3KMTA

Crystal structure of vset/sah/h3 ternary complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords A612L protein
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmtA01
3F9ZA 3VV0A 5EX0A 4IJDA 1MVXA 1N6AA 4MI0A 5KJLA 4LDGA 3S7JA 4J7FA 5CCLA 3S7DA 3QWWA 4J8OA 3KMTA 4AU7A 3OXLA 3VUZA 4O6FA 5JHNA 4MI5A 3BO5A 5KJNA 4IJ8A 4QEOA 3OXGA 3TG5A 3OXFA 4YNPA 4BUPA 4J83A 3EP0A 3DALA 5EX3A 3KMJA 3DB5A 4YPAA 5JIYA 2RFIA 2W5ZA 3KMAA 2F69A 3FPDA 3CBPA 1N3JA 3SWCA 3MO0A 3F9YA 1H3IA 5JINA 5ARFA 4NJ5A 4RZ0A 3M58A 5CPRB 5TEGA 3F9XA 4YNDA 1MVHA 5KJKA 5F6KC 4E47A 1XQHA 3RIBA 4QENA 3RJWA 2QPWA 5AYFA 5T5GA 4WUYA 4I51A 5TTFA 5CCMA 3TG4A 5T0MA 1MT6A 5LSZA 3HNAA 4H12A 4J7IA 5HQ8A 4QEPA 3S7FA 4FMUA 4NVQA 5ARGA 5HI7A 1ML9A 3M57A 3F9WA 3RAYA 3MO5A 3M54A 5F6LA 4JDSA 2R3AA 3OPEA 1MUFA 3MEKA 2O8JA 3IHXA 3PDNA 1N6CA 3RU0A 1PEGA 3N71A 1O9SA 2BQZA 3CBMA 3K5KA 3MO2A 5JJ0A 5LSXA 2IGQA 3SW9A 5KJMA 3M5AA 3S8PA 5T0KA 5EG2A 4Z4PA 1ZKKA 4YPEA 3CBOA 3RQ4A 3S7BA 3OOIA 3QWPA 3M56A 3OS5A 5F59A 5F5EA 3M55A 2G46A 3M53A 5TH7A 4YPUA 3QWVA 2W5YA 4O30A 2JV0A 4JLGA 4YNMA 3M59A 4C1QA
chains in the Genus database with same CATH superfamily
3F9ZA 3VV0A 5EX0A 4IJDA 1MVXA 1N6AA 4MI0A 5KJLA 4LDGA 3S7JA 4J7FA 5CCLA 3S7DA 3QWWA 4J8OA 3KMTA 4AU7A 3OXLA 3VUZA 4O6FA 5JHNA 4MI5A 3BO5A 5KJNA 4IJ8A 4QEOA 3OXGA 3TG5A 3OXFA 4YNPA 4BUPA 4J83A 3EP0A 3DALA 5EX3A 3KMJA 3DB5A 4YPAA 5JIYA 2RFIA 2W5ZA 3KMAA 2F69A 3FPDA 3CBPA 1N3JA 3SWCA 3MO0A 3F9YA 1H3IA 5JINA 5ARFA 4NJ5A 4RZ0A 3M58A 5CPRB 5TEGA 3F9XA 4YNDA 1MVHA 5KJKA 5F6KC 4E47A 1XQHA 3RIBA 4QENA 3RJWA 2QPWA 5AYFA 5T5GA 4WUYA 4I51A 5TTFA 5CCMA 3TG4A 5T0MA 1MT6A 5LSZA 3HNAA 4H12A 4J7IA 5HQ8A 4QEPA 3S7FA 4FMUA 4NVQA 5ARGA 5HI7A 1ML9A 3M57A 3F9WA 3RAYA 3MO5A 3M54A 5F6LA 4JDSA 2R3AA 3OPEA 1MUFA 3MEKA 2O8JA 3IHXA 3PDNA 1N6CA 3RU0A 1PEGA 3N71A 1O9SA 2BQZA 3CBMA 3K5KA 3MO2A 5JJ0A 5LSXA 2IGQA 3SW9A 5KJMA 3M5AA 3S8PA 5T0KA 5EG2A 4Z4PA 1ZKKA 4YPEA 3CBOA 3RQ4A 3S7BA 3OOIA 3QWPA 3M56A 3OS5A 5F59A 5F5EA 3M55A 2G46A 3M53A 5TH7A 4YPUA 3QWVA 2W5YA 4O30A 2JV0A 4JLGA 4YNMA 3M59A 4C1QA
chains in the Genus database with same CATH topology
