3KM1A

Zinc-reconstituted tomato chloroplast superoxide dismutase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
125
Chain Sequence
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 28
structure length 125
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km1A00
1TO5A 1SPDA 1F1DA 2AQQA 1N18A 1SDAB 3L9EA 1MFMA 1IBDA 1E9PA 1E9PB 2GBUA 1SXCA 1ESOA 1BZOA 1F1AA 4A7GA 4U4IA 1IBBA 1DO5A 1CB4A 1YAZA 1Z9NA 1Q0EA 2APSA 2GBVA 2WKOF 2WZ5A 4BCZA 5KBKA 2C9UA 1SXAA 1COBA 1OZUA 1CBJA 3SODB 3F7KA 1Z9PA 2Z7UA 2JCWA 2AQPA 1E9OB 4A7VA 5KBLA 3ECVA 1AZVA 2E47A 3ECWA 2SODB 2AQRA 3CQPA 2Z7YA 1OZTG 3GZQA 1JK9A 1PU0A 1JK9B 2VR8A 3MNDA 1OEZW 4BCYA 1BA9A 2GBTA 2C9SA 2AEOA 4N3TA 3HW7A 2AQSA 4L05A 1SOSA 3L9YA 2AF2A 2ZKWA 1IB5A 3QQDA 1B4LA 3KH4A 1S4IA 5KBMA 1RK7A 1XTLA 1HL4A 1PTZA 2WWOA 1JCVA 2NNXA 2WWNA 2XJKA 2Q2LA 2Z7ZA 1DSWA 3GZPA 3RE0A 3T5WA 3S0PA 1KMGA 4B3EA 2ZOWA 1U3NA 2WKOA 2WZ6A 1PZSA 3KH3A 1P1VA 1F1GA 3HFFA 2E46A 3H2QA 4BD4A 3F7LA 1EQWA 1IBFA 3ECUA 3KBEA 3GQFA 2K4WA 2JLPA 3GTVA 1OAJA 2WYZA 4A7UA 2VR7A 1IBHA 3KM1A 1B4TA 2LU5A 2XJLA 2ZKYA 3KBFA 3QQDB 4A7SA 3LTVA 1SDYA 1N19A 4MCMA 3KM2A 1XSOA 2WYTA 2V0AA 1UXMA 4OJAA 3GTTA 2ZKXA 1FUNA 4A7GF 1F18A 4FF9A 1SXZA 3PU7A 2AQNA 2AQTA 1E9QA 1SXNA 1EJ8A 2WZ0A 1E9QB 3CQQA 3HOGA 2C9VA 2R27A 2VR6A 3K91A 4A7TA 1XTMA 1SXSA 1YSOA 4OH2A 1UXLA 4A7QA 1QUPA 1SRDA 4N3UA 3CE1A 3H2PA 1YAIA 3GZOA 1TO4A 1SXBA 5CU9A 3MKGA 4MCNA 1HL5A 1E9OA 1L3NA 2Z7WA 1OALA
chains in the Genus database with same CATH superfamily
1BWMA 3IFPB 2AQQA 4ZMAT 2QSQA 1X6LA 1YCSA 2FQEA 1BREA 3GSXA 4AL8C 2RIKA 4E2OA 1ZHNA 5J0BA 1CFQB 2EJ1A 2BERA 3VI4F 2MSPA 4L8DB 3QO1A 4UOZA 1EJFA 2FATL 3UCQA 2ED9A 2EE3A 4YIQB 2F5BL 5KTEL 3KL3A 3QUMB 4ELMB 2QLVB 4G7YH 4XMLL 4HKZA 5L0QC 4BFJA 3KPMA 3BVVA 3KGUA 3O3DA 3ROLA 4GFXA 5CR8A 3W9EA 2BVOA 3ZK0A 5E99H 1E4XL 3NTCL 3QORA 2HT4D 5HYEA 2WCPA 5F0PB 1FGNL 1GGUA 2DMBA 4H8QA 3S5LB 4NKOA 2E47A 3MDJA 3CHOA 4QNPF 5CBAA 1IC4L 4PJHA 1EAQA 5FKAB 1ASQA 1W91A 2NY3B 4F2MB 5C09E 4XNXH 4N0CC 2CR0A 3NESA 1IAOA 1UWFA 2I9LB 4J6RL 5CHNB 3ILQD 3LS5L 1ASOA 2Y6SC 1XT5A 3HNTH 1CIUA 4PJGE 1HDMB 4Z7OB 1S7XA 3GLZA 3VI4A 4AQ1A 4M3KB 1VRSA 5ES4B 5KBDA 4XVJL 4YXKH 3BZFB 2BOBA 2DB8A 1QNZL 3WD5L 2GEEA 3ZU8A 2HYMA 4U1JB 3GLAA 5C92A 2NY1D 3HC4L 5CLTA 1FZJB 3TBBA 2ZYHA 4NYLB 1ETJA 3KGSA 1E6OH 1KULA 1A64A 4OZHE 2GK2A 4JY5H 4MXQD 3GBNH 5D71L 3VFUB 2CMRH 2K4WA 5I0XA 4KJPC 4BFFA 1UOLA 1HJBC 1TT6A 5DC9B 5KS9B 1KCVL 3ZTNH 4XP9L 5ICZB 1UWGL 4TRPL 1YEEH 3MJ8A 1ZMYA 5DD1L 4PJCF 3D0LA 3DUSA 1KDIA 5F72S 2P49B 4KKBC 3BVUA 3D18B 4G43A 4KUZH 4OCLC 3VFRB 3W11D 3K2MC 4MDIA 4LVHC 1XR8B 2UY6A 2ENJA 2XT1B 3MTRA 1A7BA 1N0XL 4RNRA 4TMPA 1CGSL 4DP0X 5FB8B 1C08A 5D93B 1EA9C 1S7WA 1MG2C 3AG4B 2IAMC 4PW4A 5GZOA 1TTUA 2XV2A 4NPJA 1VACB 1D5RA 1X5KA 4D9LH 5D7EA 2Y25A 4E9SA 5IW1A 5DMKA 1ZT4A 3P02A 4GEJA 2I5YL 4HV8B 4RGNB 2OSYA 4GUOA 4XNDA 3BDYH 4QRPB 3FU8A 5KN5A 3K6SB 1U3HC 1C16A 1KENH 3VXSE 1J5CA 1UOKA 2Y7QB 3BVNA 3CBRA 1F1DA 2VMJA 1RU9L 2W07B 4MVBC 3EJTA 4L29A 5HI3D 2X0UA 1F6AB 4PRHB 1JN6B 3BDXA 3IDXL 4PD4J 3FB7B 4PJCA 3C60B 1UCBH 3BESR 4MAUL 3DMMD 2UZYB 1F8TL 3I02A 4JPSA 4ZAKC 3N0PB 4MNGE 1UJTA 1UM4H 1MFDH 2XVGA 4JVWA 1V7NL 3NSDA 4B9PA 1OY3B 5ACZB 2VUKA 4NHCH 3SKOB 3VD2A 1J9RA 1HXMA 3F05A 4I0PA 5LGYA 3RWCB 4DETA 2Z31A 3M1CA 4FQCH 2A9ML 3OF6D 5INCA 1S7SA 1W8EA 3ALPA 1USZA 2GTQA 3ZKXB 4G1EB 3ZYJA 4AJVA 4LNVA 4FG2A 5HYJE 2DWYA 2Z93B 3QCUL 1AZBA 4JQVA 4XZ4A 4BCYA 1H19A 4PBVC 5JO5A 1ZLUH 4PY8J 4XN2A 2HLAA 5BOPA 1LE9A 5H94A 5IW3A 2OA9A 4G6KH 5KVGH 4PJ8B 3UYRH 2LAAA 1OM3H 3NBNA 4Y2OA 4JNXA 1XTLA 4YZFE 4OZ4A 2X4QA 4Q89A 2R2EA 2JTYA 5I1KH 4KJQD 2G9HB 1YN7A 3B3BA 3WIIL 5B8CA 1A7NH 1QSFD 1KACB 3H3KA 5DZOA 2V8LA 3ULAB 4F8QA 2O5ZL 2OX5B 1ZANH 3LQAL 3P3TA 4N2LA 1YMHB 4YNYA 1TQBB 4GW4A 2PWEA 2B8OT 3CFJA 4JRLA 5EN3A 5JQ6L 2VH5H 2MNUA 3D51A 4JL1A 4XRCB 2C4FT 5DJZB 4CVXA 3QUZA 4XPTL 3MRMA 5DFVD 4PW9A 1XAUA 3FYIB 2N7SA 2VDKB 3UGEA 3SD2A 1ZVYA 3P0GB 3T3PF 3KLHD 3HG5A 2WHVA 1MCWW 3N5AA 3ERXA 5ERWA 3C5XA 5D2LB 5SWZB 5B39A 4P5TA 1MAJA 1BJ1J 3RWHB 2AQTA 5EEUA 4LSTL 3RDTA 1J5HA 3LRLA 2CO6B 1K5WA 2BZDA 4HUXA 4M8QA 4PI0A 5K59E 4ORGA 1CBVL 2NZ9C 1BAGA 4FI6A 4PJBF 3EYFB 3M07A 5C0RL 3L7EA 1SMOA 1CICC 2PW2B 1S9WA 5T1DH 3US9A 3MVSA 2YSSB 3F5WA 3ISYA 1P5UB 4K9JA 3GC3A 4KY1L 2X38A 1T1ZA 4G9DB 5IP4A 5DVMA 4DGVL 3F7VB 3V7AE 4O5LL 3DPBB 1AG0A 3D12B 2CLVB 4MASA 2JKJA 3F7YA 3FT3A 1TU2A 4EIGB 1F1AA 3AMLA 3LQAC 5DCCA 4OZGE 1PW3A 1FHGA 3E9TA 4E9XA 2PN5A 4UT9H 2CLRA 2B14A 5T1LB 2FJFA 3P4OB 4TSBL 3RL2B 3GMLB 1JYVA 1B9KA 3DV4A 3FFDB 5SX5K 1FV1A 4PJBA 4YOKA 3A6BH 1E9OB 1J0ZA 3IXAB 1CT8A 3FRPG 4KROC 3UDWA 1HHGA 5FC9A 1KBBA 1OEZW 1W6WA 3IJHB 4L3EE 4F7TB 1Z5HA 1YG9A 1MRCH 3ISWA 3QDGA 1SBSH 4OCSH 1ZEAH 1OTUC 1V3JA 4KKRA 3FQNB 2XTJE 2NPLX 3UBFA 3ZHFA 3MXVL 1EZUA 1WO2A 4HALA 3WO4B 2XZAH 4NUPA 3SDYL 2YEZB 2HVJB 4OLUL 5D7SL 4YC2B 3BPOC 1E7UA 5MENA 5KYNA 4HHGA 2DQJH 4QRRB 5HHOE 5IR1A 1GYWA 3CZGA 3QDJE 5LLIC 1E8YA 2EAEA 3L1OL 3VFMB 3VXUE 4LL1A 3WKNA 1MUJB 1MJ7H 1J48A 1NCCL 1P1ZB 4XC1H 1UG9A 