3KM1A

Zinc-reconstituted tomato chloroplast superoxide dismutase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
125
Chain Sequence
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
total genus 28
structure length 125
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km1A00
1EQWA 1E9OA 2WWOA 2SODB 1PZSA 1IBBA 4OJAA 4L05A 4A7GA 1YAZA 3KBEA 3KM1A 2E47A 2WZ5A 2ZKXA 1JK9A 3F7KA 1B4TA 1N18A 3GZQA 3HW7A 1SXZA 1SRDA 2WYTA 1IBFA 2AEOA 1IBDA 3LTVA 2GBUA 3PU7A 1P1VA 4A7SA 2APSA 1PU0A 1ESOA 4BCZA 1FUNA 3QQDB 1YSOA 1PTZA 4A7TA 1F1GA 1BA9A 1SXAA 1XTMA 3KH3A 1S4IA 1N19A 3T5WA 1XSOA 3ECUA 1SDAB 1SXSA 4U4IA 2WYZA 1DO5A 2AQSA 1F1AA 3CQPA 2C9VA 1SPDA 2WZ6A 2WWNA 3MKGA 1IB5A 4MCMA 1SXNA 1F18A 2NNXA 2AQTA 1DSWA 1E9QB 1F1DA 1UXLA 2AQNA 1U3NA 3ECWA 2AQQA 1CBJA 1SDYA 1RK7A 3S0PA 2AQPA 5KBLA 1OALA 1IBHA 1MFMA 1BZOA 5KBMA 4FF9A 1B4LA 2XJLA 1L3NA 1Q0EA 2Z7UA 1E9OB 2GBVA 2ZKWA 2AF2A 1KMGA 3KH4A 1YAIA 4A7QA 3CQQA 3H2PA 1OZUA 3GZPA 4N3TA 1SXCA 1Z9PA 2ZOWA 2R27A 2GBTA 4A7VA 4OH2A 1TO4A 2VR6A 2VR8A 1E9PA 2WZ0A 4A7GF 1TO5A 3GTVA 2LU5A 4A7UA 2VR7A 2E46A 1COBA 3K91A 1HL5A 1AZVA 1Z9NA 4B3EA 1JK9B 1OEZW 3GTTA 3RE0A 1UXMA 2Z7YA 4BD4A 2Q2LA 2JCWA 2K4WA 2C9UA 3KM2A 3CE1A 2JLPA 1CB4A 1SOSA 2ZKYA 1SXBA 1E9QA 1JCVA 5CU9A 2C9SA 2Z7WA 1QUPA 3L9YA 4BCYA 3MNDA 5KBKA 2AQRA 3GQFA 2WKOA 3HOGA 1OAJA 1HL4A 2Z7ZA 4MCNA 3SODB 2V0AA 1EJ8A 3GZOA 2WKOF 1XTLA 3L9EA 2XJKA 3HFFA 3F7LA 3ECVA 1OZTG 3QQDA 3H2QA 4N3UA 1E9PB 3KBFA
chains in the Genus database with same CATH superfamily
3QFJD 2E9JA 3DBXA 2ED8A 2PYEB 4X7DC 2OFQA 3RIFK 1B4JH 1YG9A 3NIGE 1VRSA 4Z7QE 2W92A 2O4EA 4UT9A 4JKMA 1TTFA 3CDYA 4LSTL 5DI8B 2FH8A 1S46A 9CGTA 1JPFA 4W4OA 3BH8B 2AQ2A 3ISWA 2NZIA 4N25A 5D7IB 3CH8A 4FDWA 4PRHE 5FF6A 2WK2A 2DBJA 2FT6A 3NJIA 3WTTA 3GBNL 4NPKA 3T6WA 1IGIL 4PLJD 4OLXL 3T1FA 5BJTB 1LK2B 3DPBA 1KJ2A 4JG0H 5DMGD 4XP5L 1MQ8A 5BRZD 1YY9D 3UJJH 1Q0XL 5DMJB 2EDYA 2M26A 3INOA 3QXWA 2DMBA 2N7SA 1U3HC 1G7MA 4JHBA 3OSVA 5BS0E 4DERA 3EH5B 1OTUD 2J6EA 1QR1A 1UQSB 5DJXB 3H9HA 3CFUA 1JWUB 5J9PB 4NP9A 5GPRA 5BRPA 5B38B 1HU8A 3VH8B 4UV7H 3HLAA 3N0AA 1DJYA 1M7XA 5FAAA 4QLWA 1XGYL 3TWYA 5EN2A 4WUUD 1EGJA 1E43A 2LVEA 3IJYB 4FFVD 4NQXA 2D73A 1WWBX 4J6IA 1FDLH 4PSRA 4F80A 4LPYA 3RGVC 3FO1A 3OGCA 2P42B 1FE8L 2DIBA 2HFEB 1RERA 2YZ1A 4ZMYA 1EZUA 1E50A 2KH2B 4QRQA 1B3JA 3ILEA 2OSXA 2XXMB 2V5SA 4RAVB 1DUZA 5J6HB 4WFFE 2BNRB 5J9PA 3BLPX 2XWBB 1P7BA 3D52A 3MN8A 5C0BB 5FO7B 3PWPB 1N64H 3SDYH 3KYKL 3T77A 2WXHA 4F7CB 2JK5B 4KRMB 2ALAA 3UIZA 4RLDA 5GHWL 4DEUA 4AEIL 4FULA 2Z92B 3QDGA 3ZRCC 4MB3A 1YMMA 2ED7A 3MOAH 3AREC 1BG9A 1V3MA 2ADIA 3EYFB 3LMJL 4HJGB 2FX7H 4ZOCA 2YGQA 1O6TA 5ANMA 2Z0BA 5K9OB 1LO4L 1MOEA 2APFA 1S7QB 2CJUL 1KOAA 2IF7A 4YHML 1MFDH 1EVUA 1T66C 2AI0H 32C2B 1AO7B 3DSNA 3RUGB 1X9UA 3O0RH 7CGTA 4RGMB 3N04A 3T8XA 4JFUA 3AB0B 3L2NA 2WNGA 4Y4KC 1HL9A 2XXCB 3H2QA 3FTUA 3X13A 4GXUN 1KJ3H 2AK4A 1DQDL 2AGJH 4QCIA 3LS4L 2ADIB 3QIBC 1UB6A 2E47A 3RAJL 2L4OA 3VNZA 1T2QL 2WQVA 3IU4H 1SN2A 4RISL 4ZI8A 2VT0A 4YBLC 1O9WA 3E8VA 4FQPA 3ZQXA 3WNJA 5H37G 3FQTA 4LSTH 3DV4B 4G6KL 4L4VD 5JOPE 2X6CA 3JVFC 4ENEC 4HIJA 3RX8A 4M4RA 2Z65C 4JFFA 3VACA 4IK7A 4PJAF 1J88A 1LP9F 1SZNA 3SDCD 1E6JH 2QFRA 3U4EB 4IRZH 4JO3L 3ARED 5D1ZB 4IRJB 2GJZB 3IFPA 4JBSA 1HINL 2IGFL 2YAEA 2HRHA 3B7YA 3ILQD 4F7TB 4OCXL 4XMXA 1YEGL 2VXSH 4YAQA 5L2JB 2EVJA 1ZIAA 1TTGA 1ZD6A 4KK8D 3H0TB 1G9EA 2QV2A 4M61A 2LOEA 4OGAC 2NQDA 2H4EA 3AGVA 4Z0BH 1MHPL 3KPSD 4KI1A 4X4XA 5C08E 3W1ZA 5BQ7A 4J3OD 2EDDA 2GEEA 3WN5B 3U46A 5DVNA 3PYCA 1MH5A 4KJWC 1AY1H 2AQQA 2NY4D 5C0BD 4PP1C 2AQPA 4XNMA 4ANUA 4HPOL 4CW1A 2BS71 4XPTL 1G7PA 1VAHA 2JXMA 5DD5H 5JDSB 5DJYB 3D50A 1U95A 2ZCZA 3DJTA 3PY9A 3X11A 3MXWH 2WXJA 3CC1A 1DQQB 4Y19B 1WV7T 1Z9SA 3WV0A 3QXVA 3V5DB 1OB1B 2BLFA 1OARH 2H0FA 3PJSA 4G6KH 1O6SB 4H2AA 5E5RB 1J12A 4KGJA 2HN7B 4NN7B 3T9WA 4IBLT 5JO5B 3ZTJG 2C3HA 3L3IA 1MI5D 1PY4A 4XBEH 1BM7A 5E5UB 5GRUL 4AT6B 5TDOB 2ITEA 4ORZC 2OXHA 4XCCH 3MROA 5DJZA 4Y4HC 1JUFA 5JZ7D 4JFEB 1JZIA 1QSEE 1J7VR 4Q6IC 4I2XB 5D7EA 3TIEA 3X11B 4EE2A 4QD2E 3K46A 4PJGB 4ABQA 3GBEA 1GZPA 4PGZA 1VZHA 4EZLA 1WP6A 3P9MA 1AGCB 1CGSH 4ZPVB 3EO9L 4D7PA 2IQAB 1YC7A 2K6ZA 2VM3A 3TO2B 4EVNA 5J1AA 2NY4C 2HX7A 2NYKA 3L3IB 1U92A 5LGJB 3JV4A 5IQ7L 5JPNC 2W88A 2ZT9C 3CVIL 1GS8A 4OFIA 5DQJB 3FQ4A 5I76B 3OPZL 5FM4A 1FNEA 3HE6B 4I3SH 4N2HA 5D1ZI 3VFGL 3WUWA 1Z0NA 5HBBA 4NM4L 4GQPH 2JJTA 3HE7C 2QPEB 4DZ8A 5I0ZA 1RZJL 3AMLA 4XP9L 4V11A 4XMUA 5D7LD 4ODHH 4K2UH 2R0ZH 1XH2A 2A9NL 1G84A 3SKJL 4AZ8B 3DECA 2EDLA 3REWA 4DGIL 2CLZB 4OM0L 4TRPH 2A73A 2AXGA 3ARYA 1NEPA 3BWZA 4HKBB 1T04B 3CFKA 1IVLA 4H8HA 5CP3A 5ENWB 8FABB 5LQBH 3MNMA 1JRHI 1OP9A 3R0MA 2XTJD 2E7HA 5EU3A 4NJ9L 1HN1A 2XTLA 4P4RB 5FS5A 3DURA 5T3XE 3DHUA 4BRVA 3DOSB 3D3VD 2I85A 1JGIA 2ZZUT 4CGTA 5EOCH 1DQVA 3U4BH 4YMPA 1Y0LA 4QHMA 1UG9A 1C5BL 1GVIA 1QWHA 3BH4A 4LBEB 1OCCB 2Y69B 3FT1A 2EH8H 2NNFA 4XE0A 2JELH 3QB7C 5K9JL 2GY7B 3GFUA 3K6DA 4YE4H 5EBGA 2NW3A 2ZOKA 5I0WA 3L9RA 3X1BA 4C54A 3G5YB 3HZMA 1CFNB 5FM5M 5EEZA 1ANUA 4TQ8A 3VFGH 4XZ4A 