3KMTA

Crystal structure of vset/sah/h3 ternary complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords A612L protein
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmtA01
4J7IA 3OOIA 5JIYA 3K5KA 5KJKA 4QEPA 4YPUA 5F5EA 3PDNA 3M54A 1PEGA 3TG5A 1MUFA 4IJDA 3S7BA 2IGQA 2R3AA 4YPEA 2F69A 4H12A 3RQ4A 5EG2A 3IHXA 3EP0A 3QWWA 4FMUA 4MI0A 1N6CA 3N71A 3M55A 4YNPA 4QEOA 5TEGA 3F9WA 3M5AA 2W5YA 4RZ0A 5EX3A 3KMJA 5CCLA 4IJ8A 1MT6A 1MVXA 4Z4PA 5T0MA 3KMAA 4J7FA 4YNMA 3M58A 3FPDA 3RIBA 5LSXA 3MEKA 5KJLA 3RU0A 3S7JA 5CCMA 1ML9A 4J8OA 3M59A 5ARGA 3QWVA 3M57A 1N3JA 1MVHA 3M53A 3SW9A 3MO0A 4O6FA 5CPRB 3MO5A 4E47A 3S7DA 3HNAA 2BQZA 3RJWA 3CBOA 4AU7A 1ZKKA 4MI5A 5HQ8A 3CBMA 5T5GA 4WUYA 1N6AA 2W5ZA 3OXFA 5LSZA 3SWCA 3F9YA 5HI7A 4NJ5A 5F59A 5T0KA 4YNDA 5TH7A 3F9XA 2O8JA 5ARFA 5JINA 5JJ0A 5KJMA 3RAYA 5F6LA 4JDSA 3QWPA 3DB5A 5F6KC 5AYFA 3F9ZA 5EX0A 3S8PA 2JV0A 3DALA 3M56A 4YPAA 4LDGA 4J83A 4C1QA 3OS5A 3OXLA 3S7FA 3BO5A 3MO2A 4I51A 5TTFA 2G46A 2RFIA 2QPWA 4QENA 3KMTA 1O9SA 3TG4A 3VUZA 1XQHA 4NVQA 3OXGA 3CBPA 4JLGA 3VV0A 4BUPA 5KJNA 3OPEA 5JHNA 4O30A 1H3IA
chains in the Genus database with same CATH superfamily
4J7IA 3OOIA 5JIYA 3K5KA 5KJKA 4QEPA 4YPUA 5F5EA 3PDNA 3M54A 1PEGA 3TG5A 1MUFA 4IJDA 3S7BA 2IGQA 2R3AA 4YPEA 2F69A 4H12A 3RQ4A 5EG2A 3IHXA 3EP0A 3QWWA 4FMUA 4MI0A 1N6CA 3N71A 3M55A 4YNPA 4QEOA 5TEGA 3F9WA 3M5AA 2W5YA 4RZ0A 5EX3A 3KMJA 5CCLA 4IJ8A 1MT6A 1MVXA 4Z4PA 5T0MA 3KMAA 4J7FA 4YNMA 3M58A 3FPDA 3RIBA 5LSXA 3MEKA 5KJLA 3RU0A 3S7JA 5CCMA 1ML9A 4J8OA 3M59A 5ARGA 3QWVA 3M57A 1N3JA 1MVHA 3M53A 3SW9A 3MO0A 4O6FA 5CPRB 3MO5A 4E47A 3S7DA 3HNAA 2BQZA 3RJWA 3CBOA 4AU7A 1ZKKA 4MI5A 5HQ8A 3CBMA 5T5GA 4WUYA 1N6AA 2W5ZA 3OXFA 5LSZA 3SWCA 3F9YA 5HI7A 4NJ5A 5F59A 5T0KA 4YNDA 5TH7A 3F9XA 2O8JA 5ARFA 5JINA 5JJ0A 5KJMA 3RAYA 5F6LA 4JDSA 3QWPA 3DB5A 5F6KC 5AYFA 3F9ZA 5EX0A 3S8PA 2JV0A 3DALA 3M56A 4YPAA 4LDGA 4J83A 4C1QA 3OS5A 3OXLA 3S7FA 3BO5A 3MO2A 4I51A 5TTFA 2G46A 2RFIA 2QPWA 4QENA 3KMTA 1O9SA 3TG4A 3VUZA 1XQHA 4NVQA 3OXGA 3CBPA 4JLGA 3VV0A 4BUPA 5KJNA 3OPEA 5JHNA 4O30A 1H3IA