3LXBA 5GGTA 5FM4A 3GXMA 1VENA 4M7LL 3HLAB 1RJCA 5A2JH 2MOQA 4AT6A 1AIFB 4OUUA 1X7SA 1CDBA 2VXQA 1RULH 3VXRB 4J2XA 1J1OH 1MQ8A 3PF2A 4FHJA 5EBMB 1WA1X 2EYTA 3Q5TA 1S7RA 1LK2B 1UH4A 1WZ1L 2B08A 3MLXH 1I4FB 5I8CA 1CVSC 4AQAA 5J11C 1KTRL 1F18A 3RZCB 3BO8B 1Y18B 3ME0A 4FJZA 1H15A 4NQCD 1QR1A 5CZXD 1HKFA 3A0OA 3V4PL 1ZGLM 1E65A 5EO1A 2GITB 4PWKA 4PS3A 5EEYA 5EUKA 1S7UB 1KB9J 1MY5A 4H44C 4Z3TA 3D69A 4B60A 2MEJB 4G80B 3D05A 1J8SA 3ZDZF 1YNTB 1FQ9C 4R7NA 4IIQB 3WXWH 2VW4A 3QEHA 3OAYK 4Y4HA 3TYFA 4C83B 4CMMA 4JM0A 3HB3D 5CJ8A 5EFIA 4BQ6A 1CFVL 4L4VA 1WAPA 4FL4C 3K1KC 3VH8B 2VR5A 4LCCC 4WI3A 5FYJD 4ZQTA 2Z1PA 3BSZL 4RX4D 2A6KB 4OD3L 5D1QB 2FSEB 4UTAL 3V0AC 4OFKA 1SY6H 3ZZLA 2ZSVB 3I9IA 4PWHA 3CN3A 4RLDA 3SJVB 5FYLH 1O5DT 1KB5H 5TPWH 3R06B 2DLIA 3COOA 4Y89A 4L37B 5MHSD 1U6AH 4FQLL 1ZHBB 4EBQL 3O2DL 4L18A 3LIZH 4TXVB 5L2KB 1G7IA 1SGKA 5JHDE 3KPPA 5CJOL 5EUOE 2DJUA 3GINA 4X6DF 1A1MB 1SZNA 5F7KC 4F7CA 2WXOA 2R59A 4N6RB 4R83A 3ELAT 3VFPB 1IEHA 4FMFA 1JGIA 4WWOA 2K7QA 2DL9A 2Q6WA 1SOSA 5DI8A 2DQFA 4LDOB 1W2KT 5KUMA 2YPLA 1ECZA 2ZF8A 3O0RH 3W9DA 2YMXL 3GRBA 3EH2A 3QT2A 4KZDH 3QPKA 2OLDA 1KCWA 4MJIB 1VLXA 4X7FC 1JZ8A 4MA8H 3O3BB 4G7QB 1XCWA 5BS0A 2NQDA 2VTFA 3S7GA 2IH1B 2QKIA 7PCYA 3VXTA 1ORQA 4GG6E 4YDKH 4WWPA 2A73B 4XPHH 4DO6A 1NANH 3ECUA 4XWOD 4GRWE 3X13B 3ZE0F 4X99A 1JZ7A 4X6DA 5F8RC 3TF7C 2OYPA 4Q8BA 3ZIMA 2VW6A 3O6ML 5I19H 3LAFA 2YPVA 4I2XA 4H20H 4OJEH 1TZAA 3EH1A 3L2MA 3VWKB 3BUYB 1GGIH 4KMTH 3ZO9A 4DK5A 2YIHA 1ROWA 3O6FC 3SE8H 4AVJA 1ZE3H 2EVHA 1P6AB 4IU2B 5GS1B 3UPCA 3DRQB 4YLBA 2OP4L 4S11A 3LN9A 1DBKL 1HNFA 1N64L 3GSWB 5B7EA 3LPOA 1LDPH 1WDAA 1LK3H 1GL4B 4LO9A 3RRQA 1J1PL 4JFHD 2QZ5A 3KCPB 4NAQA 3MRIB 3W5MA 2R69L 4I0CC 4Q7DA 1J8HE 1OLLA 3BKYL 5CEZD 1JBJA 1EO8H 2FJGA 4FFVC 2PO6C 4NJAL 1RPKA 2NY3D 4QD2E 1A9VA 1ZPUA 5I0YA 2XWEA 4AUYA 3FB5B 5I0DA 1TTGA 1UA6H 5CLXA 4AJ0A 4P4KC 3V6ZA 2WP3T 4O9HL 3WL9A 1AGFA 3SDCA 3THML 4DK6A 5E6IC 3ZRFC 3ECQA 1U8IA 1GPOL 4X7SH 5D2NC 3J27A 3MFFB 1AS7A 3DX7B 3C5ZC 4PJ7F 1VCAA 4NO2B 3WNOA 1HSBB 2HVKB 2VRQA 2LT9A 1I31A 3EDFA 5DJDA 4DUVA 3TEWA 2A6DA 3Q8CA 1SYVA 4UQ9A 3I9GL 4TN9A 3H3BC 3WNNA 4PRPA 3IFLL 3MUGB 1U41A 1A4CA 4HGWB 4MS6A 3VYNA 4B3VA 1MWAA 4ODSL 1XGQA 4XGZA 1T7VA 2PMZA 5EEWA 1ZIAA 2HH0L 3BAXA 3PJNA 5DXWA 2BOLA 3OSVA 4JKWA 4WEUD 1FORL 5E94A 4LLMB 3RB7A 4GKLA 3S96A 3WDJA 2X3AA 5C7XH 3DROA 1XGRA 2GVYA 4GB9A 3F58L 2FNBA 3S34H 2WSPA 1PCXA 3PWVA 4IDLA 3WFBH 2KUTA 4AQZA 2CH8A 3G08A 1BFVL 3NCJH 4AIEA 1FFNA 4EI5A 4OFPA 5CLYA 5KG9B 3ULVL 4F37F 3O9WA 1BGXL 1OGAB 3TT3L 5J13B 3AAZA 4A38A 4OGYL 3IRCA 4BZ1L 2Z7ZA 4PJ7A 5IBTL 2W81C 4G2AA 4JKKA 1UOWA 4W9LC 5C0IA 5IQOA 4HW6A 3BJ91 2BP0B 5D4QA 3H2QA 1FP5A 2WSDA 3EFFB 1SUHA 4QXUL 1JJUA 4RGND 5HJDA 2DLFH 1OTTC 4XXCC 4QRPD 1IM3A 5BMFL 2VE6B 2GHWB 1CXFA 1A7QH 5C0ND 3IGAA 3U7YH 5EOQL 1JGLL 4JG1L 4QRQB 5HVHC 4HC1H 4PRHD 5LAPA 5I30H 1BYPA 3B6SA 3CXDH 4OM0H 4D9RE 3C60D 1G84A 4JQIL 3NCFB 3NIFE 2YKLL 3CG8A 3VWJB 4BRVA 1WBYA 1AKJA 2NQ3A 4KO6A 1B4RA 1WFMA 2ZAGA 4MA1C 5FW7A 3U30C 2ALAA 2O6PA 4WO4C 5GS2D 3I9AA 5T1MB 5KVEL 4KPHL 4Y1AE 1MREH 4OSUH 4P2RD 2AKRB 5KUKA 3EYUL 3WLBB 4NWTL 1VSCA 4G6AD 2CBPA 2W59A 4WEEA 5ADPH 4PGBA 4X80L 4XP6L 2D4DA 4ZRGA 3BVDB 4YHOL 1OARL 4M62L 5K39B 1C9SA 4KUCF 3S36L 4JHBA 3V6FB 4JO1L 3UYOD 2JQMA 2Z0UA 4ES9A 2H0PA 1CFSA 5IFJA 1DLFL 5LXGL 1E4KC 3AQXA 3ULVC 1LM8V 3NFSH 1N3NB 2BP8B 3QO0B 5I1HL 4KVNL 3QR1A 3BMWA 5AEAA 2VQ1A 5EEZA 12E8L 1NAKH 2K6ZA 3OJDA 5EBLA 4HK3N 2JKIS 4HWEL 2V33A 2R56H 1FZOA 1ZHKA 4XE0A 5CWSB 2KLTA 1CXHA 5DRZA 1HH9B 1R3KA 1OT2A 2HTKD 2EH8H 2OW7A 1QSEB 3L95A 1AE6H 3L1FA 4J4PA 1HZHH 3QUMH 5CJQH 1G5AA 4KK9D 4WNJA 4WCYH 4TPRL 3ZE1B 5ADOH 4BSWA 4FEIA 1YUHB 4EQ2A 2XZCL 1NCJA 3MZGB 5BRZB 1MNNA 2WKGA 4P5SA 3MA7B 1UADC 3OKLB 2WMPB 3I6GB 2AJZB 1HILA 3EYVB 3V9FA 5L4FA 5DHMC 4WTZA 5L4IA 2Q8BL 2HSIA 2QR0B 4LK4A 4OCRH 3QUYC 1RURL 4AIXA 1HL4A 3OHXB 4TQHA 3QWQB 1T6VN 3ESNA 3V55A 2DQUH 2PLTA 3U0PA 4JY6A 3GO1L 3SGEI 4CN6A 1SYSB 1BQHG 2FEJA 3JWDL 4NGHH 1EAJA 1TOXA 4MJ5B 2EDOA 2JJUA 4WFEE 3L5WB 3B8SA 3FQYA 4RBPH 3BWZA 2NY0B 2BJMH 2VN6A 3BKML 2JLLA 1OAQL 3F62A 3VO0A 5LAXB 5H8DA 5IBLD 4G8EB 3H9YA 2XQYA 1ZLUK 2QLYA 4GLRH 2BVTA 1AFVH 4DJMA 3JTTB 3AB0C 3CIAA 2VM3A 5IKCB 1IBGH 1A21A 2ZWKA 3DGGB 4KMQA 5L6YH 1N10A 2ROYA 2H9GA 4G8FA 1MF2H 4GPVA 2FO4A 1F4YL 1RZ8B 4KX7A 2B4CL 3FH5A 3GBLA 4YHMH 3ABLB 4ZQKB 3UTPD 5EC1A 3QW9A 5FUOL 5SWQA 4KHXH 5IJVA 1VESA 2G3XA 4QYOA 5JORB 4K3JH 4IS6A 1WIOA 1DSFH 5T1LD 4P48A 4PP1C 4YDJB 5BW7C 4OF0A 4RWHA 2JVUA 1E9QA 4E42B 3OQRA 4NDMB 3I3EA 2VZUA 4KJWD 1G9NL 1MCLA 1MEXH 4QTFA 2O61B 4XP5L 1FVEB 3AREB 2RBLA 3U1SH 1KTCA 4PRBA 3WSQH 2JI2A 4GAFB 1KTJA 3S88H 3TWCH 4PLKC 1JRHL 3OKOB 3OWRA 1OF0A 2ENPA 4KK6C 4JFFE 3US0A 2I26N 4N9GB 1SXBA 1T4WA 2XQYK 3D5OF 4NM4L 4EUPB 2B5IC 1UXWB 4KV5E 1QTPA 3B2VL 1FG2A 1L3NA 2YOAA 1ZDSA 2ADFL 4ZFOL 1OAXL 3T4AA 2DI7A 5GS3A 4QKXB 4WNSA 4MA3B 4Z77A 5E4EB 2H1LM 1TG8A 3DURA 3NEOA 3JWDC 1OE2A 1OK8A 4QIRA 4X6CF 1FFPB 5DRWA 1FNGA 3L8QA 4X5XA 4TNWK 3CXHK 4QRRD 5DK2B 2EECA 3GIVB 5DUMH 4LARL 1BVZA 4UB0L 