3KM1A

Zinc-reconstituted tomato chloroplast superoxide dismutase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
125
Chain Sequence
b'TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDAGGRLACGVVGLTPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of tomato chloroplast sod
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 28
structure length 125
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3km1A00
1YAZA 3KBEA 1SDAB 2AEOA 2NNXA 1UXLA 1SRDA 4OH2A 2GBTA 2Z7UA 1DSWA 4N3UA 1JK9B 3CQQA 1N18A 1SXBA 3GTTA 2XJLA 2Z7YA 1QUPA 1XSOA 1F1AA 1Z9NA 1E9PA 1B4TA 2WZ5A 1UXMA 2WYZA 2GBUA 2Z7WA 2AQRA 3L9YA 1IBFA 3CQPA 1SXAA 1BZOA 1EQWA 2C9VA 1PZSA 1SPDA 2JCWA 3F7KA 4MCMA 1OZUA 2AQQA 2LU5A 2ZOWA 4A7GA 4FF9A 3F7LA 4BCYA 1OAJA 1AZVA 2ZKWA 5KBKA 1PTZA 2WKOF 3KH3A 1YSOA 3GTVA 4B3EA 2WZ0A 3HFFA 2WWOA 1RK7A 4A7TA 3T5WA 3KM1A 1F1DA 1N19A 3GQFA 1Z9PA 1XTLA 3K91A 3SODB 2AF2A 1F18A 2JLPA 1SDYA 4OJAA 2AQPA 2K4WA 4U4IA 2XJKA 3KH4A 1IB5A 1XTMA 1COBA 1PU0A 2ZKXA 1IBDA 3ECWA 3LTVA 2V0AA 2E46A 2GBVA 5KBMA 3ECVA 2AQNA 2AQTA 1SOSA 1HL4A 2C9UA 1OZTG 2WZ6A 3HOGA 2C9SA 3RE0A 1JCVA 3H2PA 2WYTA 1SXNA 1F1GA 1U3NA 2Q2LA 3MNDA 1SXSA 2VR7A 1TO5A 1MFMA 3QQDA 1OEZW 1S4IA 2VR6A 1FUNA 1ESOA 2AQSA 1Q0EA 1SXCA 1BA9A 4N3TA 5KBLA 1CBJA 3QQDB 1SXZA 4BCZA 4MCNA 3H2QA 4A7UA 3GZOA 1E9QA 5CU9A 1IBHA 2SODB 2Z7ZA 3CE1A 1B4LA 1P1VA 1E9OA 2VR8A 4A7GF 1HL5A 1TO4A 3HW7A 1OALA 1IBBA 4A7VA 3PU7A 3GZPA 1L3NA 2R27A 1E9QB 3GZQA 3KBFA 3S0PA 1DO5A 2ZKYA 3L9EA 2E47A 3MKGA 4L05A 1KMGA 1E9OB 2WWNA 2APSA 1JK9A 1YAIA 4A7QA 1EJ8A 1CB4A 3ECUA 4A7SA 4BD4A 2WKOA 1E9PB 3KM2A
chains in the Genus database with same CATH superfamily
4YVNA 6FABH 4R2GB 1U8JA 5SWZB 3D39A 4WEMB 1A6UH 4HCRL 5EPMB 5BS0E 2WCPA 2BERA 4U3SA 2VJ8A 3QWOA 1OCZB 4MKTA 2YPLD 3L7EB 1XEUA 2X4TB 1CXIA 5E8NB 4HPOH 5C3TA 3UTOA 1ZS8A 5CGYC 2V2WB 1E4KA 3GXFA 1CC3A 1QRKA 3E2HC 3KEDA 3IMSA 4AE1A 2EDWA 2BJML 2DTMH 2UXFA 4YGAB 1AHWC 2BIPA 2R8SL 1P4BH 4XO8A 3HMXA 5JW4R 1JGUH 5T33L 3NZSA 2CCVA 2NXYB 1I31A 4AVJA 1J18A 1U9KA 1JZ3A 3WMQA 3C60C 1GGTA 1MHHB 1TLKA 1W16A 1ZK9A 2XWXA 1CLZH 3O0RL 1C08B 1ZIAA 2AJVH 1QG3A 2C1OA 1FFOB 3N1GC 2ID5A 3T3PF 2PETA 1AO7E 1AXTH 3T0VA 4GAJL 5JW4Q 4ELKA 1RULH 4IKJA 4ANKA 5IHUL 4UQEA 1HJCA 1J48A 2ZKXA 2XXMB 3HJEA 4G43A 5HYQA 1S9YB 2V0AA 2PUQT 4FMFA 3VFTA 5L2KE 4LSUL 1HE7A 3WKQA 5BMFH 4HFWA 1PFCA 4NS0A 3T8MA 2IALA 2VDOB 3OGCA 4Z7NF 1DEDA 2E4TA 2XV2A 4I2XE 5E6ID 2APXA 2DJ4A 4K55A 5LCVL 1E4JA 3EFOA 1SYSA 2ZCHH 3EHBD 4LCCA 2H6OA 4HC1H 1TTGA 4F7PA 4MZIA 4IBYA 4BSVB 5FM5M 1Q4NX 3TN0A 3BD5A 1EEZA 3FH7A 4FKHA 4N2IA 4XZUA 3WENA 5HHMB 4ZD3L 5JO5A 3E9UA 4Q89A 4KY1L 3A5VA 4PJ5D 3OHXA 4XBEL 1KELL 3KPSE 4JDTL 4RFNB 4IS6B 1IEHA 3QQDB 2BSCA 1DVFD 4BXVA 1ZLUK 3H2WA 4O2EB 4JRYB 3UAJA 5JPMA 4RRPM 2PYFA 2ITCB 1G1CA 5LJYH 2HVKA 4NI3A 5KOVC 4HIXL 4I3RL 4H8WC 2R1XA 3HLKA 5I8CA 2Z31A 4PSPA 2XPZA 2NXYC 3ARGB 1A0QL 3N40P 4B7IA 2LT9A 2E4FA 5I1LA 1G7PB 3MFFB 3IXAB 4HKZA 1M71B 1CB4A 2YPKA 3AACA 4L48A 1Q1JH 3DO3A 4PCKA 1KN2L 5AW9B 3EFDH 4KK5D 1K8DA 4PJAF 3L6FB 1UM5L 3D5OF 5DJ2A 4OZIF 5IW1A 2FGZA 3M1BB 4L29A 4PB9L 2GTZB 3U30C 1HVXA 4Y1SA 4BE6A 5JIHA 1KSRA 4H26B 4LF3B 1DUYB 3H6AA 3OAYK 2EEXA 5F7KC 4HIEB 1CQKA 4R7DB 3ES6B 5DK3A 4MMYB 2EDMA 4KO6A 1ZTMA 2FLRT 2EXWC 3GRBA 3MA7A 1IL1B 3GDBA 3W82A 3WS6A 4ZX6A 3NABL 5JR1L 3TJPA 4AW7A 4YXLL 1BD2B 2WVTA 2X6UA 5DQJB 2HPTA 1CR9H 4WFED 4HVBA 4YDIH 1DJXA 5DEGA 5HDBF 2OZ4A 4DW2H 3UBGA 3ZDZB 1IT9L 1R47A 4PREB 3BAEL 3B5TA 3O11B 5EU6A 4Z7QF 2BC4A 4FS0A 5AVQB 4GKZB 4BQ8A 4BFKA 4Z3TA 4PTTB 3FHEA 4KXDA 1BGXH 4XXDB 2AQPA 3ABLB 4HWBL 3GBNH 4IBZA 5E6ZA 2QQKL 5F6IC 3V4VL 1VGKA 1YY9D 4WGVB 4UT7L 2FJFB 12E8H 4H1LB 4MD4A 1JERA 2CJTA 25C8H 1JF5A 1AG6A 4Z7UB 3NSFA 4MMXC 3RWFB 1CBVH 3MV7A 3PGDB 3QRGH 5FYKU 1FL6A 2HKHH 3MNMA 3H9SA 2WZ6A 3O9WD 2Y36L 4ZRGA 3P3TA 4KGLA 2VIRA 4X6DF 3WYRA 1HI6B 1S7TA 2DY2A 2NY7H 2WXMA 3QC6X 4NZTL 4WCYL 4DN4L 1WBZA 3QPKA 2AJXL 5J57B 1UD5A 4KFZC 4O9HH 2H1PH 4RAHA 5EOQH 4IMLB 1KIPA 3HLAA 1A3RH 3TLRA 2AVFA 4LSDA 3HCVB 3LD8B 3SGDH 3CXHK 3MRKA 1OAZL 2QPFA 2BP0B 5F7UA 5EC1A 1J9QA 2ADJA 1U8KB 4RGNE 2G2RB 1VPOL 4LQ1A 1M9WA 4ZOBA 1ERNA 4U1HB 3C9NB 4CA4A 2MHAA 1I8LC 1K4DB 2ICWB 2QSCL 2PXYD 3KVDD 1EUTA 1T89C 1UGKA 3QG7L 2EDXA 2FIRT 4L05A 5BOZG 3LIZL 3FJTA 3MA9L 4YX2L 1KCSL 3ZGHA 5JW4N 2P5WA 3CFUA 4KXZH 4QO1B 1ZSHA 4JY4B 3X3FH 2HT4D 4LB8A 5H37H 1WBYB 3KBEA 5B39A 3FUEA 1QNZL 5IVXF 2YPLB 2Z7UA 3N6YA 2IAMC 1MVFA 1JVOA 2WXRA 3W0WD 1UB5B 1CN4A 2VN6A 4TKWA 3FUHA 4RGMC 2LHAA 2QTEA 2VM9A 4V1DA 3Q48A 1BFVL 4LBAA 4I1RA 5FOBB 1NGQH 2CALA 1QLRB 1LE5A 5AOKA 5LAXA 4MXQD 3GSNA 4O4YH 1QI5A 1RZKL 4UOW0 2AK1H 4X6EB 3U36A 3I6KB 4NZFA 3B3IB 1D9KC 3QDGA 4LCYA 4WJKB 2VTFA 3KVPA 5F7HA 3F00A 2OYPA 3TH3T 5T1DL 3NJIA 3GXDA 3WUWG 4AQOA 5BVPH 4LLMA 1HXMA 2XV6B 3N42B 5C09A 4QRRD 3VA6A 2CLZA 1BBDL 2C9AA 2B14A 2ZYRA 2MCMA 4OKDA 4FA7B 5HGDB 5FEBA 4FULA 3WNMA 1WF5A 4HUNB 5FDWA 2V2TA 2ZOLA 4CJ0A 3IE9A 4I0PA 4PJCB 2YGVA 4UM9A 4W81A 3UZQB 4YDZA 5EZIL 1LD9A 3WGUB 4P4RA 3QAQA 2DN7A 5GSRB 3RL1A 1ES0B 3MLRL 4LP8A 4N9OB 2VLME 