5IVZB 2D7OA 1TMCB 3GHEL 1BEXA 1I4FB 1RJLB 3AQXA 4YHNA 4JQIA 2ZYSA 4N0YH 3QORD 4W9KC 4F27A 5I73C 5GSRB 1DQKA 3LXBA 4BFRA 4IEFA 2ZCKH 3QZWB 4L4VE 4FA7B 1F2XK 1CG9A 3ERXA 3K5SA 4PJ8A 2YOCA 2R29H 3L9RB 2R1WA 3CD4A 5FO8B 3CVCA 4ONGL 4I8DA 1S7UB 3BGFC 1MCOH 1SDDB 1KIQA 4H8QA 3UMNA 4X6EA 2WBJB 2R9HC 3T4AA 3DUUA 3OLDA 5JW4M 1UB5B 1KEML 2AEIT 5I1KL 1NGZB 1W0WB 4IJTA 4BBWA 5LAXB 3N42F 5BQDA 4M43H 1K2DA 1YMHB 4GRLC 3CVDA 4YE4L 2XIDA 4K7PL 4D9QE 1QBLL 3C08H 1UFGA 5D8JL 3GKWH 2EDJA 2Z8SA 3VJ6A 1BEYH 3QZWG 4QT5A 1RJCA 1KB9K 5F7WC 2HTKD 1BF2A 2MOGA 2JKSA 1W16A 5DRXA 3VU1A 3UOAB 4EN3A 1HOEA 2B5IB 3TM6A 1IGYB 4P23C 3WEXA 3FTSA 1NGZA 1W0WA 4Z7VE 4LLMA 1G87A 2O6PA 4LPVA 5EO0A 1KGWA 4AQEA 5J4MA 2CJTA 2ZXCA 4RGMC 3KBHE 3GBMH 1W0YT 2QLYA 1ETB1 1JPFB 4GMTL 1ID5I 1NDMB 5FUOH 4X0KA 2Y25A 5F3BA 4ZMQA 1YUKB 1ACXA 1CFVL 4HF5L 1FYHB 2FGWH 1S9WA 4K9EC 1C5CH 3EBIA 2FR4B 4UU9A 2CWRA 3M8OL 3P4MA 4Q6IA 5E94A 5FUCE 2OA9A 1BF8A 2QDVA 5JHLA 1UA7A 5C08D 3E2HB 3K6SB 1NM9A 4PJDF 2YLKA 4OZ4A 1F4WH 1HHHB 1USZA 2NY3C 4NKQB 1F18A 4NKMB 3W9EB 5KG9B 5FA4B 1X4ZA 4HIXL 2I7SA 4TSCH 3Q2NA 1CIUA 1NDMA 1R3IL 2PKDA 3BSZA 2BOBB 1A7PL 4U1SA 3MLRL 3QCTH 1A6TB 3BP5A 3F58L 2LT9A 3IF1A 1IAKB 2XVKA 3V0WL 5L8LB 4YDJB 1LDSA 5B38A 1KXQA 2D0FA 1ZT1B 1S7RB 3L3GA 3ZZSA 4ZZKA 1S7XA 5CCKH 4BH8B 4Y19E 4QDGA 1P0SE 3TPUB 3F6JA 2VDKL 3IMSA 1QRNB 3N50A 4NO0D 1J1OH 1C9SA 1BQLH 2KZ1B 1HEHC 4LAJH 1K8IA 3W9EA 3WHXA 5KG9A 4B9KC 2HJKA 2LTQB 4TQEH 1FIGH 4HKXB 4LEBA 3VXUE 1C5DA 4FABL 4OH2A 5J6HA 3HPJB 4X80H 1GRWA 3VQLA 4S1SL 1HKLH 3H9ZA 5CBEA 1XL4A 4EOWL 1NAML 3MA7B 1S7RA 3EDEA 5K1VA 4M48L 3QUXD 5C0AD 4JKKA 1AOZA 4KITB 1LK3L 3BRDA 3TNNA 5C2BH 3KYOA 1QYGH 2P8LB 4OD3L 4XMPL 2OTWA 3H3PL 3UGUA 1PD1A 4LSSH 4PN6A 1JCVA 1QR4A 4G8EB 2RIKA 3T3PB 4MD4A 4P3DB 5GGQL 3G9VA 2N7BA 3GJEA 5IJBC 2EDRA 5ANMB 1MAJA 2X4SB 5DWPA 1HDMA 2RTTA 4QNPE 1PCXA 1WBZB 2VKWA 3FPXA 1TTBA 3HKFA 2IG2L 4LXFA 3C08L 4B50A 2NX5B 3NIDE 5JW3H 5F9DC 4DP2X 3CFNA 2J2ZB 3IMRA 1JD7A 4MTMA 1R0AL 5D9SB 3BUTA 4MMXA 1BP3B 3B2UD 3CZLA 2EUVA 4YO0A 1KV7A 4EZMA 1ZSHA 5ESQB 1HJCA 1A4CA 2GJPA 3MA9H 5HDBE 3EO9H 5CGYD 5EA0H 3KBEA 4X8XA 5AZEL 2GAZA 2V3DA 5L4JA 4NXKA 1DL7L 1CDYA 3PQYA 5GRJL 1TQVA 4Q89A 1P5UC 4O2FB 3NFNB 1CURA 3WIIH 3NBNA 3IJ7A 1I9RH 5E4AA 1AJ7H 4K9EL 3FQTB 1TZGH 3U1SH 4ANVA 1JCKA 3FOLB 1NCWH 3QRLA 2J1ZA 4YO0B 5G4NA 2VN3A 3BVWA 1AY1L 3EJSA 1H8NA 1FA4A 3OGOE 3GK8L 1BXVA 2BHZA 3RWDA 1JN6A 1JXDA 4FJZA 1XGUB 4LVHB 4B9JA 3CFMA 1KC5L 3ZO9A 1GAFL 1N19A 2AEQH 3VGAC 2YPVL 3ARBA 3D25A 5INCB 3MUGB 1T03L 15C8H 2J88L 3L3HA 5L2KA 4NO0B 3B2XA 2NZ9C 5HJDA 2C4FT 2XDHA 5E03A 2D3VA 5LCVL 4Q9BA 5I1AB 1JNLL 4JFHE 5BW7C 1JG9A 4A2EA 2Y9RT 3Q8BA 1NUFA 3D0VA 3FXIC 2VM4A 2YIHA 4APXB 3DO3A 5E8NB 2PYED 1T21B 5D8JH 1E6OL 3C2SA 2JQZA 4HULB 1MHHB 1P53A 1VESA 2Z93A 3NJGA 2GSIB 1BQUA 4HX1A 5D1QE 2DY2A 2DF3A 3VG0L 4F8PA 3RKPA 1FFRA 1JYWA 3EJYC 2YEVB 3K4DA 4FQHA 5FCUL 5H35A 5IMMB 1ADQH 4QKXB 4FKKA 4DAGL 1HIML 4F8TA 3AG4B 3GXIA 4OIIL 5EU6E 5EDSA 3KYMA 3I75A 4R5TA 1KXHA 2GFBA 4S1SH 3Q6GH 1ZS8A 2BCKA 5F9AC 2FTAA 3II1A 2FHCA 4H4NA 2VH5L 3KW8A 3AAZA 3WY1A 1LK3H 4ODTL 1U2HA 1NKGA 1UVQA 1XMWA 3AWFA 4XWGH 3MJ9A 4UTBH 1RIVL 5EBLA 3BGAA 4JPIB 1RV6X 1J9RA 3IDIA 3ZKXB 3ASWA 3V5KB 4F37F 2NUPB 3VDAA 5DC0A 3D39E 3SCMA 2HT2D 5AAMA 4HWUA 2XN9D 4G72B 3NZSA 3EJTA 2VSMB 3DTXA 4X4ME 2Y7QA 2CO4A 2WBKA 1U8PA 3O4LE 3US0A 3I2CH 3Q9QA 5JPMB 3K2IA 2RJMA 2F54E 4MNQB 3UBHA 5F44A 5DJYA 1QSFA 3VI4A 2EECA 4YGAB 4R7XA 2OP4L 2APTA 1ET7A 3RL2A 1XAKA 5I1IH 4PJBF 1RZIA 2XWJB 3QAZC 4M7KL 1MFUA 3WUZA 5C0AE 5F7UA 2OJZL 3EW3B 4I5BB 3TBTB 4FCHA 1TZAA 1IEHA 5AAWA 5KN5A 1GSKA 4EKXA 1F5WA 4E41D 1R3LA 3NEOA 4LT7A 5LB1A 4K8RL 3DURB 4G71B 5KOMC 3SDDB 4GH7B 1LWJA 4L23A 4HAGA 1LQBC 2GG1A 2J88H 3I6SA 3MRRB 4FXTA 3W11C 2G60L 1Y0LB 1IU1A 2BX5A 2C9AA 2HT2C 1PYWA 3MV8D 4Z3JA 5DZOA 1QTPA 3D7PA 4M8VA 3QUYC 4HCIA 4WTWA 1A4BA 3VWKA 2CO6A 4Y19D 2IALB 4NO3B 1RP8A 2KT6A 1CFTA 3AWGA 3JTSA 4H8WC 4OR1A 2JKJA 5EBMA 1MLCB 2FEEL 3PAVA 1A2YB 4HQQL 1YUHB 2WLYA 4FL4B 5G4MA 2OMTB 3ETTA 4G9FD 3QFDA 4MQ7A 5T33H 5I76A 3Q7JA 4NUPA 4XMKH 3O2WL 2CGYA 3UTZA 2ICEC 2Q7YB 1UWYA 4YDVA 3D69A 3AY2A 4HK3N 1AC0A 3RPIB 1CG9B 1Z1WA 4L3FA 4ZTOL 5CF3A 5KBPA 3V6OE 4WO4C 5AENA 1NFIA 4OZFG 1EFXB 3WDIA 5E2JA 5DVOA 1V27A 5IV2A 2OMZA 3AUVA 1FNLA 2CSPA 2OS7A 4B9GA 4L1HA 3WE6A 1EDHA 1OQOA 2ENSA 3VFRB 1YPZF 3GHBL 1YECH 1KG0A 1F58L 2EYSB 3AMKA 3QRGL 3C5ZD 5GJTH 4CU7A 4LLYB 2C1OA 3GUTA 4HVBA 3S6CA 3AQDA 1YMHA 2B14A 4OZIE 4WDIB 2OMYA 4BCYA 1QFWL 3JWDH 4LLAA 5F7MC 4GUOA 3FQ2A 3DOSA 1JBJA 5HI4D 1WA0X 4HXBL 2BSBA 1IM3B 1HL4A 3DROA 5TQ2H 1XCQB 2HFGL 1KTRL 3RU8L 2A6IA 4O02L 4OLVH 3HRZB 5TE7H 3SSGA 1WS8A 4ZUVB 1XSJA 3W3BA 1RUPL 3M1OA 3QQDA 4M7ZB 2VMFA 4YUEH 3OKDA 4UOW1 5FYJH 1M56B 5C0GA 1VADB 2CAKA 2WSKA 3M86A 4ZO9A 3MV7B 1OSZA 3OR7B 1WCBB 3P4LA 4HIIA 1U3JA 3FT9A 4YZFF 3BQUB 4LLMB 1JF1A 2YD2A 5B1CA 4WDIA 1S5IL 2J8UA 3DMMC 3UYRH 2WUCH 1BBDL 4HSCX 5JW3L 4P5TD 1NGYB 1IBDA 4EPSA 2HSIA 5BUGA 4OZHF 4PWFA 3PUCA 1IC7L 3CX2A 2Y5TA 2WANA 5GS0L 3QQDB 4AL8H 3GSQA 3TOPA 3IDJA 