3F9ZA 3VV0A 5EX0A 4IJDA 1MVXA 1N6AA 4MI0A 5KJLA 4LDGA 3S7JA 4J7FA 5CCLA 3S7DA 3QWWA 4J8OA 3KMTA 4AU7A 3OXLA 3VUZA 4O6FA 5JHNA 4MI5A 3BO5A 5KJNA 4IJ8A 4QEOA 3OXGA 3TG5A 3OXFA 4YNPA 4BUPA 4J83A 3EP0A 3DALA 5EX3A 3KMJA 3DB5A 4YPAA 5JIYA 2RFIA 2W5ZA 3KMAA 2F69A 3FPDA 3CBPA 1N3JA 3SWCA 3MO0A 3F9YA 1H3IA 5JINA 5ARFA 4NJ5A 4RZ0A 3M58A 5CPRB 5TEGA 3F9XA 4YNDA 1MVHA 5KJKA 5F6KC 4E47A 1XQHA 3RIBA 4QENA 3RJWA 2QPWA 5AYFA 5T5GA 4WUYA 4I51A 5TTFA 5CCMA 3TG4A 5T0MA 1MT6A 5LSZA 3HNAA 4H12A 4J7IA 5HQ8A 4QEPA 3S7FA 4FMUA 4NVQA 5ARGA 5HI7A 1ML9A 3M57A 3F9WA 3RAYA 3MO5A 3M54A 5F6LA 4JDSA 2R3AA 3OPEA 1MUFA 3MEKA 2O8JA 3IHXA 3PDNA 1N6CA 3RU0A 1PEGA 3N71A 1O9SA 2BQZA 3CBMA 3K5KA 3MO2A 5JJ0A 5LSXA 2IGQA 3SW9A 5KJMA 3M5AA 3S8PA 5T0KA 5EG2A 4Z4PA 1ZKKA 4YPEA 3CBOA 3RQ4A 3S7BA 3OOIA 3QWPA 3M56A 3OS5A 5F59A 5F5EA 3M55A 2G46A 3M53A 5TH7A 4YPUA 3QWVA 2W5YA 4O30A 2JV0A 4JLGA 4YNMA 3M59A 4C1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9Z A;  3VV0 A;  5EX0 A;  4IJD A;  1MVX A;  1N6A A;  4MI0 A;  5KJL A;  4LDG A;  3S7J A;  4J7F A;  5CCL A;  3S7D A;  3QWW A;  4J8O A;  3KMT A;  4AU7 A;  3OXL A;  3VUZ A;  4O6F A;  5JHN A;  4MI5 A;  3BO5 A;  5KJN A;  4IJ8 A;  4QEO A;  3OXG A;  3TG5 A;  3OXF A;  4YNP A;  4BUP A;  4J83 A;  3EP0 A;  3DAL A;  5EX3 A;  3KMJ A;  3DB5 A;  4YPA A;  5JIY A;  2RFI A;  2W5Z A;  3KMA A;  2F69 A;  3FPD A;  3CBP A;  1N3J A;  3SWC A;  3MO0 A;  3F9Y A;  1H3I A;  5JIN A;  5ARF A;  4NJ5 A;  4RZ0 A;  3M58 A;  5CPR B;  5TEG A;  3F9X A;  4YND A;  1MVH A;  5KJK A;  5F6K C;  4E47 A;  1XQH A;  3RIB A;  4QEN A;  3RJW A;  2QPW A;  5AYF A;  5T5G A;  4WUY A;  4I51 A;  5TTF A;  5CCM A;  3TG4 A;  5T0M A;  1MT6 A;  5LSZ A;  3HNA A;  4H12 A;  4J7I A;  5HQ8 A;  4QEP A;  3S7F A;  4FMU A;  4NVQ A;  5ARG A;  5HI7 A;  1ML9 A;  3M57 A;  3F9W A;  3RAY A;  3MO5 A;  3M54 A;  5F6L A;  4JDS A;  2R3A A;  3OPE A;  1MUF A;  3MEK A;  2O8J A;  3IHX A;  3PDN A;  1N6C A;  3RU0 A;  1PEG A;  3N71 A;  1O9S A;  2BQZ A;  3CBM A;  3K5K A;  3MO2 A;  5JJ0 A;  5LSX A;  2IGQ A;  3SW9 A;  5KJM A;  3M5A A;  3S8P A;  5T0K A;  5EG2 A;  4Z4P A;  1ZKK A;  4YPE A;  3CBO A;  3RQ4 A;  3S7B A;  3OOI A;  3QWP A;  3M56 A;  3OS5 A;  5F59 A;  5F5E A;  3M55 A;  2G46 A;  3M53 A;  5TH7 A;  4YPU A;  3QWV A;  2W5Y A;  4O30 A;  2JV0 A;  4JLG A;  4YNM A;  3M59 A;  4C1Q A; 
#chains in the Genus database with same CATH topology
 3F9Z A;  3VV0 A;  5EX0 A;  4IJD A;  1MVX A;  1N6A A;  4MI0 A;  5KJL A;  4LDG A;  3S7J A;  4J7F A;  5CCL A;  3S7D A;  3QWW A;  4J8O A;  3KMT A;  4AU7 A;  3OXL A;  3VUZ A;  4O6F A;  5JHN A;  4MI5 A;  3BO5 A;  5KJN A;  4IJ8 A;  4QEO A;  3OXG A;  3TG5 A;  3OXF A;  4YNP A;  4BUP A;  4J83 A;  3EP0 A;  3DAL A;  5EX3 A;  3KMJ A;  3DB5 A;  4YPA A;  5JIY A;  2RFI A;  2W5Z A;  3KMA