2EE9A 2YEQA 1MUJB 5I18H 1I53A 4K7PY 4NCC2 3T3MB 5BS0A 2O93L 3UH8A 5D9SB 1PLCA 1KNOA 4GP5B 1T83C 3OKKB 2P42B 4ZX5A 4MXWH 1W2KT 1E42A 1KB5L 3HZMB 5DA0B 3AS0A 3ZSSA 4J12A 3HG1E 3WTXA 3LZOA 4G1MA 4ZDHA 3VQLA 4PJ5B 4NKOA 2CPUA 2GHZA 1ASQA 3K4AA 3F58L 4ODXB 4H7VA 3IJHA 4KJQC 3RHWF 1DVFB 4MWFA 5DMKB 2XTJE 1M7DB 3K2KA 1MJ8H 5G2NA 3EDDA 4NQEE 4JN1L 3VFSA 3F6JA 1FORH 4RX4D 2AMUA 2F53D 4GRLA 4OJEH 3BWSA 3H2QA 5DUJA 5JUEL 4ACTA 3MXVH 1F56A 3UAFA 4QJ4B 3B9EA 4Y1AE 1MJJA 4Y7MA 4B9ZA 2HJFA 1NKOA 3DTXB 2X6CA 1AO7A 2OR7A 3HI5H 5FWRA 4D0CA 1QR4A 5EU5A 5MI0B 4L23A 4FEIA 1FC2D 3S96A 3VFUB 5DQDL 5CSZA 4U6YA 4LPXA 5BJTA 3ZKMD 4A7SA 1I1CA 2QVFB 1TEYA 2P1YA 3LEXB 4FJ6A 4LHUA 5E0QA 1A1MB 1NFIA 4WO4C 4NOBA 1JYWA 4I2XA 4R4NC 1S46A 3C5ZA 1OK8A 1XGZA 4V11A 3NOIA 1UFUA 4LKCA 2X6VA 4QHUB 4H8WH 4XPGH 4Y4HA 4TRPH 4U0RC 1ORQA 3DVNB 1KBKA 4Y9FA 2B1HL 5K1NA 5E2UH 3VFMA 1BAFH 4R8WL 2XN9D 1LEIB 3FB7B 3CWGA 3VXQB 4PRAA 1XO8A 3D9AH 1E3ZA 3KPSA 5FOJA 5CBEB 2H2SC 4M4RA 4XRCA 2DQCL 2G9KA 1NEZA 4HV8B 2UZXB 3DUSB 4MDJB 2ZUUA 1LP9E 2Y5QA 4LPUA 1DBAH 1IM3B 1MW1A 3BOVA 4HK3J 4LCWD 1H8SA 3QZNA 4OZGB 4Q2ZB 1KJVB 1R5WB 3DXAE 4G7SB 4Y16C 3WFDL 1H15A 3EKCA 1IE4A 5KOMC 3VFVB 4IBUA 2C3HA 5GS1A 3VWJD 4JO4L 4X7DC 1CDYA 4PY7B 1KDIA 1COBA 3BN9C 3VI3E 1KG0A 2Y1YA 3CFIC 4YDJB 1B90A 4FQ2H 1LK2A 1OSPH 3HMWL 2IQAB 5C0IB 5CINL 4I77L 5HYJE 3WXWH 3HOGA 1W0WA 1HNFA 3WJMA 5BV7L 2WXGA 3ZIYA 1PQZB 5MI0C 1KJ2A 5HY9A 1MFCL 3EADA 4GW1A 3TVMD 4LASH 5FO7B 2B08A 1KTRL 4PW9A 1A5FH 3VFOA 3M6DA 4R5VA 1VGEL 1HHKB 1OE2A 4DVBA 3IXTB 2ARJQ 5B1CA 4Q97A 2YMOA 2OXHB 3ARDD 1HHJA 5F88B 2XXCB 1J05A 3E6FB 3IJ8A 4JRFA 4P2OB 5I8KH 1EZUA 5I5JA 1HAUA 2FLBT 4N6RA 4YHML 1SDDB 2FX7H 4OAWB 3EO0B 4XHJC 2WCSA 2TSBA 3ZX1A 4XPBH 1NC2A 3DDGA 4XNBA 4XCCH 2PXYB 3QAZB 3ZT5A 4AGLA 4FLQA 4TPRL 5J6HA 2CDFA 5DK2B 3RWCB 4DGYH 5T3ZL 2W07B 2DWTA 3GTNA 4M29A 2OJEB 2QADD 3SD5A 4RISH 4AYID 4FFWD 5F1SA 3QYNA 1U8IB 1MWAB 4RCAA 3V9FA 4LNVA 2CJUH 4PP2B 4P23C 2V5SA 3AG3B 1UT1A 4K3DH 3F5WB 3MCLH 2UY6A 3PWVA 3SEPA 2YSTA 4BFEA 1G1KA 4IRJD 3ZZSA 3NZHL 1W8EA 1F4HA 1KIUA 1JWUB 1PLGH 4K8RH 4M5ZH 5C0DB 2CK0L 1D6EB 2EIZB 4DGIH 1VZIA 3RAJL 1TVHB 1IJ9A 1I1AA 3S4SA 1TQBC 1TTCA 3HVNA 4NQCD 4JO3H 5E95B 3J7HA 2PTVA 3ARXA 3BD4A 1TZGH 1JTTA 1XBDA 2B77A 4Y5YB 5CHNB 2ZSWA 4M93B 1YQVL 1F4YL 2X87A 3K81A 4PW4A 2C7UB 1QX1A 4H2CA 3MROA 4DAGH 3LXBA 2VL4A 4GQZA 5E9DD 2WZ0A 3NJMA 5HHPA 3B2UD 2PCFA 5IJVA 3MOAL 4P2OC 2A6DA 2MJWA 1XGQA 4KUCF 3QRBA 3MQIA 4Z78A 5I8EB 3P0VL 2XHNA 4FXGC 3OKDB 1GGIH 3OB0K 3RWDB 2MCPH 5F96H 1WIOA 1Y07A 4NNXA 3NA4A 4TNFA 1UA6L 1XB6A 3FT9A 2AANA 1HH6B 2X4RB 4ACPA 1JN6B 1PX8A 2Y22A 4WHTB 3ETBF 3EH2A 1NSNH 5D93C 1NLBH 1E30A 5JQ6L 4F9LC 5HI4D 3PCYA 3EYSH 1IC4L 4OJDH 3SDCD 4FQHA 1DQLH 5CSGA 4ZS6D 1M3JA 3QA3A 4WENB 3FO0H 4OM1H 2CZNA 2VLKE 2C9XA 4HIHB 1Q0XL 2Y7OA 4N1HB 4EZMA 2VR7A 3VGEA 4E9YA 5DRXA 4MQ7A 4OI7A 2F53B 2ROYA 4MD5B 4XT1C 4DP1X 1FUNA 3BKML 4YHPB 5D5MF 1IQDB 2H32B 5KAQF 3A23A 4Z7WB 5EF2A 2DQGH 4EI0A 1EXUA 4A2LA 5I6OA 4A2GA 1DDHA 3WUZA 2WMPA 5FECA 2CLVA 4PVNA 1SUHA 1IVTA 3RX5A 2VOTA 3VI4E 4PR5B 5DZAA 3KLHD 1YEFL 2I07B 2F68X 2BDNH 3F01A 4M7ZC 4B9GA 3FSAA 1XH1A 5K1VA 4HWEL 4WKZA 1BG1A 3SYQA 4HOWA 2ICEC 3HRZA 4KVNL 1N5YL 4LCUB 3U1SL 1I9RH 2AERT 1GW0A 1RFDH 4B9JA 4OCYL 5I75B 1OGAA 5J12B 2W9LA 1RMFL 1QLFA 2VSDA 2FT8A 5F7DA 5IMOA 1GS8A 3K1KC 4HHWA 1IRAY 5GGVL 3I02A 3KS0J 4OGZA 2BNUB 2CLRA 3MNVA 2M2DA 2V5RA 1M56B 3GSUB 2B39A 2WO2B 2HFGH 2ZNWA 2GSIB 5E8OA 1RU9H 1FNHA 4DGVH 2YRPA 4LXFA 5GSVB 2X2YA 2I9LA 1YEWA 2Y4SA 2XN9B 3HG1A 3V0HA 1X7SA 3FFDA 5CIPA 1WHPA 5EORH 3G6JF 1XR8B 1ND0B 3O2VH 4W9IC 1WFNA 4LVHB 3UIZA 3UIYA 1HEZA 3P54A 1UM4L 1NANH 4X6BB 4DZBB 5CO1A 1A8JH 3W9EB 1PIFA 3BI9X 3KLSA 4BFNA 5CWSB 1JAEA 2EVHA 1K85A 2YAPA 35C8H 4MASA 1JV2A 1TQWA 3BGAA 4LCWB 1T0NB 5IGXH 1TKWB 1RKRA 5BOPA 1WHOA 3VMPA 1PDKA 15C8L 1KLGA 3VWJB 1U0QA 3U9PH 4WY7H 2F58H 3FRPB 1BZ9B 4PGCA 3BPLC 4O00A 4AZ8A 1AI1H 1C7SA 5JIIA 4X8JA 1BWWA 1KCLA 4ZZFA 1DVTA 4UINL 4K7PH 2A6KA 2KQNA 1FZJA 4C59B 4PMEA 3QCVL 4I13B 2ZPKH 3TVMB 3ECVA 3S34H 4MYWB 3TFBA 3SKOB 4XPHH 3R1GH 1CG9A 3ULVD 3APDA 1TF4A 4U1KB 5J12C 4V2CB 2C1PB 2W0FB 3ARDB 5LGYA 4NWUH 5J0BA 3DOHA 3FTYA 5I1EL 4BH7B 2QV4A 2HRGA 1CLCA 1JF6A 2VO8A 5ALCL 2BRRL 1BQRA 3FONA 4KI5F 4CVZA 5L2JB 3U79A 1GJUA 4J4PA 4KMTH 2XA8H 1HDMA 1G1OA 2WO3B 4AJVA 2JJSC 2CWRA 2O30A 4TSCH 4U3XA 3U7WH 1BF5A 1OANA 2VO5A 3L5IA 1GRWA 2ORBL 4DKDC 3SYPA 2Q76B 4JDZA 5DJZB 2CO6A 4HJGA 4ABUA 2QADB 5D4QA 1LMKA 4YLBA 3NJHA 2O6DA 3K1DA 4N26A 1LP9A 5DVMA 4QOKE 4UBDD 3L16A 3CCHA 1E3XA 5IEKB 1SEBB 1ZHBA 3ZR6A 1KJ3H 3DXAA 5K9JL 5J6GA 2ZX9A 3LZFH 5E23A 1CE6B 1IUZA 4Z7VF 5EU4A 3A21A 4K0OA 4M9PA 5HYSB 2QPUA 2C4XA 3BYTA 3VFPB 4IRJB 2VC2H 2EUVA 3UJJH 3JTTA 4RA0C 3AITA 3S98A 2PTUA 2VMCA 3CU1A 5C08B 4KVCH 1KCVH 1YCSA 4JM2A 1HHGB 4IHOB 2P8LB 5HYJA 2YMTA 2QSQA 4O02H 3QUMA 4YC2C 5PAZA 2A73A 2HFEB 4NB7A 5I2IB 1R75A 3ZHNA 3TH2T 1LE9A 1G9NC 1LNUB 4IKIA 5DZOA 4XVUD 4UM8A 5J13C 4CUCA 5AENA 5C07E 3AS3A 3CBJB 1BJ1H 2W9DL 3PGFL 3VB9A 1YC7A 2A3TA 3QUZD 1ITBB 1PCSA 1DQMH 2BW4A 4F5CE 4FLSA 