3H2WA 4GP8B 4DN3L 2ORBH 3NGBC 1E2VA 5EO9B 5GGRA 4TVPD 2GUOB 3IJSB 1W0VA 4NO5A 4AJYV 3GD1C 3MNVB 5AKTA 3UEZA 1JGDB 2DIBA 3NIDE 1MVUB 2B4CC 3MLTB 4G42B 3VXRD 2ZOKA 4I9WD 1GYAA 3GHPA 1LYQA 4H5SB 4TOYH 3MLZL 2EIDA 4Y2DA 6FABH 2C9SA 4N3TA 2EXWC 3LX9A 4RAUB 3VYPA 4LOUD 1X9UA 3T6WA 1FIGH 1G9NC 3DTXB 4NZTH 5LGHL 4X6CA 3RZCD 1XD0A 1G0DA 2IFGA 2ARJA 3DMMA 5KJRL 2ZF9A 2JJTC 4TNFA 4LT7A 43C9B 4XAKD 3GF8A 1IGCH 3KWXA 2FIKA 3EOBA 5E2TH 3B7YA 5C0CE 3NIGF 2JJSC 1FYTB 3CPLB 3WN5B 4HT1L 1UQSA 5IF0B 2EC8A 5E03A 4FI7A 3KHQA 4R4BB 5JW3H 2R2BA 4F5CA 2ZOLB 3HZMB 4BQBA 2MPAH 1P7BA 3GHEH 3C6LB 3FO0H 2CIIB 3WTWA 2YSTA 4M3JA 4MZ3A 2F68X 4HS6B 3ECBB 5D1QD 5JUEH 2NY6B 4Z7QB 5G5DB 1CDYA 3DX8A 4P5KB 3SJVD 1I8IA 4DGWC 5FF6A 5KYYA 1I7RB 1EH9A 2BSCA 3D09A 3M46A 4MB1A 2R0LH 1FJ1A 3VMPA 1ML0A 5EU4A 1QSFA 3QUKA 4I4WB 1V8HA 4ZW6A 3EYSH 5FKPA 5L2KD 1ZK9A 5HYFA 5EB9A 3PDGA 2P45B 4YHIB 4L2LA 3ETSA 3FKUS 3II3A 3BXNB 3BEVB 4D7BA 3QZWB 4HISA 1DN0B 1KPVA 3O2WL 5HI4D 3MRQB 2X5PA 1E5ZA 4KO7A 4WAFA 2C9PA 1YNLL 4E41E 2GK0B 4X7CC 1ZV9A 1R0AL 4UQIM 4NZJA 1JHKL 2CO4A 2FEEI 3SZ6A 1RV6X 4O2EA 1VZGA 2XPZA 3RBGA 4Q9QH 4Z0BH 1ZIBA 4MJID 1J86A 5AVWB 3RWEB 4D8PB 5DHVA 5AKRA 3DIFB 4OVUA 3UO1H 2VLKE 4AWJC 3KDMA 1CU4H 1BOGB 2W88A 3CFDA 1MDAA 3GMMB 4XPBH 5HDBB 4HIJA 4FS0A 5GGVY 5A3IC 3AJ7A 3DA0A 4WJG3 1C5DB 1YN6A 2VMCA 1CGTA 1XR9A 2D2CC 1TYEB 2PF6A 5DDHA 3LV3A 5DVPA 4U2ZA 1OB1A 3CSBA 3VWKD 1NFIB 2XA8L 4I8DA 4FA8A 3LKRA 1P4LB 3M1OA 1DQLH 1XH2A 5IFAH 5E9DE 2N7AA 5FGBC 1E67A 2OR9L 5I73B 5D6DC 1JZ4A 3EYOB 4QXGL 2CRZA 4IK6A 3CWGA 3TBVB 1GC1H 5TDNA 3FPXA 4AMKL 2PWHA 3SGDH 2GW5A 4DN4H 4Q0XH 1J0IA 2WZ6A 5GHWH 1AIZA 1NEZB 2IQAA 5BO1H 2H5UA 1BM7A 4XNQA 1CLCA 5FPIA 1L9PA 2CUMA 1F3RB 5DSCA 5IQ9B 1PD6A 3AS1A 1JZ6A 4N24A 4UM8B 4ZDHA 1FZKB 5F6IC 4HU8A 3ZT5A 4TQPA 4HPOH 4TVPH 4JO8A 4D8OA 1OM9A 1WITA 3C75A 5CINL 2Q7YB 3MODL 1NQBA 3RI5F 4LNRA 4MA7H 4N0YH 4Z23A 5CP7B 2QVKA 3GXPA 4XMKL 1EEYB 2A4CA 2AJXL 2AK4E 4EZKA 3KGTA 1BLNA 5E0QA 3MBWA 3GM0A 1UUNA 1AXTL 1GOFA 2ZUVA 1FNFA 5C9KA 5ALBL 3QEGH 4ZNEA 3MRDB 5J8OA 4NXKA 3ML8A 1FNSL 2R27A 5JXEC 2V7NB 3VRJB 1F4HA 5H2BB 3WJJA 2BK8A 1UZ6E 4WW1B 4EE2A 5IQNA 3DRTB 3CE1A 1AI1L 4ZXBC 3MGAA 4IJ3B 4LIQL 4X98B 1XCXA 1F90L 4AV4A 4LBEA 4F2EA 4Z6AT 5A16B 2AK1L 4NNYA 1KCRL 3TU6A 4F3FB 2VDRH 1ZT7A 1UVQB 2YRLA 3EOAB 4H26A 3CHRA 2X6BA 4WRLA 3T6QC 1HQRB 5B7MA 3H9ZA 1OGAD 4X7TA 1GAFL 4NN6C 3BT0A 4YLCA 2WTOA 2VDLL 1IJNA 1P9MC 1QYGH 2P46B 3GIZH 4B50A 3FO1B 1I1YB 1OKEA 5B22A 3AXIA 2GSIB 2XWDA 1BBDL 4NQCA 1GSKA 5IB5A 1TLMA 4MNQE 5DMJB 2DYPA 1FNLA 1CBJA 4GUPB 1JPSH 2J8OA 4XVTH 3BAJA 4KNSA 3GLDA 4GXFA 2J6EA 3ECWA 1A02N 3CQPA 3GGWB 4HZLA 4JFEA 1JHTA 2XACC 3FFCE 4G3YL 5EDXA 3OR7A 2BNQE 3VI3E 3PAYA 3NZUA 2CO7B 5E00A 4EQ3A 2HN7A 4MCYB 3RI5K 4AENB 4PAZA 3VWJD 1BSIA 4K8RD 1PG7H 1NCOA 2VLJE 5F7UA 1FAIH 1T1YB 4PG9B 2B0SL 4P49A 4K7PH 1F97A 1IEAB 4RX4A 3SO5A 4JFUA 3AWFA 4PEEA 5GRJH 3SOBH 2CDGB 1PX4A 2FBOJ 3V0WH 4YL9A 1KYOK 4JCWA 3HJEA 1G7PB 1NSNL 4Q6YA 5E6UB 1NCWH 4HX1B 3DV6A 3ZBMA 3FHQA 4MAYC 2H26A 4PSPA 3EO1B 3ALXA 5DO8A 5A2AA 3RGBA 3HNSL 5FYKL 5F7NC 2CUHA 1WGOA 4QJ5B 2XFXB 3U2SB 3UJTL 3MR9B 1BXXA 3TC9A 5MI0B 1OT4A 2CGZA 4GO6B 2B77A 2F8VA 3LN4B 1G7LA 1ZGLA 5C09B 3C12A 2JKRM 1K5NB 1JGEB 1N4XL 3EFOA 1UJ3C 3IETA 2J8UE 1NL0L 3GB7B 4K0OA 4ZTPL 4H25A 3TN0C 1WC7B 1RIUL 3ZDXE 4OLEA 5LN4A 4XCFH 1XZ0A 2HT3C 4YHPA 5J5EA 3MV11 3NN8A 2A77L 1KGCD 3GMRB 4PJGB 2FWOA 1JZDC 4LPXA 1XGTB 3HR5B 1GJUA 5CUSH 4KKZA 5BRZD 4LL9A 3UABA 1OD7A 4DVRL 1BMWA 1D6VH 1BXVA 2IBZY 4N8PA 5CU9A 3ZMRA 5IGXL 4U3CA 3ARFC 2B59B 1PS3A 3IFPA 4H88H 4OZHB 3RWEA 1INDL 4UT7H 3INUH 5AL0A 4N25A 5F0LB 2FX7L 2ZOOA 3IFOB 3MLUH 5FO8B 4NM8H 4L8DA 1E5UI 1TFHA 1KIRB 1RKRA 1WICA 2C1PB 4R7LA 3HMXH 5DK0B 5IUCA 3L1EA 3QUMA 3X3FL 1QFPA 2QDVA 1HYSC 2AJSL 2WKOF 1GZQB 3K2IA 2NY0D 3NCYP 2HX9A 2EH7L 4GMSH 4YX2H 2B1HH 2GJ6E 1UM6L 3HC0B 3HKZA 3V5DB 2IDSA 3S5LA 3CVHL 2J7LA 4UILL 4DSYA 4BFNA 2WQAA 2R2HA 3QR0A 5FKAA 2X89D 3CC1A 4MMYB 2MHAB 3R8BB 4F2MA 3QRGH 1H3GA 3LQMA 1UM5L 4OCNC 4C47A 4LSRL 4LSPL 2IV8A 5A2KH 2I9LA 4NNXA 5CHNA 2Y0SA 4KFZC 3FH7A 3NJVA 1TIUA 4XO9A 4P9HL 4KNUA 3VXSB 1RUKH 3BZFA 1MPAH 1E6JH 1XIWB 3LYRA 4AK1A 3DK2A 1DHKA 4KTEH 4PV9B 2VDQH 4EDWH 1H8LA 2K8MA 4RMBA 5C08B 4DNLA 2V2TB 1X5FA 3ARED 2WKOA 3CSYB 1EZLA 1CK0L 2PNDA 4NYLA 1BVKB 2J72A 2CDEB 2PPEA 5EU7E 4WU5A 4E9WA 3BP5A 3DVIA 4MNGB 3UADA 2ZWZA 3MCLL 3MX0B 1Z3GL 3HZKA 1NBVH 1D5IH 3UJJL 5E56A 3PRZA 1GZPA 3H42H 5A2IH 4YSUA 2VDPB 3SDAB 5KS9A 5ICZA 3QJUB 4PJDE 3W57A 5GSVB 4LAQL 1D7FA 4KZCA 4MCMA 5F9DC 2OMWA 2CG9X 4HJJL 5F7HA 3TNMA 3SBPA 4X6BA 3FB8B 3D18A 2AEWA 5HYJB 3VFRA 1LXMA 1DVFC 2XV3A 4IOSD 2IIJA 4HAGA 3CHQA 3T65B 3ZL4L 2IGFL 2V17L 4K8RH 4HJIA 1X5LA 1NBYB 4GI9A 5FGCE 3ZUNC 1E3XA 5I1LB 5FB8A 1I8LC 4LRNH 3L4XA 3UPRA 3BAEL 2K7PA 3KNBA 1I82A 2NCEA 3S48A 2PR9A 5I2IB 3QS2A 3C87A 4WWID 2APWA 3HE7C 1VACA 5AG9A 3A4EA 4HV8A 4W70A 5IJKC 3KJ4B 4NRYB 4FGMA 1OE3A 4UOW0 3K6SA 4P9HC 2F1EA 2Y7QA 4N90D 4ODWB 4MGXA 2O6FA 4QXVA 2W07A 5GGSB 1D5ZA 4Z3HA 5F7AA 3TCLA 1F6AA 1IT9H 1T80A 1MRFH 