  1HNX L;  5IY0 A;  4WJ3 M;  4DR6 L;  4HIM A;  4DR5 Q;  3CCL A;  2JJQ A;  4LF9 Q;  1TXY A;  2I5H A;  4GS3 A;  4HJ5 A;  4X62 L;  3PIO A;  4DUY Q;  3SGI A;  1PH2 A;  2R92 H;  4UP9 A;  4Y7N H;  5LMN L;  4DR2 L;  4DPG A;  3AQQ A;  3PUX A;  5AJ3 Q;  1P16 A;  5FJ8 G;  1XPO A;  3H0G G;  4XIG S;  4DNI A;  2JA6 G;  3FHW A;  2KEN A;  3OW2 A;  3ULP A;  1YIT A;  1KIX A;  3U4Z A;  2B29 A;  2K14 A;  2VUM H;  3J80 c;  2UXC L;  2Z6K C;  3FKI G;  1BBW A;  2F52 A;  4BY7 H;  1BBU A;  2BA0 A;  2KHJ A;  1EIY B;  2ZM6 L;  1L1O B;  3PUY A;  3I4N H;  1XMQ Q;  4OO1 G;  1X65 A;  2N3S A;  4BBR H;  3A5U A;  4L5S A;  4JOI C;  4AH6 A;  2E8G A;  2AHO B;  5IP7 H;  5IT9 c;  5LMN W;  3E9H A;  1N36 L;  4DR7 L;  3HOU H;  4AYB E;  3PUV A;  1EQQ A;  4KLK A;  4BXX G;  3STB D;  1WOC A;  3K81 C;  3KOJ A;  4A3I G;  1VQO A;  1KQS A;  4QY7 A;  1A63 A;  3T1Y Q;  1VQH A;  3F1Z A;  2N78 A;  4UP7 A;  1OXS C;  5M3F G;  5IYC H;  3HOZ H;  1PV4 A;  1PFS A;  2ASB A;  3HOX H;  1Q86 C;  2K52 A;  5K36 G;  1YJW A;  2GN5 A;  2HHH L;  2UUA Q;  2AWN A;  4WJ4 A;  3EIV A;  3MXN B;  1Q46 A;  2CFM A;  4LFA Q;  3TRE A;  3UDI A;  1XPU A;  3J81 c;  1NTG A;  4QL5 A;  1ASY A;  1VQ8 A;  1A0I A;  1U0L A;  4LF5 Q;  4JI1 L;  4TQU S;  1PH3 A;  1EIF A;  1OXU A;  3OTO Q;  3T1H Q;  2VW9 A;  1X9N A;  4L5R C;  2C35 B;  4YWM A;  1MIU A;  1Q7Y C;  4A4I A;  2HIX A;  3H0G H;  4JC0 A;  4GOP C;  4X64 Q;  4HIO A;  3A74 A;  4DV3 L;  5LMU L;  4HJ9 A;  4NPS A;  2Y0S E;  3FKI H;  4LUV A;  2VQE Q;  1VQN A;  4A3G H;  1HJP A;  4OON A;  1IYJ B;  3TS0 A;  2E5L Q;  3GDE A;  3F2C A;  2R93 G;  2Q2H A;  4APV A;  1NMG A;  5DLQ E;  4BXX H;  2JQO A;  2K50 A;  2WAQ E;  1YHQ A;  3F2B A;  2ALY B;  1XNR L;  4JV5 L;  2JE6 I;  5HGQ A;  3G48 A;  2NZH A;  3CCV A;  4LNQ A;  2V1C C;  1CKN B;  3W5O A;  4DKA C;  5M3F H;  4GKK Q;  4KHP L;  4IPG A;  4DR1 L;  1YIJ A;  1SE8 A;  4P72 A;  1NE3 A;  4YWL A;  1VQ5 A;  5HY6 A;  5C44 H;  4A3K H;  2QEX A;  1AH9 A;  4NB3 A;  4POG A;  3CCR A;  1J5E L;  4A3L G;  1I94 Q;  1Z47 A;  1HNW Q;  4J15 A;  2VY3 A;  3G71 A;  2I0Q A;  2R6G A;  4A93 G;  2PI2 E;  4GNX A;  2UUB Q;  3BU2 A;  1G6P A;  3A5Z B;  2RCN A;  1HZA A;  2IY5 B;  4B3M L;  4A3C G;  2KHI A;  2E2J H;  4GLX A;  4X65 L;  5FLM G;  1UE5 A;  2UXD Q;  4OXP A;  4X6A H;  4OX9 Q;  4C3J H;  4PMW A;  3AFP A;  3L0O A;  3K80 C;  4TVA B;  1EQR A;  2NZO A;  1PH9 A;  4DV6 L;  3J7A 5;  3PV0 A;  5BR8 Q;  2MNA A;  1LM0 A;  4JBK A;  3PF4 A;  4DR2 Q;  3PF5 A;  3M7N A;  3RLN A;  5ELN A;  2OTJ A;  5C0X I;  4DV5 Q;  4JI5 L;  1KL9 A;  2IHF A;  4A3J G;  1A8V A;  1SRU A;  2UXB Q;  3CCE A;  3GD7 A;  1VQB A;  2JA8 G;  4R1J A;  4DV0 L;  2R93 H;  1NJI C;  4LFC Q;  5M5Y H;  3U50 C;  2CCZ A;  1IZ6 A;  4KI0 A;  3GTG H;  3S1M H;  1E1T A;  2Q2T A;  2D0P A;  4A3F H; 
#chains in the Genus database with same CATH topology
 5M3M H;  1I50 H;  1RTO A;  1CSP A;  3P7J A;  3U4V A;  3RLF A;  4GLA C;  2F4V L;  1CZG A;  5DAU A;  4B3R Q;  3J81 E;  4RKB A;  2K5V A;  2JXM B;  1QZG A;  3A0J A;  4F7X A;  5I9P A;  5KEE A;  5G3L D;  1P8L A;  2CQO A;  4C1N K;  4ILW A;  1L1O C;  1VQP A;  5D3I B;  4RAU C;  1DOL A;  3GV6 A;  5KGU A;  1VQL A;  2EE1 A;  2QCP X;  1VQF A;  2L9H A;  3H94 A;  3MTS A;  1FJG L;  3HOU B;  1HPC A;  2YYZ A;  3KUP A;  4QB4 A;  1SDF A;  3D0F A;  2B2W C;  2EYJ A;  5A2Q L;  2R7Z H;  4POF A;  4MIU A;  1DM0 B;  3IRB A;  3K5M A;  4LJZ C;  1LT3 D;  1VQK A;  4ZYS A;  3D8G A;  4C56 C;  4FF2 A;  1B3Q A;  4QF4 A;  4JI3 Q;  2K75 A;  1HR0 Q;  4K2K A;  2QDB A;  4KD4 A;  5IWA L;  4IJH A;  3ULJ A;  2X69 A;  1SFO H;  4JI0 L;  3S24 A;  4A3B H;  3FP9 A;  1K8O A;  3K0X A;  3DEP A;  1SRO A;  2DUD A;  4L5Q A;  5ISR A;  3LWU A;  4WOR A;  1S4Z A;  1XJV A;  3J81 j;  1QVF A;  2BDO A;  4C3H H;  3VYT A;  4IPD A;  1F2Y A;  4WJW A;  1PZI D;  1YNN D;  3T4A C;  3KJP A;  1JR0 D;  1RD9 D;  1XPR A;  4A3K B;  3VA5 A;  4LF7 Q;  5C0X G;  1K83 B;  2Z6K A;  4XT1 B;  4YHH L;  1AFP A;  2QDL A;  5BN5 A;  2SOB A;  4DK3 C;  1B8A A;  1WTV A;  4X3K A;  4F87 A;  2VXW A;  1NUC A;  4NKL A;  4DAV A;  3NEN A;  3ND9 A;  1TT2 A;  1YZ6 A;  3VR5 A;  2IW3 A;  4GLV B;  4MHE A;  1FGB D;  3NQI A;  4H02 A;  4CKE A;  2NYZ D;  3F2D A;  3NP8 A;  3HRZ C;  2PQA A;  2KCM A;  5IGG A;  4EX5 A;  3PSI A;  1W2B A;  5M5Y B;  1T5X D;  4HCS A;  1E2V A;  2WII B;  1QZH A;  3KK7 A;  5M3M B;  3M3Y H;  3S1N H;  3S14 B;  2N8N A;  4DV2 Q;  2RHQ B;  4KY7 A;  1TKW B;  3NBH A;  2GVA A;  2F0K A;  2PMZ E;  4H44 C;  1PH8 A;  3E0J A;  2Q8T A;  4LFA L;  1DGS A;  3HOY G;  2DN8 A;  1VQD A;  1XYI A;  4LF5 L;  2KCN A;  2Z9H A;  3BYY B;  1KHI A;  