4D9QE 3CQPA 3W1ZA 2F74A 1U21A 1IM9A 2WNKA 1Z9SB 1OZUA 3BLKA 3GMMB 3F7RA 5E9DB 5K39B 1KB3A 1BBJB 2ZWLT 5F9OL 1NIFA 2BVEA 1AGCB 2W38A 2WQ8A 4OCXL 4B3EA 2HRPL 1UFGA 5DR5L 1BQHG 2QMKA 3RVVD 2UWEF 2V7NB 3AAZA 3BFWA 5D7IA 4H4NA 3EUDA 3EOBA 4UUJB 1KY6A 4I3SL 4X0KB 1SQ2N 1DTUA 3KDMA 3UC0L 4ZMYA 1AZUA 3PYCA 4UAOB 3ZR5A 4EVNA 4YZWA 3SDCB 4F58H 2X70A 2BJMH 3ULUD 2H45A 3TIDA 5K9OA 3BGFB 3DX0A 2FJSA 5AVSB 4NO2B 2ZXGA 4BINA 1DSFL 2PCYA 5SV3A 1JCVA 3TOPA 5EEXA 1QBLL 2XFGB 1XH3A 3BDXA 2Y06L 1QSEE 2X4PB 3EJJX 3PL6A 5EOTB 4HS3B 3BKCH 2R7EB 1MCWM 3NCEB 1BVOA 2X38A 3NIDB 4FJZA 4N2MA 2HCZX 2IDFA 3HN5A 5BRQA 4F37F 4HJ0D 4B0MM 3EYFA 5LN8A 5F7YC 4YAQA 1NBZB 3BUBA 3PRZA 4WIQA 1L7IH 2NNRA 2W92A 4XN1A 1SJMA 3Q2WA 4GS7B 2GUOB 2QMJA 1J10A 5JIQA 1SEQH 2YK1H 2V5TA 2EACA 3R06A 1JJUA 1THAA 1KFAH 1WIUA 3NFPA 5I5MA 5LB1A 3A4EA 5KSAC 2XY2A 2Z4TA 2FL5B 4NXSA 1NGXA 1AQDA 2Y2WA 2Q7YA 1PS3A 3W2DL 3OSKA 3EJCA 3QZWB 1MCIA 4I48A 3CX5K 4NJAH 1NCBH 4UV4L 4ZX4A 1CK0H 4NO5B 4UT9L 5GGSA 1U92B 5K9KA 2K70A 2H8PB 1WP6A 2QGCA 2ZX6A 4QHMB 5L4MA 4R5TA 4XP4L 5AAMA 4IRZA 2XBDA 2APSA 3JWOL 1BECA 4K07A 4CMHC 2GAZA 1CGXA 4JY6A 1EVUA 3BEVB 1LL1A 2XZAL 4KY1H 3UO8B 3SGJC 2WLIA 4TLSA 5C0FB 3D48R 4G83A 3JWDC 3ME0A 3F7VB 4ZFFA 4UAOC 2OQJA 1JWSB 1YVLA 1KTDA 4ICXA 3GXPA 2VLKA 1BZQK 4FHJA 1KTLB 5B8CB 2BVOB 4QYAA 1RUMH 3VQMA 4PWEA 3SKNB 4PJFF 4PLJC 3BGFC 4I3RH 4XI5D 1EEQA 1EFXD 3S48A 1AC6A 3GKZA 3QUXB 5HVGB 3Q05A 1Z6JT 3GO1H 4I89A 3OAYH 3L4TA 1SPDA 5GJTH 3SE3A 5ABDE 4PRHD 2GEEA 2GKIA 4JB9L 3QE5A 4NKDA 3T6ZA 4LEEA 2QV2A 5E7BA 2H1XA 4HYTB 1YECL 4KRMB 4Q52A 4NWTL 4NZUL 4UTAA 2D7TH 4MNGE 3MRDB 3WS3B 1ZLSL 3O2DL 1UM5H 3ARFC 4NQQA 3VI4A 3C5JB 3QIWD 2XPGA 4KKAD 5C6WH 2P80A 5E51A 1ORSA 1A9EA 1CGWA 4FADA 3ZO0A 4JQIA 1FH5H 1TU2A 2X4OB 4OFKA 5EO9B 5GRJL 3T2OA 1WBXB 4D0BB 5TH2A 4BFFA 4B5EA 4P3WA 1P5UA 3E8VA 3GLDA 4CADA 2K6ZA 2Y07L 4M8UA 3WNOA 3MRPA 2A9NH 3FT2A 4G42B 3UOAB 1E8ZA 1U8LA 4Q6IC 1E3FA 1T4KB 3AS2A 1MCKA 4QEGA 2BX5A 5DMIL 5HD8C 4PJHF 1KGWA 1I3GH 4H0GA 4PG2C 2QDVA 3RX9A 1AMYA 3H4HA 3GSRB 3L1OL 3UTSE 5L88H 3D12B 1IT9H 4WTZG 3UXFA 4WHCA 1I3RB 1JXGA 1Y0LB 2H0EA 1CYWA 4UWQB 3EJRA 3SDDD 2X40A 4QXUH 3Q6FB 4JFPA 2LE9A 2VDOL 1QUNB 3N43B 4XMLL 2J6WA 5IB4B 4JFWA 4F2FA 4P2QE 1I7TB 3QEQD 4LPVA 4ZMQA 3JV4A 3MLVH 3KGTA 5ESQB 4DIXA 3RVTD 4Y9GA 3UPRA 5GISL 1QYGL 2ATKB 4HBCH 2V17L 2GFBB 1GSMA 3ESMA 4JFXA 4MJ6B 4Y4FB 3H85A 1BVLA 5ADPH 5IB1B 2Y36H 3QUXC 3BC9A 3B9AA 5C3LD 1KCUL 1FL3A 2R0LH 2UY7B 4BZYA 4E9VA 4KZDL 4NOFA 4X4KA 2P7TA 2V3EA 3P2DA 1FAIL 1MG2C 3JUZA 4B9CA 5F7LB 1NCTA 4QHLA 2W60A 4P5RA 3VX1A 1F8TL 3SDYL 4BFOA 4KO9A 3BAJA 3KWTA 3MV01 1ADQA 3QXWA 2DYPD 1VZHA 3GHEH 2EIDA 3RKPA 3B5GA 4D9LL 5LBSL 4KKLC 2KHAA 3ZRCC 1TPXB 2BRQA 1PY4A 5EIIG 3WIAA 4GO6B 4XBPA 2W0KA 3SDXF 5BRZA 4DZ8B 3GIZH 3SCMB 4JR9H 1DLFL 2VL5A 1XGRA 4R0LA 1RIHH 4Y2LA 3CDGB 2QPSA 1VPOH 4FXTA 2D7PA 5IOPB 1VEPA 5LHDA 3QUZB 5FO2A 1MCPL 2M1KA 2ZJSL 3VXNB 5KVMC 5DUBB 3MGOA 1P9MC 2EDJA 5FW7A 5DFVC 4I9WE 1I1FA 4JJ5B 3RTQC 3ZIMA 2HH0H 4OQTH 2ZWYA 5E94B 1M2VB 2H3NA 4JHVA 5JIMA 2BZDA 1XGYL 2XT1B 3OTTA 2VDNH 2J8UF 4O5LL 4FABL 5J11B 2ZF8A 3WO3B 1QSFA 2EIKB 3OC5A 3GSOA 5F1OB 3VRLF 1G84A 4YSOA 4URTB 1FDLL 3I6GA 1BLIA 1PJ9A 3D2TA 1G9NH 2C9QA 4QOKA 5GGVY 3HJ0A 2VZTA 3LRMA 4KI5C 7PCYA 1MCDA 4GKNA 2DMKA 4NHCL 1AIFA 1OM9A 3FDWA 4D0DA 1F58L 2X4UA 3EJTA 1PY9A 3SB3A 5ACZB 2XJKA 1P84K 3KH4A 4Y4FC 4GMTL 4FDWA 1NDGA 5AVTB 4U1NA 3V0JA 5E5MA 3IDGA 5TQ0H 1NCAL 1V05A 1QFWM 3KYOA 4Q0XH 1WITA 1A9BA 1FNAA 1QTPA 5FYKL 3NIGB 2GI7A 2A6IA 2I85A 2FO4A 4H8QA 1I7RB 1F4AA 3ZZ1A 2IFFL 4ODUA 7CGTA 4JKPH 5E2JA 1A6ZA 4IRSD 4NM4L 3FCSB 4P2AA 4AGOA 3MRMA 4OBSA 4F5CA 4GMSH 3RU8L 1RZ7H 1GHFL 1ASPA 2F08A 2JLLA 3V6OC 1IKOP 4PG9B 3QIUC 1ACZA 3WUWA 2ZSVA 3MLRH 4L4JA 3WGVB 5C0BD 1HZHL 2ZWNA 2Q86B 3REVB 3FO9A 1KN4H 4RIRA 3SJVD 3OKEB 1WTGT 4WK4B 5HPMA 4FL4C 3GD1C 5AVRB 2CKBB 1XCQB 3H7BB 5DURD 4PJBE 3HZYA 4QRUB 3LH8A 3N0AA 4MVBD 5GJSL 4PJ6A 2KI6A 3ZE0E 4GAYB 4WGKA 1AQ8A 2D4DA 1IE5A 2VISB 2QR0B 5AUMA 4AI7A 3IAPA 2YBRB 4W9KC 1OAXL 3IPFA 1JFQH 3MRBA 4MNHA 4AENB 4JLRB 3S36X 3JBG7 1QSEA 1JMZA 5CZVL 1L6ZA 5DJ8A 3RIAK 1B0GB 3DIVA 3BJ91 1QOKA 1EFXB 5IP4A 1M7IB 2BCKB 3FOLA 4JFHE 1TJGL 1F1AA 1RIUL 1CDBA 5EA0H 3K5SA 5F6HI 4Z7OE 4PRHB 2X6BA 3FMGL 1F90H 2X2HA 5EZJA 1I1YB 1XH2A 2X3AA 1KPUB 3O45A 2ADGA 4EKXA 3LRSA 3X1NA 3QORA 4FP8L 4N0UE 4S2SA 1MCHA 1R34A 4WUKH 3QIWB 2NUPB 4DOHB 2KL6A 3L3IB 2Z1KA 5D6CA 2ZKWA 1UM6H 3EYQD 3JWDH 1M1SA 5FF6B 4FQXD 3SN6N 3W9DB 3VDCA 3TZVA 5DLLA 5ELIA 4N9GA 3L7FB 3VD5A 1TTAA 2HJLA 5JOEA 4ZTOH 4HC1A 4KJPC 1HHHA 1GC1C 1W72B 4JG1L 2XWCA 4XBGB 3RURA 4ONHB 1J1PL 2X4SB 3U6RA 3BSZH 2OMVA 3BKYL 3FOMB 1DVUA 1QLEB 1ZS2A 4FQQB 4TV3A 2B1HH 1G7LB 2WLKA 5EBLA 1QFWL 1AYOA 4LSQL 5KJ7E 1TEGA 2Z8RA 1D6VH 1PLBA 3ETBJ 2PR4H 2WK2A 2W0PA 3PXHA 3TA3A 2OKMA 4NIKB 2XQYK 4QRSB 5B38B 5ANMB 2J2ZB 5F7EL 1X5HA 4YDNA 3SDDB 1JHTB 5AW4B 4JFYB 2Q6WB 3EOAB 3EDEA 1A2YA 4GEJA 5HHOE 5I1DB 5F3HB 4OFPA 2GVYA 2IH8A 3PHOA 3LZLA 3IFPB 3QEQB 4QTHB 1YMME 5SV4A 2CBMA 5D6DA 4JVUA 4NHUB 3SPCA 3DNKA 2R83A 3LV3B 5AYQA 5GZOA 