A;  2F69 A;  3FPD A;  3CBP A;  1N3J A;  3SWC A;  3MO0 A;  3F9Y A;  1H3I A;  5JIN A;  5ARF A;  4NJ5 A;  4RZ0 A;  3M58 A;  5CPR B;  5TEG A;  3F9X A;  4YND A;  1MVH A;  5KJK A;  5F6K C;  4E47 A;  1XQH A;  3RIB A;  4QEN A;  3RJW A;  2QPW A;  5AYF A;  5T5G A;  4WUY A;  4I51 A;  5TTF A;  5CCM A;  3TG4 A;  5T0M A;  1MT6 A;  5LSZ A;  3HNA A;  4H12 A;  4J7I A;  5HQ8 A;  4QEP A;  3S7F A;  4FMU A;  4NVQ A;  5ARG A;  5HI7 A;  1ML9 A;  3M57 A;  3F9W A;  3RAY A;  3MO5 A;  3M54 A;  5F6L A;  4JDS A;  2R3A A;  3OPE A;  1MUF A;  3MEK A;  2O8J A;  3IHX A;  3PDN A;  1N6C A;  3RU0 A;  1PEG A;  3N71 A;  1O9S A;  2BQZ A;  3CBM A;  3K5K A;  3MO2 A;  5JJ0 A;  5LSX A;  2IGQ A;  3SW9 A;  5KJM A;  3M5A A;  3S8P A;  5T0K A;  5EG2 A;  4Z4P A;  1ZKK A;  4YPE A;  3CBO A;  3RQ4 A;  3S7B A;  3OOI A;  3QWP A;  3M56 A;  3OS5 A;  5F59 A;  5F5E A;  3M55 A;  2G46 A;  3M53 A;  5TH7 A;  4YPU A;  3QWV A;  2W5Y A;  4O30 A;  2JV0 A;  4JLG A;  4YNM A;  3M59 A;  4C1Q A; 
#chains in the Genus database with same CATH homology
 3F9Z A;  3VV0 A;  5EX0 A;  4IJD A;  1MVX A;  1N6A A;  4MI0 A;  5KJL A;  4LDG A;  3S7J A;  4J7F A;  5CCL A;  3S7D A;  3QWW A;  4J8O A;  3KMT A;  4AU7 A;  3OXL A;  3VUZ A;  4O6F A;  5JHN A;  4MI5 A;  3BO5 A;  5KJN A;  4IJ8 A;  4QEO A;  3OXG A;  3TG5 A;  3OXF A;  4YNP A;  4BUP A;  4J83 A;  3EP0 A;  3DAL A;  5EX3 A;  3KMJ A;  3DB5 A;  4YPA A;  5JIY A;  2RFI A;  2W5Z A;  3KMA A;  2F69 A;  3FPD A;  3CBP A;  1N3J A;  3SWC A;  3MO0 A;  3F9Y A;  1H3I A;  5JIN A;  5ARF A;  4NJ5 A;  4RZ0 A;  3M58 A;  5CPR B;  5TEG A;  3F9X A;  4YND A;  1MVH A;  5KJK A;  5F6K C;  4E47 A;  1XQH A;  3RIB A;  4QEN A;  3RJW A;  2QPW A;  5AYF A;  5T5G A;  4WUY A;  4I51 A;  5TTF A;  5CCM A;  3TG4 A;  5T0M A;  1MT6 A;  5LSZ A;  3HNA A;  4H12 A;  4J7I A;  5HQ8 A;  4QEP A;  3S7F A;  4FMU A;  4NVQ A;  5ARG A;  5HI7 A;  1ML9 A;  3M57 A;  3F9W A;  3RAY A;  3MO5 A;  3M54 A;  5F6L A;  4JDS A;  2R3A A;  3OPE A;  1MUF A;  3MEK A;  2O8J A;  3IHX A;  3PDN A;  1N6C A;  3RU0 A;  1PEG A;  3N71 A;  1O9S A;  2BQZ A;  3CBM A;  3K5K A;  3MO2 A;  5JJ0 A;  5LSX A;  2IGQ A;  3SW9 A;  5KJM A;  3M5A A;  3S8P A;  5T0K A;  5EG2 A;  4Z4P A;  1ZKK A;  4YPE A;  3CBO A;  3RQ4 A;  3S7B A;  3OOI A;  3QWP A;  3M56 A;  3OS5 A;  5F59 A;  5F5E A;  3M55 A;  2G46 A;  3M53 A;  5TH7 A;  4YPU A;  3QWV A;  2W5Y A;  4O30 A;  2JV0 A;  4JLG A;  4YNM A;  3M59 A;  4C1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...