4IOC A;  1EYC A;  1WTR A;  4LW1 A;  3GQB A;  1SLJ A;  2E75 C;  3J80 L;  1GVP A;  1E22 A;  1Q12 A;  3HG9 A;  3MHB A;  5JOB A;  2RDF A;  3RN5 A;  3EJI A;  4OEM B;  1Q1B A;  2PNH A;  1T5E A;  4IAL A;  4B9W A;  3T13 A;  1IBM L;  1JCK B;  1KDB A;  4X3U A;  4DR4 Q;  1SBB B;  1Q82 C;  2HCC A;  4A3J H;  3N6R A;  4X3S A;  3I70 A;  1YNJ C;  1A2U A;  5EKK A;  3QG1 A;  1PH1 A;  4JI4 L;  1SFO B;  4KHV A;  2HUG A;  3VR2 A;  1MJE A;  4A3B B;  2UUB L;  2SDF A;  2UUC Q;  2HDL A;  4BY1 H;  2NWG A;  1QCB D;  1PTO C;  3URY A;  1SMX A;  2UXD L;  4OX9 L;  4JV5 Q;  1TY0 A;  2MUY A;  2EVB A;  2IT1 A;  4C3H B;  3UDG A;  1TWG H;  2B63 G;  2F03 A;  2A1A A;  3CC7 A;  3DUZ A;  1LLR D;  1O7Z A;  2R61 A;  4O0A A;  4A3G G;  3ICE A;  2ZJP A;  2EQS A;  1W6J A;  3RLO A;  4X65 Q;  2K28 A;  3TRZ A;  4JBM A;  1STE A;  1XWE A;  4B3R L;  4B3T L;  3GTK H;  5BN4 A;  4K0K Q;  2XWB B;  4IUQ A;  4BWG B;  1Y1W H;  3CC4 A;  1VQE A;  4NW2 A;  4A3K G;  3FPP A;  5IYB H;  3ULL A;  4FF3 A;  2ICE C;  4JOI A;  3KDF B;  1AEX A;  4RMF A;  3V96 A;  1EQT A;  3ONA B;  2MFI A;  3DXJ C;  1N33 Q;  1TS3 A;  5JEA H;  3S1N B;  4HMJ A;  3M3Y B;  3C1F A;  4C3J G;  1PFN A;  5C3E H;  3GO5 A;  2PZW A;  2OF1 A;  3HGB A;  2F3I A;  1PVO A;  5EKL A;  1HZ9 A;  2XWJ B;  1BKB A;  1HTL D;  1LTS D;  1X56 A;  5I6W A;  1VMC A;  3S16 H;  4EQO A;  2Y0S B;  1XMQ L;  3L7Z C;  5M5X B;  5IGD A;  2OTL A;  3TQY A;  2NVT H;  2K05 A;  2LMC B;  4LF8 Q;  1CSQ A;  1VQJ A;  2OCE A;  5JVH 3;  1PRT D;  2F0O A;  4K8I A;  5M3M G;  1EOV A;  3SK8 A;  3Q0A A;  2YTX A;  2ZTE A;  4JI3 L;  1G51 A;  1PH5 A;  3EQL C;  4LWC A;  5IP9 G;  1HR0 L;  4E6I A;  1N9W A;  2WKD A;  1F2L A;  5AFW A;  4Z9C B;  3RZO H;  3JC6 6;  4A3D H;  3IAY A;  2KEC A;  2PW7 A;  5FOB B;  1YJN A;  2EY6 A;  1SYF A;  3D4D A;  2EXD A;  4HJA A;  2RDG A;  3M9B A;  4TSS A;  3GTO H;  3D4R A;  4JI7 Q;  1B9M A;  4CDC C;  5KND A;  1ZYR C;  2FJ2 A;  3BZC A;  4IOA A;  1IW7 D;  4IFD G;  1O80 A;  3ERS X;  1E1O A;  3HFZ B;  4A3J B;  4DK6 C;  4GKJ Q;  4H0L C;  1EY5 A;  1JQY D;  4LF6 Q;  4LF7 L;  2QGQ A;  3OOC A;  1M90 C;  1KLU D;  3HOV H;  2NVY H;  2CWP A;  1ONL A;  3E9I A;  1IKL A;  4IZ8 A;  2K5W A;  2R7Z G;  1G2S A;  4G7Z C;  1IL2 A;  2GA4 B;  1CK1 A;  3OYY A;  1G29 1;  4I7A A;  1Z9F A;  3WOF A;  1GUN A;  1FVI A;  1DD2 A;  2NN6 H;  2LXK A;  4K6L A;  1SYE A;  1K8G A;  3I4N G;  1N8R C;  4ZUJ A;  2K32 A;  3DWA A;  5I2X A;  4IPC A;  3KF6 A;  4ZK9 B;  2HCI A;  1TWG B;  3CRK C;  3T53 B;  5EPJ A;  1U4P A;  4N8X 1;  5ELO A;  1Y1V H;  4HJ8 A;  4A3E H;  2HQE A;  4IUP A;  5FLX E;  5C0X J;  4KN4 C;  2WIN B;  1EEF D;  3K59 A;  1WTQ A;  2A6E C;  2JJQ A;  4LF9 Q;  3MAQ A;  4G4K A;  1JOR A;  4CGY B;  1KNA A;  5C5L A;  2P5Z X;  1TY2 A;  4I65 A;  4DPG A;  1FYC A;  1D6E C;  5AJ3 Q;  2QIL A;  1P16 A;  3A56 A;  5IGC A;  3H0G G;  4DNI A;  1EYD A;  4ZKC B;  3MZ5 A;  1Y1W B;  3ULP A;  1JB3 A;  3DHQ A;  5JPN C;  2G9D A;  3QO2 A;  2Z6K C;  1Y8N B;  2EOT A;  3FKI G;  2F52 A;  4XYO A;  2BA0 A;  4BY7 H;  1SMY C;  1ICF B;  1BCP C;  1X65 A;  2N3S A;  4BBR H;  3C2P A;  1PZK D;  1PMR A;  4FO2 A;  5LMN W;  4AH6 A;  5IT9 c;  5IP7 H;  4AYB E;  3PUV A;  4BXX G;  3K81 C;  1KQS A;  2K03 A;  4QY7 A;  2F1M A;  1ET9 A;  5C3E B;  3HOZ H;  1AZP A;  3CRL C;  2IWH A;  2KUM A;  2UUA Q;  2O4X A;  3MXN B;  1I4P A;  1XPU A;  3A8J E;  3S16 B;  1IYV A;  1NTG A;  2WB1 B;  3TBI B;  1VQ8 A;  1OXU A;  3OTO Q;  3QWN A;  2NVT B;  4HCE A;  1X9N A;  1S5E D;  4YWM A;  1ESR A;  5CV7 A;  4JC0 A;  4X64 Q;  5ELC A;  2Y0S E;  4LUV A;  2VQE Q;  4OON A;  2PYK A;  4A3D B;  1QIL A;  5ELE A;  4JVZ A;  1I4R A;  4ZUI A;  1NMG A;  2JQO A;  3F2B A;  2ALY B;  4JV5 L;  2JE6 I;  3OW7 A;  3G48 A;  3GTO B;  1F9Q A;  1CKN B;  4P2C B;  2WAQ B;  3RUZ A;  2J4X A;  4GKK Q;  4IPG A;  1BUV T;  1SE8 A;  4YWL A;  1WTH A;  5C44 H;  3VYU A;  1Y8P B;  2Z6B A;  3CCR A;  4XDX A;  5D3D A;  1HNW Q;  1C48 A;  2F0I A;  3HOV B;  2NVY B;  4GNX A;  3PIO 3;  5J39 A;  2IY5 B;  4ODG A;  4X65 L;  3BZD B;  4OXP A;  3AFP A;  5C4H A;  4TVA B;  2NZO A;  3H91 A;  1MHW C;  1DJR D;  3S2H B;  3PV0 A;  2MNA A;  4JBK A;  1LM0 A;  4IUN A;  2XRQ D;  3A54 A;  1EIH A;  4A3J G;  4J8Q A;  4KKU A;  2JSO A;  2ZXO A;  3GD7 A;  3GTM B;  1LAC A;  4R1J A;  2R93 H;  1NJI C;  4LFC Q;  1Y1V B;  1IZ6 A;  4KI0 A;  1E2W A;  3V2T A;  2A69 D;  4A3F H;  1N33 L;  1N36 Q;  3GTP B;  4BY1 G;  3M4P A;  4B08 A;  1L0W A;  3HKZ B;  1HRJ A;  5EPL A;  4A93 H;  5C3X A;  2M9V A;  3NWT A;  3GTL H;  5COY A;  4A3M G;  2CWA A;  4DK0 A;  1J6Q A;  1HXY D;  3C46 A;  4BBR B;  4LF8 L;  1CQV A;  3S1Q