1JIBA 4XN5A 4M43L 5FHBL 4GRWB 2VXSH 1RURH 2J6EL 5T1LA 1JPTL 3KYKL 1XB8A 3UC2A 2H3XC 1JE6A 3LQZA 4JBSA 4GSDL 1QO3A 3ZDZF 4MNGA 4TM9A 5DLML 1SY6H 2CIKA 2IAND 3I3BA 3VXPB 1JL8A 2VQ4A 3BPNC 5LGJA 1VA9A 3DKHA 1WYJA 4ZPTB 4XAWH 1F41A 4OZFH 2DYPB 1IQWL 1EWHA 4QHKJ 5AAPA 5ID1B 1B4JH 2WXFA 1MHPH 1JGVL 4X4ME 4YX2H 2APBA 2CCLA 4NN6C 2YZ1A 1FV1B 4YHZH 5CLXA 2RQEA 2HT3C 1U8OB 3U46A 1YEHH 4AUJA 4YXHH 1VHPA 1G7MB 2CQVA 3JWNG 3VFNB 1SXBA 4J3UA 4X5WB 1LDPL 2N4IA 3D33A 3FXIC 2WOBA 3FQRB 5I17B 1FNSH 4AEHH 4FXKA 1U6AH 4BK8A 3BQUA 5FYLD 4HSCX 1ET8A 4OSUH 3ZE1B 4GKOA 4WU5A 2O6EA 4HCIA 5GRYA 4AKOA 5EBGA 4ZMTA 1TYJA 4GNKB 2N59A 2FR4B 4P2QA 4EDWL 1E5UI 3I6LE 5JMRA 2YUWA 3RDTD 1N8OE 4HUWA 2CHWA 4HKJA 4RMQA 4L4VD 3T1FB 3VTAA 3ZL4L 4XX5A 1KDJA 3CH1A 3GMLA 5IROA 3O3AB 2IIJA 1R19A 4BCYA 3E8UH 4G80B 1ETZA 3IU3A 3NJNA 3MLTB 1F4XH 4JPWH 3L5WA 2YFOA 1J9CT 1FVDB 3MOBL 3ZL1A 1M9SA 3SY0B 2WKLA 1ZHKB 1DQJB 4RRPG 1EANA 2LTQB 5DFWH 1HL9A 3WKNA 3BXNB 1M1XA 4W9ZA 2ED8A 1UZGA 5FR3A 1N5AA 4KOCA 1AE6H 4MDIA 3EBAA 5J8OA 3GSWB 5TPWH 4A6YA 3MBXL 2EUWA 3LTVA 2L7UA 4I18B 4O51B 1F3DJ 4L37B 4U6VH 4F33B 1Q9OB 4WI8A 1YYCA 2JELL 1U36A 2YA2A 2BY3A 4IRSB 4EDXB 2PPDA 2ALAA 2Y25A 4Y89A 1TZHB 1F4YH 3QFJD 5CMAB 5ENWA 1YYMH 2CHZA 4UIMA 5EFIA 3OKMA 2BZCA 2VLRE 3RVWC 1NAMB 2RAMA 5KSBE 3GJFH 3PJSB 1Y18A 4MB3A 3VD9A 3K72B 2YMXL 4TVPH 2YD7A 5BQDA 2PCPB 1S5IH 4LGSB 1OV8A 1AVAA 3QNXA 5C0BB 1WGVA 3O3BA 4C83B 1OAQH 1BYNA 2LR4A 1BP3B 1TZIA 2RCSL 3EBGA 4DUWA 1FLRH 4HH8A 3N42F 3CHXA 4AM0B 3VRJB 4J39A 3HC4L 1P4UA 1KJMA 1QEWA 4LBEA 4P0DA 5DURB 2UVFA 3L5XL 4PGDA 4PJCF 4DP4X 1Q0XH 1TIUA 3KBFA 4BA0A 5L4JA 3CMOH 4OCSH 3GSVA 5LN4A 1CFNB 2OMUA 5IHBA 1N4XH 3OR6B 2AJUH 2AJZA 4LMQI 1TJMA 3PWUA 3GBMH 4AXWB 1JHLH 2K8QA 3BKMH 4M7LH 3P4OA 2HG0A 4P5TA 5A6IA 3SQBB 3O8XA 2NY2C 3DSNB 3ETSA 3T3MF 3SHSA 1MXGA 5FLVA 4ISVB 4KK8C 2QVKA 1MWAL 1NGZA 4LVOB 1T0MB 1MFEL 1CO1A 2G5RA 5KVGL 1TJIH 1U3HD 1FCGA 3SYOA 1YEFH 4Z6AT 2A38A 4U49A 2ZG3A 2DQJL 1CI5A 4KHXH 3MYJB 1GTFA 1LM8V 1FWXA 3FUJA 3FUNA 1RSFA 1AHWA 1L9RA 2QGBA 3GM0A 4S11A 4X6CB 5DI8A 5IG7A 5FFOA 4FQXB 1USZA 3FU7A 4C58B 2NZ1A 4DP0X 3GWJA 1AZVA 1XMEB 4G1EA 2P8MA 1TSHA 4OIAA 4Y2OA 3V0VA 4ATWA 5F7WC 3C08H 4XCFH 2AKRA 1GIGH 3DPBB 3O6KH 4G6JL 3HR5A 4J5VA 3L17A 2BOBB 1ONQB 1Z0NA 5T1MB 1OM3H 2R23B 3VH8B 5E2TL 3EYOB 8FABB 3GUFA 3DX9B 1XCWA 3L4YA 1CVRA 3RB5A 1D5IL 2Y2YA 3DV6A 4XXCC 1NFDB 5FYJE 3QXDB 1GTNA 2ZCKL 1KF9B 1V7ML 3QO0B 1XEDA 1IMHC 4LPYA 2WUCL 2YWZA 3D4ZA 4GI8A 1NJ9B 4WWPA 1A64A 5J06A 1UQSA 3CZLA 2C9SA 1CF1A 1RZJC 2E5EA 2BZ7A 2DL9A 1MWOA 3LPOA 1RK1A 3MNDA 1GC1H 15C8H 1CIUA 4U6HA 3MRNB 2XZQL 1A7OL 2ZKHH 1QR1A 2IPUK 3HVDA 2ZWKA 3QIBD 1S4IA 4XP9H 3KXFA 2IANB 2Z3FA 2XWEA 4J8QA 1PZ3A 5IFJA 4UINH 1Q0EA 3AU1A 5HHQB 3EGSA 4J3VA 2AXGA 5KVEL 3ZKXB 1OO2A 1AGDB 2FIKB 1OSZB 2F54D 2LLGA 5DD0L 1SN0A 1FZKB 3VCLB 4EI5D 3WJJC 1BIIA 4H0LC 1EEYB 2XC8A 2B1AL 4QRTA 3F04A 5IUSA 1LO5A 3QI9D 5JHDE 4DKEL 1L3NA 4H20H 1WCBB 4PY8I 2CBQA 2YGNA 5SX5K 4ONGL 5IMMB 4F3FB 3ABZA 4M7KH 3AXLB 4X6FA 3SKMB 1ZSDA 3HG3A 5EO1B 2GJZB 4FEMA 4FZEL 3TPKA 4N5UA 1HOCB 4GP4B 2TSAA 5HHOA 2YARA 3BFQG 5E9AA 2DOCA 3CFBA 3FNKA 1PNDA 5DWUH 1E28B 4TSBL 2BS8A 1N7MH 1YMMA 3RDTB 2ZUQB 1EV2E 2HLFC 4OZFG 4MRBA 1MDAA 1IGYB 4MCZB 2BOCB 4XR8C 5E1AB 3SGEH 3GPEA 2VDLB 3UBXB 5MHSD 3UG3A 3KR3L 1X4XA 5GZNA 5KSVB 4ZXBD 3HE6C 5DJAB 4XCYB 3U1PA 2LVCA 4HGKC 1U91B 4R96A 3TBYB 4PVMA 3LKRA 1OGTA 2NNFA 4HOMA 3G04A 2DJUA 1X7QB 3L4VA 4QRPA 1ZGLP 2EKJA 4AG4L 1ANUA 4P2RD 1XZWA 2CHNA 5I6XC 1LEGA 4BE5A 4RAVB 1EHNA 4A2DA 2CMRH 4HU8A 4MA8H 4EAEA 1BZDA 2W9DH 5AW6B 1YA5A 4GB9A 3BMVA 4M1DH 2ZICA 4OVUA 1IKFL 3QFJB 4MMXA 4OUOA 1KTBA 5HDBE 3VXUA 4EXPX 8PAZA 3L95A 5KBMA 3DHJA 3NK3A 2EYRA 3RZWA 3LN5B 1GKEA 2OMZB 4LP4A 4XVJL 3KLDA 1EMTL 3IDXH 2QLYA 2JB5H 1BXXA 3KPRB 1J1XL 4XN9A 5HJ3B 1JGDB 2CBOA 5JLZB 2JKWA 3SIKA 2VQ1B 4LEOA 3LQAL 3MJ8B 2NCMA 4OBRA 3QISA 3MRCA 1AP2A 1QA9A 4EKJA 5JZ7C 4G8AC 4FQIH 2OMYA 3CUPB 1P6AB 3QQ9D 4M1CC 1UJ3B 2K7QA 2DD8L 3FUKA 3AGVA 3NN8B 1VIWA 1CTNA 2Z65C 1CICB 1BQHA 4X5XB 3H42L 2X42A 3BUDA 3VUAA 3ZQ9A 4HCGA 1I8LA 5MEND 4CBZA 3OPUA 1QBLH 2KZBA 1RJYA 3M07A 1XR9A 2PTTB 5CR8A 5EF1A 5IEHB 4Z95H 1HHIB 1T89A 1TQVA 1BX2B 1MW2A 4J6IA 4OD2A 5EHFA 2W94A 5L8JB 4TQHA 4DN3L 4G3YH 1DEEA 1T03H 4QTFA 5BQ7B 2ZZUT 5FFLA 3MRFA 4OCRH 3Q9QA 4XOAA 1E65A 5I5RA 1GKOA 1A9VA 1IGTB 3BT2H 2XTLA 2IAMA 4MNQE 4F7TB 3QDME 1U3HB 1J0YA 5DHVA 4HUVB 4TLKA 3V4PH 2X9ZA 1JYNA 5ID0B 4APQD 3PY9A 5TQ2H 1QVOB 1QABA 2RTTA 3FQ2A 3PP3H 1ZLWK 4NZRL 4B9YA 5HHVH 3WLWD 4UV4H 2VDMH 1TJHL 4MLIA 2HAZA 2EUXA 4HJEA 5DUPH 1YPZF 4AMWA 1DBML 3QHTC 1EZVX 4Z7WF 5ISZE 4OJFH 4YHLH 3G6AA 4QTIL 1I7ZB 1Z5HA 2GSMB 3TNMB 3UPCA 4CN6A 1S7QB 5IK3A 2Q8BH 2IVFC 1NTDA 3FAXA 5CFHA 5DS8A 3TU6A 3N1QC 3NCFB 1XTLA 2ZOUA 4HWUA 4JVPA 2A83A 4KNQA 3HS9A 1R24B 1J8SA 2VZUA 4YZFE 4GKSA 2ZCLL 2CKNA 2H9GA 1CICC 1X4ZA 3BAIA 5I1JH 2A9BA 5C7XH 3O6FC 3P77A 1C12A 5E8PA 4TNWK 4N2FA 3PE9A 1J5OL 5B3JE 3W11D 2NY0D 4L8SA 4I4WA 3UMNA 1KY7A 1MCEA 1S7WA 3U2SB 3HPJA 4N25A 1A7RL 1LJMA 4FFZL 1SVCP 1N67A 3GHBL 4L3CA 1Z5LB 5AYUL 4GRMA 