4HWEL 4V2BA 4A7TA 4EO5A 4XGZA 2C3WA 1S4IA 4HIIB 1JVLA 3CDGB 1SBSL 4I0PC 4PTTB 4UDUA 4UV4H 3VMNA 3ULUL 1NGWB 2XX1A 4KUCD 3I02A 4X83A 4C55A 3FFCB 3O8XC 5JXAH 1ORSA 3F85A 2DICA 5DK3A 1SHXA 4DETA 1I7ZB 1DFBH 4NKMA 3LQZB 4PIBA 2JB5H 1ZLUH 3V0JA 1PZCA 3BH8A 3B2PA 2FLBT 2OZ4H 4TQEL 3ZL1A 1TETH 2WQAA 3DVNA 1MDAA 1BFVL 3HLKA 3QEHB 1N9PA 5I1CL 4HHWA 4RGNC 4XGZB 1UD3A 4NCC1 5GRZA 2WHVA 3CVHL 1QRNE 4UTCA 3FTYA 3NYKA 3U2IA 5BV7L 1P4BL 2Y7OA 4NO5A 3OC8A 4BFFA 3P77A 4PQXA 4L8SA 2YPKB 1P1ZB 3ES6A 1SMAA 4JHUA 1AI1L 1RMFL 2VLRA 3MBWA 3PWUA 4ELMB 1KB9J 3GMQA 3EGXA 4MVBC 4QHKI 1IGMH 2A9MH 1K6QH 1OAKL 5GIRB 4RMBA 4UWQB 3HLAB 4HIHB 3RX7A 1OV8A 5HGBB 1GOGA 2Z31A 3FSAA 1J0ZA 1GIGL 5PAZA 3F12A 3WTUA 1GGCH 4FERA 3MLPA 2Z0UA 5CO1A 2E5EA 1I8UA 1OAQH 3RL1A 2K8MA 3KYOB 2PWGA 5HJ3A 4ZW6A 3JWOL 4GNKB 3V6FA 5I74B 5FIEA 4NHUA 1SLVA 4JFPA 1HHKA 1BHGA 3L9YA 3F83A 3P4MB 5FYKH 5BRZE 1TETL 1WZKA 1Y18B 2MCG1 1LE9B 3DX6B 4EN3C 2MPVA 3G6AA 4IOFC 2FQGA 2EDFA 4L4JA 1NBYA 5D72H 2E0PA 5C0JB 4UUJB 3CSBA 3KXFD 4PS4H 3ZIYA 3FO9A 4O02H 2H32H 3VD9A 1UZ6F 3QDAA 4OI7A 3WFEH 3S3BB 2YO3A 3WNKA 4U1IA 4JO1H 2GSGA 3KBFA 4KI5E 1H3UA 1SF3A 4O58H 1KB5H 1KCRL 1W8OA 2CXGA 3EGSB 3CXHK 4XWOC 2H0PA 4XCFH 4L5FH 1S7XB 15C8L 2V9RA 1HOCA 5G5DA 2A2QT 4LRNH 4YXKH 3EOTL 3L5JA 6TAAA 2DKMA 2PPEA 3ARDB 3WI9A 5CSBA 2GI7A 2WVVB 4KKLD 1EZSA 2N4IA 5T1KD 3SGEI 1PTZA 4ZG1A 4APQC 4U4BA 3NFSH 3O41B 4JCWA 4BZ1L 3CLEL 3BW9B 2FZ3A 3C60A 2UX6A 1OSEA 3OSKA 3LHPL 2WXMA 1D5RA 3K0YA 4LP5A 1F6AB 5EC2B 1XSIA 4E5XA 1AGFA 5J57B 1BG1A 4HLJA 5H2BA 2E76C 2YJLA 1YECL 4W1TA 2G75A 3UFIA 2MCAA 2ICCA 4NHCL 1G7LA 2H3NB 4JDVB 4J3SA 3NJMA 3CSYA 3D2UA 1AFVH 4PJFA 4WRLA 3ILPA 4AYMC 5JQIB 5CWSB 2DQFA 4LPUA 4S0SD 1BFVH 1FN4B 3EYUH 4YLCA 2RB8A 3U4EA 2YZ8A 2H0JA 2ZUSA 1R24B 4BXVA 3JWOC 3OWRA 3CU1A 4WEMB 1F6AA 2QZ5A 2GBVA 2CG9X 4PJGE 1BAWA 3MNWA 3R0NA 4KO9A 5TDPB 3GI8H 4JO2H 2P7TB 4R9HA 1AG6A 2CHZA 1E2ZA 4RH4A 4KOBA 1MF2H 1CE6A 2EEDA 2ZXEB 3MU3A 2QQKL 4OZFB 1UJTA 4L37B 2CO2A 2LTQC 5I71C 1A6ZB 1K3ZA 2UWEF 3NVQA 2DYPA 4LKXA 1D9KB 4B95C 3D3VB 1RK0A 3RZCD 3DOHA 1KPRB 3VFWA 3NH7H 4YJZL 5A2CA 1GR7A 2F58L 2WINA 1S8DB 4TNWK 2EQDA 4Z5RB 1RPQA 1SHMA 2VWEE 5GHWH 3A0OA 4H5SA 2A4ZA 4LL1A 1QLRA 2Q2LA 5KWYC 1NCDH 1J8RA 3EYVB 2ICWI 5IJDC 1G4MA 35C8H 3NSYA 4E9RA 2UVFA 1XX9C 4H44C 1U91B 3DLQR 4X9HA 2HT3C 2EADA 2I24N 5IROD 1T5KA 3CVHA 4IKJA 4MJ4A 5FHBL 5KBDA 4AG4H 4XNXH 1PD6A 4B9ZA 2ADFH 2K6WA 4WSGA 1S8DA 1MCQA 1R5VA 2X28A 5EEWA 4EBQL 3BZDA 1I3GH 3U6XA 5LNGA 1KJMA 2BIOA 1T6BX 2QJDA 3ARPA 3U36B 1I9IL 4V1DA 1OAXL 2HYMA 1V7MH 4P48A 5CKGA 12E8H 5E5MB 3VG9B 4FFVC 4WU5B 4JJ5A 4K7PX 1XQ4A 2ENQA 3VFOB 2NSXA 2F15A 3GMRB 4LLWA 4UB0H 3AROA 2P8MB 2ERJB 1O7DE 2JI2A 4NWTH 4Y5YA 5K9QI 2E6QA 2WN3A 3L08A 4MD0A 4QGYA 3V0EA 3DX8B 4QRBA 4HX1B 1KGCD 4JPVH 1ZSDB 2YQ2A 3RB7A 4P9ML 4XCCL 1H3GA 4P2OC 4Q2ZB 1LMKA 2BINA 3OHMB 4DN3H 1M7DA 5LBVA 3NZHH 3T8VA 1HL8A 1JGLL 5IF0B 3S2CA 1L5GB 1DVFC 5KN5B 1KELH 5DHDA 4LNVA 4XCYA 4WGKA 1QRKA 1R9FA 1DO5A 1ZV9A 1U93A 3OB8A 5F97E 3BE1L 1G94A 3NCWA 4ZX3A 1EXUA 1JXKA 1D6VH 1SPDA 5EO9A 2WIIB 3CZKA 5FHBH 4Z0XA 4JM2A 3WN6A 4AEIH 3VD0A 2FO1A 3HJ0A 1DEDA 4X9FA 1MVYA 1A0QL 5AB1A 4PRIE 4HWEH 4DFHA 5TDNA 2OW7A 5CEYA 5JXEA 1GZHA 2CIKA 3NACL 5CLWA 4Y1TA 1NL0H 3KPQA 4RX4A 5JOFA 5HGHA 4JFZL 1LEIB 1IBHA 2DM7A 3DTDA 1WO2A 4H20H 1A5FL 2AJXH 3P11H 5DWUH 4Z77A 4XP9H 1ZVYA 4XXDB 2WOYA 3WS3A 4Q0XH 5BVPH 1RHHB 4LBEA 2G5BA 2EE6A 2MKLC 3GI8L 4JO2L 5KJ4A 3BUIA 1BDYA 3DMMA 4LVNB 4YHLH 5C0DA 3TN0C 4K5MA 1ZANH 2BRRH 1QNZL 4RMVA 4GBXC 3S36L 4W68A 4KKCD 1T7WA 4BKLA 4JFFD 3ULUD 5IB3B 5AKSA 1SLWA 1NFDF 4RMSA 4W9HC 1PW3A 2F7RA 3NN8A 4HJ1A 3R1GH 4X7SH 4FN0A 4XNBA 4F33B 1DVFD 3H9HB 3U48A 4XPFH 4PVNA 2WAHA 1SEBB 5EV7A 3C09C 3FZUC 3AXIA 5DS2A 5AVWB 3P30H 3CZFB 4RDQF 3HBGA 4QMEA 5JW4R 4Z9KB 5E0QA 2HX9A 2Q86B 1KBBA 1VGEL 5DTFA 2VL5B 5I1JL 5IKCB 4J8QA 2AJYL 1E4HA 4ZFGH 4NZFA 5KBKA 2AQRA 4G7VL 3GSNL 4KVPA 3Q6FA 4DGVL 2AAVA 3EBAA 4CAGA 1IE4A 3FCGA 4KVNL 1OE2A 1DDHA 2EDOA 3V4VH 1A9VA 3N40P 2YAOA 3B9KD 5C7XH 5L4MA 4Y4FD 4X6DE 4HUUB 1BQRA 4HJUA 5E8EB 2VQ1B 3UBXB 4EI5B 1I3GL 4D9RE 3KHQA 4HCRH 5H37H 1JWMA 1YMMB 4XNYH 3PWJA 1YYCA 3KE0A 2ZKXA 2B9BA 1T83C 4A6YL 1MELA 3KL3A 3OHXA 5SWSB 1A3RL 1AZBA 3IEAA 5GS1C 4YHMH 2DQJH 2EXTA 1TZHB 5L0QC 3MLWL 1BVLB 3WELA 1OM9A 4DVRH 3BDYL 4WO4A 1KB5B 3LTVA 3UG5A 3KWXA 5F1NB 1JDDA 3B3BA 3Q2CA 4GG6B 1NLBH 4ELMF 1DBKL 4YDVB 3IS0X 4DGYH 2ICWJ 1OF0A 2G0KA 2OI9C 3O6LL 4IU2A 4B9CA 1ODUA 4JZJB 4Z3FA 3FT4B 1S9VB 4UDUB 4CVWA 1E27B 3TTYA 5B8CA 3QUYA 4XX5A 3VWKC 4W9ZA 3KCPA 4TNVK 1J9TA 2O5XH 3NH7L 4A04A 4GQ9L 3LPWA 4QWWC 1PG7X 4EUPG 1UOVA 5BUPA 3SO3C 4IBWA 3SO3B 4HUCA 1N2RA 1HI6A 5AOKA 1FLRL 3NCXA 3DHJA 2HLAB 2DI8A 3HUJA 3W39B 5HI4C 3KGSA 4E9LA 4Z7IA 2CA3A 4KOCA 5MEPA 4UU9B 3EKCA 3GSRB 4I88A 4QHLA 1EJ6A 1TCRB 1KGIA 5IB4A 1A3RH 1XR8B 3VXUD 3SOBH 2ZTBA 4NO5B 3G7TA 3CVIH 3MCKB 3RYMA 2X2IA 3VGFA 4LKCA 4GLRI 2PCXA 1TZOA 2ZPKL 4FTDA 4HMEA 4JFWA 3S48A 1H3PL 1G7JB 2FGZA 1J9SA 2X4TB 1AD9B 4KV5E 5MEOA 3CV5A 3IF1B 2FGWL 4OZHA 5JR1H 4R96A 2GCYB 3B3IB 2VWEC 