3HHMA 4ODUB 4PRHA 5DEFB 1RJLA 2F5AL 1M42A 3C60A 2UZYA 2XDHA 1F4XL 3RA7H 2QVMA 1U3YA 1UACH 3ROOB 1I85C 1FO0B 2IJ0C 3MLRH 3QG6B 4WI0B 3T6ZA 3GMPB 1SDDA 1V27A 3B9KC 2VZ3A 5B39G 3NJNA 3MJ7B 5BV7B 2YA1A 1QKZH 1QZ1A 4P2RA 5ACZA 1FYTD 4G8GA 3SKOA 1SEBA 3L2LA 3LZRA 4R90L 2JF1A 3VFTB 3Q06A 3L9BA 1KEML 2Z7UA 5FM5M 4H0IA 3HI6H 4P99A 2AERT 1JVOA 3SO3B 3GYRA 4G1EA 1NANI 4M61B 2DV6A 3C6LD 2QPDB 1I1AC 5EWIH 1ZTXE 2Z93A 4ZSOE 1MHEB 4EO5A 3NZHL 2C9AA 2F8OA 4NC2B 1CE1H 3FUEA 2VLME 4IGBC 1A3LH 3KJ6H 2NY6D 4N9OB 2A38A 5HYIA 4NRZB 4PJEF 2D3VA 3JYCA 1F11B 3L9RA 1RZPA 4LVHB 1WUZA 5DQDH 5JOEA 3B8YA 3FSVA 1JSYA 1YC7A 1CD1B 2G9HA 2VRAA 3CX5K 2GUYA 1T5WB 5AFAA 5DJ6A 2CHXA 3PWLB 3GUTA 3UIYA 1PZSA 2P5PA 1PSKL 5AWNH 5BCAA 4DP2X 3QEQE 1WUNT 1QG3A 3QZMA 4OZGB 5HJBA 4C56B 3DVGB 4M5TA 4NP4L 1S9XB 1Q9OB 2VLRD 3BQUB 4PGEB 1SVBA 2IWKA 4W6WB 4XAWH 4FQ1H 1O7SA 3MROB 1QHOA 4XRCA 4PJAB 4JS7A 3KYOB 2VSKB 3FRUB 3D2UB 5E7BA 5LQBH 1CVRA 2VLLB 3LKNB 4IBSA 4PUBL 4V33A 4F58L 3NSXA 5JIMA 4PRDA 2VWEE 4ZAKB 2Z92B 1FUNA 4R2GC 2NNCA 3VXMB 1T0OA 2AEQL 4O02H 3O41B 3RWHA 3SQOL 3D08A 1A47A 4XN1A 1R5VB 1G7HB 3BDBA 2VJXA 4B9FA 2XTJB 1HE7A 4Y1SA 1XH3B 3MBXL 3AUVA 1QUPA 2DZEA 4HS8H 4JG5A 2BM3A 3EYFA 5HHME 3V5HA 5KSBE 3QNYB 5CJBA 4LASL 4Z7WE 3G9AB 3MCKB 4XPFL 4WFFD 4ELKB 2H3NB 5K5YA 5A2BA 3QH3A 2X4RB 5G4NA 2MQ0A 5B21A 2KPWA 2P3YA 2EQDA 2R7EB 4M9PA 1P5UA 4EUPH 1GZHC 5BUAA 5D1XB 3IK2A 1JWUA 1U8LB 4UOW1 3VXUB 1L0QA 3F7VA 1U3JA 2Y1YA 1RK1B 3DPBA 1UWYA 2FDBP 2CLVA 4DGIH 3N43B 3O8XC 5EBWB 1C5BL 1KGUA 3MOBL 5IVNA 1MCDA 1NPNA 5DJCB 4P3DB 5I1AB 2EEFA 1D5MB 4YUEL 1CB4A 3TVMC 4DVBA 2W8CA 1RFDH 5T1LA 4F33B 2O26U 1I3GH 4U7KA 4Q2ZB 2ZXCA 1K3ZA 3IFNH 5J56B 3RL2A 1SXAA 3GMLA 2ZPKH 3LSOA 4JQXC 2FT7A 1WAAE 4KKLC 4GQ9H 1ICTA 2F19L 3D4CA 4FQIH 1LEKB 3IXAA 4HOZA 2OBGA 5JNYA 1C5CH 3IMWA 2FUTA 5DK3A 3RY4A 4E9VA 2ED6A 1DBMH 5EHFA 4BGDA 2X10A 2F7RA 3IJHA 3D48R 2H7WA 4PW3A 2BFVH 4ZFGL 1F6FB 1W16A 2NCMA 4TV3A 1R3LB 4RMVA 4DCQB 1QABA 5FDYA 4WK0B 4NC1E 3EO9L 3KLAB 5DMYA 5IJCC 3WFDL 3V4UH 1PTZA 2HKHL 4JKLA 4M7ZC 4XXDA 2HVJA 1PDKB 3V4PA 1JZEA 1FSKC 3NZ8B 1U8QB 2AXJA 3A6CH 3E7JA 1XD1A 2W38A 3NP4A 4DEPC 3REVB 4IBTA 4NEHB 2DM7A 2SEBB 2EVIA 1PL3A 4D0DB 5JOPD 2HFGL 5TK2A 4NFCA 1R3IH 4MSWB 1ITBB 2XXMB 4JDTH 3T1FB 5FIEA 3VFMA 1BZEA 1MUJA 4GAGH 4XVSH 3QULB 3JWNE 3OR6A 1E4XI 2JELH 1AIFA 1RZIB 1T83A 2DQHH 4OFDA 4DZ8A 3G5ZB 3VXRA 4F15B 3CC5B 4RFOL 4DO5A 4FXLA 2I25N 3KVQA 2ZJSH 2CKBB 5EBMA 5AD0A 5JHDB 5EUOB 3D9AH 4HPHA 5DYOB 5HDQL 1LK2A 4HXBL 1MCKA 1I4FA 1E3ZA 1H8SA 3L4YA 4GSDH 4YBQC 3FCTB 4GXVL 2UZIH 1Y18A 3BO8A 4FFZH 2WVUA 5IHHA 3PU7A 4MS8C 5B1JA 4Y19E 4RGMC 1MOEA 2GITA 5C1MB 3WEAA 4Y1TA 3O6FA 2P1YA 3GI8H 5C9JB 4G80A 2O72A 3O2DA 3N40P 4JB9H 2DL2A 4XMUA 2DAVA 2J6WA 5FA4B 3QIWC 2DW5A 4M1GL 4OT1H 3TYGL 5EIIB 4WFHE 2CLZB 3QI9B 5F7EH 2RJMA 4GG6B 2MPVA 4PB9L 3WI9A 4C83A 1FWXA 3ULUE 1RVFH 2F58L 4PHXA 5J6HB 2WUBH 2PO6A 1MZZA 1ZOXA 4GRWB 4YDVA 1THCA 2FQFA 1K8DB 2ZT9C 4HCRH 5I8KH 2Y4SA 1SHSA 5IEKB 5E2UH 2A6KA 2PWGA 3DXAA 3IJYB 4I3SH 2DQ6A 1QI4A 4P4KA 3TT1L 2ZSVA 2AEIT 3C08H 4UYPA 3SJVA 2UXVA 2X3CA 2FX9H 2FIRT 3R06A 3WENA 4L37A 1DEDA 3ZN6A 5TF1L 1ZHBA 3FT4A 1BLIA 4J3OD 1RUAH 1GGTA 2ZCLH 2F6AA 1QNIA 2ZP0T 2CK2A 3L3KA 4I9XA 2XNAB 2X2JA 4FQ2H 4WTWA 1J8HB 2BDNL 3VFPA 1XF5A 4YPJA 3LS4H 4H8VA 5JIIA 5GSRA 1N5YH 4J12A 3OPZH 2WXLA 2JI3A 2G2RB 5C09D 4KXAA 5TK4A 4NQUA 3PUCA 4CMHC 5CILL 2WYIA 3QJVB 4OTXH 3U4EB 1CPUA 2I07B 5DD0H 4Q6IB 2IPTH 3POCA 3KGRA 4KI5E 3MBEA 5FOBA 4MJIA 3T5WA 3RX7A 3ZRCC 4P0DA 5DS1A 3LNFA 4AQ8C 1RZQA 5TFSL 3RVVD 3A21A 4MB3A 2ALWA 5GRXG 5AAWA 3X13A 3K2UL 5EZJA 5IMLB 3H6AA 5FUZL 2W9DH 5AKVA 3QQDB 1J1XH 3LEVH 1RZFL 3Q2NA 5F1OB 3VWKA 3MYJB 3IJEB 1AHWB 1DDHB 3RVXC 2KKQA 2APVA 3GSQB 3K4AA 3II2A 4AQOA 2EVGA 3QWRD 4IU2A 5GS1A 2P8MA 4CW1B 4LDCA 2ZWNA 3DRQA 4YJZL 4LVOC 4YHKH 5I18L 3GSWA 3EJUA 1PY9A 1I7UB 3QA3B 4P3CH 5KVFL 4RQQB 3SHSA 3U9WA 3BAWA 3OC5A 1KCUL 3MRIA 2MCG1 4CJ1A 2J1KA 5IHUL 2R0ZH 2X4SA 1D3CA 2MTAA 4W68A 1VZHA 5CD5C 1PEZA 1TJIH 3L1GA 1QBBA 4LCWB 4Z7UE 4DP8X 1C8PA 3FB5A 3QDAA 4HQQH 3LB6D 1T03H 1WYJA 2B3RA 5HD8C 3GSNL 3P4LA 4PY8I 3SPVB 3BWUF 5B4MD 2PR4H 3CFKB 3L4UA 4JHVA 3IYLW 1L0PA 2EEDA 4KI1A 4M93C 1A7OH 4IOFD 3DETD 1E4KA 2ID5A 2MIZA 2VDMH 3QIBB 3VXSD 3JXAA 1XIWD 1O6TA 2GY5A 3MFFA 2D31B 3KAAA 1ZVHA 4Y5YB 2FAUA 3DX7A 4BZ1A 4GFTB 5C08D 4WHCA 3FUJA 2HXAA 3F85A 1DO5A 1QFWL 1A4KB 1MFAL 4FD0A 4OI7A 3C8KB 3VRLF 2P8PB 4XX1E 3J8F7 3NIFB 4KRLB 3L6FB 2WO3B 3TPUA 4G70B 4BKLB 4MB4A 4JHZA 5DZ9A 1PNDA 2XBTA 1JPEA 2RALA 4KK5D 4XOCA 3SODB 4CKQA 2WWKT 3MUGA 4PMEA 4Y1AB 1HAUA 4HGWA 4ZMYA 1EHLL 1U8PB 4AK2A 5K9OB 1J8RA 3RJOA 3SDAD 1JK9B 4LLMA 1WT5C 1V5JA 4KOCA 4YDZA 2LHAA 1BZDA 1NAML 2J44A 5EA0H 5HYJD 4FFWC 2BRRL 3MLYH 3T0EE 2AI0L 4ABWA 5KG9A 2J55A 3FULA 4PGZA 4HUCA 2W0PA 3MO1B 1OGAA 4ZD3L 2X2HA 2XV6B 5E8OB 3RL1A 5D96B 3N2JA 5D1ZB 1JPGB 4GSRA 3RE0A 3BT2L 4UDTB 3GI9H 2VXVL 5CZRA 3FQUB 1H5BB 2IADB 3SYOA 2WO2B 3QUYA 2BP0A 4LDLB 4NI6A 1LQSR 3PGDB 1SN5A 4I18C 1IILE 3P4NB 4D3CL 2H45A 5DQJB 2JKSA 2WUCH 2YUWA 4FZ8L 1YDPB 3RVTD 