H;  3AFQ A;  2NN6 I;  1Q3L A;  4YCU A;  1KAW A;  3M85 A;  2XVS A;  1YNX A;  3L2P A;  2ENB A;  1B44 D;  3I2Z A;  1VQI A;  5LMU Q;  2PW5 A;  2AQ2 B;  2JA5 B;  2QW7 A;  5E7N A;  1M1K C;  1I3Q B;  4LMQ D;  3NPP A;  1Y1W G;  2Z4H A;  1ILQ A;  3RZD H;  3NUC A;  3DWQ A;  4JI7 L;  3BDC A;  1SYG A;  4ME3 A;  1STB A;  2FFK B;  4HSP A;  2NVX H;  1SNC A;  5JEA G;  4LF6 L;  5ELF A;  1IXR A;  2SEB D;  1JMC A;  1JWU D;  1F9R A;  5C3E G;  1I4H A;  2WB1 E;  2F0L A;  3NK9 A;  3CCQ A;  1QVG A;  2KBN A;  2LSS A;  4KK7 A;  1YNN C;  2Q2I A;  1B50 A;  1LAB A;  3BVG A;  4L5T A;  2MO1 A;  1LUZ A;  4DXG A;  2OWO A;  1MKH A;  3J81 i;  2K01 A;  1YBY A;  1C4Q A;  4KD3 A;  2B3G A;  3KF8 B;  4IFD J;  3IKJ A;  4PG3 A;  4ZLT F;  4OIK A;  4DV0 Q;  2JYO A;  4PZ7 A;  1U4L A;  1TS4 A;  1UEB A;  2ZXP A;  1FL0 A;  2QF7 A;  4DUZ Q;  1EY7 A;  4N8F A;  4LF9 L;  5LHY 1;  2EYM A;  1WTO A;  4N9T A;  4XQJ A;  4HID A;  5AJ3 L;  4XXE A;  1XMO Q;  2WAQ G;  5K36 H;  2RDH A;  1K83 H;  5HGT A;  2OXP A;  4UAI A;  1S72 A;  3OWE B;  2K04 A;  1EWI A;  2L5T A;  1PFM A;  3VR4 A;  2CH4 W;  2R93 B;  4OO1 I;  4TRD A;  2M2L A;  1HNX Q;  2KEE A;  2HQL A;  1STG A;  4I7Z C;  1SXT A;  3LWE A;  4BA2 I;  4X62 Q;  3HZX A;  2FXQ A;  5KIX A;  4U68 A;  4M1U B;  1STA A;  3CPF A;  3LGJ A;  2DY8 A;  3T56 B;  1CKO A;  1OTC A;  3P75 A;  5G3L F;  4CHT B;  5M5W H;  3W1B A;  1ZKO A;  1NBW A;  3NTH A;  4A93 B;  2VQF L;  2UUA L;  3KLR A;  1VQA A;  3QOJ A;  3GTL B;  3S14 H;  4A3E G;  1SR3 A;  3OTO L;  3HKZ E;  1KD1 C;  3KBG A;  1JJ2 A;  2CW0 D;  3S1Q B;  1VQG A;  1EYG A;  1HUM A;  4A3L H;  3I7F A;  4X64 L;  5D14 A;  3PMF A;  2D5D A;  1JWM D;  2RKS A;  4CJ0 B;  1OO9 B;  2IHE A;  1BDO A;  2VQE L;  1A3T A;  1LT4 D;  5IT9 L;  4DV7 L;  3OWF A;  5C5M A;  2HHH Q;  4A3C H;  1D2B A;  3W1G A;  1RHP A;  1QUQ A;  2YV5 A;  1K8A C;  2EYF A;  4JI1 Q;  4DXF A;  1WYD A;  3RZD B;  4AQY L;  4BY7 G;  2F0M A;  4GN4 B;  4GKK L;  2L0C A;  2NVX B;  3QIA A;  2F0V A;  1CM9 A;  1OXV A;  1T9H A;  3LX0 A;  1R4P B;  2K5N A;  3CCM A;  1PA6 A;  4JPB W;  2EYH A;  2EY5 A;  3HOZ G;  1STN A;  1PH6 A;  3I3C A;  4ZAI A;  2K5H A;  1K73 C;  4JBJ A;  1XNR Q;  2E2I B;  1Q1E A;  1U4M A;  3HKS A;  5HUR A;  1CZW A;  1E24 A;  3PO2 H;  1SN8 A;  3J7Z C;  5DM7 3;  1R4Q B;  1ILP A;  1FR3 A;  1EEI D;  4JI6 Q;  3FEW X;  2HT1 A;  1N32 L;  4NXM Q;  2B2U A;  2HD3 A;  3K0Y A;  4LFC L;  3I4M H;  2PQE A;  2N49 A;  1V1P B;  3T16 A;  1WCM G;  5JJL A;  2RCF A;  4DV6 Q;  5GAH C;  2JA7 H;  1SJE D;  3K7U C;  3GTJ H;  1LTL A;  4JI5 Q;  3ZJY C;  4UPA A;  1H9S B;  2L12 A;  5C44 G;  5IYD H;  3FRP B;  4FNF A;  2B8G A;  4GNX C;  1QWY A;  2LY7 A;  2RA4 A;  2JEB I;  3HOW H;  2VNU D;  3QJY A;  4WRD A;  3SXH A;  1S5B D;  1TWH H;  1YI2 A;  3CCS A;  1HFG A;  5M5W B;  4RKL A;  1VDZ A;  3NBI A;  2ES2 A;  1CA6 A;  4JG2 A;  5E1F A;  3QOL A;  4HMI A;  2JP1 A;  3DMU A;  1B7Y B;  3KBX A;  3JAM E;  3QB3 A;  4MZ9 A;  4RG1 A;  4A3F G;  4BBS H;  1G6Z A;  3T1Y L;  4GOP B;  1I6H H;  3M4Q A;  4IUV A;  1OXX K;  3E5S A;  2CHB D;  2EYL A;  2OEO A;  4QQB X;  1HQR D;  5LL6 X;  2PI2 A;  5IGF A;  5M5X H;  4BS9 A;  4LFB Q;  3TP8 A;  1SNP A;  4HR7 B;  2E2H H;  1HNZ Q;  3AMU A;  4RWS C;  1V1Q A;  4RA8 A;  2EIF A;  2QEJ C;  2KVM A;  2BE5 C;  3CXC A;  3CPW A;  4JW0 A;  1Q81 C;  5JEA J;  1KNE A;  4YY3 Q;  4OWW B;  2E5L L;  1RIP A;  4P71 A;  2EYP A;  4DN4 M;  3H15 A;  1VQ4 A;  1HCZ A;  4DUZ L;  5CBA E;  4HED A;  4IN3 A;  1KDC A;  2MO0 A;  2IPK D;  2Z4I A;  2C9O A;  2IX0 A;  4DFA A;  3E0E A;  2F0G A;  3MVV A;  3HOU G;  1B3A A;  3TP5 A;  2FHT A;  3MWY W;  1Y14 B;  4HAE A;  3PO2 B;  2I5M X;  3I56 A;  1I94 L;  3UDX A;  1D1K A;  1TWF H;  1MSH A;  4G7O C;  3I4M B;  3TS2 A;  1HNX L;  3SK6 A;  3UI2 A;  4HIM A;  4DR5 Q;  2I5H A;  4HJ5 A;  4X62 L;  1IHZ A;  4DUY Q;  2R92 H;  4QUC A;  4UP9 A;  4Y7N H;  2TMP A;  4DR2 L;  2B2Y C;  1B53 A;  3VA7 A;  2JA7 B;  3GTJ B;  1XPO A;  2A68 C;  4CJ1 B;  3FHW A;  1DCZ A;  3VYR A;  3FPU B;  2KEN A;  3DWP A;  1YIT A;  2B29 A;  2K14 A;  2VUM H;  3CU7 A;  1BBU A;  2KHJ A;  3F2U A;  1L1O B;  3PUY A;  2FIN B;  1GHJ A;  3HP3 A;  4X3T A;  4PMC A;  3E9H A;  3HOW B;  1ESF A;  2SNS A;  5KYI A;  1TWH B;  3KOJ A;  2G9H D;  4AYB B;  4UP7 A;  2EY2 A;  1PFS A;  4R8N A;  1SYB A;  3HOX H;  1Q86 C;  2WV6 D;  5K36 G;  2HHH L;  4WJ4 A;  3EIV A;  1Q46 A;  3Q23 A;  3V05 A;  1A3U A;  2PZU A;  1PRT F;  2B2T A;  4K8J A;  3NTI A;  1A0I A;  1U0L A;  4RCO A;  4JI1 L;  3T1H Q;  1VF7 A;  4DGZ A;  4Q0F A;  4A4I A;  4CKC A;  1PFB A;  1BXT A;  3C1E A;  1LT6 D;  4BBS B;  3A74 A;  4R8I A;  