4DN4H 1UUSA 2H6PB 2MRYA 3GSRA 1I85C 3K8MA 3W0WB 5T3ZD 2RFXA 4L3CB 3CLWA 2VXQL 4GT0A 5K59E 3OMZA 4M7JH 3SDDD 3D30A 4HCGA 5F9OL 3G6JA 3VFTB 1F4WL 3KM2A 4K3JH 3FQWA 3Q9PA 1CLOL 1IC4L 2G9HB 3EZ8A 3HB3B 3LSOA 4O2CB 3SQBA 3NZHL 3WAKA 1R3KA 5ETUA 1ETJA 3VH8G 4HKXA 3RIAK 3QCTL 3C5SB 4ZO7A 3RTQA 1LE9A 1EO5A 1AACA 3O3DB 4E9XA 5CEXB 5AVQB 4LRNL 1NLDH 2DLEA 2VERN 2HN7A 3EOBB 3LYRA 1XFPA 1ORQA 3LVTA 4PJXE 1OTSD 2FHBA 1CQYA 5DZNA 3RUGA 5F7LB 5E4EB 5ABZA 2CKBH 2EKSA 1I7ZA 1OD9A 2VXQA 4PSPA 4WFED 4KTGA 3L7FA 1I82A 3FRUA 2R59A 3PL6A 3OKKB 3ARWA 3PG2A 1SQMA 4KU1A 2EH8L 4JPQA 5EF3A 4WAFA 3HG1A 4OCNC 4HHGA 4Z3EA 1UC6A 3ESVF 3ME0B 4TLUA 3ZT5A 1MHEA 3EGSA 5FM8A 3D39B 3R7RA 1YPZA 4FKHA 5BOPA 1E5BA 3HMXH 1AQDA 2VXSL 1RUKL 1YEGH 3ESPA 2FYYA 1VA9A 4JKWA 4S1QH 3TX4A 1OE3A 1AGCA 2Y5EA 3PHSA 4WI3A 5TPWL 2Q8AL 4DOHB 3FONA 4YQXL 4GUQA 3ZUNC 3P77B 3DV4A 1JNJA 1NDGA 3RRQA 5CCJA 3ML8A 2A6JB 4A2GA 5HVHC 1PL3A 4B27A 3P3SA 4TLTA 2MQ3A 4QTIL 4JDTH 2NY2B 3L81A 5TE6H 1GYCA 2B7DT 2HLEB 5SV4A 5KS9B 4M7LT 1H9VA 1HTYA 2LE9A 1KCWA 3MV9B 3VD7A 3SQOH 3W9DB 1N8ZA 5HPMB 3B2VL 2YXMA 4WFGE 1NDGB 1LO0L 1J05A 2HKFL 4L0ZA 1A3QA 3ZHKA 3BWAB 3WD5L 2F08A 1FORL 5EO1B 5C6TL 5D70L 5MEND 5JQHC 4N0CD 4G8FA 5KSVA 4ZOAA 1L9OA 5DC9B 1UD2A 1I7RA 4P23A 5HVFB 5HHXH 4YDNA 4OCSH 1AHWC 3HTLX 5L2KB 3KR3L 4ADIA 1AHWB 2VUKA 3BAXA 3MNWB 4AYGA 4DP5X 4WSJA 3VWJD 1KN2L 1S3KL 3SOBL 3ULVE 1VEPA 1YNKH 2B15A 2E9IA 4KPHL 2JB6A 1OCZB 3GMNB 1NEZB 3ZKQD 4L37A 1REIA 1WF5A 1T0NA 1N4XL 4GAYA 4PYGA 3QXAB 4ZFOB 1D6EA 1B90A 2VR6A 2QFPA 3U6RA 3V5HA 5L4FA 4AQ8A 2IDSA 5AW9B 4GW4B 4KKLC 1HQ4A 4ZBJA 4NQED 4L9LA 2PO6A 1ILSA 3GBML 1F2QA 2IH3B 1MHHA 2Z93B 3KCWA 1DVYA 4H5SB 1I7TA 1I4FA 4JL1A 3PAYA 3PP4L 1WZ1L 2JLPA 4MDIB 4LVOC 4ELKA 3NRPA 4LVOB 1FNFA 1RZFL 4WEBH 5D1ZA 4EVNB 3QIUA 3KPTA 4YAQB 3HOGA 4F9LC 3AJ7A 3K3QA 1F11A 1UM5H 2H5UA 3HG0A 4HETA 5I15L 1NMCB 3APFA 4QRAA 3KYNB 5DJ8B 5BRQA 4IKNA 4HISA 3UP1A 5HYSG 5B3SB 3PPSA 5E6IB 1S7UA 1GHFL 5DO2C 3BPLB 2YXFA 1PZSA 3SZ6A 4KPHH 3UDWC 3UTPE 3G6JF 3RFZA 3WL9B 4L3EE 1JHTB 4TKWA 4JE4B 4ETQA 4Q58C 3F7KA 3OAUH 5IFHH 3S35X 4X9GA 4ZD3L 1NCJA 5TF0A 2YPLD 1CFSA 2YUWA 3QQ3B 1KZYA 1MWAL 4HIPA 3VJ6B 2VLKA 4NQDA 3O0RL 4U6VH 1NCWL 5MENB 1NCCL 4A37A 4LNRA 4YC2C 3FB5A 5FUZL 2YSSA 4OJDH 3H4HA 5DRXB 2L7QA 1UM4H 2RD0A 5DJ6A 3LEYH 5F7KC 3ARGD 3V4UH 5I17A 1CO1A 5AG9A 4AEFA 5D1XA 2WKGA 2XV0A 1VLXA 3STLA 4XBEL 2HRPL 3EJZC 5IFAH 5C0ND 3P9MB 3PDOB 4RETB 4NZ8A 1A66A 2ZOKB 3EAKA 3VVWA 2H41A 5AVUB 3TO2A 2Z91B 4UOW0 4X7SL 5JOFB 4N2IA 1J5HA 2R39A 3L4XA 3O4LA 4MXQC 3U0TA 3HIZA 4ZJ9A 4ZS7L 5F88B 5JIKA 5CP7A 4U6XA 1I75A 5ID1A 4NT6B 5IFHL 5A16B 5T3XH 1ADWA 5HYJB 4A7QA 4KROD 1VZGA 4M6ML 2PETA 5ILTH 5GS1A 2EIBA 3O3EB 4BHUI 1ADQL 2NTSP 3OPZH 4G7VH 5IB3A 4JG9A 2DQCH 2VR8A 3ROOA 1BZ8A 3EHBD 3T0AA 4PJEA 5FGCE 4R0LC 2CLRA 2ESVA 5B39A 3QAQA 4XP4L 1SDDA 3LRSB 1UYWH 4OAWA 1VFBB 1J5IA 5A16A 3C8DA 2GT9B 3CZFA 3HC2A 2WBJA 3ZUCA 3COOA 3QULA 1MCPH 1V05A 2NYYC 1UA3A 4J23A 2VXTL 5EU3B 1NIEA 4JO4H 4NWUL 2ZYHA 4MAYB 1GAFH 4ZDHB 4G43B 2EXYD 4N90D 5AYUH 1WC7A 1LYQA 2KHAA 2YC1A 3CXDL 3FTZA 3N5AA 3QWNA 5AOIA 2OK0H 5KYUB 4QT5B 1DDHB 1LLAA 3L9EA 2VJXA 3ARFD 4BQ6A 4RFOL 3N3EA 1JPSL 4BSWB 1ASPA 4H2CA 2HJFA 4OFYA 1YJDC 4WTXA 2FHFA 1T4KB 1TLMA 1WCQA 3IXAA 4G8GD 4PM1A 4XMKL 3GUTB 4LCYB 3P9WB 1INDH 2BXYA 2XA8L 4MAUL 4N1CA 4PREB 5ABDE 2FQEA 3V6ZB 1SRDA 2PCFB 5BO0D 1U8CB 3H4FA 2VR5A 3BEWA 3VXRB 2CO3A 1L6ZA 2VLRE 4WU7B 4UOQA 5I1IL 1GY2A 3E80A 3VVVA 3HRZA 2BDNL 3NCCB 1LJMA 3LPOA 4PRHA 4AITA 1F41A 2DLIA 4ZNEE 2FEEI 4N0YL 2XZCL 4FQLH 4MMXB 1L6PA 2ICES 3TZVA 4M7LL 4JN2B 1HCYA 3MR9A 3ZW3A 1AQKL 1W0VA 4IYKA 2WO2B 1QZNA 3Q2WA 2VC2H 1DJZA 1F1AA 3VFPB 1UWXK 3UJTH 2JJVA 3FC8A 5EWIH 3BUPA 5FW8A 2OK0L 2IPTL 3UAJC 2VH5H 1TJGL 2V3EA 2XFXA 5CJ8A 4FLRA 1ZA3B 5IBTL 3I9AA 2GK2A 1TJXA 4ZRGA 4FQ1H 5ADPH 3MI6A 4FJYA 3EJRA 3P0VH 1MFCL 3SDAC 1U8HA 3PFUA 4JN2A 2AJVL 4HS8H 4LSQL 5E4IA 3RWDB 3V7MA 5DS8B 1BFSA 4NJ9H 3ATAA 3RWCA 5HYIA 3T6QC 1AO7E 3AW5A 4BQ8A 4WUUA 3UBFA 2CHDA 5J1TC 3BFQG 1HXKA 4GJTB 1DCEA 1K3IA 2WQXA 4G7RB 2DZEA 3SBRA 4DK5A 4UMSA 4M9OA 4YBQC 1RIUL 4OFVA 3LN5B 4HGWA 2H26B 4L1LA 1JXJA 4CDGC 2XZCH 3U7WH 3C6EA 3V9FA 4A7GF 1KTBA 3IRCA 4D7BA 1F90L 5D6DA 1DQML 2WZAA 3SGEH 2P5EB 1F4XL 3C09B 2OMNA 4FZ8L 4PLOB 1I1FA 3BKYL 3S9DB 3OX8A 2DIAA 3L3JA 5FECA 2F53D 4OKVB 4F2ME 1NFAA 4H13C 5F2FA 3VWKD 4IU2B 1H6EA 1A1MB 3VXRD 4F15C 5IMMA 1G9HA 5JMRA 3JWDL 3WIIL 1TIUA 2V0AA 1ORQB 2J44A 1XF1A 5SWSD 3ZL4H 4IRZA 1KY6A 3UC0L 1INEL 4OCYL 4N9GB 1RH8A 1SEQL 5FF6B 2BSTA 3U2JA 1BLNB 1AKPA 3S3CB 2V8LA 3LKQA 4L1TA 2D3NA 1CLZL 2WZ5A 2EUWA 4QO1A 2XQYK 4CMHB 1TITA 5GRUH 2NSQA 2A9ML 4LIQL 2XG5B 1A9BB 5JORB 2W9DL 1L9SA 4AW4A 5A2IH 1AD0B 1F13A 2WJ7A 1VGKB 1WA2X 2MTAA 3QIBA 2HWZH 3QJQB 2X42A 1T1XB 4FQQA 4CU8A 3P3YA 3ABZA 5C0EA 5DYOB 3C5ZA 3OJDA 1NEZG 2JIXA 2W0LA 4B3VA 4GO6B 2GCYA 1OM3L 3EUDA 3NJXA 2R0LH 4CRPA 1KBKA 2WYZA 3OAUL 3RI5K 2KMWA 1E4WL 4E42B 5DFVC 3FQNB 4I0CC 5AKRA 4YSUA 1VEMA 1A9BA 5CZVH 1K5NA 4XOAA 1A7RL 5C3LD 5C9JA 1JZEA 4Z7QB 4UMGA 3FOMB 4YR6A 4NUJB 2XWJA 