2FYYA 4NQUA 1OE1A 3QIBB 1KYUA 2UYLA 4J23A 3O2DH 3TBTA 3HC3H 3N5AA 3ROOA 1A1OA 1YEEL 1YHPA 5DJ0B 1OCWH 1KGYE 3WE6B 1R0AL 3FS9A 3SE4A 3P9MA 4HK0A 4WJ5A 2F8IA 4P46B 2F54B 1MJUH 1XZ0B 2FK9A 1ZA3B 1NCHA 4G5ZH 4EI5B 3VSQA 2B16A 2Y07H 2FO1A 3TCLB 1ZTXL 1SYVA 2FD6H 1INEH 2DQTH 4OZ4B 4XWOC 1F4WL 3TCTA 3UCQA 4LKXB 4ORZC 2HN7A 1RZJH 2ZXWB 3LPWA 1BYPA 3QI9B 4JFDD 2CG9X 4PJGE 4PJEE 3FQTA 3N9GL 1X3DA 4RMUA 5ERWA 1USQA 3WNJA 4JFUA 1CLOL 4ODHL 5AKRA 1PKQE 3WTWA 3BUIA 2NY5L 3IKCA 4AC4A 5IFAL 1HL8A 2VLLB 2CH8A 2MQCA 4EE2A 5ACMA 3GMPB 1IGML 3NCJH 1KEMH 3H3PL 4JANB 3K71B 5AVUB 3VFGL 1OD9A 4WO4A 3UAJD 4PCTA 5FLUA 3VU1A 1E2ZA 3NH7H 4OV5A 3X14B 2OW7A 2V8LA 1KLUB 3LAFA 4NJ9H 3WIIH 1AOZA 2IH3B 4YSUA 4L8CA 4BFJA 5DJXA 4WTZA 1K8IB 4YR6A 2Z7YA 3OF6D 3S8FB 5L4FA 4R97C 1CGVA 2GIMA 3K0YA 4PTUA 5DYOB 3NJLA 5FK9A 4GFXA 3RGHA 4KZDH 1RD6A 1N2RA 3HB3D 1J8RA 4KAQH 1FAIH 3MV9A 1AD0A 1IAII 2CO2A 3PREA 3IDIA 4AQEB 1Z9MA 4HKBB 2Y1ZA 5FUZL 1PZDA 2EICA 5AZUA 5GS0C 5LBSH 3S36L 4BWTA 4NP9A 2BOLA 1RZPA 1FRGL 4P2RB 4NT6A 1GOGA 3C8DA 3BE1L 2NUTB 1SFDA 1RK7A 4APXB 3DYPA 2D3JA 2E6PA 3G5ZB 3RIFF 2WLHA 4P4KA 4IM8A 4Y16A 2FWUA 5TE7H 2VABA 3TTSA 3CSTA 1HXYA 1OPOA 2XIDA 4XBMA 4HX1B 1S9WB 1XD0A 1HXKA 4PLKD 4GT0A 7FABH 1CL7I 5DD1H 3DUHA 2B5IB 3OKNA 1YEGL 1IGFL 5GRVK 4URKA 4OKVA 3MRGA 1JV5A 5HJGA 2ZAIA 4UT6H 1P2CA 3TJEL 1XGYH 3C6SB 1KXVC 1Z3GL 4O5LH 3FZUC 2IV8A 3KDPB 5ADOL 2C3GA 5EU6D 3IFOB 3TYGL 4BH8B 1XH0A 5DO2D 5C0CD 3QEHB 4JO5A 1FVEB 2GJRA 4XVTL 1EDYA 5BO1H 2ZG2A 3ULVL 1A4BA 2DWDA 2FAUA 1E4XI 4UQCA 1ZIBA 3QWRA 1OQXA 2HTLD 1CLVA 1EHLH 2XG4B 3EJYC 3SPGA 5K33A 3ZYIA 2JCCB 3K6NA 4QWWD 3MLZL 3NCBB 4J3TA 3ZDWA 3OQ3B 4S1RL 3R19A 3ATAA 4ADJA 3SGKA 5L6YH 5F7AA 4JPIB 2GG1A 3H55A 3CC1A 1IGCL 1PNCA 5T1KA 3ZQXA 2G75B 1VADA 4ZFOB 1GYAA 4AZUA 3B9DA 4X7TB 3GXMA 2NCEA 2LABA 4GIAA 2EO1A 4R7NA 1RZGB 3KLAB 4N87A 3CH8A 4L9LB 4NM4H 2OL3H 2E47A 4XP6L 1OLLA 4K3GA 3RLSA 3RU8H 1S7XB 3L3KA 3Q3GA 4FCHA 4FXLA 5ICXB 5KN5B 2CGYA 3BVDB 3P3SA 4APQB 3KLLA 1AQKL 1E5YA 3CZFA 4PLOB 1ZK5A 4OH2A 3EXJA 4U1MA 1F42A 4WNJA 1U8MA 3SBRA 4HJ1A 4E42A 2FHFA 5EU7C 5ITBH 1INQB 2HG5A 1LVEA 4E41E 4FQLL 1Z1WA 2B5IC 3NIDF 4JL1A 1JYVA 1U8JB 3D39B 3RBGA 2WXPA 1JZ8A 1OD7A 1UKTA 4HP5A 5HP5A 2VSMB 4J3OD 1DJHA 3QWOB 5FUCC 4IDJL 2H2PC 5ETUB 3UTTD 1EO8H 2V9QA 4CSZA 2CIIA 3IGLA 1OF2A 1EZLA 2HX7A 3Q01A 1BG9A 4EUPG 1WA1X 2DBLL 3L08A 2D2CC 5M7QA 2H0JA 3EJZC 3MBWB 1ZT4A 1JRHH 3TO4A 4OCMC 2HVBA 2ZAHA 3JXAA 2NSMA 4OGXL 4ENZA 1PZAA 4Y5XC 1MFAL 1NICA 3IJSA 2ICWJ 2P45B 2FH6A 2LLNA 1A21A 2X9XA 3GQFA 4M6ML 4LOVA 4YUEL 1UXSA 2IDSA 3QDGD 4MMZA 1MIEH 4ZFZA 1TJGH 2NTFA 2NY0B 1J9SA 2DQEL 3O4OB 3OXSA 4EI6A 1M42A 1RUQL 3GKWL 2E74C 1KPRA 4JFOA 2BHUA 3GUTB 5D1XC 2RACA 5F97E 5AW3B 1EAQA 4F9LA 4ELKB 4FP8H 3QDMA 3HNTH 3ULUL 1VFBA 4WNSA 5C0JA 1N6QH 1F86A 4XH2A 4LVNB 4JKLA 3QJVB 4YDLB 4I0PD 4LESA 4UM9D 2X4QA 4UV7H 1MAKA 2IQ9L 2H3KA 4HIJB 1G94A 1R3JB 4HFWB 3PQYE 3OGCB 4GBXA 3VXTB 3QUYA 2OW6A 2Z35A 1VESA 4F7MA 4W9JC 1PBYA 5IVXA 3EFOB 1SYSB 1LO3L 5ISZA 1HYRC 2I5YH 4JFDB 5D7KD 5T5NG 1G5GA 3OJVC 5DD5H 2FGWL 4F7PB 1HC1A 3KHQA 1D2OA 5FA3B 3TO2A 4BUHA 3GGWA 1RUAH 4XZUB 1QBAA 1HINL 3A4DA 3BFOA 4JPQA 1UWGH 5EUOB 3SD2A 1OGPA 3JV6A 3OHXB 2R0WL 3LEYL 3NJKA 2V7HA 2CBTA 1D7BA 2NDGA 2DQUL 4LQFL 4RFOL 5D5ME 5INCB 1OY3B 3FCTA 4NSKB 3L9EA 4Z0XA 3MKGA 3ZKND 4ZMLA 2PYFB 3ULVF 2HVKB 2J5LB 3DGDA 4GG8A 5FHBH 3T0XA 1YAZA 2QPEB 5I8CB 2NNXA 2Z31B 2BHYA 2CKBL 4PRDB 3V0WL 2ZUVA 5I1LB 2DEXX 4ZS7H 4HKZB 1O6SB 1AO7D 2YPKB 3HB3B 3V95A 4AVHA 2Y23A 1JCKA 2XWBA 3QT2A 1JK8B 1K8DB 3GXIA 2EEFA 4K9JA 1ZLDA 3N43F 3AG2B 4XCEB 1R1CA 5IW1B 4L5FH 2F6AA 1PGRB 2WLZA 4L29B 5H35A 4QLRA 5L2KD 3G9VA 2ZD0A 4JREB 2KKQA 1SJEA 3DIFA 4QDGA 4P04A 4ETYA 3CHRA 4EXKA 4PPTA 5GGQH 4KH9A 1YLBB 3C5ZD 5KUMA 4EQ2A 1TQSA 1OLZA 3MA7B 3T8XA 4LSSL 2ED9A 4IJ3B 4PJGA 3VSTA 4PJEA 5EIVA 3QNZA 3SKUD 1WZAA 3G6JE 4XMPL 4XX1G 1BM3L 4G8GA 5E2VL 4LCCC 2AF2A 1L0PA 2DM4A 3G08A 5DEGB 1E8XA 3MUGA 4OUUB 3MLPA 3TN0C 5HSFA 2BK8A 5EMYA 4RWHA 1AC0A 3KPSD 5EU6B 3RWJA 5ACLA 2BC4B 2DLFH 1UEYA 2WWKO 1LO2H 3FQWA 3T08A 4EDWH 5C0CB 5GS0H 2VWEE 5I8OL 1JVLA 3MXWH 2GBAA 1W72L 4J1UA 2O5NA 1KCRL 1A6TA 5D7JA 4C4UA 3MRJA 4XC3H 1E5BA 1QLEL 2VZSA 3JTBA 4S1QL 4WI5A 4KJWC 5JPMC 1CXKA 1PKOA 4XVSL 3P30L 5D1ZI 3S35X 4Z3GA 3MOBH 3ZK0A 1FL6B 4BZ2H 1HSAA 4K9EL 4IIQA 5IB3B 2Z31C 2R0KH 4IBLT 4AEIH 5L8LB 5AW2B 1S7TB 4X8CA 4PGEA 2VR4A 1CDUA 2JJSA 3MLWL 4PJDB 2BFVH 3MBXH 5D7EA 4NENB 4PEEA 2LU7A 1KIPB 1NBQA 4FI6A 1HQ4A 1MQKL 4NQDE 3Q06A 3HNSH 3ET9F 3J8F7 4DETA 4DNLA 2VR8A 4JREC 4FQ1H 4DEPB 5I16B 5EC1B 4RRPA 1YZZA 2ADJB 3QO1A 4KI5E 2G4GA 2QL1A 3S7GA 3ULUF 4NIYE 3UYRL 1X5IA 5DZPA 4EEEA 4ZUVB 4TVPE 1I3UA 4KQ4H 4OQTA 2EADA 3WS6C 3FTUA 1TQCC 1UB6B 3QR0A 4PMFA 2J1XA 3LIZA 2EDBA 2BSSA 3GINA 2DIBA 4JKWA 5IQMA 4X9YA 3NIGF 1UGNA 3UGEA 1T4WA 4DT2A 1SUJA 1ZAGA 2EC9U 2EJ1A 1XF2A 3QHFL 3AMKA 1JZJA 1HCYA 3UTTB 5DFAA 5B39B 5MERB 2A4CA 1PCXA 3PG2A 1G6RH 2DLTA 2E8YA 3IRPX 4H1LG 3B1TA 3S5ZA 1JPGA 4OT1H 2P8PA 2VERN 2V8MA 4U2YA 3V6OE 2KMWA 5D7LE 4V1DB 3ZE2E 5HGBA 4TL5A 1DCLA 2APWA 3SDAC 4FTVE 