3BVZ A;  1TS5 A;  4NPS A;  1I6H B;  2FMC A;  4RGT A;  1X3Q A;  4L63 B;  2Q2H A;  1I4Q A;  4EQN A;  5K5P A;  1H9R A;  4R9W A;  1XNR L;  4FF1 A;  3DEO A;  3CCV A;  2E2H B;  4DKA C;  3W5O A;  5M3F H;  4PV1 C;  2LFN A;  3K6O A;  4P72 A;  1VQ5 A;  3FVQ A;  3X3N A;  1HQM C;  1SE2 A;  4POG A;  4A3L G;  3SK5 A;  4HTH A;  1M8A A;  2F0F A;  1PRT B;  1H9J A;  1ROD A;  3BU2 A;  2KOL A;  1G6P A;  3A5Z B;  2RCN A;  5FO8 B;  2EYO A;  4A3C G;  1UE5 A;  3L0O A;  3J7A 5;  1EQR A;  4DV6 L;  2B2V C;  5BR8 Q;  1HA6 A;  2NVQ B;  1WVL A;  3M7N A;  1SND A;  5ELN A;  1EZ6 A;  2OTJ A;  1CA5 A;  4JI5 L;  2IHF A;  1SRU A;  2UXB Q;  1B4O A;  3MXG A;  1AZQ A;  3EA6 A;  4OGQ C;  1ET6 A;  1SYD A;  1TWF B;  2MGS A;  2CCZ A;  2H1E A;  5E4W C;  1E1T A;  3MA2 B;  2D0P A;  3I73 A;  3OMC A;  2RSN A;  2EPB A;  2A6H C;  2AQ1 B;  1K8M A;  4FDB A;  5JAV A;  3S2H H;  2R92 B;  1SNQ A;  1I5F A;  4OWX B;  4OL7 A;  4Y7N B;  5GAE C;  1IKM A;  2NTS A;  1CUK A;  3GTM H;  5A2Q E;  5COR A;  1A3V A;  4FXG C;  2F0H A;  5FLM H;  1HHV A;  2VUM B;  3K7A H;  1WTW A;  3W2D A;  2RF4 A;  2MHV A;  2B2U C;  4A3B G;  1K3R A;  1O7I A;  4JK1 C;  4LK1 C;  1H9K A;  1MGS A;  3GTP H;  3PUZ A;  5IIF A;  1V8Q A;  4V0B A;  3DM3 A;  4ME5 A;  2UU9 Q;  3EN2 A;  4DV2 L;  3NEL A;  2XTI A;  4H13 C;  2CVR A;  3MEF A;  5J1Z A;  3CF5 A;  4DV3 Q;  4C3H G;  3BG3 A;  3ITP A;  1SSO A;  1I4X A;  3HOX B;  1AN8 A;  1GXD C;  4NP5 A;  3A7L A;  3STB C;  3PO3 H;  1V43 A;  4C1N I;  4LFB L;  1YNJ D;  2VB2 X;  4WFN 3;  2I07 B;  5KNC A;  2YTV A;  1HNZ L;  4CDF C;  2KA7 A;  1S3O A;  4ZCK A;  1DOK A;  2EY1 A;  4YWK A;  5JVG 3;  2JA5 H;  4KMU C;  2LXJ A;  4AYB G;  3CKI B;  4RHR A;  1I3Q H;  4NDX A;  4YY3 L;  3Q22 A;  3L3O C;  1K9M C;  1QJO A;  4DAY B;  1RCV D;  1SEB D;  4ULL A;  4CBV A;  4B3M Q;  4AIM A;  2QA4 A;  3IL8 A;  5IGE A;  3J7Y W;  1U9R A;  5IOD A;  4DR4 L;  4MTK A;  5M3F B;  2MQH A;  3CME A;  3BS1 A;  4M8A A;  3AU7 A;  4DV4 Q;  1RTN A;  3K8A A;  1JE5 A;  3KDF A;  4OO1 H;  3CCU A;  2ID0 A;  2UUC L;  3K5O A;  1C9O A;  2WP8 J;  5I6Y A;  4DR5 L;  1LTB D;  2Y0S G;  4FP5 D;  1CHQ D;  3NWS A;  3EVQ A;  4A3I H;  1IBL Q;  4KY6 A;  3H3V H;  5GAD C;  3J7A V;  1LTR D;  5FLX c;  1X32 A;  1U4R A;  1HZB A;  5L37 A;  1GUW A;  4PZ8 A;  2JA9 A;  4ZQ3 A;  1KTK A;  2ATW A;  1BOS A;  3E3X A;  4NXN Q;  3RR5 A;  3O13 A;  1SAP A;  2BDN A;  2HDM A;  1EFI D;  4DR6 Q;  1II3 A;  3S17 B;  4RHS A;  5LMN Q;  1BBX C;  3J80 E;  3RN2 A;  4K0K L;  4DK1 A;  2ZJQ A;  2K5Q A;  4S3S A;  2A5H A;  1C7Y A;  3CW2 C;  1LT5 D;  3CQZ B;  4L6T B;  1FGU A;  1W3S A;  2O5I C;  2UXC Q;  4A76 A;  3K7A B;  2ZM6 Q;  2F0E A;  2NZ1 D;  4QIW E;  2NUC A;  4R4Q A;  3UDF A;  4DF7 A;  1FNV A;  3GTQ B;  3J7A F;  2LKV A;  2F0W A;  2R92 G;  1X6O A;  2K5D A;  2H5X A;  1ICW A;  5GRO A;  2BA1 A;  1ZYR D;  3Q8D A;  1EWC A;  3KFU A;  3PO3 B;  2VUM G;  1NR2 A;  3R2I A;  1CHP D;  2IL8 A;  1ZEQ X;  3F8T A;  1TII D;  3L9A X;  1C0A A;  3OIQ A;  1VQ7 A;  1A2T A;  1IYU A;  2EJG C;  1JWS D;  2L55 A;  4YHH Q;  1CKM A;  2IX3 A;  3RD4 A;  2D62 A;  3TP6 A;  1C8C A;  1GKH A;  2JK8 A;  5EPK A;  5IYB G;  2SNM A;  1EY6 A;  1X3E A;  1EU4 A;  4MN3 A;  2B2T C;  1RL2 A;  5BR8 L;  3I4O A;  4XYQ A;  3EBE A;  1YHA A;  4XQN A;  4GKJ L;  4KHP Q;  3UE0 A;  1G2T A;  4ZRZ A;  2A6E D;  2UXB L;  3GP7 A;  1I6V C;  4K5V A;  1B9N A;  3KJO A;  1VQ9 A;  3S15 B;  2WB1 G;  4MNO A;  2E2I H;  1JJG A;  4C3I H;  2B2Y A;  2PCF B;  1W6K A;  4A3I B;  1GUO A;  3ZYY X;  2F4I A;  4C2M B;  3MXU A;  1SMY D;  1DYQ A;  1BCP D;  2OQK A;  1WTX A;  1TWA H;  4J1M A;  3MXN A;  1E7Z A;  1EY0 A;  3MFY A;  3H09 A;  3M4O B;  1UWV A;  3BVM A;  4KJO A;  3CD6 A;  3S2D H;  4A3D G;  1XTD A;  1BCP B;  2CH4 A;  2Z1C A;  3DM1 A;  4IUT A;  4K5X A;  3AB9 A;  1D5X C;  3TEH B;  2A74 C;  2UU9 L;  2B63 H;  3OHX C;  3D6W A;  2RBM A;  2PO4 A;  1RKN A;  1VMP A;  4LF4 Q;  5T1I A;  2M00 A;  2K4K A;  3R2T A;  4IUR A;  5I9O A;  3MXP A;  5C4X H;  2PQA B;  1GD7 A;  3HOV G;  1Q8K A;  1IBM Q;  4TKO B;  1ASZ A;  1DOM A;  1CKN A;  3PCO B;  3VR6 A;  2AMC B;  1PHJ A;  3KLW A;  1Q8I A;  2K1B A;  4JI8 Q;  2ICI A;  2Q2U A;  3H3V I;  1HH2 P;  2NN6 G;  2D0O A;  1SNO A;  2A19 A;  2DNE A;  3NE5 B;  1VQC A;  1L0Y B;  1S5D D;  4JI4 Q;  3NBH B;  4HJ7 A;  3WOE A;  2FMM A;  5CMD A;  1LTI D;  3U9O A;  3G7L A;  1EIG A;  5D65 A;  1XNQ Q;  1Y1V G;  5H1S E;  1HA5 A;  2JN4 A;  2VZA A;  1HR0 W;  1J8I A;  4O42 A;  5ELD A;  1NR4 A;  2RSO A;  3HKZ G;  3Q6S A;  4DV4 L;  1Z7T A;  1R9T H;  2JEA I;  2EXZ A;  4KJN A;  3HOY B;  2F0Q A;  4JYA Q;  3SDZ A;  1TQO A;  5EAY