3AU1A 4FQJH 4PJIB 4ZMWA 1BFOA 1ZHLB 4G8IB 4E9WA 5GRYA 5KJRL 3C5SA 5LN8A 1C7SA 2J57A 4I4WB 4XNQA 1O5PA 4LPCA 4JL2A 1PLGL 4OQTL 5C6PB 4PBVC 1MIMH 2AJUL 4X5PA 3MJ9H 3ZT6A 1QNIA 1YYLH 1KZQA 4WHTA 3NCJH 3O9WD 4V1DE 4WWKA 5A2AA 2Q5BA 1OWWA 1JP5A 3PL6B 1K5NB 4P5TA 3PP4H 1O0VA 4ZW7A 3MV01 3U0WL 4DUVA 4MA8H 1CXIA 4KKAD 4N5ED 3M17A 4YNYB 5DC2A 3DWTA 4YHIA 3WDJA 2FD6H 3EDFA 3MRQB 4R2GB 1CTMA 2YBGA 4TSCL 3QYCA 2GK0B 3DO7A 3QXAA 4ZFOA 2X2YA 2BNUB 1NFDA 5E2TH 3TNMB 1ONQB 4IBYA 2IEPA 3R06B 2CK0H 3RVWD 4FQ2L 1BW8A 1MI5A 2EDMA 1BCIA 4XMZA 1BJMA 2XTJC 4YOKA 3GC3A 4ZOEA 5EOCJ 4X4YB 1HXYA 4UYPA 5ESVA 4NNYA 5GGTA 1E5AA 1GCYA 3NABH 1IFRA 3D0LB 4XRCA 1U8IA 4MNHA 4NJAH 1CDGA 5CFHA 2E86A 4PFEA 5M94B 3ZDYF 3OVUB 4F8LA 5JXAL 4IMKA 4JFEE 2PXYB 3HHRB 4JFOA 3QRGH 4ILDA 2PLTA 3OXSB 5IB1B 3FQUB 3GIVB 4M1DL 5KSBA 4UNTA 1SN0A 4GRMB 4ISVA 5EO1A 4PH8A 3TH4T 4KJYB 2PPAA 4KMTL 3WL9A 2VLRD 4NBZB 1OANA 5E8NA 3HS9A 1IX2A 5ALBL 3CXDH 3QDMB 3FB8B 4AQAB 1ULVA 1WBXA 4YXKL 1WFTA 1MCOL 4GG8B 3ARQA 1M71B 3MRPB 5HXMA 3FQYA 4X4XB 4NZRH 2WWKO 5LKNA 1ZGLM 1DQLL 4LU5L 3EDKA 3QUKA 1KGCE 1BQKA 2CBOA 1KJMB 4ZUVA 1U4EA 4LNRB 3HAEA 1RJYA 2OXGA 3V0FA 1JGUH 4OZIB 1BQ5A 1PGRB 3J2PA 3QJOA 4PLKD 1U8MB 1AZCA 3IE4A 3GMPA 1P7QB 1F3JB 4RVBA 3MUUA 2WWNA 1SVZA 1HE7A 3IFOB 2ZWLT 5GZND 1IGFH 3FB8A 3PWPD 1FVDB 4IBSA 3MLVL 1W72A 1OAQL 4FNRA 3O6MH 4GG8A 5DGQA 3WJMA 1JSYA 1ZE3C 2AQNA 3ISYA 3VWJB 2GJ6E 1A21A 1HHGB 2XKNB 3GDBA 3GEWB 3V5KA 3LNGA 4PGDA 1CFTB 4HJJL 4KTEL 1CF8H 4XNUL 1R17A 1VIWA 2NY5L 4H7VA 3BZEB 1DR9A 1PMYA 3VXMA 4XO3A 4X6CA 4Z7VF 1EAPA 3AACA 1F3JA 2F19H 2HPTA 1JUFB 2CRZA 1GMEA 4AZUA 1NGWA 4IKIA 3SOTA 1E2VA 1OF2B 1UATA 3NCJL 5DMIH 2V2TB 5KYYB 1BQHA 3H53A 1RK1A 3IJEA 4L4VA 4XP1H 3T2OA 1MDTA 3G5ZA 3MRDB 4PJAB 3T6ZA 1II4E 2QSCH 4UZSA 3RPIA 4ETQB 1H19A 4MSWB 4ZUUA 1P5VB 2AJSH 1VCBC 2PNDA 3SDCA 3QZBA 4LEXL 3PGFL 4PS8A 2PTUA 3P40A 1FNHA 4N0FB 3INUH 2XETA 5IBLD 3MXVL 5BV7H 3WE6B 4APQD 2ENPA 1GKEA 1IGFL 3FFCD 1IKFL 4IOSD 3QEGH 1T7YA 2E4TA 3FN3A 2YSSB 2ZOTA 3G5ZB 3MRDA 4FFZH 2QVIA 5J11B 2YPKA 1T5WA 2P5PA 4UT7L 1CU4H 1QBAA 2ZUXA 3MLYH 4RAVA 4DEPB 1IAIM 4BDVB 2EE3A 1KXVC 2WP3O 5D2NC 1IC7H 1YEJL 1RZKL 1DO6A 2LR4A 4TSAH 1NEUA 1PFOA 4FNSA 3RY6A 1N0LA 2X3AA 3MLSL 2YUXA 3MGTB 1EQWA 2A73B 1J8HA 4QTHB 1HK6A 2SODB 2P45B 3ZMEA 2BNRE 3BQUA 2XOTA 4PEEA 1JF1B 1WUNT 3JTBA 1L7IH 4CSSA 4QLRA 3O4LB 4KMTH 1XGTB 4R7VA 4F5CE 3PHQB 5IJKA 3DUSB 3ATEA 2Y06H 3P9LB 1PKQB 2FSEB 3U4KA 3VYOA 3QFDB 4L0PB 5E9DA 2IPTH 2VDLB 4PJHE 4BQBA 5DUML 3HB3D 32C2A 3PWNB 2OTPA 1XF4B 4UF7C 5IHZA 5G2NA 2GW5A 2D31B 2G2RA 1F1GA 2NOYA 2PWDA 3U82B 2FE0A 4GRWF 1OAUL 2AK4B 2AJYH 1EPFA 1Q9WA 3IDUA 2UZXB 5TQ0L 5EORH 2CM5A 5I6XC 2J6EL 4WW2C 3VFRA 1JMXA 3P9LA 3BVUA 1SQ2N 3H56A 3LDBB 1F42A 4IOFD 3U9PL 3H3KA 1E4KC 1FL3B 4UBDC 2WLMA 1LNUB 2ATPA 4J39A 2DL2A 1GC1H 3RWFB 4KKPA 1SDYA 5FCSH 5CR1A 1KXQE 2ICEB 4R8WH 4WV1C 3VFVA 5GJTL 4CN6A 3KPMA 2NY2C 2TRHA 1L7TL 1MCFA 1C08B 1G1KA 3RUGF 1FZOA 1CICC 3L7EA 1M7UA 1M05B 1GL4B 5FWRA 2D4FA 3WNNA 3EHBB 5ALCH 4JZNB 4F92B 3OKLB 3T71A 1UD8A 1ZT4B 1G5AA 4GSDL 1ZTXH 4XCEA 4LCYA 1F3DH 4ZPTA 4F8OA 5JIDA 1QNZH 3NFPB 3S36H 4KTDL 1A6WH 3BVTA 3MAWA 2W81C 4YLBA 3WO3B 1RULL 1MH5B 4EQ2A 2CD0A 1FV1B 3M1BB 2DQFB 3WYRA 2OTUA 2GQHA 3X2QB 2HAZA 2D4DA 2HFFB 1MNUL 4ALAC 1Z9LA 1XR8A 2WO3B 4FA8A 3KPPA 4G2AA 3X14B 3EYOA 4FGMA 4ESKA 3FBQA 43C9B 3HR5A 4DO4A 3U0PB 4OIBA 2ZE0A 5CU9A 2VDRH 1BBJB 4DP8X 4ZXBD 4P59H 3MR9B 1G7JA 2FJGB 2ITDB 3CDZA 3I2CL 4QRRA 1OB1A 2IDTA 1OD7A 3FF8A 1K8DB 3MJWA 3LKRA 4RX4D 1UUNA 2Z7ZA 1AGBA 1CD1A 1U3HD 2B9AA 1IVTA 4HFUH 1TQCB 1GH7A 1S9YA 1A02N 2AXFB 3CSFA 2HZHA 1U6AH 5AW2B 3RTQC 4JG0L 5E08L 1XIWD 3CH1B 1BXAA 3CFCL 3GXNA 3FCTB 1MWAA 4UQAA 3S5LB 5F3BB 5JHDA 3Q1EA 2YKLL 1LDPH 2ZKHL 3BHBB 3MACL 1O9ZA 4YXHH 4QOKD 43CAA 3WEAA 2FJGA 2ITDA 3BZFA 3QPQD 1ZRUA 2YS4A 1NGXB 7PCYA 5HYSB 2XG5A 1T3FA 2VISB 4CBZA 1EO8H 3NCYP 3HAEH 4OB5L 2VR3A 4UTAA 3S8GB 3RNKA 2AXWA 3HEIB 5FA4A 1GY1A 1J86A 5HHPB 5DUMH 3T0EE 4JFDA 3ZDWA 4KKNA 4ELMA 3LN5A 4XWGL 2H1LM 2P47B 3CU7A 1E28A 1Z9OA 2JJSA 4HEME 5K93A 2A6KB 2BIQA 2PW2A 3KH3A 4RZCB 3BHBA 3LZNA 4ZAKC 1KC5H 4YSQA 4P59L 4UB0L 4OU3A 1G7IA 1P4LB 2A7BA 3JV5A 2UUDK 1GGIH 4HIEA 2MEJB 1JAEA 2JSFA 3RY5A 2DEYX 4G1EB 5E8OA 3ZKMD 2UXVA 1PAMA 1FL5B 1MLBA 5E08H 1RZKC 4YK4C 1XHHA 1KXTB 1XF5B 4LESA 1Y18A 3JT0A 1FN4A 3D8MA 4LAQL 3MOAL 2QADD 3MACH 4YXHL 3SD2A 2IH8A 4MYWB 3WMSA 5EH1A 2V7HB 4XMLH 3T65A 1EAQA 5FYLH 4XPAH 4L8CA 2HRLA 3JV6A 1M2VB 2Z31C 4YNYA 5D6DC 4M5YH 4P2YA 4WENB 4HK3J 4Y0GA 4JS7A 4GRWB 1ECZA 3GMMA 5FHAH 4JJOA 1NC4D 3LRMA 2UXTA 2ZXBA 4PY7B 5ITBH 2YPVA 1B2WL 4JHAH 1BVKA 4FZEL 1ROCA 5D9SA 2E27H 2RCSH 2WVVA 5FFOA 4C8XA 2MPAL 1I31A 2DWEA 4OJYA 4PHXA 3DIVA 1CJYA 4UTBL 3WJLA 3ZKXC 2O61A 2PO6C 4M8QA 4OSUH 4YIQB 1RZJC 2NUTA 3Q43A 2F7OA 1ITCA 1V3LA 1BMWA 1R34A 3DMMB 1UWXH 2G5RA 2YHGA 4X6FA 3VD3A 3U6RB 3CLEH 2DQIL 1UWFA 5JA8B 5I1EH 3ZE1F 5ICZB 2QADC 3DXAD 2WKOF 3D85D 3RKDC 4LQ1A 1WH0A 5KSAB 1EAOA 4KO7A 3OZ9L 4N8VA 4HT1L 4X4MA 3TEYA 3BP4B 4HUMB 4XE5B 2OYLA 5EEYA 2LHAA 4H0LC 3CFCH 1ZHLA 