1I7TB 3X3GH 5AZ2H 4QRQA 4NSKA 2ZKYA 1F58H 4YVUA 2A9NL 4MB5A 3G6DL 4QRTB 3KPSE 3ARSA 3ENEA 3VWJA 1WH0A 4WTZG 5D2NB 3VW3L 2CO1A 2IBBA 2CDFB 4LLWA 1KGWA 2FECL 3C5ZB 1UWEL 3HS9A 3GK8H 2AKRA 5E08L 3WLBA 1XQ4A 3BPLB 5AZEH 3SPHA 1D9KB 1EJ8A 1L3WA 5IOKA 3ARGB 3MUZ1 2IMMA 1Z66A 4OLYH 3GNMH 5H37A 2OMBA 5K39A 4EN2A 5IQ7H 5IVXB 3ZE1F 1KBGL 2IOMA 2B2XH 2J25A 4UBDC 5CEXB 1MFBH 3QHZL 1HYRC 2VJ0A 5CP3H 2DBLL 4FQPA 4DUXA 3QJQB 4LFHD 4WJ5B 2XQYG 1BW8A 1GJWA 3A4DA 4UIKL 5CIPB 2D73A 3D33A 2Z8RA 1N6QL 3VGFA 1RAMA 5I8OL 5JMOC 1U8OB 1RUMH 4D0BA 4HWBH 3B2UD 3MC0A 3T71A 4JFXB 5CWSA 4YE4L 1SHXA 5ID0B 2R83A 2EACA 4OLZL 1HH9A 1H3PH 5SX4I 3D2TA 1KPUB 1Z9NA 2IXQA 5FHBL 5F71A 2J20A 1QO3B 2PABA 4N26A 3OLGA 3LKOB 2RCSH 3TO4B 1YUHA 1YPZE 3BQUD 1JVLA 4K4KA 5CD3B 3CMOH 5T3ZL 1PU0A 4W81A 1YY9D 2WMPA 1OPGL 5HVHB 4ZUUB 4I1RA 3D2UD 4XMPL 3EYVA 1PLGL 2WXQA 3DVNB 4GEIA 2X12A 3SKNA 2ZWYA 3IDIB 2DLGA 2IAAC 4JFFB 3RTQC 1SEQL 4ZAKD 1KBWA 1S4IA 2AW2A 5IT2H 4WV1C 3VXMD 2X53A 2JKTM 2CNZA 2EKJA 1CL7H 2E9GA 2J8HA 4RAVB 3OHXA 1J9QA 4OIIL 1L9MA 1PLBA 2XTJD 3NAAH 5JIQA 5EOCJ 1GIGL 2DKSA 1IEBA 1KG0B 2FGWL 4MJ5A 3V8OA 1YMME 1YVLA 3L5WA 4Z3IA 2PTTA 5GQBA 1UXSB 4G8EA 1QEXA 2O5XH 1OCRB 4A7UA 3JTTA 5KVGE 3MRGB 2DM3A 5D1XD 3EADA 2X89A 3SYAA 4TSAH 3VXUD 2JJSA 3DGGA 1SMDA 2HLEB 2P43B 4ZFOA 2YPKB 4MQ7B 3I3DA 4GIOA 3FQWB 1UYWH 3LH9A 3KM2A 2K6YA 2VDPH 3C5SA 2KQNA 3K4DA 3NIDB 5IBUB 3P9MA 5GRYA 3GS7A 1KV3A 2AEPL 3BD4A 2W0FB 1TJXA 5DRNB 4YDJA 2OFQA 4KTGA 1DQQB 5I6OA 4B96A 5DVOA 1M3JA 4NDMA 4N0RA 4V1DE 1NGPH 2JCCE 2WANA 1II4E 4WENB 1RMFH 1FVEA 5KVDH 3AREA 3KXFE 2XPGB 1ZAGA 4U4BA 3UX9B 1MJUL 2D4FA 3OKOA 4QI3A 5J1TC 2A74C 4Z7AA 3DLQR 4HXAL 4N9GA 1KWGA 3WFCL 1HIMH 4EUPA 1MCOH 1UXWA 1F02I 2PKDA 4PJXB 1CGXA 1ZS8A 4LQFL 3U9PH 4AIOA 1TPXC 1TTBA 4Y5VC 4MA3A 4OZFB 4H2CA 3Q7JA 5KSAB 2OPCA 5GS0D 1AP2B 2V3EA 3DSFL 1IRAY 4JO4L 1GGCH 4G6JH 3NH7H 1EANA 3UGUA 2P5WE 2CRIA 1ETZB 2ATKA 1C1EH 4QHUA 1N9PA 3A4FA 3D3VB 4IOSA 3TCTA 2E6JA 5ABZA 4TTGA 3DUUB 2DICA 5E23A 5EO9A 3T2QA 5F1KC 1KYAA 1P0SE 5E24E 2XZQH 2GUOA 3IJSA 2WCSA 5AVVB 2OZ4H 3SKMB 3APNA 3LZPA 1G9ML 5KBLA 1GYUA 4BZYA 4XOEA 3IN0A 5EMYA 3NJHA 3NK3A 4HPYH 1J0HA 1MVUA 1IKFH 4H8WL 2BSDA 1NLBL 1T89A 4H5SA 3B56A 2ZXWB 1BVNT 3WHXB 5JHDD 4EVNB 1Y0LA 4RAUA 5FEBA 2A1WH 4NRXB 2FATH 4PR5B 2F5BH 3DTXA 1SUJA 1UEYA 4Z7QF 4XMLH 1U4FA 1BAFL 1KXQA 2O93L 3T08A 3VFWB 3NTCH 3GZPA 1JNHB 4M56A 1ADQL 43C9A 1FGNH 3PAZA 3S0PA 2XVKA 1IC4H 1KIPB 1FYTA 1GY1A 3CPLA 3P77B 3WN5A 3EYQC 3MXWH 3L54A 3VTMA 5IF0A 1Q9KB 2VLKB 3MV7A 2YBRA 4BUQA 3CDFA 1M6UA 4LLAA 4R4BA 1B0WA 3QI9D 2ZOLA 3HZMA 1Q1JL 4XXWC 5E2VH 2ATAA 1YEKH 4PI2A 3C6LA 4OF6A 2IPKB 3PAUA 5I1CL 4JM4L 2CIIA 4K94L 4FTVB 5E0FA 4XVJH 4I77L 3Q1SL 3UPAA 1QNZH 3WD5H 1GYVA 3T0AA 3U2IA 4EKXA 5ABAA 3HC4H 4TLTA 2XWXA 1XB6A 5G5DA 1KCBA 3A5VA 5JPNC 3QAZC 4P5KA 2N7BA 3QRLA 4ZW8A 4B9YA 5IW6B 1G9MC 2ZYRA 2WWMC 3IJ9A 4W9ZA 5HDBF 5E9DB 4H8WC 3H7BB 4N8UA 3BSGA 1AOHA 3L5IA 4FZEL 1E3FA 4I4WA 4H2AA 4L5FH 1OO2A 1TQTA 2MH4A 3CPUA 1FFRA 1NWOA 2OYKA 2X6CA 4PYHA 1KCVH 3U7AA 1UWGH 3PY9A 2PWDA 1J8HD 4TRPH 3BXNA 4ZS7H 1E90A 4HU2A 1DN0A 2Y3NA 2VZTA 2VLRA 1LO3L 3BGFB 2EIMB 3FF8A 3NRQA 4JCLA 4CSSA 2GKIA 1JGVH 3VFOB 2WYHA 4OCMC 4X4ZA 4DZBB 3T1WA 1K85A 4APQB 2EYRB 2GK0A 3L48A 1NKRA 2WN2A 4U1MA 4Z7VE 1HXYB 2E6QA 1QUNB 3MV9E 4FXKB 4F7PA 1N0XH 3IXTA 4GRLC 3SZKC 1CGSH 1N59B 2BHYA 3AROA 1INEH 2G60L 3B83A 4NQXB 2OM5A 4QOKB 4U4IA 1KNOB 4D8PA 2D3NA 3GMMA 2CJTA 1Z5LB 2BVQA 4TTDD 3ESMA 4NKMB 3VFVA 3R4RA 3T2NH 3BZDA 3VJ6B 4K94C 4NKDA 4HVBA 5I1EH 1NCTA 3ZHNA 2Y72A 1RU9H 4J3VA 5IWLA 2D3LA 2AQRA 3NYKA 1URZA 3ILEA 5IROD 2O6DA 2Z8WC 4MAUH 2ISDA 3DI2B 1OIOA 2JIXB 1A4JB 1P4LA 2DOCA 2ZIDA 4X4MA 4EOWH 5DEGB 3CCHB 3OKNB 5FYLE 1V7NH 4JVPA 4HJUA 5IB1B 1BQRA 3UL4A 3D1MC 5E5MB 1RJZB 3EYOA 1MCEA 2FJHA 3NFNB 4AZ8B 3TBVA 1DJHA 1ET5A 1EBAA 4KDTC 2C5DC 2NMSA 5DLLA 3VVWA 2VABB 1NEZA 4LCWD 3BLBA 3HNVH 5IQ9A 4UM8A 1J05B 4C4UA 2D9CA 3VXNB 2H32B 1DCEA 1HN1A 2E3VA 1JYWA 1OW0A 3U9UB 2R9HC 4JM2B 4PJ9B 2YEVB 2Q7YA 1SOQA 4OKVB 4AUUA 4RMSA 3B5TA 3QQNA 2AAAA 3QIBD 1XSOA 5CP7A 1LO0H 2NY5L 4JGJA 4NZRH 3WIIH 2F54A 4E9QA 1EEYA 3FFCB 4YSCA 3RWFA 1UH3A 3RWGB 4P9MH 4R7XA 4UINH 3VI3B 2MCPH 1T04A 2G0KA 2YAHA 4WZ9A 4D9RD 3T3MF 3L3OC 4NWUH 4XNYL 4XCYA 4M6NH 2IDQA 2OL3L 2O5ZH 1S7VA 3MRDA 1UTDA 2VLJB 2V7NA 1XTMA 1KJ3L 4OI8A 5H2BA 1HEHC 3MRFB 4JUTA 4WW1A 4Y1AD 5I0WA 3MJ9L 3DRTA 3IJ7A 4J27A 4NBXB 2VAJA 3KR3H 3GZOA 4MFHA 5A16A 3NABL 4N22A 1UT1A 3MUY1 4MMZC 3EJZD 4X9BA 1L0YA 2GT9B 5L7XL 2O5YH 4F3FA 1AYOA 3ABMB 1UVQA 3WLWC 1Q94B 2MKWA 2NNFA 3DGDA 3EOAA 5I5JA 2XKSA 2VC2B 4KU1A 1VCBC 2XKUA 1KZQA 1S78C 2H4EA 5KW9L 4EPSA 4LSTH 5D1ZD 1HI6A 3ARFA 5D7LE 2EIJB 3DSNB 3FO1A 1W9XA 1I1YA 3H55A 4JFPB 3P30H 2BFGA 3H9SB 3RP1A 2E9JA 3SBWA 2XPYA 4UIMB 5GGRY 2ZUXA 4F8LA 2H1PH 4FFVD 1DJXA 3HBQA 4ACTA 3O4OB 4GUPA 4L4JA 5D70L 1MFCL 5E70A 4P23B 2J8UB 4R4FH 1KJMB 3AXLB 3ZDXB 2D7TH 3A23A 5F7YC 4J3OF 1FLRL 3V4VB 4OIFA 2CXKA 4WFGE 2NY5C 3STZB 4AYFB 5CF3A 5F6IB 1A0QL 2EIKB 1E2ZA 1LILA 3TO2B 1YEDA 3QXDA 4O5LH 3ARBB 4BK4A 