A;  2ZJR A;  1F9P A;  4OIJ A;  2B2V A;  2PPB C;  3PO3 G;  3A8K E;  3QR8 A;  1YEZ A;  1IBL L;  3NEM A;  1ML0 D;  2XGT A;  3PQI A;  4BBR G;  5IP9 H;  1E0B A;  4EQP A;  1N34 Q;  1A6X A;  2RQX A;  5IP7 G;  3SEB A;  4ID6 A;  4B3T Q;  5EQ0 A;  3R3O A;  1VS0 A;  3TZD A;  2Q8I B;  1EYA A;  1JE4 A;  4NXN L;  1HNW L;  2JA5 G;  3FMC A;  4RCN A;  1B70 B;  1EUJ A;  3U9S A;  4DNT B;  2IX1 A;  3FDT A;  4JI2 Q;  3G6E A;  3JAM i;  4WJ3 M;  4DR6 L;  2F0S A;  2F0D A;  4IFD H;  3NHH A;  4GS3 A;  5FKA C;  1K28 A;  2MJ8 A;  1BQQ T;  4C3I B;  5LMN L;  4Q5V A;  2F0J A;  3PUX A;  2G5D A;  4CJ2 C;  1TWA B;  4XIG S;  4DAP A;  3W3A A;  1O7Y A;  2ZT9 C;  3U4Z A;  2UXC L;  1GOZ A;  5FLX L;  4DU9 A;  1EIY B;  2ZM6 L;  3MEH A;  1UEA B;  1XMQ Q;  2MPM A;  4CKB A;  3I4N H;  4OO1 G;  3S2D B;  1PYW D;  3A55 A;  2AHO B;  1N36 L;  2LS0 1;  3ERO A;  2PNR C;  4K5W A;  2B63 B;  3SVM A;  1WOC A;  3IFT A;  3TZU A;  1VQO A;  4A3I G;  1A63 A;  3K57 A;  3F1Z A;  2N78 A;  1OXS C;  5BN3 A;  1QB5 D;  1LTG D;  5IYC H;  1DZ1 A;  2KHS A;  4A3G B;  5FO7 B;  1YJW A;  2CFM A;  3TRE A;  3J81 c;  4FF4 A;  5C4X B;  2BCO A;  1ASY A;  1PH3 A;  1CT1 D;  1EIF A;  3D6C A;  3A8I E;  4L5R C;  2A73 B;  1MIU A;  3K5N A;  3KF8 A;  1Q7Y C;  2HIX A;  3H0G H;  2DNC A;  4KY5 A;  4PQX A;  5CV8 A;  5LMU L;  4HJ9 A;  1V1O A;  3FKI H;  3X3M A;  1XXG A;  1HJP A;  1KLG D;  2DY7 A;  3OPO A;  1PRT C;  3TS0 A;  3F2C A;  1D5M C;  1TS2 A;  5M9O A;  2R93 G;  4APV A;  5DLQ E;  4BXX H;  4J6H A;  1MSG A;  2ZXR A;  2NZH A;  4C3J B;  2E74 C;  2V1C C;  3BYT B;  2L4N A;  4KHP L;  1EY9 A;  1EU3 A;  2EJM A;  4NB3 A;  2QEX A;  1F77 A;  1NCV A;  1Z47 A;  4J15 A;  2VY3 A;  2H4O A;  1R9T B;  1IW7 C;  4A93 G;  2PI2 E;  2E2J H;  4GLX A;  4X6A H;  5DNF A;  4PMW A;  4YIJ A;  4B9X A;  1I50 B;  3K80 C;  4N9P A;  4KKS A;  3PF5 A;  3RLN A;  3T51 B;  4DV5 Q;  1A8V A;  1VQB A;  4DV0 L;  3NXW A;  4RFB A;  3HS0 C;  3GTG H;  3S1M H;  1UNS A;  1KXL A;  2WFW A;  3CHB D;  1EFW A;  2NVQ H;  1CTM A;  4UP8 A;  2BH2 A;  5E3F A;  3MC0 B;  4JBW A;  4B3S Q;  1XMO L;  2CKZ B;  4LF4 L;  4GN5 A;  1WFQ A;  4A75 A;  3PUW A;  2OQ0 A;  3KF6 B;  1KAB A;  1S40 A;  1L0X B;  3CC2 A;  2X6L A;  2R7Z B;  1KRS A;  1S5F D;  2VS1 A;  5CV6 A;  3NSW A;  1HTP A;  3OMG A;  1BVS A;  2J0T D;  1F2Z A;  1U5K A;  1NMF A;  2VB3 X;  3PGZ A;  3I4N B;  1OXT A;  5A35 A;  5CBE E;  4UHV A;  3TN2 A;  5JJZ A;  4JI8 L;  1WJJ A;  4V19 0;  3BJU A;  5KNB A;  3GV3 A;  3I90 A;  1MD2 D;  5GAG C;  4C3I G;  1EQV A;  4P74 A;  3JAM c;  1GHK A;  4OHJ A;  1K3B C;  2O2L D;  4FXD A;  1AE3 A;  2ZTD A;  1J9O A;  3D4W A;  1LTT D;  4IUU A;  1JOK A;  2AUK A;  4XTC S;  1XNQ L;  4ZKB B;  2CQA A;  1ENA A;  1YJ9 A;  4LUZ A;  5IE8 A;  4IFD I;  2F3V A;  1LTA D;  1KDA A;  4CDD C;  5IGB A;  1H95 A;  4HN7 A;  4R4O A;  3B6Y A;  1PLF A;  2ZTC A;  2EDG A;  1HFN A;  1QNK A;  3H0G B;  1X55 A;  1CI3 M;  5KYL A;  1AP0 A;  2K7V A;  1V1P A;  1V9P A;  4QJF A;  3FKI B;  3VDY A;  1WI5 A;  1BF4 A;  3WDN A;  1WD0 A;  2V4D A;  4A3M H;  1B2T A;  4JYA L;  4L8J A;  5C6A A;  2F0U A;  1EOT A;  1UE6 A;  5C4X G;  3OSO A;  3I8Z A;  3ER0 A;  4FVM A;  4IPH A;  2QKI C;  2R7F A;  4LUO A;  4PZ6 A;  1H9M A;  1PZJ D;  5FJ8 H;  1N34 L;  2A8V A;  4DV1 Q;  1GO3 E;  2JA6 H;  4DNR B;  1IBK Q;  1H9S A;  1QVC A;  1TWC H;  1SE4 A;  5EJW A;  1X3G A;  1EWH A;  3I4L A;  3D31 A;  4GN3 B;  4JI2 L;  4QCL A;  1PTO H;  4X66 Q;  1E3P A;  1GUG A;  1JJC B;  2R7D A;  2E2J B;  1JT8 A;  4HIK A;  1GUT A;  3CAM A;  4DR3 Q;  5EKI A;  2XNA C;  5J22 A;  3CP0 A;  2BOS A;  5T1G A;  4R4I A;  2KED A;  4P73 A;  4LAA A;  1NSN S;  4JI6 L;  1L2F A;  4NXM L;  2L15 A;  1JOO A;  1XTC D;  3GTG B;  5ELB A;  3S1M B;  4GNX B;  1PH7 A;  1D1I A;  1Q90 A;  5C4J H;  3G4S A;  4GOP A;  2XRS D;  2B8F A;  1KC8 C;  4KHZ A;  2D2C C;  2AWO A;  2A69 C;  2N55 A;  1D7Q A;  1SJH D;  5IT9 E;  1QNU A;  2E76 C;  4CDE C;  2EZV A;  1TVX A;  2HIV A;  1Y8O B;  1F2M A;  2RVL A;  4UY8 C;  1M4V A;  5CR3 A;  3A7A B;  1GUS A;  3S17 H;  4DR7 Q;  3DLL A;  3LNN A;  1D8L A;  4QIW B;  5JJK A;  1ENC A;  2WAC A;  1PXU A;  3VYS A;  1AW7 A;  4F8M A;  3PO2 G;  3CQZ H;  3TSS A;  5F2D A;  2BE5 D;  2F0P A;  4YCV A;  4DAM A;  1K0R A;  3ND8 A;  5CYU A;  3I4M G;  4BY1 B;  3P1H A;  3GTQ H;  1PYB A;  4XQQ A;  4NMZ A;  5J3B A;  1PTO F;  1UE1 A;  3R93 A;  4IO9 A;  1UE7 A;  3AYH B;  5FK9 C;  3J81 L;  2JA8 H;  2JA7 G;  4IQZ A;  3AEV A;  1EY4 A;  1RF2 D;  3TME A;  5EBC A;  1HZC A;  2I5L X;  5IYC G;  1NY4 A;  4YCW A;  5C4Z A;  3K58 A;  4A3M B;  3VR3 A;  3I91 A;  4O2D A;  1HUN A;  1SNM A;  5IYD