4AV5A 5J9PB 5LAXB 1IEBB 1VAHA 1OW0A 4ELDA 1QBML 2AW2A 5EEWA 3NESA 3WEOA 4JFFA 1VERA 4ETQB 1J8HE 3QDGB 4LCYB 5D1ZD 4YVUA 4YIQB 2F5AH 2NNAA 3RY5A 5JXAH 4KRNA 1MFEH 4MJ5B 4NQTA 4KRPD 1KGJA 4QXTA 3SKJH 5KVGH 3K0WA 4LLMB 1MLCA 1HXMB 2JLPA 1CFSA 4LLQB 4POZC 3RI5F 2WIMA 3DVGB 2UX6A 4U7KA 3S3CB 3UTZA 3WIHH 4K7FB 1U8PB 5AOZA 3VGGA 5FDWB 3RDJA 2V2TB 2ZOLB 4QRFA 4F2ME 4K5LA 2I7SA 4MHHG 4I0PB 3MLXL 4UM9B 1OF0A 3OG6B 4RA3A 3MJ9L 2OMXA 3QS2A 1GR7A 1LD9B 3CK0L 4DK6A 3PJLA 1MHEA 3QFDA 3RL1B 4E41A 3L3DA 1MFBL 2YXFA 2NSXA 2YD8A 1MW0A 2FH8A 1AANA 1BREA 1UT9A 3BLBA 4NRZB 4IU3A 3POCA 4ZZKA 1SXSA 1KB5A 3A47A 3DA0A 3QHZH 1CQYA 1A7NL 4FGMA 3RA7L 3ORJA 3FQXA 5KUKA 1KV3A 5BVJA 3MRLA 1KNOB 2WBJC 4FE9A 2FX9H 4WFHE 4DPBX 5E2TH 4ANWA 4YLQT 4GFTB 5F8RC 1UC6A 3NSCA 1GZPA 1NAML 3MACL 1FO0H 1T2XA 4G1MB 4ZDHB 5ICUA 3D4CA 2CPCA 1QW9A 1BYOA 3L3OA 1ZOXA 5KSUA 4TNVK 1FE8L 4BKSC 1ODAA 3FQYA 5J6SA 3CV5A 3VFSB 2YC1A 2YSSA 3AY4C 3CLFL 3SQOH 1NGWA 2J5WA 2Y3AA 2J72A 4MD0A 2VDRL 5I1IL 2I7OA 5I6LA 3DX3A 3WEXB 5L9DL 4GYBA 5E1HB 1BOGA 3BZFA 3IKKA 5JA9A 1MVUA 2HJFB 3DTDA 3DBSA 1T7ZA 2WQAA 5FC9A 4G6KL 5JDSA 2OJZL 2Y5TA 2ZP9A 3OKOA 1AO7B 4G8FB 4LPTA 3FN3A 2GEQA 4D0CB 3SGJA 4K71C 1J0JA 3R7RA 2FB4H 4L4TE 5SX5H 3RRQA 4DP9X 2IOMA 4I8DA 4PS3A 4PRNA 1E6JL 1XSKA 3N40F 4R4BB 4UB0H 1MELA 2LGNA 5L2KB 3DTUB 2GJJA 1IC0A 2OTWA 3QXAA 3D25B 3PQYA 1URZA 4J3XA 2DQIL 4M4PA 5E4EB 4QNPF 4LSPL 2JXMB 2VW6A 1I4FB 2WZ5A 4N2BA 2VLMD 4I2XB 4DKEH 3C5ZB 2R69L 3BVTA 2VH5L 4XOBA 1JPST 1QPPA 4LKCB 1TTFA 2XNAA 3V10A 1QKZL 1YG9A 3II1A 3US0A 2VZVA 3MRQA 5DJCB 1UD3A 1NMAH 4F15B 3VFMB 3WIFA 5K59E 1TCRB 3KPLA 3GI8H 3DX7A 5D2LF 5D55A 3ARFA 2WBKA 5F9AC 4JG0L 4FZEH 1D5BB 2OI9C 3D3VD 3KPSB 5DSCA 3FTGB 1NM9A 4GEIA 2NR6A 2AXWA 3Q6GH 4EOWH 1WEJL 5D5MA 2ARWA 3D0VB 2DQFA 4E9SA 3KYNA 1NEZB 1OP3H 1YC8A 5BXFB 5CD3A 2DMHA 4NQED 3H6JA 3TPUA 2P9RA 2WLLA 4OJCA 1N64H 1R3KB 4Y1AD 3IFNH 1H15B 5FHAL 4AYSA 5GS1B 4GRLC 3T9WA 1AJ7H 3WOVA 5AB9A 5KEZA 4PG2A 2M26A 2FX8H 3CBKB 1M05A 1KG0B 2CRYA 4UQDA 4ODVH 4KKBC 1S7UA 5KG9A 1DVZA 3RPIA 5J3HD 3NYKA 1DDTA 1MFDH 1LK2B 4OZFA 3V5HA 1R5VA 3NSDA 4PJIE 1AXIB 3ZZLA 2OMWA 1W0WB 5T5FL 2O6FA 3APNA 3WJMB 4GW4A 1KJ2B 4HFUH 5HY9B 2B20A 3DLQR 2DKUA 1I7UB 4EPSA 4OGQC 1Q9LB 3WTUA 2ILLA 4LAQL 1VB9A 3RGVA 4PJHE 1A4KA 4JW3A 3LRKA 3CDZB 1T3FA 3LEVL 3V8CA 4DVBB 2LAAA 3BWUC 4XHQA 5FKPA 4M61B 3L3JA 2TRHA 1HHJB 3TTYA 3U7AA 1J05B 3AT9A 5GXBB 5DEFA 2FO8A 3IDNA 3THML 4N6RB 1JBJA 3G6JA 4F80A 1OGSA 1EMTH 2H5UA 3GS0A 1IBGL 4JM4L 3C75A 5E8EA 3T4AA 5KW9H 3A6CL 4QKTA 4WDIB 4J4PD 1M2OA 4PJ7E 4PUBH 2VXUL 5A16A 4Y4HC 2B9BA 4JFTA 3EUUA 4JAMB 2NY4D 1JI2A 2YUZA 4F15C 5FB8B 1HYSC 5B1KA 1RZ8A 5J6HB 1YDPA 2CDFB 3HAEA 5CILL 4B9FA 1LWRA 3W3BA 1RPUA 1T7XA 2O1AA 3EZJB 2AEOA 2GJ6E 3LS5H 3GBLA 1MLBA 3RVXC 2GBTA 1J5HA 3B4NA 3IETA 1ZEAL 2W9EL 5IQOA 2DIAA 3DXAD 3I2CL 4GP8B 1CPUA 1F6FB 1S3KL 1JPEA 3PWVB 1BFSA 4XPAH 1Q94A 1T5WA 3TJHD 1E2WA 4G11A 4RGOL 1ZVSA 5F1KC 3RPBA 2IGFL 3RTQA 5C9JB 5FYLL 4ZMWA 5HPOA 5DUML 3QVAA 4BHUI 2OK0H 4E9LA 2JI1A 3SDXE 2AXFA 1EHKB 1UVQA 1GMIA 2JIXA 1I1AB 2PO6A 2N56A 5D1ZB 4L1TA 5C0AE 5EG6C 3S4SB 2AK4E 2HUEA 2NY6B 1K4CA 3NCWA 5DEJA 4WUUA 5TF1H 2V6HA 2OZ4H 3B9KA 4NQDA 4KRPB 1L9QA 4BFGA 4PH8A 1WFTA 2VDLL 2L3BA 1L6XA 4JN2A 4E36A 4FG4A 3WN5C 4UYQA 1XBRA 1TQTA 3K3QA 3PNRB 4XNYL 3F83A 3H3KA 3NQKA 4IKLA 4ONFL 2ZSWB 3GJFA 4ES9A 4MJJA 2HMIC 3T2PA 4NZRH 1UXWB 3BEWA 3MROB 3S5LG 1C9SA 2NZ9D 1AKJD 1E27B 5HHPB 1UG9A 3GLAA 3L3HA 5CLYA 5IJVB 2A6DB 1D5XB 5IQ7L 3QPQC 3VRLE 4Z78B 1LQSR 4MAYA 2VDQH 2AQTA 1ZXQA 4NNXB 3CZSA 2X44D 3RWGA 4KITB 3L81A 3H9HA 3X11B 1OHQA 1JP5A 1NCOA 5DGQA 3P0YH 5EDSA 4UDUB 1BEYL 3BIBX 4JKKA 4E9WA 5E4OA 1F00I 1TMCB 5AKTA 5LNEA 2XBZA 1VLXA 1NBYB 4FQHB 1P5VB 1NLDH 1QSZA 3V6OA 1BZ8A 2DQHH 4PWKA 4YJZL 4X6CF 3BDBA 4FTVA 5H8DA 2RBLA 2PW2A 3NPZB 3DROA 2B15A 4N24A 2XVLA 4HAFA 2X3BA 2X3CA 4XP1H 1AYRA 5DRXB 2VR5A 2VXTL 5EZLA 3DBXB 5IVZA 3ZMRA 1J8HA 2X28A 1A7RH 1HSBA 4I7ZC 4FERA 4KO5A 2WC7A 4ANUA 5DEZA 1B0IA 1FQ9C 3HBPA 1AG0A 4PJ8D 4S10A 5IF0A 1I1AC 3PWLB 4PP1D 2WMPB 1IGJA 3GEWB 4P8QA 43CAA 2CLVB 5FECB 2J4WH 2NY6C 2X88A 2BIOA 3A4AA 5EULV 4FZ8L 5BUGA 3FT4A 3RWEA 1V55B 3I3DA 3RY6C 1OAUH 2C34A 1NFDF 5D72H 3ATDA 3STZA 3V6ZA 4F2MA 5I1KL 3U9UA 4KRLB 1GY2A 1AXSA 4RGNC 2XKNB 4N5ED 1NIDA 1UXLA 2YKLH 3A67L 2HKFH 3WCYA 2HX8A 3QCTH 1QLFB 4A55A 1NBVL 2FQGA 1OT1A 2NYKA 4XWGH 1IAMA 5I30H 2ERJC 2B2XH 5HVHB 2JTDA 1RVFH 3ERXA 2CLRB 1FN4A 2YD6A 3MNVB 1FYTE 1T5XB 3GSNH 1G0DA 2DMBA 2O26U 5FGRA 3G6DH 4GXUN 3CVHB 4JHWL 4XNQA 5HYEA 5I0VA 1UZ6F 1UXMA 1CFVL 2V37A 1P7HL 1BLNA 1DJZA 2BLFA 3HPLA 3TX4A 4QT5A 3HG1B 4OGAC 5KS9E 3FFDB 2K3TA 4KZCA 5CIPB 1FG2A 2PP8A 5GPRA 1SVZA 3D3VB 2AMGA 2O5ZH 2VLKD 2CRZA 1TR7A 4JPVL 4HXAL 2QVIA 4OIFA 1BMZA 3GF8A 4MAUL 2XTJB 3QCUL 4BK4A 4XX1E 3DETC 4GSRA 4Q9CA 2EIJB 4NQEB 1J0IA 3B6SA 5KVFL 1YYLL 2DWXA 4NQVA 3V79C 1JV2B 4HBQA 4TMPA 1U2CA 2UZIL 3QJRB 3R0MA 4RWYH 4D8PA 1LO4L 1OT2A 4WZ9A 3C09B 4Y1AB 1GJWA 1YEJL 4UU9A 5DJ6A 1PDKB 1U58A 4IGBD 1KLGB 3OZ9H 5DTFA 1ZA6B 4QHKI 2IG2L 4LIQL 1NUFA 2AEPH 4PGCB 4AZ8B 2AQNA 