4ETQB 2UV3A 3WFZA 1KJ2L 2CO7A 3NJGA 1OSPL 1JRHI 2F9BT 4MCYA 4AENA 4G5ZH 4DH2A 4JPKH 4WY7H 4D0CB 2ZKWA 1ND0B 1OCWL 3C5ZD 4PG9A 5GGUB 1AGEB 5AVUB 2ZD0A 3NG5A 1IEAA 5DUPL 2E7MA 2DWDB 4TSBH 5I74C 2CDGA 1D9KD 5ALCL 5DGRA 3VXOA 1EGJH 3ARGD 3AXHA 3D6GA 2Q1EA 3N40F 3D4ZA 5I1DA 3KWTA 2CM5A 3JV4A 3NA4A 1U3NA 1YQVL 1G7PA 4PJGF 3KVDD 3OG4B 5E2JA 1VADA 2WCGA 4ZXBB 3GRWH 3EO1A 4OCWH 3FN0H 3GM8A 3S5LG 4WFED 4IRSB 4S1RH 2ZAHA 2XFXA 3U2SA 3L4TA 2GJ6B 3MR9A 4YK4C 3ATDA 2MJWA 4NKIL 4OZHF 2K9UA 3IMTA 4K3EL 2ZUQC 2OMYB 5BZDB 1EJOL 4MJ6B 3SDYH 4OLUH 5LNDA 1JPTL 1A6ZB 4H0LC 5E4OA 1IC7L 4NENB 1L5GA 3GB7A 1TZHA 4JO2H 3EUDA 2EYSA 1AXSB 1MHHA 1UWXH 4G7VL 3L1OH 1URIA 3GMRA 2DMGA 2X6UA 3IWVA 3L3DA 4PJGA 3TO4D 2DLHA 1T2QL 2ITEA 4M7LH 2VSCA 4TF4A 1XGTA 2YZ8A 3HR5A 3V6OE 3WMQA 4AV5A 2WOBA 1QPKA 5CU5A 4LEXH 3ZL2A 5FCUL 3PPSA 1ACXA 4UMGA 2NXZB 3PWNB 2OK0L 4P57B 4Q9RL 1I8LA 1RZ7L 1FAKT 2Y5QA 3TA3C 1W72L 2IANE 1WZ1H 3BCFA 4RGOH 1KTBA 5ILTL 4A6YB 2B59A 3BHBB 5T33L 2C3VB 1E40A 2A9AA 2Z7WA 4OZHA 3OB8A 4JFFD 1TZ8A 3G6JE 3RFZC 1AXIB 3RBSA 4F92B 4IMKC 4OD1H 5FO8A 2ZXAA 3L4VA 4FFTA 3WE1A 5AVSB 1KIRA 1NC4A 2Y2YA 3QWRA 2C1PA 4JJ5B 4PJDB 5DK0A 3V0IA 3POHA 1BMGA 3VD5A 2ZNXA 5LKNA 2QDWA 5INDB 5IHLB 5I66B 3ARDB 3OKYA 1NLDH 1GZQA 3CAFA 4G6ML 3HC0A 1I85A 1KXVA 1GGBL 3RB5A 3V5DA 4N5UA 3QCTL 1KLFA 3FTYA 4L3CB 3MKKA 5GISL 4B9ZA 4WJKB 5FGCB 1Y6KR 3SYQA 4NS0A 1AYRA 1CFVH 1BHGA 1QR4A 2MHAA 2NY2B 1CDIA 4PLOB 2NNAB 4JBSA 4MQSB 5C6PB 4LLDB 3EUUA 1L0XA 2AEOA 3RX8A 5JYLA 1CTMA 1JFQL 1V7ML 2BWDA 3QJTB 5TE6H 5AYQA 3VXSA 4Y4KD 3PDOA 5E51A 4TYUA 4ELME 2IWFA 1IC5H 1DSWA 1PNCA 3K8MA 4IGBA 2C3XA 1CFNB 4R4ND 3CSYA 4N0UE 5GRVL 1BEYL 3FTUA 4NUGL 4YZFF 2CDEA 5IMKB 3GMOB 4MNGA 3RKDD 3VG9C 4LKXB 3MX0A 4HLZG 4ACPA 5CJXC 4UZGA 1N67A 4X5LA 1D6EB 3HN3A 1Z0NA 9PCYA 2YMXH 2AJYL 5KSAD 3R0MA 4LLYB 4JZNB 2HAZA 1XV8A 2YAEA 3AM8A 1A6TB 1NIDA 1INQB 4Z7OE 4OD2B 1YEWA 4E9RA 1P4IL 3ARQA 3FB8A 5ENWB 5FO2A 5HYJA 2XA3A 4ZSOB 4GBXC 3D3VD 1IM9A 4L8BA 1OGSA 1NBYA 2HFTA 5I1LA 1W0WB 3WFHB 4DKEL 4HUWB 4XR8C 1W8NA 5IREA 5IHZB 1VERA 2JB6A 3U6XA 5I2IA 1DYZA 3ES6A 2ADGB 2DJMA 1VGEH 3E1F1 3VDCA 3AT9A 3O6MH 1E4WL 4HJ0D 2WD0A 1WJ3A 3W82A 2HKFL 5K59F 1NGQL 2Q7AA 1UD5A 3UG5A 4M48L 4Z95L 4ODWA 1TTAA 5CN3A 2ICEB 4ZUWB 5GGSA 4ZUTB 1N64H 3BP4B 4IOIA 2Y9RT 5FGSA 3GXDA 4ODUA 1U8KB 2FX8L 3N85L 5DEFA 3D25A 4AQ1C 3IMUA 2VDOB 3LPWA 2UZXA 4RMQA 3ROOA 1FO0A 2R69H 3QG6A 4WI0A 1FVDA 4Z0XA 4Y4FC 2EKSB 1CGYA 4PS4H 3MJ7A 4APXA 4X5QA 2LW3A 3BUDA 4NJAH 3ZE2E 1KT2B 1QASA 4A1RA 1G1OA 2CGYA 4BA8A 2VLKD 4X8JB 1OSYA 2YZ1A 4N85A 5JPMB 3FC8A 4M03A 4O9HH 3TFKD 4M61A 4OV6F 5A1AA 2FYYB 1RZKL 1AZRA 3RWJB 3THMH 4FA6A 3CSTA 2DQEL 3G5VA 3PG2A 4FTVD 5IB4B 2Z0BA 2Q8AH 5GJSL 5HHMB 5KSBB 2ATPB 3O6KH 4Z7WB 3FBKA 1NCDH 4S0TD 2DYRB 4NRZA 3LRSB 1A7RH 2V9RA 2WWOA 5E9DD 4IYKA 1T1WB 3UACA 4LOVA 1IFGA 4QHMA 3PWLA 5GZOC 2QSCL 4TQIA 1J12A 1FORH 5IVZB 2E46A 3HE7B 1MJ8L 2YD1A 3B5HA 2W9EL 3OJ2C 4QRSB 4W9HC 5LBVA 1VFUA 2D2OA 5GGQL 4YSEA 1S9XA 3QEUB 1Q9OA 4S1SL 3BQUA 4N2EA 4HIHB 4XNUL 5DJ2A 3FTVA 3DX6B 4APQD 3MROA 4HJEA 3KYOA 2JKNA 4R5VA 1Z9SB 3FRUA 5DMIL 5F0MB 2NW2B 5F1NB 3D2UA 3CLWA 3FU6A 2VLLA 2QL1A 4QO1B 5IBTH 1RPUA 3PGFL 4ERSH 3STLB 4QOKD 1M7IB 2Z92A 1ZHLB 3EGDB 3LZFH 4L3EA 1R5IB 3L2NA 5I8EB 2WXGA 3HC3L 1R5VA 1G7HA 1P84K 4I0PC 5CAYB 1V3MA 1DQJB 1RZKC 5HPMB 1XH3A 2NZIA 4PV8B 1H0DA 4OM1L 1MRDH 1N0LB 5CN1A 5JW5B 3VD9A 4NUJA 3V79C 5EOQH 1JGLH 4QRBA 3TJHC 4DQOL 3MCKA 4OFIA 4Z3JA 5JHLA 5FV2A 1J88A 1QBAA 4JQIH 2JJVA 2ZSWB 4Y0GA 5HHOA 2HPTA 2JIXD 3QDJA 2R7EA 4YDLC 2BSTB 3OX8B 1U8LA 4IQHA 3VXUA 2HJLA 5TDOA 2QZQA 5KVEH 1RK1A 2GFBB 3I9PA 1KIUB 3UBHA 4GNKB 3EOYG 3EYUH 2HFFA 4FYRA 5B1CA 2BRQA 4OZFH 3LKQB 5D2LE 3DX3A 5SV3A 5SWZE 4A63A 5B8CC 2ADIB 5DJCA 1XF3B 4P3DA 5I1AA 1D5MA 2VERA 4JFVA 1MFEH 4QT5A 3P2DA 4JO1H 4IM8A 5BZWA 4F33A 3EGXA 2H2PC 4Q2ZA 3NJJA 3PP3H 1DLFH 1OAZH 5LXGH 15C8L 2KBGA 5TJWK 2Z9TA 4FNUA 1WF5A 1GOGA 2NUPB 1WZLA 2FGZA 5FUCC 1U2CA 4MNQD 2VO8A 4Y19B 3VI4E 1A2YB 4N87A 1LEKA 1MIEL 2R4SL 2XIIA 4JM2D 4PJ9D 1TEGA 3QJFB 2NYZA 2AV7B 3FT9A 1IGMH 5CEYA 4BIKA 5F3HB 2GSMB 4PGDB 3WEOA 1R3LA 4DCQA 2CSPA 3RNKB 5J1SC 3FO9B 5EUOF 1QACA 1DBBL 3PABB 3FFCD 3K7UA 3UROR 4FLQA 3KLAA 2BNQD 5IG7B 1IGFL 4YDMA 4JZOB 1TETL 2G5UA 2F1BA 3EBHA 1BXAA 3KVPA 3UMNA 1O0VA 1B2WL 1JNLL 1WE5A 2G3MA 4QNPE 2EZ0D 4M5SA 4BWUA 3ESPA 2HFEA 3RDTC 1PDKA 1NGYA 3AACA 2VLJD 3QQ3B 3BPNC 3ZXAC 3KHOA 1XGUB 3REVA 2XZCH 5AYUL 4D0DA 1K4CB 2BY0A 4TSCL 2V5SA 4MSWA 2NSMA 2ODHA 3HFFA 5MP6H 3T1FA 2E7HA 4BD4A 3QRFM 3PQYE 1U92B 3EJQA 2XWCA 5A2CA 3P11L 4FP8L 3QULA 3QXUA 3HUJE 3IF1B 3STBA 2IF7A 2Q8BH 1RZIA 5HGAB 1R1CA 4XI5C 4GG6F 3G5ZA 3I50L 3PV6B 3CC5A 4AQ8A 1WCBA 2F0CA 2CKBA 5CLZA 3KPOB 5ECGA 4GRWF 1AR1B 2AABL 5GGTL 4W9EC 5JHDA 2AGJH 5EUOA 4ALAL 5DYOA 1Z0MA 1IQWH 1BZ7B 3P2TA 5DQ9B 2EDMA 2YUXA 3KYNB 3SB3A 3EZJB 3FCTA 5F21B 1QSZA 3H9SD 3ULUL 3UOAB 3TIEB 4ISVB 1IZKA 4QRRE 1PFCA 4UQ2B 3HPLA 4HMDA 2HRPL 1P7QB 4P23D 3D06A 5I9QC 3HI1B 5C9JA 2NYYC 3B7TA 1XCQA 1LO2L 3G5XB 4HIEB 5FA4A 3ARBD 4FQXB 5EIIA 1JUFB 2YD8A 5E8PB 