4M3HA 5CWSA 5C8JA 5J11C 5EZOH 4AQ1B 1JHLH 2BXZA 3I9PA 3VI4E 1RSFA 4G6JL 2VTFA 2UXFA 4P9HH 3C6LD 2P4AB 4DEPC 4KVNH 2W07B 3B6SA 1PZ3A 1V5JA 2ZP9A 3NSCA 3PXHA 2DM2A 4CJ0A 1QSFD 2CJUH 4ZFQA 5TDPA 3UERA 4C58B 5I6OA 1X6NA 4AMXA 4KKAC 2FLMA 4TSAL 3LD8C 3CBRA 2B4CH 4I18C 4U1MB 5LGKA 5DZJA 4XO4A 3K5RA 3UTSE 4D0BB 4PJEE 1FYTB 5D7IF 4RGNB 2ESVE 2FSDA 1PZUB 1NJ9B 1U8MA 2XFGB 1IGYA 1RZFH 1WIPA 3FUEA 1Q9OA 3NSDA 1W72L 4GEJA 5DQDH 5B1JC 5IK3A 1ACYH 3G04B 1PZ5B 5EU4B 4XCFL 4HUXA 4KUCF 2DWDA 3PWVB 2YQ3A 3RHWF 2RR3A 4Z0XB 5IT2H 3IK2A 4LFHG 1EK3A 4Y2OB 1CFSB 2ZUQB 3NCBB 3RDTC 4Z7OF 3B2VH 4LSUH 1T1YA 1BVLA 2FUTA 4P4KB 5CEYB 2VW7A 3RWIB 1SUJA 1A1NB 3MHZA 1N3NA 2FNBA 2EDHA 2ZG3A 1AHMA 1OTSC 2QR0A 2HG5B 4ZFFB 2QPFA 4Y2LA 4FF9A 3SY0B 2WAQA 4X4ZA 3KHOA 3G04A 3AUWB 4J3OH 4LSPH 5EU4A 3CHRA 4UIMA 1D7BA 1RZGB 3LS5L 2IIJA 5IB1A 1YEWA 3RJDA 1IKFH 3IDMB 3PL6C 3BX7C 2QGEA 2X6AA 3UZQB 1CICA 1VACA 1XB8A 3I74A 1KCSL 5EBLB 5GS0C 4AQ1C 3EYQD 4JJ5B 4JDEB 4RA3A 4XOBA 3AU0A 4KQ0A 4U1SB 2NUPA 1SJHA 2OMUA 1ZJBA 1IFGA 3MODH 4ANWA 5F88A 1KJVB 4AH2B 3N1GC 5AKTA 1EO8L 5AAPA 3L3GB 4NT6A 3OMNB 3GHBH 4GKSA 4EIUA 4AYDC 2FBJH 5F1SA 1KCVH 3DPBB 1U8OA 3MBEB 2PCPB 1CGVA 2V17H 1MW0A 5FGBC 2VW6A 5BOJA 5JR1L 1EXHA 3GQFA 4MNQA 4JDEA 1J0IA 3PP3H 4GS7B 1CLYL 4WEUD 5GZNC 5INDB 1VFAB 4IDJH 2XSKA 3B2MA 4Z7NE 1RZPA 4AGLA 4AH2A 2HH0L 2WYIA 3D4YA 3AWEA 3W0WA 2CGRH 2BIMA 5FOJA 4XODA 4AWJC 1CYGA 3UMTA 3K7UA 3K81A 1Y1UA 4LHUD 3A67L 4LGPB 1RY7B 3SBQA 5BO1H 1R3KB 4JMNA 1NCGA 2IAAC 3NCMA 3DUSA 2BP5M 3LZOA 4ZD3H 4H20L 3RVWC 8PAZA 4YHZH 4EN2A 2NQCA 4CVXA 4A2HA 2AITA 4RDQG 4XAWL 2NX5A 3NA9L 5HHQB 2AV7A 4DP7X 3SE4A 2B4CL 4JANA 4NOBA 4K7FA 3P3TA 4ZODA 3IFLH 4Z3GA 2OR9H 2OX5B 1TVDA 2EKSB 3JWOH 3N85L 1N4XH 1U8KA 2G2PA 2IALA 3CVBA 4GUPA 2WGNB 3NN8B 4NO3A 1D7DA 2QKIA 1VHPA 4K8RD 5I8CA 3G5WA 4S1QL 2JKLA 4M56A 7FABH 4XPTH 4GQQA 3HZYA 4AIEA 1OXYA 1JRHH 3BSZL 3SCMD 5D72L 1AQMA 4NKOB 2DJUA 1MFAL 1UXSB 2QLVB 1I8LC 4L5FE 4DQAA 1A3LH 1E5YA 3OBAA 4N0UA 4Y16A 4DN3L 3O3UN 1VFOA 4MQSB 1IIIA 3O81A 2BZCA 3PIQB 1KEMH 1U8KB 4GUPB 3QIUC 4MDRA 5EIVA 5KBLA 2R23A 2EDTA 1PDKB 1YDPB 2VABB 1CFMA 5A6LA 3JSSA 1ODAA 2IPUG 1RXLA 1U8LA 2Q3AA 3SJVD 3SPJA 4HHAA 1N67A 3WNOA 5C07D 5BZDA 3QRFM 4KZEH 4R5XA 5BRZB 4AGMA 2BDNH 3WD5H 3E3QC 2O6DA 4P57B 4OZGA 4QF1A 3D18B 5J6GA 3KWWB 4QUOA 3QFJB 3OMAB 2OR9L 4N0UB 5CD3A 3RVTC 3BWAA 3CZJA 4PJAE 4OI8A 1KYOJ 1R19A 3QG7H 4JEGB 3D0VB 1YDPA 3KR3H 1XO8A 1KB5A 1U8LB 4MJ5B 1JZ6A 3KPPB 4DP4X 2FCBA 3CE1A 3HBPA 1N8OE 1NWOA 4AIOA 1OCWH 2A4CA 2APXA 2JK5A 3OKEA 4YPGA 2DWTA 4NP4H 3VXSD 5HHOA 3FB6A 3RY6C 3PWPE 2MHAB 1NH6A 2GJJA 1MJJB 4FNQA 4TYUA 1JXFA 1VZIA 1FF5A 5AFAA 1YN7B 1NC2A 2GJ6D 1B0IA 2MPAH 1LQSR 1Z3GL 3DSNB 4ZMTA 1AO7A 5ID0B 5KVEH 2EILB 2CGRL 2Z8WC 3K1KC 3OKEB 5HYFA 3IKCA 1G1OA 1I7TB 4WI6A 4MASA 1C12B 3HS0B 2D03L 3SYQA 1X5LA 1JD9A 1DZBA 1IAOA 4DESA 2DMGA 4S1RL 3L1OH 3DX7A 4PGJA 4JVPA 2V5TA 2YN3A 1B6UA 4LOUD 4N26A 3CFEA 1XB6A 4NQEB 4M6MH 1I3UA 4KDTC 1OP4A 4XCEB 1H5BB 4Z78A 2HX8A 3LKNA 4DTGL 4IRZL 3H2WA 3HC0A 4JO3H 3NIFE 4M7LH 4X7CC 4CVZA 1CDCA 1U8PB 4M4RB 2RQ8A 5EIQA 4JFZH 2B20A 4K3GA 3AREA 3GJFB 3O3BA 3IWVA 1UEYA 4NEHB 2Z9TA 2J8UF 2ZXAA 3P0YL 1NWPA 1B9KA 5J1AB 5DSCA 2H9GA 2F7QA 1U92B 4CA4A 4QXUH 3VRIA 1OGAE 2Y7NA 3RWGA 1NBVL 3VX1A 1EIBA 1CFVH 2A83B 5DYOA 3NMEA 5EPMA 5MI0C 4XC3L 1CLOH 1IC4H 4NIYE 3TO4A 2WB1A 1FNEB 4OQTA 5C0BA 4I5BA 1KLUA 4JGJA 5BNXD 1QO3B 2NLJA 3GRWA 1AIZA 5HGBA 2XZQH 3L5XH 5AKVA 2YAPA 5H4YA 2O5XL 4QIRA 1N64L 5D5MF 2Y24A 3QC5X 2JCCE 3F84A 2AMUA 1NEZA 1N59A 2YPLB 3CK0L 43CAB 1QG3A 4NHUB 5BVJA 3MRKB 3TEZA 4QAWA 4CKVX 1MREL 2J4WH 4MAUH 4ZXBB 2RALA 2C1PB 3LMJH 2W9EH 4LCCA 4R5VA 3IN0A 3FONB 4G3YL 4TQHA 4L9LB 4HGKC 4AMKL 1KNOA 3GTTA 3T8XB 3ULVH 1F4XH 5TDOA 5CZVL 5CP7B 2NY3D 4J3OG 4RMUA 3PF2A 4X5QA 1JZHA 2ZG2A 4NXSA 4ODSL 4YX2H 4M8QB 2A38A 3OJ2C 4RZCA 1FNAA 2OMVB 2BRQA 4J8RB 2AEPL 2G9KA 4HMCA 4D3CL 3FJTA 1E5ZA 2KPNA 4C56E 3MODL 1EJ8A 4P99A 3H42L 2COVD 3T0BA 3IM1A 5GRWA 3KYNA 1E4XI 2C9QA 5DEFB 2FECI 1NCBH 4N2FA 4H8UA 1BX2B 4NRXA 5I0XA 4XTRD 3QXUA 1INEH 1URLA 2H2PD 5D1QB 4X4YA 1FG2A 2LQRA 1DBKH 1XF2B 2P8PA 4KRPD 1EHKB 4U1JB 4ETYA 4LCIH 3BGMA 3B6SB 4GKLA 5F71A 1YQVH 5IHHA 3RZCC 1NFDE 2Z31D 5DGRA 2R1WB 3SDYL 4LO9A 2OQJA 4I7ZC 3UTQB 2BSEA 1TPXC 1SXAA 3IJSB 1FYTA 1Z5HA 3EG9B 5DVLA 4FLOA 3ILPB 3FPYA 2VLJD 4N2LA 3V5HB 1KELL 4U05A 4MXWH 2AJ3B 2H3XC 3T4YA 3DETD 3GS4A 4NQSA 5FYJU 2L04A 2XWCA 3CQPA 2E74C 5EOTA 4U2YA 4XCNA 5ENWA 5I16A 4PJCB 5KVDH 2EXYC 4H8VA 5IP4A 3KLQA 3H8NA 2IWGA 2WJ5A 1U8CA 1YHPA 3RIKA 1UGKA 3IFLL 1NGYA 3ECWA 2OM5A 4P4KA 1XIWC 4HXAH 1ND0A 3H9SD 3MSPA 2NUTB 3S0PA 1O6VA 3NACH 3SE8L 2O6FA 3BD4A 2DQCL 4PJCF 2H2PC 1S7VB 4AMWA 4KNTA 1CLCA 2R0WL 2R2BB 4JRYD 4R4BB 4MA3B 5F6HI 4AVIA 4LCUA 2NW3B 4QTIH 4DJMA 4M5SA 1UYWL 3CFIC 5EOTB 5I16B 5I6XB 1J8HE 4PJFF 4UIMB 3ABGA 2QQNH 5I24A 1MIEH 5BVPL 2PP7A 1FVDA 2BIPA 4WUUE 1HHJB 2OAAA 4L29B 1UM5L 4AQEB 1GJIA 3FS9A 3QI9D 4TPRH 3IMVA 3MRJB 3TT3H 3QIBD 3UZQA 4F2MB 5KYWA 1DE4A 2OSYA 4IGBA 4NM8H 3K74B 2CPUA 3ZE2E 1Q9KB 4M62H 4DGYL 