4L4TA 4PRIE 4L1DA 3CLEL 4X8JB 4W4OA 2P80D 3PHAA 2EYTA 1XT5A 1KTCA 4JUTA 1FZJB 2QT6A 4J8RA 4TSAL 4M5YL 1UWEL 4HUMB 4P57A 2ED7A 2HTKC 2NZIA 3TNNB 1QSVA 2YD9A 3FL7A 4G2AA 4PWHA 2DS4A 5GGRB 3BPOB 3HRZC 5ILTL 3ZVVA 3QWNA 1RUPL 5G5DA 5CS7A 1BZ7B 4JX0A 3ZMNA 1N9PA 4A67A 1ZT1A 4OM0L 2N01B 3TXAA 2RJMA 3RIAF 1Q9KB 1DVQA 4N0YL 4QYOA 5FAAA 3BVNA 3OKYA 5DRWB 4CBPA 1T20A 4YDKH 3FTWA 5IIEB 1HDMB 1WWBX 4H8PA 3VE0B 1RH8A 1VACB 2FATL 3FFCA 2CSPA 1A14L 1C5CL 2XG5A 3EOTL 2WB7A 2Q10A 2F2HA 4JFZL 4LNRA 4AV4A 2R27A 3FQNB 1ACYL 2KPWA 4HJGB 4IKKA 4MXVF 5F0PB 4HS8L 4I3GA 1LP9B 4FNQA 2X89A 4MSWA 1DBBH 4KMLB 2GJPA 4XNAA 5AWNL 1YEDA 1QRND 5CZXC 3DXAB 5J6GB 4AQ1A 4HQQL 4CC1A 5EU4B 1YNKL 1OAYL 2Q0ZX 1P1ZA 2H26B 4HLEA 2OR9L 4GXUM 2AAVA 3VI3B 2Q8AL 5C6TL 3MI6A 3FRPG 4Z0BL 1GAFL 1ZGLB 1FFQA 4MQSB 3RWHB 2XJLA 2E3VA 4JZOA 5LO7A 3LB6C 2IDTA 1UEMA 3WBDA 3BP6A 5FGBC 2G5BA 5IHZA 4PBWD 1VF5C 3CDCA 3QUMB 5CP7B 2A73B 3BO8A 3HC0A 2Y7QB 2A74B 3DGGA 2DDQL 1N26A 4MJIE 5FV1L 3RFZA 1LE9B 4X42A 1WIPA 2YFNA 3B56A 4PJHA 4XP6H 4UM8B 2HPOA 4AT6A 3Q8FA 1JNNL 2AV1A 2OSLA 5A6MA 4G8EA 4G7VH 3UG4A 1HJBC 2DM3A 1Q90A 4RFEA 5SWSE 1AQKH 4RZCB 3BPOC 4R90L 2BP8A 3VXSE 1IM9B 2R4SL 3LN9A 4JO8A 3RX8A 5T3XH 2O61A 1QFPA 1CYXA 1OSEA 1AKJB 1ZWIB 4F92B 5CR1A 1CDIA 4L2YA 2R2BA 1GXEA 1CE1L 1KFGA 1SDYA 2WQSA 4HF5L 2YA1A 3CSPA 5IJKA 5M95B 3DURA 3LCYA 3MV11 3VXRE 3QZBA 4PJ9D 4JNXA 2JI3A 3D8MA 2RHEA 1L9PA 4HS6A 43C9B 4N0FA 3V52L 2GJ6A 3Q5TA 4NRXA 4PJXE 1QW8A 4C54A 1LLAA 4JRWA 4LLAA 4CNIB 3DVIA 3K8KA 2DBLH 2WLNA 1BJMA 5I19H 2AJYH 2JJWA 5A2KH 4WEUD 3KLQA 5SWQA 3EH5B 4TLUA 2HLAA 4OGXH 5LDSA 3T77A 2DYSB 4GG6E 1MFAH 2EZ0D 1NWPA 2ENPA 2BP3A 5TD4A 3PV6A 1XH3B 3PL6B 2XU9A 2CHXA 1WE5A 3SDXA 4K5MA 4EUPA 3HKZA 2IOIA 2EEAA 3KWUA 5L7XL 5C0AA 3ARBD 1HS6A 3KGUA 2J1KA 3VGHA 1WS7A 4JM2C 4P06A 4YAQB 3QJHA 1EZVY 1P0SE 1MI5E 3ARZA 4EBQH 4PJ8B 3V4PA 3S35L 5C07D 2E9IA 3KPNA 3TS8A 1NGYB 4NN7C 2VXVL 2ATPA 4YH6A 3NFPB 4D9QD 2Y69B 3MLUL 4CMMB 3UTQA 2J8UA 1NGXB 1AQDB 4ZFOL 3KWXA 4M5SA 3LZNA 4JHAL 3UP6A 1OL0A 4KC3B 1DBKH 5K9KB 4G9FE 1FFNB 4R7LA 3PDDA 4JY6B 2J71A 1IAOB 1CIDA 1V27A 3NRPA 4RDQG 2W95A 4N8CH 2WLIB 4NN5C 1WAAE 4XNXL 5TE4H 3ME0B 5SWZA 2ITDB 1NC4D 2OQJB 3ROLA 2BVQB 2VLKB 3TBSB 3QQ3A 2ZXBA 4WW2B 2V33A 4QHPA 1ZLEA 2CGZA 4FF9A 4M1GH 4E9TA 1WQVT 1ZVNA 2CJSA 3IDMA 4J27A 1NIBA 4MA7L 3V0WH 3PL6C 4PJ5E 1FSKB 4PWIA 5GIRB 1WJ3A 3DMMD 4WHYH 1EGJL 2WWMD 3O2DA 1NUDA 5JORB 5A2JH 1UACH 3CFNA 4LOUD 2OTUB 4L3EE 1NMCB 4L5FE 1SN5A 1OK0A 4BQ6A 4OD3H 2XPGB 4XGZA 2KH2B 1ORSB 4AQZA 1D2PA 3HMXL 2XZCH 1DANT 5I15H 1MNUH 5IR1A 2GBVA 2CR6A 3Q8BA 5FUOH 3TZVD 2YHGA 1N59A 5DQ9A 2WBWB 1FFOA 2IADB 1BF2A 3QZWG 4Y2NA 4YFLF 1FZOA 2E9BA 5A2IH 1P5UB 3TEWA 4DCQA 4D3CH 4CADB 5CJ8A 2F61A 1UOVA 3FT2B 2Z6FA 1CFTB 1YNTB 1U8LB 1JZ6A 4BUQA 5GHWH 3NUKA 1S9YA 1BM3H 1KC5L 4PS4H 3HZKB 4WI3A 1KEGL 4ECNA 4WFFE 3QXUA 5B4MD 3NFSL 4H0HB 5LVEA 1KCWA 3TA3D 3E7JA 3QNYB 5KS9A 1M7XA 4Q74A 4YHOL 4NUPA 1OB0A 1N8ZA 4JFPB 4LPWA 2Y72A 1X4YA 2M83A 4BSVA 1KCRH 3CFTA 4O2FB 2SODB 3JV4B 4KX9A 5EWIL 2AP2A 1HL5A 4XPFL 3UPRB 3WTVA 1TTUA 2AZAA 2G30A 2GY7B 4JPKH 5M94B 1AAJA 3U0TB 3E1ZA 4JFXB 3PF2A 3FK3A 4Q8BA 4Z8FL 3SGDI 4XN2A 1RERA 3O41A 4IS6A 5T1LD 5EOCH 2WVVA 2D0FA 4AIXA 1VCAA 5MP6L 3VSVA 1OOAA 5E99H 4A38A 3SE3C 3ARED 2P7TB 1NDMA 1U2HA 4YDMA 1EJOL 1S7VB 4X80L 4PRIA 5LBSA 4E9QA 1MCJA 4QHLB 4YFDB 2AEQH 2AQ2A 2B3RA 1GZHC 3WTSA 5CCKL 1HN1A 2GABA 3GEFA 4PGBA 1G7PA 3DK0A 3HR6A 2LAGB 4OF8A 2IWFA 1AHKA 3POHA 1J87A 4NPJA 4XBPB 3HNVH 2CDEB 4I85A 5DMGD 4AVKA 4EZKA 2JCCF 1NMBL 3AU0A 3GI9H 4KXZI 4BWWA 3I9IA 2GTZA 3IDYC 3VWKD 1H19A 1K3ZA 2Q2EB 4B95C 3HE6A 1Q72L 4H26A 5D8JH 1DUYA 2FT7A 3UTSD 1YEKL 3WKMH 1A65A 3MODH 5C0RL 1OAJA 5TE6L 1PZUB 2H3NB 1YSOA 3GBDA 3MUJA 4F57H 2C5DC 1E7UA 3NIFE 4LCIH 4KU1A 4KTEH 5IM7B 3RYMA 2Z1PA 1WDAA 5LWYH 4V33A 2J88H 1OTUD 2NY3D 1A66A 1BD2A 2DAVA 3INUH 3OB8A 3ALPA 3BAKA 5IJBC 1M3IA 2ZUWA 1IB5A 3HN8A 4QOKB 3P2TA 4Y5VC 5AQ0A 3RTLA 1AS6A 1JMXA 1GPOH 1L9NA 4U7SA 4FFVC 3U1QA 4PREA 4HPHA 5I66A 4GKNB 5E24E 4HXBL 4D0DB 4M6AA 1LHZA 3O3EA 2X4UB 2G60H 1SMDA 2F7RA 3FT1A 1ROCA 3FN0L 2G2PA 1S78C 3MOQA 4XXDA 3I84A 2PYEE 3IDGB 1MPAH 3I3EA 3K6FA 3WDHA 1HKLH 1ED3A 2FJFA 4H1LA 2I24N 3W0WE 1IV8A 5KVGE 2LOEA 4QKXB 2ESVE 5EV7A 1K2DA 3RWFA 5I6PA 3PGDA 1RL1A 1E90A 4MJIA 2A6IB 5FUCE 3VFRB 1JHKH 2FO4B 5E1IA 4ODUB 4Q9BA 5CD5D 1A6ZB 3MX0B 5C07B 3RJOA 1HI6A 3AB0C 4G7RB 3SO3C 3MRMB 5SWSA 5LKNA 4NNPL 1SM3H 5FFGA 5IV2A 1PX4A 3PWPD 3JV5A 4R0LC 1CFBA 3QJSB 3VXSA 5JXED 4I9WD 4IMLA 1UD4A 3D0LB 5C0GB 2ZSVB 1KENH 2RA1A 4QRRE 2BP0A 5JPNB 2YZ8A 3I50H 3ZSTA 3FO9B 4WJG3 3C12A 4F7CB 4RIRB 1IBYA 2G2RA 3D2UA 4ZAKC 4PI0A 3VXRA 5TFSL 4C4BA 3V4UL 2XQBL 3T09A 4Q14A 5C2BH 4FHBD 4U1HA 1E9PB 4PJXA 5D1XE 2J1YA 2ICWA 3HFMH 3HZYB 2HFFA 4C8XA 4ZUUB 5BRPA 3A6BH 1UYWL 3D4YA 2X41A 4K94L 1KTJA 1UJTA 1QACA 1RSYA 3K2UH 5AUMB 3G7TA 3CX2A 1ZJBA 3QJXA 3UO1L 3MRBB 4B60A 1CYGA 5INDA 4QO1A 3SZ6A 2F19L 4JY4A 4KDWA 5IFHH 2YRLA 4FQJH 2YPLA 5DJ8B 3ZMEA 2VDRH 5I1IH 3AQDA 1UB5A 5B3SB 1CL7L 2GITA 4U0QB 4YFEA 3MLYH 3HUJB 2FBJH 4PV1C 2VRAA 5FOBA 