3V6BR 2CLZA 1L7TL 4BFRA 1VPOH 1WFOA 4GG6A 4DP7X 4MZ2A 4S1QL 1CDUA 4I3GA 5FUOH 1OB0A 3BH8B 3MJGX 1ZXKA 1K8DA 1RUPH 1KGJA 4UAHA 1NCIA 2ZP8A 3VG0L 3Q8EA 3SE3A 1PKQE 2YO3A 4JHAL 5JXED 4FI8A 1G6RB 2GAZB 2KMWA 3QJZA 4DEPB 5I6XB 1LDSA 3AMKA 5KSVB 3HS0A 3DECA 4NZ8A 1OP3K 4ZXBD 1DL7L 4HH9A 4NM4H 3T0DA 4N5EC 2G75B 4U49A 3RU8L 2ADFH 1YEHL 4RZCA 4XB7A 4IRSD 3ATFA 2X70B 5AW2B 3S37L 1QWUA 2WNKA 1G7MB 2GJ6D 1AAJA 3O4LE 1N26A 5EU5A 1D7CA 1J8HA 2Q7NA 3ULUC 3FAXA 5AAPA 3S4SB 1MCPH 3VFNB 5J9PB 3CDYA 3HAEB 5J6GA 4R26H 3AG3B 1CYXA 2APFA 2WO4A 3P2BA 5DVKA 1Q9LB 3CDGB 5D1QE 4KRPB 1T7YA 5FW8A 4B6ZA 4Y7OC 3U4EA 5EZIH 4BDVB 1CLYL 4Q6IA 1OP5H 2WVSA 4EIUA 4HWZB 5TQ0L 1D5XB 3DTDA 3UTZB 2F7IA 1LO4L 1USQA 4DKFH 3GHBL 1KOAA 3Q6GH 5L2KE 1J9CT 2NXZD 5FK9B 4PIRF 4CKVX 4E9TA 3PXHA 3MLZH 3PE9A 4GY4A 2RH0A 3QIWB 4BUGA 5D7IE 5BNXD 5LBSL 4Y4HC 5BRQA 4HKBB 3FO2B 4DT2A 5LGHH 2VMEA 3KWVA 3A67H 2P52A 3WTYA 3DO7B 3QG7H 2ROXA 2UY7A 3MYJA 3IJEA 1AHWA 1DDHA 5KJRH 2BY1A 3GSQA 2P28B 4WI5A 4NJ9L 4MNHB 2WLMA 1A3ZA 5HBBA 2H2SC 2CK0H 4CW1A 2O30A 2DQDH 4G72B 4Y5XB 1I7UA 3QA3A 2XN9E 2Y7OA 3ARDD 4Y9EA 4DUWA 4RQQA 1TDQA 2NLJB 3L4ZA 2RR3A 1XB8A 3CJJA 3WKML 4BFGA 5CBEB 2Z1KA 5F96L 3IDNB 2I69A 4LHUB 4N2HA 1L9RA 1A6UL 2W94A 1YAIA 5GXBB 4I3RH 4LVNB 4EAEA 4FYSA 2NY2D 4KJYB 5JIPA 2K8QA 5DZPA 3DNKA 1TEFA 5D55A 1YEIL 4OJYA 4IKIA 4JREC 3SPVA 3S8WA 1BD2B 2XWTB 4ODTL 3CFKA 1N18A 1UA3A 1CTOA 3TL5A 1R75A 5F3FA 3U36A 4A2MA 1KJVA 2BIHA 2Q3ZA 3EZ8A 4LP5A 4PJBE 3PDDA 1UWXK 5BUGA 3TPKA 4RWYH 3FL7A 2Y1AA 2D31A 2VC2H 4Y5YA 1CLOH 3GKWL 4X42A 5TQ2H 3S9DB 3GJFB 1A4KA 4NERA 2P8PA 1OOAA 1TVDA 3L3IB 2QKIC 1R6VA 3KPSB 3L6FA 3V0JA 2PYFB 1NBCA 4R7DB 4BKLA 4ENEC 3M17A 2AMUA 5TTRA 1TQWA 3VCLB 5GIRA 5H37G 3GFUA 3WIHH 3S8FB 2P44B 2ZX8A 4WGVB 1OF2B 3O2WH 1MIMH 4Y1AA 2Q3XA 4GO8A 1NFDB 2BIPA 4M43L 3UTSB 3BFOA 3GRGA 2JK5B 2P7TB 5IEHB 3IPEA 1JK9A 1HINH 2Y06L 4Y8AA 5KOVC 3RWDB 2LV4A 3MNDA 4K23H 4MXWH 3VSUA 1JHKH 1PGRB 1AHKA 1CE6B 4XNXL 1MWAL 3R4DA 1WBZB 4FLSA 4RFNC 2VM4A 1U93A 1VFMA 4WUUE 1M1SA 2DQTH 2FEEL 1K72A 5E9AA 2C26A 1MNUH 3HNTL 3MO1A 2VLMD 2WXHA 5D1ZA 1BFSA 1UD2A 4GINA 3KYAA 2QQNL 1JPGA 1HE8A 4QRUB 4UDTA 2CA4A 1ANUA 4WGWB 1BV8A 5FX3A 3RTQA 3MA9H 4QCIB 4FLRA 1MKFA 3U7WH 1H5BA 2IADA 4NOFA 3B37A 1MFVA 3NCBB 4B0MB 1BYNA 2OS7A 1E6OL 1PAMA 2VSDA 1SJHB 3WGUB 3PGDA 5DRXB 2XA8H 1X5YA 3BN3B 5DQJA 2OMXB 3GBNL 1QRNE 2CMRL 1ZLDA 4H40A 1I7TA 4AYBA 3QEQD 2OR9H 2F8IA 4F7KA 4DFHA 3SDCC 3UBXA 4QRTA 3ZTNL 1YPZB 4M93B 3ZO0A 3SCMA 1A9EB 4BZ2A 5HYQB 4YHYB 2GJZB 3GT6A 4XNMA 4AMKH 3BP7B 3T0EC 5BZXA 2CDFA 1AD9B 4DHLA 4N2KA 2PWFA 4KUZL 5DJ8A 4K71B 5J06A 3IAGC 1DBAH 1D9KA 3K6IA 4XCEB 1CIDA 4GKSB 5E1AB 3BMVA 1NINA 3NDZE 3MMEB 2YAFA 1HVXA 2EP6A 4UT6H 5CINH 2C7UB 1DFBH 4ZTOH 2ZX7A 1AKPA 4M7KL 4NN5B 4OIBA 4D9LL 2FZ3B 4LKCB 5DD3L 1BECA 1YMMB 4WJ5A 2BWQA 4XBGA 5HHMD 1NZRA 4XMKH 4IMLB 3INOA 5F88A 2JH2A 1UZ8A 5CIPA 5JXAL 1BVNP 3UERA 5F7DB 4A6YH 2CKNA 3LPFA 4XMZA 1N2RB 3VA2C 1U8OA 5DZNA 3HCVA 1EDQA 3DK0A 3O9WC 4HFWA 3RY6C 5A40E 2XHNA 1ED3B 5E8DH 1UCBL 2Z34A 3IT8D 3GBMH 3LD8C 1AI1H 5BVJB 1UM4L 4LIQH 1MFDL 1KPUA 4V2BA 3N44F 4X5WB 1NMCC 1IQDA 1QO3A 3WNKA 1EZVY 3Q6FB 5AVXB 1G4MA 3TO4A 4NHCL 2YPLE 3L5XL 5DJXB 1U30A 2YFOA 2H8PA 3FQRB 4HAFA 4FQCL 5CD3A 4V1DB 5C0DB 4JFZH 2JCCB 4EUPG 1PZ2A 1YA5A 3KXFB 3T2PA 1GAFH 2LLLA 3DVNA 3MRNB 5AW3B 2HJKA 2I27N 2E74C 2ICWB 3AS0A 4JFFA 3IU3A 2FR4B 3NIDF 4IDJL 2YUZA 1EZVX 3Q44A 4OQTH 2YFNA 4G6KL 1NGZB 1F4WH 3T2OA 4Y2LA 3UYRL 5F44A 2CQVA 3FU0A 1AR2A 3JZYA 4J2QA 1AD0A 1QSEE 2OTUB 5I1KL 3HS8A 1IAIH 1KG0A 3FUIA 3PUUA 4GXUM 4YO0B 2UWEB 4I2XE 4YL4A 4U0RB 2AXFB 4NIKB 3WKPA 1ZLWK 2W60B 2P5WB 3K6OA 5AB0A 3NACL 1OVZA 1ZANL 4DTGL 1XF2A 2V5MA 4N1HB 6CGTA 5DWPA 5E1QA 2DIAA 1B3IA 3SKJH 4YBLB 3ZSTA 3DO7A 2R29A 1EDYA 1CWVA 3T0WA 2B0SH 2VH5L 3PGCB 3Q1EA 3CXHJ 4MQ7A 4ZODA 3TV3L 1FL5B 2QGEA 2WNWA 4KH9A 5JA9A 5SV4A 4OJFH 1JWMB 2YXVA 4QKTA 4AW4A 4XO3A 3EH4B 5B7FA 3N9GL 4C58B 4QHNB 3X12B 3BSHA 4Y4KA 2DMKA 4YHNB 4GW1B 2WLLB 3VGEA 1F6LL 4OU3A 3HNSH 1CD0A 5FYKH 1AY1H 3PP4L 4H1LA 4QHKI 1QWHA 4AVIA 4OH2A 4B7LA 4Y19D 4LEOB 1NGWA 3QR2A 3UO8B 1RUQH 4Z1PA 3OC8A 1MLBA 4BINA 1EXUB 3LNIA 4ONHB 1J5OH 4OV5B 5EIVA 4YHLH 5C0CA 2XLLA 3ZLQC 5JZ7D 2CHWA 3SY0B 5T1DL 1S7QB 2WLHA 1N4XH 1GVIA 2XU9A 3T0BA 1ODUA 5KSAA 1YYLH 1AP2A 3L7FA 4WV1B 3OGCB 3WNJA 5C0FB 3B5GA 3BAYA 2DKUA 2GBUA 4YSDA 1ETZA 3L17A 3QJSB 2VDOH 4NIYE 4WSJA 1A6PA 3O3EA 5ESAA 1ADQA 4FJYA 4NT6B 2Y2TA 1N8ZB 2APXA 2V5RA 1KUMA 2X6MA 1PQZB 1MCWM 4XP1H 4ZTEA 4A37A 3QYMA 3MSPA 3DUUA 5HHNB 1I53A 2GTWB 5DO2D 2HT4C 2N01B 1U8JB 4PRAB 1SQMA 3P9LB 5AW4B 4NOBA 2XUWA 3M8OH 1JI1A 3SKMA 4B53A 4DP1X 3A6BL 4JZJB 1E0OB 4PGCA 2FX7H 1SJXA 1AR1D 3AU1A 5F9WC 3WHXA 4JVUA 1OGTB 1SMAA 3TBCA 3TLRA 5LXVA 4NRXA 4NN7C 3ILQC 3WEXB 3CFEB 4WKXA 2AF2A 1SBSL 2CUAA 4RESB 3X3FH 4OCSL 1ZEAL 4YSQA 4L8CB 5JOFB 1JK8B 2BHZA 2EH7H 3LPGA 3VFWA 4E41A 3WOVA 1JNHA 4DGUA 5TGBB 4LLVB 3OD3A 2NY1C 4Z7VB 1P7QD 4HS3B 1RZJL 3MV9B 1XX9C 1R24B 3BAKA 2BCKB 2K9FB 3S35X 4C54A 2DDQH 2DQJL 3P77A 4KI5D 3JTSA 1OQOA 1Q9KA 2VLKA 4MXQC 