4AEHL 4KTYA 3CPLB 4LDOB 4KDTA 5BZWA 4IDJL 1NCAH 1G0YR 3KAAA 5FB8A 5HHVL 4WJ5B 4B6ZA 1UASA 5B21A 3QQ3A 2C7FA 3UAJA 1I8KB 2GT9A 4XZUA 4PYHA 1CL7I 4QRPD 2E7MA 2CDFB 1V54B 1KIRB 1PEZA 5D6CA 2K4AA 2K3TA 2Z7WA 3P69A 1D2PA 4F2MA 1FSKC 1DE4B 3T3PE 1SYVA 5E5MA 4W6XB 4S2SA 4Z3HA 3O6KL 4MSWA 3GBNH 5C97A 3LHAA 4LBAA 1CF8L 1IM9A 4XNUH 5HDBF 2EIDA 3IE9A 3QC6X 5E9AA 3RPBA 3VGEA 1ZSDA 4XP5H 2LABA 1OZTG 3CFBA 1PG7H 4K3DH 1BQHG 3REWB 3O9WA 2XUWA 1ZHBB 2CDFA 2Z91A 2DTSA 3AITA 2MJWA 3EJYD 5HDBB 5BZZA 2AERT 4NFDA 1RIVH 7FABL 4DN4L 3RG1C 1ACZA 5TJWK 2ZAIA 4EIBA 5IVOA 3GBDA 3H55A 3I6KA 1XGYH 5EO9B 2VOTA 4WI4A 2NCMA 4GB9A 4Y89A 4P2OA 3ULUE 3AS3A 1HESA 4FG4A 2YA1A 1VEOA 3GHPA 4WO4D 3H3PH 3K6OA 3O3EA 4NKDA 3F7YA 2WTPA 3LNDA 4J3WA 1OK8A 3WKYA 3KPQB 1JGUL 2BS8A 4IRJC 5I8CB 3OKYA 4BE5A 4YHKL 4WY7H 3SKOB 2J25A 3AZUA 4BM7A 1F4YH 2FT7A 5F1KC 1W9XA 4F57H 2QQQA 2VE6A 1IB5A 1PKQA 1FO0H 3MLYL 5GZOD 4BFNA 4XI5D 3EOAA 4C56D 5D71H 2HMIC 3WNIA 3MLZL 4XP4H 4D9QD 1V55B 1V7NL 4Y4FC 5E99H 4QR7A 4RBPK 4MWFB 3Q8FA 4BKLB 3FKUS 1SOQA 3HNTL 3D12B 3PIQA 1OLZA 3RGHA 2X4OA 3IGFA 3APMA 1I8AA 5LGYA 4KK9D 4LK4A 3VCLB 2X89A 2EXWC 4B7IA 1JJUA 3C6LB 4NKIL 1KIQB 3UAFA 5JLZB 4EMZA 2BNQD 1XXFC 2F19L 1OZUA 2VW4A 3ATBA 4LLQB 4UNIA 5HY9A 3RU8H 4E5XB 5LUMA 5FV1L 4QXUL 3NFNA 3IPEA 2WO4A 4YGVB 4KJQD 1S2EA 4AGNA 4JQVA 3RWHB 1XMEB 1B2YA 1QLEB 2YARA 3DVIA 4XC3H 5BS0D 2DYSB 3MBED 4HJEA 5IB2B 3H6JA 4PW3A 4AYFA 2VR7A 3ZHFA 1XL6A 4NDMA 4JFDE 3QDJE 1YQVL 5JW4N 2XVLA 1MI5E 2E4FA 1BMZA 3TU6A 2B08A 1L9RA 2GVYA 5FYLE 4MJ5A 1I1FB 1R24A 3KYAA 4QWWD 1OE1A 4QYAA 2WQWA 4AEEA 3T0DA 3MRHB 4PPTA 3L5WB 4G42A 4W4NA 3V0AC 4M6OH 4CSPA 4ZMOA 5FYJD 3WEXB 2P5WE 5HYQB 2EE9A 4MJIE 3GXMA 4ZS6D 2VLMD 1D7FA 1JWMB 3O8XD 2EIMB 1EEYA 3LH9A 2AP2A 1H9DA 4ZK8A 4NKOA 1NC2B 1WBZA 4NX0A 2FUQA 3GSOB 5EIIB 5F1NA 4NRZA 1DJIA 1NCHA 1DN2A 1MG3C 3PL6D 4YX2L 5JIMA 2YEZA 4RAUA 3IKCB 4O2EB 4PJ7E 3DGCR 5HYQA 1E4WH 4DGWC 5C92A 1HXYB 2WYTA 1U4FA 1EHXA 1ZEAH 5SX4H 1HSAA 1X4XA 2Y06L 1KYFA 2HJLB 1G9NC 4HHAB 3L13A 4IIQC 5DRZA 3OTTA 4CC4C 5J3HD 5E6SB 2G60H 4DKEH 1N2RB 2WXRA 5HGAA 1R33A 4OLYH 4N2CA 1ZS8B 1TTRA 1N68A 1FBIH 3LKNB 4J3OF 1DQJB 1OLLA 3FUMA 1IEAA 2DTML 4IRSA 5DQ9A 3TBWB 1XGUA 1P9MA 4DW2L 4FKEA 3FCSA 3L5XL 1J0KA 4NQCD 1OAKH 5CD5C 2EH7H 2DQUH 2I9TA 3SHSA 2WWMC 1GGCL 2ZYIA 3PABA 4KZCA 4F3FB 4YPGB 5E1GA 1U3NA 5AL0A 1A14H 1C5DB 1BQLL 2TSBA 1AD9A 2B39A 5MEOB 4IBUA 1DQJA 3FTWA 2HKAA 4ZTOH 3UIYA 4ACTA 3O6KH 5IQLA 3ARUA 5DJ2B 3TFKD 4Z7UF 4LCVA 4IKKA 1FFTB 5DQ9B 5T3ZH 3WMQA 3ARDC 4P23D 4GAJL 2F7IA 4G1EA 2ARJB 1EAJA 2APVA 3QH3A 5E00A 1AHKA 3VXPB 4FMFA 5DLLA 3MRIB 2Q7AA 4LPWA 3MOBL 2G3NA 3DSFH 4K07A 5IHUL 3NABL 2GK0A 4GAAA 3DO7B 4XVOA 5IW6A 4HJJH 1CFQA 4KTEH 1XR9A 2ZNWA 5CJXA 5ADOL 1OPOA 3ZDZB 2ZUYA 5L88H 5AVTB 3QDGD 3BZ4A 3DX7B 4PLKC 3R8QA 5BUAA 3BPCB 3TJHD 3T0ED 4OZIF 3WEOA 3LPPA 1BWMA 1VGKA 4PJ5B 4F7EA 1EHNA 4L8CB 1PLCA 1UXMA 2Z7YA 3KWVA 3O6FC 3JZYA 4O9HL 4X5LA 1NAKH 1RKRA 1JPSH 3HI6H 3LPFA 3NJVA 5IUCA 5DS1A 3FYIB 1MHEB 2J1YA 2MFNA 1G1YA 1OGPA 3D33A 1JE6A 1EZLA 3VGBA 1BZ7B 1T6WA 3INUL 1WYJA 2CHXA 3L4WA 5ISZD 2EO7A 3GT6A 3N40F 1BIHA 2PXYA 3R4RA 3TFKC 1L0XA 2LFEA 5T33L 4XPAL 2JTYA 1K5WA 2GABA 5DYFA 2XN9A 3MV9E 1KSRA 2AS5M 4GIPD 5ILTL 3PNWA 1BD2D 3Q5OA 2ZOOA 2ORBH 4X6CF 4Z7VA 4YIQA 4K73A 3NJFA 4ZT1A 4Y4KA 5KVGH 2IAMB 4FQJL 5CLYA 3DI3B 1THAA 3CSGA 4R3SA 5I5IA 4J4PD 1DVTA 4WHTB 4TUUA 2PR4L 3W9DA 1WBXB 4NFBA 2YFNA 4FHBD 2C3GA 5I1AA 2EP6A 4N2BA 3U1PA 4DO5A 1G6RH 3QDJD 5IV2B 2YPLA 2JMRA 3MRQA 4APQB 4WW2A 1FZJB 3BXNA 3HAEB 4HP5A 4ZZFA 1BGXH 1BF5A 2BNUA 1MAKA 3WKPA 4OCYH 1XSOA 3N9GL 5C8JB 1UWEH 3RWEA 3TWCL 5C2UB 2MMXA 3HJEA 3EO1B 2DEXX 2IV8A 2JNZA 1SXNA 3MUJA 3BVNB 3ARSA 3MDJA 2GSIA 2PTTA 2W9DH 1DSWA 5SWZD 4F9LA 4WZ9A 3VXOA 3DNKA 5AAMC 1P4IL 3UDWA 5FA3A 3KPNB 5I6MA 4G83A 1G9NH 3JUYA 1Z7JA 5GGRY 3ESNA 3R19A 5SWSE 4XPBL 1X5IA 3OKDB 5C09D 3ARFC 3T0EB 2XJLA 3HHSB 2P1YA 3L3OB 4YZFE 2G5UA 1D5IL 3O4LD 4LLUB 3FUKA 1CBVL 1UOWA 4U7MA 3QUYB 1S9XA 4DF9A 3V8CA 3KS0J 5M95B 5KSBF 1HHJA 3POHA 3FL7A 3IJEB 3QWQB 3CN2A 4MNGB 1T1ZB 3F2LA 4ELKB 4PUBH 1QVOB 3KVQA 1Q9KA 4JPIA 2XY1A 4JFDD 3DIDA 4U7KA 4XVJH 3C2AH 3HNTH 4KX9A 5DUBB 3RWIA 1CR9L 3K80A 2VXVL 3QIUB 2GIMA 4MZIA 2CA4A 3EYSH 3W39A 4RIRA 4W70A 4AJ0A 2RH0A 4AQAA 2ICEA 2PCYA 1CT8A 1TUPA 4L3EB 1OEZW 1CXKA 1TYJA 5EWIL 3L7EB 1Z2KA 4TQIA 3PJLA 4NN7C 3QCUL 1CDBA 4POZD 2EXSA 2X4QB 3N44F 3F7PC 3SN6N 2HXAA 4MKTA 4MZRA 5HGDB 1SEQH 1VF5C 1JHTA 1R4XA 3BIAX 4FFTA 5DUBA 3ZE0B 1JV5A 3WENA 2Y23A 3V0VA 2C1OB 4LSQH 2R8SL 3ZKMC 5TE7L 1DFXA 1CT8B 1RZIB 3IPBA 1M6OB 5T5NG 2VDNH 3DRQB 4J6RH 4WK0B 2EIEA 1JNHB 1MCIA 2ZWZA 5JNYB 5IQ9B 4NQXB 4OJAA 2XKNA 4OF7A 4P04A 2Q3XA 1U8OB 4JHZA 2HT4C 1QW9A 2VNCA 3F62A 3VFTA 3A21A 2ITCA 3F58H 2HFEA 1K6QL 3PQYE 4Q6YA 1DN0B 3C2AL 3GSNA 5TGBB 2KC0A 3FT2B 1S7WA 2FNWA 4LCWE 4WWPA 1EHAA 4OZGE 3MRRA 3QI9C 2VO5A 1YO4A 2AVGA 4KKCC 3EOBA 4N2GA 3VGDA 1NGPL 5L9DL 1P6AB 4JR9H 3T77B 3VRJB 4PJAA 4IGBB 1KCVL 2ZKHH 3F7YB 4IGBC 4LDCA 4O02B 1Y1DA 5IHWA 3FRUB 5DUPH 4ZUUB 1SFDA 1WAAF 3DX0A 3L45A 1QEXA 4FTVB 