3DMMB 1MI5A 2GSGB 5EZJB 2AI0H 1CLYL 5IESH 3O45B 2ADGB 3LRSB 5EUOF 1A7PL 4OLYH 5CGYD 5IB2B 5JHLL 1QQDB 2EKSB 3QQ4B 2YKKA 4FTDA 2B0SL 3SBQA 4YQXL 4KQ3L 1YPZE 5SX4I 4K4KA 3BHBA 4Z7WE 3AG1B 3TWCH 2BSDA 2DQIH 4QRBA 3N3EA 5IVNA 3MMEA 4HUUB 3TZVB 4R7VA 4N9GB 2EDEA 4XPTL 4G6ML 1YN6B 3C60D 5HGDA 1HHHB 2VXQL 4JO1H 3U6RB 2WTOA 2MPAL 2K9UA 2FWOB 2VQUA 5D7SH 5LDUA 1HIML 4PJCA 5HI3C 4LRNL 3OAUL 4K3EH 1X5FA 1IO4C 1TZ8A 5EBLB 4LRIA 1AY1H 5DA4A 1BVNT 1W91A 5TDPA 2A9ML 5A3IC 1LO0L 2ZOOA 3TA3B 4ZMAT 2WWKT 1NUGA 1T66C 5E6IA 3WY2A 1MUJA 1WEJH 3DX1A 3QZMA 1W8NA 3S3DB 2UV3A 1BPVA 2Z93B 4OIIL 1A2YB 3ZTNL 2DEWX 1A8ZA 3PHOB 1YMHA 1W80A 3GLEA 4DKFH 2Y9RT 2FQEA 4ZMVA 3ZU8A 4I87A 1UCBH 2NNCA 3ABMB 3B2VL 3BWZA 2XN9E 5DVPA 4GT7A 5CUSH 4PJ5A 1L7TH 3CJJA 3QW9A 4ODXA 3BRFA 5T1LB 1IKNC 3VX0A 3WHXB 5FCUL 1DVFA 1UD2A 3LQZB 4F8NA 3ISRA 2I60H 1QO3B 1R3LB 2P5EE 3Q0HA 3ZKSD 4MNGB 3ZYOA 2EH8H 2DLHA 4L3EA 3H3BC 2YD4A 3CHOA 3GIVA 5KYYB 1CGSH 3RKDC 3S3PA 3S5YA 4JHBA 1CU4H 3QORC 1T7YA 4OI9A 4BD4A 1BMGA 1DQQA 1BFTA 4K5NA 2Q3AA 5D70H 4UTBL 1V3LA 4YGVA 2D3VA 3ATFA 3K6SA 1RUKH 2NXYD 3L1GA 1AGBB 4JO2H 1P84J 4JM4H 3GDCA 4WV1B 4WSJA 2PNDA 1BMWA 3VWKB 3LEXA 3QDJE 3AWFA 3WFBH 3UTSB 2XWJB 4PJDF 2Y24A 4FXKB 2XOTA 4GW5A 5B38G 4X8XA 1FP5A 1DANU 1OSYA 4ZPVB 4QHUA 4UTAH 5JNYA 4WAFA 2IDQA 4N86A 3WFCL 5F6HJ 4GXVL 1XF5B 1KOAA 4P5KA 2NY3B 5ECJE 1A4JB 1H6UA 1N19A 2EXWD 3GB7B 4HKJB 5ESAA 5IY5B 3VW3H 3VXQA 3CH1B 3QNFA 3GMLB 4MJ2A 3MTRA 3PHQA 5D6DC 1ETZB 3IU3B 1P4LA 5GZOC 4U4IA 3L5WB 4RGOH 5F7MC 1Y1UA 5I74C 4Z3JA 1WFMA 3MRRA 3BMWA 3BDYL 4HV8A 3QPXL 3UYPB 3DUSA 1KXVA 3M8OL 3NGBC 4MDJA 4HIQA 3UBFA 4JQVC 4KZEH 4XMWA 4P3DA 4YHIB 5LQBH 1WZKA 1QD0A 1N5AB 2F7IA 4UILH 4MDIB 1R5WA 1UHVA 4FNLL 4J3OF 4QRQA 1ECZA 3QJUB 4BSWB 2G3ZA 2CRMA 3GRWH 4PY7A 1BXVA 1CUOA 4JFEE 1XDTT 3CPLA 3O9WA 5D96B 4R26L 3ELAT 4OLXH 4HULB 2WXHA 1XXFC 5ENWB 3LHPL 1QHQA 2F8XC 4UIMB 5C0IA 2EVJA 3HHMA 2VN4A 3KHOA 1PQZA 3DDFA 3APMA 3MV7E 3FB6A 2VUOA 5A43C 4NQCE 2CUIA 3D07A 3CLWA 4OY9A 4TUKL 3H9SE 3U4BL 1HHKA 4GKLA 5K93A 1KJ2L 5DT1L 2JKTM 4CW1A 3IXTA 1SHSA 3O3BB 3CE1A 1EJFA 1P1VA 4X50A 3EO9H 5F88A 4B5ZA 4EMZA 1T6WA 3E6FA 4ELME 1G4MA 4FXKC 2FJHA 2OV0A 3MUHL 3BQUC 4HWZA 4MB1A 1HNYA 3S5LA 1C16B 4HZ1A 1SDDA 3N44B 4OAWA 1FIGH 2ENYA 2N7SA 1KJMB 3KCWA 1QEWB 3L9RB 4LBEB 1ADQH 2XI9A 4OGYL 1WA0X 4YK4C 3OLDA 2IEPA 4ZO9A 2PXYA 3OJ2C 4NKIL 4PGDB 3WD5H 2VLJE 3RWCA 5IROC 2W07A 1EPFA 2XQ0A 2WCGA 2OMUB 4HH9B 4NQSA 3TBWB 4KFMA 1U8IA 1MWAA 3P4OB 3RZCC 5I24A 5C0NC 1N3NB 1RZIA 1W15A 3O8XB 3W0WA 1IFHH 2RGSA 1G6VK 3LZRA 4PP2A 2ESVA 1AGFA 3FHQA 3SE6A 3NTCL 4X4YA 4LFHG 5EEZA 1NGZB 4KJYA 2IAMD 4AQ8C 2P5WE 3U4KA 3PPEA 1JWUA 4QGTA 1DZBA 5C0DA 4UTCA 3U2JA 1ZHNB 1D6EA 2EIZA 3E2HB 1R46A 5D96C 1W6LA 1FL5B 3S37H 5MEQB 2VLRD 2VDKH 1JXFA 2IPTH 5EC2A 1AHWB 3FT0A 4KY2A 4KV5E 1U4FA 3T04D 3L4ZA 1D9KD 1BV8A 5CN2A 2WBXA 4QRRA 1C8QA 5CZKA 3GK8H 4G1EB 4AGMA 5FM4A 4Y5YA 3ZDXB 1CDCA 3TT1H 3UJTL 2D2OA 1HOEA 2C7UA 3HR5B 5DHYA 2E0PA 3HI6L 1P7BA 2HUHA 1FO0A 4M6OH 5JYLA 4PJBB 2Z4QA 2PPAA 2C3VA 2CGRH 4FQCL 1G87A 3FO1B 3PS6A 5I8EA 4J6RL 5C09E 3ZE0B 3VGAC 1R33A 4PB0L 2DKSA 3OKDA 1RP9A 1IU1A 4JPVH 4XZ4A 4EN3C 1KCBA 1U42A 4MAUH 3T2NL 1N12A 2X4RA 1OTSC 1RLBA 1XGPA 4WTQA 4FYSA 4RH4A 4WHTA 2EP6A 3PAVA 4JDEA 4HUCA 4RMWA 2I32A 2FHCA 4ZOAA 2ARJB 1PZ5A 1RK1B 1EUUA 4P5TC 4Z7OB 1GS7A 2EQDA 4HJJL 3O8XC 4XE0A 1QR1B 3OPZL 4U7MA 5J56B 3CSFA 1XGTA 2NTSP 1E9QA 3ILQC 5K9QI 5CZRA 5DJYA 4QMEA 1VSCA 2IBBA 3CLEH 5HDQL 3JYBA 4J2QA 1IGIH 4N0UB 2F53A 5IFJB 1Q8MA 2IWEA 4LSTL 1YPZA 4YHPA 3EGSB 4NZJA 1IQDA 3OX8B 4KJQD 4Z7WA 4ALAL 1DJIA 1DLHA 4P3CH 4DK3A 2X4NA 3I9AA 1BIIB 3RY4A 1RK0A 3VG0H 4BBWA 4JFQB 3LMJL 2VKXA 4WRLA 1MAJA 4GAFB 4X98B 4M7JL 1LO5B 4PR5A 4M48L 2VM4A 2I07A 4G59C 4HT1H 1FJ1B 4YE4H 5DD3L 1UADC 5EU3B 4N0YH 1X9RA 1HESA 1DQDL 1M53A 3HG0A 2WNGA 3C6LC 4NM8H 1YY8B 1CZ8H 2FATH 4L1HA 4AL8L 1A14H 2BMKB 4YHKL 3VTTA 2V3DA 1OCCB 3U30B 2B9AA 3ILPB 4G70B 4CC0A 3GSUA 4WO4D 4E0RA 1ACYH 2GTQA 1ZGLM 1WLHA 3W37A 3VVVA 4Q9RH 2GSIA 2BNRD 1K5NA 1PZSA 1OP5K 5AFAA 4M62H 5I73C 4IBVA 2Z8WC 1YMMB 4R4ND 2WW8A 3P3UA 1WVZA 2VN5A 5GSVA 3CVHL 4IK7A 3AM8A 2XN9A 4MX7B 4PFEA 3VXOB 3B2XA 1NAKH 4Z3EA 1TFPA 2WWOA 1M6OA 3O4LE 4XNUL 2G5UA 1GAFH 3VD7A 3BZEA 4X99B 4DZBA 3IAQA 1WFIA 2EIEA 2P5EA 1FGVL 5E03A 3ZT7A 1AR2A 4R96B 1OGTB 4KX8A 1G7QA 2H2SD 1R3IH 3G04B 4LCWA 3CFCL 1T0NA 2L04A 3EW3B 1IBDA 2QHRL 2K8MA 2TAAA 2BIHA 5F7BA 3U7YH 5MEOA 3FRPA 5F6IB 1HQRA 4ODWB 4R5XA 2BHZA 5CJQL 4Y16D 5JHDD 2JMRA 1OCRB 1JNHB 1V7NL 5T3XE 5GRUL 4MMXB 5CBAB 3DUUA 3L95B 3FUMA 2N1TE 4ZW8A 3BN9D 2EYRB 2SEBB 3QDJA 3VYPA 1CF8L 2DI8A 4JRLA 5KVDH 3TVMA 3TT3L 4N0CC 3AQYA 5EUKA 1YNLH 2Z92B 3SKOA 2WGNB 1L9SA 1H9VA 3Q1EA 3VG9C 2UVEA 4U1KA 4LEOB 2C1PA 5I1GH 3ARDA 3V52H 4U4BA 1MHCA 3SBPA 2KBGA 3RILA 3QUKB 2C4FT 3TFKC 4NPYA 2VJ0A 4RMRA 4OD1H 1QA9B 4S1SL 3GSXA 2OMYB 1W0VA 2EIMB 3AROA 5G4OA 1YN7A 1HZLA 1C8PA 4K23L 1G7IB 4A66A 5JOFB 1H6FA 4QXGH 2L8AA 4HLJA 4BM7A 4DERA 1XL6A 4KDVA 1BQHB 2PW1A 4AGPA 3CFKA 1E6OH 3H9YA 1MSPA 5KJRL 4XHJD 4KTGA 3SE8L 1A6VH 5DJZA 3I9GH 1S7SA 3C2AL