4IHOB 4FQXD 5ICXB 5C7ZA 3GQFA 1MJ7L 4XC1L 4ZUSB 3WTUA 2GPZA 2DQIL 4NO0B 2F18A 1EDHA 2IPKA 3MRKB 4Y5VB 5D7HA 4CC0A 1E28B 5JDJA 2Q10A 3BLPX 2MMXA 2ENQA 3S36X 2EIZB 2PTUA 5LCVA 4NC0B 2OCCB 1C12B 4C57C 1TQCB 4PS7A 3U4KA 5FFGA 1Q9WB 3O0LA 1CK0H 3MLXL 3W11C 3PL6B 2BXYA 4PREB 3S5YA 3ZHKA 5E9DA 3H7BA 4HIPA 5AUMB 1QPPA 1KB5B 3FU7B 3PJSB 3R18A 4A7QA 1FL6B 3MLWL 1NEZG 2VN3A 2H6UA 3ETBF 4HEPA 4LAQH 4FXGC 1FGVL 1C8QA 2LFEA 3CZUB 3DARA 3EJPA 3OXSB 1JP5A 4HJJH 4PWGA 4TUJA 4UAOC 1UZ6F 5J89A 2BMKB 3RPKA 3VFOA 4DZBA 4APQA 2EYRA 3LH8A 1T2JA 4XO8A 1NJ9B 4ZYKB 1HXYA 2V17H 5I15H 1QUNA 1RZJC 4FXKA 4KRPD 5T1KB 4LSVL 1TEYA 2YC1B 2WVVA 3DMMC 4MMXC 4HSAC 4MMZA 5K9JL 1XH0A 1N59A 4NQXA 2LU3A 4FNTA 3RVWD 1QP1A 2A6IB 2Z8SA 3L5HA 1KNOA 3SGKA 3JWNH 1GY2A 3QQ4B 3PV7A 4QY8A 1QVOB 1JNJA 3OKEB 1FHNA 4JEGB 1Z5LA 2XX0A 1MW3A 2DQMA 4NKMA 4AEIL 3NPSB 3HVNA 2AK4A 4LCUB 5D1ZI 5E6YA 1U6AL 1LWHA 3VJ6A 1NMAL 3FH8A 4WI2A 1O9VA 3BH4A 2W0LA 5TH2B 4E0RA 4U1LB 2QJDA 2E7BA 2QQKL 1JPST 4TQEH 1NH6A 4LLQB 1WD8A 2JIXA 1BF2A 4XP4L 2J12B 3L9YA 5DEGA 3CCHA 5C8JB 1H9DA 5F1IA 2RQEA 1TZOA 2IFFL 2JE8A 3ZKMD 2R2CA 2YN5A 3NOIA 5IB1A 4FEMA 5E5MA 1BQHB 3O0RL 3VI3F 3UBXI 4XVOA 3NFNA 4RIRA 2NXYB 4PB0H 4AZ8A 4BSVB 5HPOA 4KJQC 1MVYA 4I7ZC 4D94A 1F86A 4LHUD 5DVLA 1GOHA 2VABA 1OAUL 5D7LB 1P1VA 3RKPA 3X1EA 5GRUH 4J7RA 1EQWA 4BFIA 3DHMA 3WFEL 3E2HB 5K1VA 4MNQA 3T8VA 2H32A 1AOZA 5C3TA 1BD2D 3D39E 2OYMA 3JYBA 4PJ9A 4RRPM 4WSGA 1SOKA 4CGTA 3HHSB 3OAUL 4LRIA 2WJ5A 5I19L 2D7QA 5DFVC 4GIAA 1M3IA 4H20L 4RVBA 4ZPTB 2QV4A 2X4TA 3W5NA 1GGIL 4KMTL 3FFCA 2PP9A 3KLHC 3RWGA 2VQ4A 3SE8L 3V0HA 1OHQA 2BNQA 3VI3A 3L5JA 1H6TA 3U46B 3SN6N 3KPSD 4OCYL 4RZKA 1LDPL 1ET8A 1JS4A 4KXCA 4P5MB 2VLJA 3S3PA 3RAJL 3MRFA 3M7OA 4U1KB 4XBPB 3ULSB 3X14B 2AJVL 3G6AB 3UTSD 2B1AH 3RIFF 3Q5OA 5EEXA 1M7DB 2VKXA 3A6OA 3V9EA 4J3OG 4Z7NB 4LMQE 4PUBH 2GT9A 1A4BA 4L8SB 4JO5A 4F58H 5EF3A 2HTLD 3K3QA 1BVLB 3U0TB 1LEGB 3CVDA 3GZKA 1CXIA 4JJHA 2DIEA 1WWWX 4YR6A 1DANU 2Y23A 1J0KA 2JMRA 3SQOH 1XSKA 3MRRA 3KDPB 5DLML 4ONFL 1PD0A 3C09B 3H53A 1HXKA 1F0LA 1U33A 4X7SL 1HZLA 4AE0A 4PSRA 2HRLA 1AZNA 3QPQD 4IMKA 4UIMA 1SHWA 2QKSA 4XPFH 2FO1A 1U8MB 3WS3B 2ERJC 3QJHA 2X42A 5E9NA 4P23A 5MERA 1KJMA 3AXLA 1BX2B 2C9XA 4FNQA 3L4WA 3V4VA 3CDCA 4XMXA 3STZA 5HD8D 1KTDB 5IM7B 3TO2A 1NMBL 4IEFB 1L6PA 5ICUA 1F3JB 3ARBA 4PWIA 4XT1C 3UZVB 4ETQA 2EABA 1M71A 2WLZA 2J6EL 1C5BH 1KBVA 3MOBH 1Z6JT 1ZXQA 3I2CH 5DZAA 1YYML 1F2QA 2NY4B 5AALA 5JHMA 4D0CA 2M8XA 3T4YA 4XODA 1ND0A 1AVAA 3OL2A 3WFBL 5GGUA 1AGEA 4ZS6D 2IANB 3HAEH 2C3HA 4N28A 3NCJL 4QXTB 2DWDA 3L3OB 1OAKL 3F01A 2ICCA 3X2QB 4F5CE 1EHKB 1EV2E 2NYKA 3G6JB 4YEFA 2V2WB 4ABQA 3VFSB 4JDZB 5FYJL 2CAKA 1TVBB 1OANA 4EI0A 2YEQA 2DYSB 3AZUA 4JFWA 3RIFK 5FHAH 3WS6A 1YMMD 1X7QB 3PYCA 4IRSA 3QBTB 3TTYA 3SE9H 1W72A 3C2AH 2GJ6A 4XB8A 2V2XA 4TNGA 1A7QL 1U36A 2NSXA 3MGTB 5I23A 3C5JB 2OMYA 2RFXB 5HHXH 4HC1L 5DS8B 5I30L 4O00A 3F7PC 3K5RA 5AW6B 5HGDA 4LPTA 4W9DC 1EUUA 4NENA 4PJDF 1KLUB 3CUPA 5DWUL 4P46B 1AXSA 2WK2A 2Z4QB 3SE6A 4AM0B 4L1SA 1JF5A 1MREL 1Y07A 3E6FB 1KZYA 3IRZA 3NEXA 2V3DA 2X2IA 3QSKB 3R1GL 4OSUL 4A7TA 5J1AB 2HCZX 4GBXA 4LPUA 2TSAA 4IHBA 4ZMXA 4QGTA 1O75A 2W65B 4RFOH 4V1DD 2XY2A 4S0SD 1FN4B 3PWNA 4L4TE 2FD6H 4P57A 1DO6A 3SBQA 5F9JB 1FF5A 3KXFD 1XEUA 4N0UB 3W56A 3ESOA 5AW0B 2R4RH 4F7MA 2HG5B 4N2IA 2OXGB 3BHBA 5H35B 5I1IL 3HB3C 4KRMB 5ECJE 5C0JB 1M1XB 3QARA 5CGYD 3KG5A 5IB2A 2E9IA 1NAKL 2LU4A 3AT0A 2HKAA 1KN2H 2L7EA 3BN9D 1ESOA 4JJ5A 4PJDA 4KKCD 4WTQA 5EN2B 1FC2D 1IIKA 3QCVL 5INDA 2CJUH 3L3JB 3ARDA 5I66A 1PZDA 9CGTA 3CNKA 4KXZH 3AS3A 1P7KB 3ZZ1A 2P5WD 4UBDD 3GJFH 2TAAA 2EH8L 4F80A 1IGYA 4NKQB 4M1GH 1EMTH 1ZA6B 1AE6L 2OJ1A 1R5WB 4QLRA 2X40A 4PB9H 1HZHL 3QUML 4Y4FA 5CJQL 3E80A 4WCYL 2F58H 3P73B 4KQ3H 4DKAA 2RGSA 3TZVB 5ADOL 4BFKA 3O11B 5MHSE 1WPCA 1LLAA 2ZX5A 3GZQA 2DM2A 3K6FA 2H41A 2NNAA 4KGJA 4LF3B 5CEZL 3OVUB 2ZUQB 3TS8A 1AQKH 3BZEB 1SN0A 5DHYB 5HHQB 3TT1H 3ZR6A 3UTTA 2ZE0A 2E7LA 2BNUB 3M6DA 2AP2A 1FVCB 1AGDB 2HMID 3JWOL 5KWYC 1Q38A 2R1WA 4OCRL 4ODVL 2N3JA 5I1JH 3BP6B 1CFNA 3RURA 5GRVK 1U2YA 4JR9H 3ZKND 4XN5A 1UOVA 1IE4A 3GMOA 1RY7B 1HESA 2QVIA 4XWOC 4M1CD 5DGQA 3VGHA 2ADYA 2QMKA 1CI3M 4OJCA 1URLA 2ZCHL 3N42F 3ZE2B 5T3XE 3DJTA 1OAYH 2D0HA 1BJMA 3WIAA 1D6EA 2VR7A 4N2BA 3K72B 1AFVL 2TSBA 4R5XA 4ZMLA 1IBGL 4LLYA 4JZNA 1HWHB 1QI5A 4LFHG 2ENYA 5EBGA 1XZWA 1B0GB 5L6YL 4OD2A 1MF2L 5EC2A 2EXSA 5E4AA 4ZSOA 4PPTA 3ZTDC 1A5FL 1MHCB 4GMTL 3MV8B 4U3SB 5C08E 4FF9A 4KHXL 3BEWB 1W0WA 4K3JL 3WFHA 1DSFL 2IPUK 1TFPA 4HUWA 1HQ4B 3V7AG 5IHZA 2C8NA 1FBIL 4MD5A 4QF1B 3WNLA 1TJHL 1MEXL 1SRDA 4KRNA 2ADGA 4WW2B 1H3XA 1MELA 4L9DA 3U1SL 5FO7B 3S88L 3TWCL 4LXFA 1VAHA 2V4LA 3OTTA 3JWOC 2XG5A 2ICEA 4K3DL 4ZUWA 3CX5J 4EZJA 1IL1A 3QEQA 1O6VA 4ZUTA 3BP4A 1IU1A 2OYLA 4UM9B 4Z7WF 5EULV 5IK3B 1F56A 1U8KA 1ZPLA 3LMJL 5EU6A 3DVFA 5CCKH 5LWYL 1KCUH 4YSSA 4NFDA 3E6HA 2Q9OA 5DUJA 2VUOA 5IHUH 4ZFZB 5KVDE 1FC1A 3EFDH 3MV9D 4JFEE 2EKSA 3S3DB 3VMNA 1S2EA 1ECYA 1KT2A 1VFBA 5D72H 2ZUYA 1ZWIA 3LN5B 4X8JA 2OSLB 2CXGA 4IRZH 4AKPA 2XZZA 4Q74A 5B38B 5JPMA