G;  5CC4 A;  4F88 A;  1BR9 A;  2IJ0 A;  1YVC A;  3J80 i;  1A62 A;  3I55 A;  1S5C D;  3NTK A;  1TR5 A;  3PIP 3;  3H3V C;  1YHB A;  3HOW G;  2Q8R E;  2KQ3 A;  4DR1 Q;  1D5Z C;  2JA6 B;  4DV5 L;  1PTO D;  3GTK B;  3SHL A;  4EQ5 A;  1PDQ A;  1J5E Q;  4RH6 A;  1ENF A;  1JOQ A;  1TWC B;  1L1O A;  4FXK C;  3SK4 A;  2KCC A;  2AUJ D;  3H6M A;  4R4T A;  1FD7 D;  1F9S A;  2A68 D;  3MFG A;  1PTO B;  1NAP A;  4KKT A;  2K6A A;  2L11 A;  1LYL A;  4OEL B;  3K5L A;  2GVB A;  2B2W A;  3RNU A;  4B3S L;  1MI2 A;  3RMH A;  3KYH C;  4KTA A;  4BBS G;  2R3Z A;  3P20 A;  4H7B A;  1DXM A;  2VQF Q;  2YTY A;  3S15 H;  3WWV A;  1JB7 A;  4KV6 A;  4G57 A;  2AKW B;  5DEH A;  2F0N A;  5FO9 B;  1QOH A;  2DGY A;  1STY A;  4DUY L;  2XN9 C;  3I72 A;  5C4J B;  4C2M H;  1O7L A;  4MTN A;  2F4V Q;  4U67 3;  3TDQ A;  5JJI A;  1BNZ A;  1G8Z D;  3PIP A;  1GM5 A;  2RHS B;  3BDO A;  1MBY A;  3G6J B;  3M4O H;  3S9W A;  4DV7 Q;  4Y52 H;  2EJF C;  1WCM H;  3RZO B;  1X54 A;  4XT3 B;  4O1N A;  3UE1 A;  1O78 A;  1EZ8 A;  2Z0S A;  1VCI A;  5CV9 A;  3SR1 A;  4AQY Q;  2O5J C;  4JCV E;  5DM6 3;  1FJG Q;  5GQO A;  5C0X H;  1IL8 A;  2KCT A;  2F0T A;  1QE6 A;  3NQT A;  2KJX A;  5I2Y A;  2CW0 C;  2D9U A;  4BA1 I;  4QGU A;  1KRT A;  1NNX A;  3CMA A;  2WKC A;  3JAM L;  3BZK A;  3T1H L;  1A15 A;  1PH4 A;  2OT2 A;  5KRU A;  2F3W A;  4P75 A;  4DV1 L;  5JPM C;  3SE0 A;  2NBF A;  3M4Y A;  3E6Z X;  1IBK L;  4RGO S;  2JA8 B;  5IWA Q;  1VQ6 A;  1RDP D;  2X6G A;  4JI0 Q;  1N32 Q;  4RGM A;  4R4C A;  4IJL A;  1EL0 A;  4HSV A;  1G91 A;  1XX8 A;  4A3E B;  2BH8 A;  3S1R H;  1AE2 A;  1VQM A;  4X66 L;  2L1B A;  2TSS A;  1MJC A;  4FYD A;  1QUQ B;  4K6D A;  4DR3 L;  4ALP A;  3N52 A;  2VL6 A;  1X3F A;  1SE3 A;  2XIW A;  1GJX A;  4ABN A;  4QUF A;  2A6H D;  3U58 A;  2YU9 H;  1LO5 D;  4OWT B;  5IOC A;  3HOY H;  4RGN A;  3KLS A;  1KAA A;  3CCJ A;  4K2L A;  5I4D A;  2PZT A;  1PYS B;  1CQF A;  3HOX G;  4BY7 B;  5IY0 A;  3R8B A;  3CCL A;  1TXY A;  3PIO A;  1BCP F;  1FNW A;  3SGI A;  5C3W A;  1PH2 A;  3EFX D;  1TU2 B;  5E4X A;  3AQQ A;  5FJ8 G;  4DA2 A;  2JA6 G;  3HOZ B;  1KIX A;  3OW2 A;  1VF5 C;  3J80 c;  1STH A;  1BBW A;  1CFM A;  2N88 A;  3A5U A;  3C3L A;  4L5S A;  2Z8L A;  4JOI C;  1UUP A;  2E8G A;  4DR7 L;  2AQ3 B;  3HOU H;  1WD1 A;  1SYC A;  1EQQ A;  4KLK A;  1UAP A;  5CGK A;  3STB D;  2J7Z A;  3T1Y Q;  1JIC A;  1VQH A;  5LL6 S;  5CV4 A;  1EY8 A;  1BO0 A;  1QG7 A;  4PMB A;  4EGV A;  5M3F G;  1JC7 A;  1PV4 A;  2ASB A;  2B39 A;  4DAY A;  3Q24 A;  2K52 A;  2GN5 A;  2AWN A;  4LFA Q;  1WCM B;  2I46 A;  3UDI A;  4QL5 A;  4LF5 Q;  4TQU S;  4K14 A;  2VW9 A;  5NUC A;  4QMG A;  2C35 B;  3BDL A;  5TSS A;  4GOP C;  1X3P A;  4HIO A;  3IFD A;  4DV3 L;  2NB0 A;  5C44 B;  4G7H C;  4A3G H;  1VQN A;  4UDU C;  1IYJ B;  5EBD A;  2MP1 A;  2E5L Q;  3GDE A;  1Y69 U;  5CV5 A;  1Z6H A;  2C5C A;  2K50 A;  2WAQ E;  1YHQ A;  5HGQ A;  4LNQ A;  3KLS X;  4PNY A;  1RJT A;  4DR1 L;  1YIJ A;  1NE3 A;  3M7G A;  5HY6 A;  4A3K H;  1AH9 A;  1J5E L;  4GZY C;  2XSC A;  1I94 Q;  2DJF C;  3G71 A;  2I0Q A;  2R6G A;  1DON A;  3D3R A;  2K33 A;  2UUB Q;  1HZA A;  4B3M L;  3HEJ A;  2KHI A;  3S1R B;  5FLM G;  1FNU A;  2UXD Q;  4A3F B;  4OX9 Q;  4C3J H;  4EVO A;  1LV9 A;  1PH9 A;  2E2D C;  5EGT A;  3PF4 A;  4DR2 Q;  3ERQ A;  3TP7 A;  5C0X I;  2DJG C;  2NTT A;  3OIP A;  1B1Z A;  1KL9 A;  3CCE A;  1K0S A;  4KN7 C;  2YU9 B;  2JA8 G;  1ZXT A;  5M5Y H;  3U50 C;  2PMZ B;  1WTP A;  1I4G A;  2Q2T A;  1E2Z A; 
#chains in the Genus database with same CATH homology
 5M3M H;  1KXL A;  2WFW A;  1I50 H;  1N33 L;  1N36 Q;  1CSP A;  4FDB A;  1EFW A;  4BY1 G;  3S2H H;  3U4V A;  3RLF A;  2NVQ H;  4GLA C;  4UP8 A;  2F4V L;  3M4P A;  2BH2 A;  1I5F A;  1L0W A;  4OWX B;  4B3R Q;  4JBW A;  5GAE C;  4B3S Q;  1XMO L;  2CKZ B;  4LF4 L;  2K5V A;  1CUK A;  4GN5 A;  1QZG A;  3A0J A;  3GTM H;  1WFQ A;  4A75 A;  4A93 H;  3PUW A;  2OQ0 A;  3KF6 B;  1S40 A;  3CC2 A;  1KRS A;  2VS1 A;  1P8L A;  2CQO A;  5FLM H;  3K7A H;  1BVS A;  3GTL H;  1L1O C;  2RF4 A;  1VQP A;  1U5K A;  1NMF A;  3PGZ A;  4A3B G;  1K3R A;  1O7I A;  4A3M G;  2CWA A;  1J6Q A;  1OXT A;  3PUZ A;  1VQL A;  4LF8 L;  3GTP H;  3S1Q H;  3DM3 A;  1VQF A;  1WJJ A;  3AFQ A;  4JI8 L;  2UU9 Q;  2NN6 I;  3BJU A;  3EN2 A;  4YCU A;  1FJG L;  1KAW A;  3NEL A;  4DV2 L;  2XTI A;  3M85 A;  2YYZ A;  3MEF A;  1YNX A;  5GAG C;  3L2P A;  3I2Z A;  3D0F A;  1VQI A;  3CF5 A;  5LMU Q;  4DV3 Q;  4P74 A;  3JAM c;  2R7Z H;  5E7N A;  4POF A;  1AE3 A;  2ZTD A;  1M1K C;  3IRB A;  1Y1W G;  3STB C;  3PO3 H;  4XTC S;  1VQK A;  