4PG9B 1KWGA 2NYYD 4JFYA 3OV6A 2NMSA 2XX0A 3SE4C 2OULB 2C9VA 1A2YA 4JFPB 3TONA 5HPOA 1R6VA 4HMDA 5K9OA 5HYJA 2BVUA 1NGXA 1L3WA 1KJ2B 4ZTPL 4CVXB 2E7BA 1KIRA 2VUOA 3EFDH 1EFQA 2IOOA 1TOXA 2JF1A 4KWUA 4PTUA 2HTLD 3U2SA 3D69B 5DUJA 4N8PA 3GZKA 3WEBA 3KJ6H 2VZTA 4L2YA 4ZX6A 2RAMA 1LEKA 3QWRD 3S34H 2WN2A 3TGXA 3UTPD 2LLNA 4RQQB 1EFXA 4FFZL 4L3ED 3HZYB 5BO1L 3ZSTA 4L4TB 3LRSA 1QX1A 2X1QA 3FN0H 2Z34A 5KS9A 4ZQTA 1CTOA 3JXAA 3LDBC 3UEQA 1E5CA 4JM2F 4YHZL 3D07A 4LVNC 4LSDA 1AKJD 3N1FC 2NY7H 4OT1H 4WNQB 3VSUA 4E9SA 4F7MB 2WBWB 2GUOB 5ES4B 5E1AA 3QRBA 1FL5A 1MLBB 4PG2C 4B41A 2XZAL 5AEAA 3A6OA 3W2DH 4E41E 1NMAH 2GPZA 1CXFA 1Z9NA 1A7OH 4FFYL 5DD1H 1QFWH 5DEZA 1IKNC 4U6HB 3CN3A 3HE6C 5DK0A 2DDQL 3MLXL 1JL8A 1M9WA 4U6YA 3F12B 2QL1A 3LNHA 1BIIB 2WTRB 4PJ9B 2J1XA 3MKKA 5AAWC 4DEWA 1WZMA 2VRKA 3HE7B 3DYPA 4ODTH 3CDZB 3WY4A 5KS9F 2L8AA 3GKZA 1DVZA 4HKJA 5BXFB 1G7LB 4HJGA 2H3NA 4GAYB 3D08A 1T89A 2AQ1A 1XDTT 2UWEA 4P2CG 3RDTD 4CSTA 5AD0A 4I0KA 4W6YB 1B4JL 4WU7A 1S7QA 1ICTA 4UM9B 1GGYA 2F61A 2XN2A 1QABA 1NBYB 1KB3A 4U6YB 5BCAA 3RQ3A 2DWEB 2EXWD 3SJVE 3B8SA 3CC5A 4H8WH 1CE6B 5E2TL 3NQKA 2GKIA 4FD0A 1UOLA 1OTTD 4Y2DA 4GSQA 2AVFA 1UCBH 5DRZB 1D9KA 1HOCB 4FXGA 2X53A 3C5XA 4RA0C 1Q0YH 3F6LA 3QGVA 1QPPA 4GP4B 4UINL 1A0QH 1E28B 2P9RA 2WLLB 3HE6D 4CUCA 2P80A 4N8VB 1HEZA 4M8RA 2BSSB 3JWNG 4ZTEA 3CIQA 1IKOP 1NANH 1RUMH 2R1YA 2VN7A 4L4TD 4GYBA 3RWCB 3MKGA 5EMYA 3C5ZC 3SD5A 3L2LA 3SZKC 1H15A 3JTTB 1A5FH 1VFUA 2VN6A 3NIGB 2J7LA 3UO1H 2DBLH 3OAZK 1J8SA 4NN5C 3VFMA 3RKDD 5I1GH 4MQTB 5EC2A 5BMFL 4RMWA 4K9JA 5DHVA 4GLRH 4QJ5B 3QJUB 5MP6H 1RK7A 3ZIMA 2E8YA 5JXEC 4YFEA 4EXPX 4DH2A 5GIRA 1JK8B 4GKZB 4U1LB 3ZGIA 1AI1H 1RMFH 2CLVA 2O1AA 4MD5B 4NWTL 1JNNL 1QFHA 2L3BA 5GQBA 6PAZA 1HNFA 1H15B 1MRFH 3JTTA 4PJ9D 2ARJA 2DQGL 2ZSWA 3ETBJ 2DWDB 3PWVA 4Y5YB 4WWKD 5KANG 2NX5D 4ENED 3MJ6A 5HHNA 3RVXD 3L1GA 4ABWA 4A2LA 4F7PA 5CBAB 4Q2ZA 5IGXH 5FEBA 3PDOA 2PABA 3EOYG 4XMVA 3FSOA 2VISA 1NIDA 5DFAA 3K91A 1BVKB 4OBSA 1FNGA 2ZCHH 5DK2B 2A0LD 2NDFA 1ZLDA 4M1GH 5A6IA 1CGXA 3HC3L 4HCFA 3MUHL 4XAKE 1FP5A 5B1JA 3ML9A 3IDYB 3MLXH 4N9GA 1AS7A 1J9CT 2PW2B 1EO7A 1GGBL 2FECL 2VRAA 5EZLB 1W6WA 2FYVA 2NZ1A 1GZPB 3HCVB 2A74B 5JOEA 2E3VA 4EZKA 1WS7A 5FKAB 2FK9A 2FX8H 4PJBA 4XNXL 2I9TB 5IROA 1ZGLB 5GGVL 5IVZA 1NCIA 2CBQA 3EJPA 3JV4B 4MAZA 3FUFA 1E9OA 2ZKMX 4TN9A 3TYGL 3SB3A 5SX5K 1PQZA 1RAMA 5I5JA 5LJYH 3UADA 1W72H 4V1DD 1KTJA 2K45A 4CN1A 2ZWSA 5CZXC 5EOQH 2R8SH 5F7YC 3Q5YA 2VN4A 4XNZC 1E6JL 3KJ4C 2Q87A 3I3EA 4U3SB 3QIWC 4GRWE 3D09A 4NZDA 2NNCA 4GQRA 4PJBB 3TXAA 1BYPA 3PAUA 3Q3GB 5C9JB 5FO8A 4KUZL 3FHAA 4NQCB 4NZRL 5B1KA 4HK0B 1P4IH 2IBBA 3ARBD 5E8PB 1TYEB 3TC9A 2CCVA 1FPTL 4Q97A 1FZJA 3DJ9A 3WLWC 3HI5H 2MNUA 4ATTA 1QLFA 4LQFH 4HLZG 2CLZA 4NPJA 1UB5A 1NAMB 2AAAA 1CBVH 2QGCA 2VL5A 4XBGB 5IKCA 1EANA 3L3KB 3BVNA 1EV2E 3BUQA 1Z32X 4WWKB 2YAFA 3D3VE 2YRZA 4KK6D 5GZNA 1NC2D 2GJ6A 5GGVH 5ESAA 4N2DA 4Y9FA 4JAMB 4N86A 4R97C 4A67A 1GYVA 1WZ1H 1LXMA 1KGUA 3I50L 5ICYB 3VXME 4JRLA 3TNMA 2OX5A 3ZTEA 1I9JL 5CJQH 2MNJB 5TDNB 1FNSH 5T1LA 4EI5A 2VSCA 1NAMA 2NNRA 4LHUB 4LLUA 2ZUTA 4KK5D 4D94A 1WITA 3P3UA 4ES8A 3QJVB 2E9BA 3BP4A 5EU7E 4GIAA 4QHNB 4OLVL 3IDMA 3SO5A 2G30A 4JLRA 5KVEL 4XXDA 4MA7L 4ONFL 4AQ1A 1N12A 2GITA 4Z7VB 5GSRA 3IKKA 5GS2D 2JIXD 3I85A 2V8MA 3P54A 1NKRA 4LOUC 2X6UA 3BC9A 2YR3A 5F8RC 5B4MD 1JHLL 3GM0A 2XYCA 4AK2A 1AH1A 2D7QA 3KLLA 4M00A 5HHXL 2EDXA 1JK9B 1IZKA 2BHYA 5J56B 2ZOLB 4I85A 3NIGF 4XN2A 2KPWA 1UXWB 4M6NL 5LGHL 3AABA 1SOSA 4TUOB 3N41B 1SEBA 2CM6A 2H2SC 1BJ8A 4ISVB 5J7CC 5FGBA 3VSVA 5TTRA 2IDFA 4KJYA 5BRZA 1CE1H 3TT1L 5I30H 1WWCA 2HLAA 3ISRA 3PV6A 3P0GB 4RGOH 1EEQA 3QG7L 4HGWB 4WFGD 3WTSA 3MLUL 3A24A 3D6GA 3L4TA 2IAMD 5DZLA 2H7WA 1NMCC 3I6LE 1XZWA 3DRQA 5DQDL 1QI4A 3AADB 3AM8C 4AGOA 3FQRB 3ROLB 3KPNA 4POUB 3QZPA 4NP4L 2Z4QA 4U1NA 3ALXA 5C07B 3WFEL 1RJYB 2OXGB 4I2XE 4F5CA 2ISDA 5AVRB 4FP8H 2DQTL 2ITCB 1JZFA 1EUTA 1ASQA 4OKVA 4CGUB 4MX7A 1JGVH 4GW5B 1E4XL 4MRBA 2EIKB 3HRZC 3IFOA 3UG3A 1T20A 4OUUB 1TQUA 2CNZA 1MJJA 4JM2B 1FUNA 1J5OH 5LG1A 1JYNA 1B3IA 3TIDA 2H32B 4QPEA 2CIKB 2YK1H 4XN5A 4PG9A 1FVCB 2H2SD 2FJFA 2G9HA 4LAQH 4O2CA 5CR8A 4WNSA 4Z7NF 3KLAB 3VXMB 4GW5A 3LHPH 1TVHB 1HNGA 4M5ZL 3RTQB 2BWDA 3C75A 1BZ9B 4KVCL 1EJOL 4ONHA 5GXBB 4NQTA 1NIFA 4GOSA 1RZ8A 1H8OA 2ZXWB 3BAKA 4YS4A 1HI6B 3HZKB 3OR6B 2F5BH 4FQQB 2NY0D 1ECYA 4HAFA 1A6TA 1B4LA 5C0IA 5C0BE 1EMTH 1W8EA 1HILA 3V95A 5DHYB 3DVGB 4KY1L 1RZJH 2X2JA 4Z7AA 4ICXA 2QV4A 3MNVA 2DDQH 3RGVA 3CUPA 4PJ7A 3ZYJA 3TA3A 2FIKB 3VXUA 5IQNA 4UANA 5I66A 4P57A 5I82A 2PPFA 1MCLA 3QPXL 3UZEA 2DYRB 2EDBA 1WTLA 5KVGE 3TF7C 1D7CA 2OYKA 2F18A 1GPOL 4DNLA 4OM0H 4TRPL 5FYLD 1KCUL 4YR6B 3WKQA 4X7TB 4AV0A 1P84K 2VDOB 4DP6X 4W9CC 4LE8A 4WY7L 4KQ3H 2EKJA 5F0LB 1QBLH 1MNUH 3DVGA 4RNRA 2L7EA 3OKNA 4LF3A 4LRIC 3K6FA 5GSVB 5AW5B 3HVDA 4P5MB 5EN2B 5IMKA 4JY4B 4WLCA 2YXVA 1UEMA 4JREC 2DJSA 2K3HA 4JFYB 2OTWB 2DD8H 3QYMA 1NL0L 3UC2A 4ZMPA 5BV7C 1KTDA 1BVNT 3MFFA 5C3IA 1MAML 3RX5A 4HPHA 5KSVB 5FO7A 4AIZA 3OAYH 2J2ZA 4Y16B 3W82A 1U30A 3PDGA 2F74A 1K9TA 2YD6A