1XNQ L;  1V43 A;  4LFB L;  1YJ9 A;  3RZD H;  4LUZ A;  5IE8 A;  4IFD I;  4JI7 L;  2YTV A;  4ME3 A;  1HNZ L;  1H95 A;  4R4O A;  3B6Y A;  1S3O A;  2ZTC A;  2NVX H;  5JEA G;  4JI3 Q;  1X55 A;  4LF6 L;  2K75 A;  4YWK A;  1HR0 Q;  1IXR A;  2JA5 H;  1JMC A;  5IWA L;  4IJH A;  2LXJ A;  3ULJ A;  4AYB G;  1V9P A;  5C3E G;  1I3Q H;  2WB1 E;  4QJF A;  1SFO H;  3S24 A;  3VDY A;  1WI5 A;  4YY3 L;  4JI0 L;  4A3B H;  3FP9 A;  3K0X A;  3CCQ A;  4A3M H;  1QVG A;  1K9M C;  4JYA L;  4DAY B;  2KBN A;  2LSS A;  1SRO A;  2DUD A;  4L5Q A;  4B3M Q;  2Q2I A;  4AIM A;  1UE6 A;  4L5T A;  5C4X G;  2MO1 A;  2QA4 A;  3ER0 A;  1LUZ A;  3J81 j;  1XJV A;  2OWO A;  1MKH A;  4IPH A;  4DR4 L;  1QVF A;  2R7F A;  4LUO A;  4PZ6 A;  3J81 i;  5FJ8 H;  1N34 L;  2A8V A;  1YBY A;  4C3H H;  4DV1 Q;  4IPD A;  1GO3 E;  2JA6 H;  1IBK Q;  2B3G A;  2MQH A;  3KJP A;  3CME A;  3KF8 B;  4IFD J;  1QVC A;  1TWC H;  1XPR A;  4DV4 Q;  4LF7 Q;  5C0X G;  3K8A A;  1X3G A;  2Z6K A;  1JE5 A;  4PG3 A;  4YHH L;  3KDF A;  4DV0 Q;  4PZ7 A;  4DK3 C;  3CCU A;  1B8A A;  2ID0 A;  3D31 A;  1UEB A;  4GN3 B;  4JI2 L;  2UUC L;  1FL0 A;  1C9O A;  2WP8 J;  4DUZ Q;  4X66 Q;  1E3P A;  4DR5 L;  2Y0S G;  4LF9 L;  1JJC B;  2R7D A;  1JT8 A;  4HIK A;  4A3I H;  1IBL Q;  3CAM A;  4DR3 Q;  3NEN A;  3H3V H;  5GAD C;  3CP0 A;  1YZ6 A;  4GLV B;  5FLX c;  1HZB A;  4HID A;  5AJ3 L;  1XMO Q;  2WAQ G;  4H02 A;  4PZ8 A;  4R4I A;  2JA9 A;  4P73 A;  1K83 H;  3F2D A;  4JI6 L;  2ATW A;  2PQA A;  1S72 A;  1EWI A;  2KCM A;  3RR5 A;  4NXN Q;  1L2F A;  4NXM L;  2L15 A;  4OO1 I;  4EX5 A;  3PSI A;  1W2B A;  1HNX Q;  2HQL A;  4DR6 Q;  4GNX B;  1PH7 A;  3S1N H;  5C4J H;  1QZH A;  3M3Y H;  4X62 Q;  4BA2 I;  3G4S A;  2N8N A;  2FXQ A;  4GOP A;  3CPF A;  5LMN Q;  4DV2 Q;  3LGJ A;  2RHQ B;  1KC8 C;  4KHZ A;  3RN2 A;  1CKO A;  1OTC A;  5M5W H;  4K0K L;  2AWO A;  3W1B A;  2ZJQ A;  2GVA A;  1NBW A;  1D7Q A;  2PMZ E;  1C7Y A;  3CW2 C;  2VQF L;  1PH8 A;  2UUA L;  2HIV A;  1FGU A;  1W3S A;  4LFA L;  2UXC Q;  1VQA A;  1DGS A;  4A76 A;  3HOY G;  4UY8 C;  2ZM6 Q;  1VQD A;  4LF5 L;  4QIW E;  4R4Q A;  4A3E G;  1KHI A;  1SR3 A;  3HKZ E;  3OTO L;  4IOC A;  1KD1 C;  3S14 H;  3UDF A;  3S17 H;  4DR7 Q;  1JJ2 A;  3DLL A;  1VQG A;  4LW1 A;  1D8L A;  1EYG A;  1SLJ A;  5JJK A;  4A3L H;  1GVP A;  3I7F A;  1E22 A;  1Q12 A;  4X64 L;  2R92 G;  1X6O A;  3RN5 A;  2H5X A;  2IHE A;  1Q1B A;  2PNH A;  5GRO A;  2VQE L;  2BA1 A;  3PO2 G;  4DV7 L;  3CQZ H;  3Q8D A;  2HHH Q;  4A3C H;  3W1G A;  4YCV A;  4DAM A;  1K0R A;  1QUQ A;  2YV5 A;  3KFU A;  1IBM L;  2VUM G;  3I4M G;  1K8A C;  4JI1 Q;  1WYD A;  4AQY L;  4BY7 G;  3GTQ H;  1PYB A;  5J3B A;  4DR4 Q;  3F8T A;  1UE1 A;  1Q82 C;  4A3J H;  4IO9 A;  4GN4 B;  1UE7 A;  1C0A A;  3AYH B;  4GKK L;  2JA8 H;  1OXV A;  1VQ7 A;  2JA7 G;  3AEV A;  1T9H A;  3CCM A;  2K5N A;  1PH1 A;  1PA6 A;  4YHH Q;  1HZC A;  4JI4 L;  1CKM A;  2I5L X;  3HOZ G;  1MJE A;  2D62 A;  5IYC G;  1PH6 A;  2UUB L;  1NY4 A;  1GKH A;  4YCW A;  2UUC Q;  2JK8 A;  4BY1 H;  2K5H A;  4O2D A;  5IYB G;  5IYD G;  1SMX A;  2UXD L;  1X3E A;  1YVC A;  4JBJ A;  1K73 C;  4OX9 L;  1XNR Q;  4JV5 Q;  3J80 i;  1RL2 A;  1A62 A;  1Q1E A;  3HKS A;  5BR8 L;  3I55 A;  3I4O A;  1YHB A;  3EBE A;  2IT1 A;  3HOW G;  1YHA A;  1E24 A;  4GKJ L;  4KHP Q;  3UE0 A;  4DR1 Q;  3PO2 H;  1SN8 A;  3J7Z C;  3UDG A;  4DV5 L;  1TWG H;  2B63 G;  4EQ5 A;  2UXB L;  1J5E Q;  4JI6 Q;  2A1A A;  3CC7 A;  2HT1 A;  1L1O A;  1N32 L;  4NXM Q;  3I4M H;  4LFC L;  4O0A A;  4R4T A;  3KJO A;  1VQ9 A;  2N49 A;  3ICE A;  2ZJP A;  4A3G G;  2EQS A;  1WCM G;  3RLO A;  4X65 Q;  2WB1 G;  4MNO A;  2E2I H;  3TRZ A;  5JJL A;  1LYL A;  4JBM A;  4C3I H;  1JJG A;  4DV6 Q;  3I4N G;  5GAH C;  2GVB A;  3RNU A;  2JA7 H;  3K7U C;  4B3R L;  3GTJ H;  4B3T L;  4B3S L;  2OQK A;  3GTK H;  4K0K Q;  1LTL A;  4JI5 Q;  1TWA H;  4BBS G;  3KYH C;  1Y1W H;  3ZJY C;  1E7Z A;  1VQE A;  4UPA A;  3CC4 A;  5C44 G;  5IYB H;  1UWV A;  2VQF Q;  4A3K G;  3ULL A;  5IYD H;  2YTY A;  3CD6 A;  3S15 H;  3WWV A;  1JB7 A;  3S2D H;  4JOI A;  3KDF B;  4A3D G;  4RMF A;  2AKW B;  1XTD A;  4GNX C;  2MFI A;  2JEB I;  3HOW H;  2DGY A;  1N33 Q;  3TEH B;  2VNU D;  4DUY L;  4C2M H;  2UU9 L;  2B63 H;  4MTN A;  1TWH H;  2F4V Q;  1YI2 A;  5C3E H;  3GO5 A;  3CCS A;  5JJI A;  4LF4 Q;  3PIP A;  2F3I A;  1GM5 A;  2RHS B;  1PVO A;  2K4K A;  3M4O H;  1HZ9 A;  4DV7 Q;  4Y52 H;  1BKB A;  1X56 A;  1WCM H;  3S16 H;  2ES2 A;  1X54 A;  4JG2 A;  5C4X H;  2PQA B;  1GD7 A;  3HOV G;  3UE1 A;  1Q8K A;  2Z0S A;  1VCI A;  1XMQ L;  3L7Z C;  1IBM Q;  1ASZ A;  2OTL A;  1CKN A;  3PCO B;  3TQY A;  2AMC B;  2NVT H;  1B7Y B;  4AQY Q;  1CSQ A;  1VQJ A;  3KLW A;  1PHJ A;  4LF8 Q;  2OCE A;  4JI8 Q;  4JCV E;  4MZ9 A;  4RG1 A;  4A3F G;  2Q2U A;  5M3M G;  1FJG Q;  3H3V I;  4BBS H;  1EOV A;  5GQO A;  2YTX A;  2ZTE A;  1HH2 P;  1G51 A;  2NN6 G;  4JI3 L;  2KCT A;  4LWC A;  2D0O A;  5IP9 G;  4GOP B;  3T1Y L;  1PH5 A;  3M4Q A;  1HR0 L;  2A19 A;  1I6H H;  1N9W A;  1VQC A;  1OXX K;  3RZO H;  3JC6 6;  4A3D H;  4JI4 Q;  3NBH B;  4HJ7 A;  4QQB X;  4BA1 I;  4QGU A;  1YJN A;  2PI2 A;  1KRT A;  5M5X H;  1XNQ Q;  2EXD A;  4LFB Q;  4HJA A;  1Y1V G;  3M9B A;  5H1S E;  3CMA A;  3GTO H;  3T1H L;  3BZK A;  4JI7 Q;  2E2H H;  2VZA A;  3BZC A;  1HNZ Q;  1PH4 A;  1HR0 W;  4IFD G;  4IOA A;  3ERS X;  1V1Q A;  2EIF A;  4P75 A;  1E1O A;  3HFZ B;  4DV1 L;  4DK6 C;  4GKJ Q;  1IBK L;  3CXC A;  3CPW A;  4LF6 Q;  3HKZ G;  4DV4 L;  1Q81 C;  2QGQ A;  5IWA Q;  1M90 C;  4LF7 L;  1VQ6 A;  1R9T H;  2JEA I;  3HOV H;  5JEA J;  4JI0 Q;  2NVY H;  2CWP A;  3E9I A;  4YY3 Q;  4OWW B;  2E5L L;  1RIP A;  1N32 Q;  4R4C A;  4P71 A;  3H15 A;  4IJL A;  2R7Z G;  1VQ4 A;  4JYA Q;  1IL2 A;  5EAY A;  2BH8 A;  3S1R H;  1AE2 A;  4DUZ L;  1VQM A;  4X66 L;  2ZJR A;  3OYY A;  1MJC A;  1G29 1;  1Z9F A;  3PO3 G;  1QUQ B;  1YEZ A;  2MO0 A;  1FVI A;  1IBL L;  4DR3 L;  2LXK A;  4ALP A;  1K8G A;  3NEM A;  2XGT A;  4BBR G;  2IX0 A;  5IP9 H;  1N8R C;  1N34 Q;  3E0E A;  2VL6 A;  1X3F A;  4IPC A;  5IP7 G;  4B3T Q;  3KF6 A;  3HOU G;  1Y14 B;  1VS0 A;  3U58 A;  2I5M X;  3I56 A;  2YU9 H;  1I94 L;  4NXN L;  4OWT B;  3UDX A;  3HOY H;  5ELO A;  1HNW L;  2JA5 G;  3CCJ A;  1Y1V H;  1B70 B;  1EUJ A;  1TWF H;  4HJ8 A;  2IX1 A;  4A3E H;  3TS2 A;  1PYS B;  4JI2 Q;  5C0X J;  3JAM i;  3HOX G;  3G6E A;  1HNX L;  5IY0 A;  4WJ3 M;  4DR6 L;  4HIM A;  4DR5 Q;  3CCL A;  2JJQ A;  4LF9 Q;  1TXY A;  2I5H A;  4GS3 A;  4HJ5 A;  4X62 L;  3PIO A;  4DUY Q;  3SGI A;  1PH2 A;  2R92 H;  4UP9 A;  4Y7N H;  5LMN L;  4DR2 L;  4DPG A;  3AQQ A;  3PUX A;  5AJ3 Q;  1P16 A;  5FJ8 G;  1XPO A;  3H0G G;  4XIG S;  4DNI A;  2JA6 G;  3FHW A;  2KEN A;  3OW2 A;  3ULP A;  1YIT A;  1KIX A;  3U4Z A;  2B29 A;  2K14 A;  2VUM H;  3J80 c;  2UXC L;  2Z6K C;  3FKI G;  1BBW A;  2F52 A;  4BY7 H;  1BBU A;  2BA0 A;  2KHJ A;  1EIY B;  2ZM6 L;  1L1O B;  3PUY A;  3I4N H;  1XMQ Q;  4OO1 G;  1X65 A;  2N3S A;  4BBR H;  3A5U A;  4L5S A;  4JOI C;  4AH6 A;  2E8G A;  2AHO B;  5IP7 H;  5IT9 c;  5LMN W;  3E9H A;  1N36 L;  4DR7 L;  3HOU H;  4AYB E;  3PUV A;  1EQQ A;  4KLK A;  4BXX G;  3STB D;  1WOC A;  3K81 C;  3KOJ A;  4A3I G;  1VQO A;  1KQS A;  4QY7 A;  1A63 A;  3T1Y Q;  1VQH A;  3F1Z A;  2N78 A;  4UP7 A;  1OXS C;  5M3F G;  5IYC H;  3HOZ H;  1PV4 A;  1PFS A;  2ASB A;  3HOX H;  1Q86 C;  2K52 A;  5K36 G;  1YJW A;  2GN5 A;  2HHH L;  2UUA Q;  2AWN A;  4WJ4 A;  3EIV A;  3MXN B;  1Q46 A;  2CFM A;  4LFA Q;  3TRE A;  3UDI A;  1XPU A;  3J81 c;  1NTG A;  4QL5 A;  1ASY A;  1VQ8 A;  1A0I A;  1U0L A;  4LF5 Q;  4JI1 L;  4TQU S;  1PH3 A;  1EIF A;  1OXU A;  3OTO Q;  3T1H Q;  2VW9 A;  1X9N A;  4L5R C;  2C35 B;  4YWM A;  1MIU A;  1Q7Y C;  4A4I A;  2HIX A;  3H0G H;  4JC0 A;  4GOP C;  4X64 Q;  4HIO A;  3A74 A;  4DV3 L;  5LMU L;  4HJ9 A;  4NPS A;  2Y0S E;  3FKI H;  4LUV A;  2VQE Q;  1VQN A;  4A3G H;  1HJP A;  4OON A;  1IYJ B;  3TS0 A;  2E5L Q;  3GDE A;  3F2C A;  2R93 G;  2Q2H A;  4APV A;  1NMG A;  5DLQ E;  4BXX H;  2JQO A;  2K50 A;  2WAQ E;  1YHQ A;  3F2B A;  2ALY B;  1XNR L;  4JV5 L;  2JE6 I;  5HGQ A;  3G48 A;  2NZH A;  3CCV A;  4LNQ A;  2V1C C;  1CKN B;  3W5O A;  4DKA C;  5M3F H;  4GKK Q;  4KHP L;  4IPG A;  4DR1 L;  1YIJ A;  1SE8 A;  4P72 A;  1NE3 A;  4YWL A;  1VQ5 A;  5HY6 A;  5C44 H;  4A3K H;  2QEX A;  1AH9 A;  4NB3 A;  4POG A;  3CCR A;  1J5E L;  4A3L G;  1I94 Q;  1Z47 A;  1HNW Q;  4J15 A;  2VY3 A;  3G71 A;  2I0Q A;  2R6G A;  4A93 G;  2PI2 E;  4GNX A;  2UUB Q;  3BU2 A;  1G6P A;  3A5Z B;  2RCN A;  1HZA A;  2IY5 B;  4B3M L;  4A3C G;  2KHI A;  2E2J H;  4GLX A;  4X65 L;  5FLM G;  1UE5 A;  2UXD Q;  4OXP A;  4X6A H;  4OX9 Q;  4C3J H;  4PMW A;  3AFP A;  3L0O A;  3K80 C;  4TVA B;  1EQR A;  2NZO A;  1PH9 A;  4DV6 L;  3J7A 5;  3PV0 A;  5BR8 Q;  2MNA A;  1LM0 A;  4JBK A;  3PF4 A;  4DR2 Q;  3PF5 A;  3M7N A;  3RLN A;  5ELN A;  2OTJ A;  5C0X I;  4DV5 Q;  4JI5 L;  1KL9 A;  2IHF A;  4A3J G;  1A8V A;  1SRU A;  2UXB Q;  3CCE A;  3GD7 A;  1VQB A;  2JA8 G;  4R1J A;  4DV0 L;  2R93 H;  1NJI C;  4LFC Q;  5M5Y H;  3U50 C;  2CCZ A;  1IZ6 A;  4KI0 A;  3GTG H;  3S1M H;  1E1T A;  2Q2T A;  2D0P A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...