chains in the Genus database with same CATH topology
4J7IA 3OOIA 5JIYA 3K5KA 5KJKA 4QEPA 4YPUA 5F5EA 3PDNA 3M54A 1PEGA 3TG5A 1MUFA 4IJDA 3S7BA 2IGQA 2R3AA 4YPEA 2F69A 4H12A 3RQ4A 5EG2A 3IHXA 3EP0A 3QWWA 4FMUA 4MI0A 1N6CA 3N71A 3M55A 4YNPA 4QEOA 5TEGA 3F9WA 3M5AA 2W5YA 4RZ0A 5EX3A 3KMJA 5CCLA 4IJ8A 1MT6A 1MVXA 4Z4PA 5T0MA 3KMAA 4J7FA 4YNMA 3M58A 3FPDA 3RIBA 5LSXA 3MEKA 5KJLA 3RU0A 3S7JA 5CCMA 1ML9A 4J8OA 3M59A 5ARGA 3QWVA 3M57A 1N3JA 1MVHA 3M53A 3SW9A 3MO0A 4O6FA 5CPRB 3MO5A 4E47A 3S7DA 3HNAA 2BQZA 3RJWA 3CBOA 4AU7A 1ZKKA 4MI5A 5HQ8A 3CBMA 5T5GA 4WUYA 1N6AA 2W5ZA 3OXFA 5LSZA 3SWCA 3F9YA 5HI7A 4NJ5A 5F59A 5T0KA 4YNDA 5TH7A 3F9XA 2O8JA 5ARFA 5JINA 5JJ0A 5KJMA 3RAYA 5F6LA 4JDSA 3QWPA 3DB5A 5F6KC 5AYFA 3F9ZA 5EX0A 3S8PA 2JV0A 3DALA 3M56A 4YPAA 4LDGA 4J83A 4C1QA 3OS5A 3OXLA 3S7FA 3BO5A 3MO2A 4I51A 5TTFA 2G46A 2RFIA 2QPWA 4QENA 3KMTA 1O9SA 3TG4A 3VUZA 1XQHA 4NVQA 3OXGA 3CBPA 4JLGA 3VV0A 4BUPA 5KJNA 3OPEA 5JHNA 4O30A 1H3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7I A;  3OOI A;  5JIY A;  3K5K A;  5KJK A;  4QEP A;  4YPU A;  5F5E A;  3PDN A;  3M54 A;  1PEG A;  3TG5 A;  1MUF A;  4IJD A;  3S7B A;  2IGQ A;  2R3A A;  4YPE A;  2F69 A;  4H12 A;  3RQ4 A;  5EG2 A;  3IHX A;  3EP0 A;  3QWW A;  4FMU A;  4MI0 A;  1N6C A;  3N71 A;  3M55 A;  4YNP A;  4QEO A;  5TEG A;  3F9W A;  3M5A A;  2W5Y A;  4RZ0 A;  5EX3 A;  3KMJ A;  5CCL A;  4IJ8 A;  1MT6 A;  1MVX A;  4Z4P A;  5T0M A;  3KMA A;  4J7F A;  4YNM A;  3M58 A;  3FPD A;  3RIB A;  5LSX A;  3MEK A;  5KJL A;  3RU0 A;  3S7J A;  5CCM A;  1ML9 A;  4J8O A;  3M59 A;  5ARG A;  3QWV A;  3M57 A;  1N3J A;  1MVH A;  3M53 A;  3SW9 A;  3MO0 A;  4O6F A;  5CPR B;  3MO5 A;  4E47 A;  3S7D A;  3HNA A;  2BQZ A;  3RJW A;  3CBO A;  4AU7 A;  1ZKK A;  4MI5 A;  5HQ8 A;  3CBM A;  5T5G A;  4WUY A;  1N6A A;  2W5Z A;  3OXF A;  5LSZ A;  3SWC A;  3F9Y A;  5HI7 A;  4NJ5 A;  5F59 A;  5T0K A;  4YND A;  5TH7 A;  3F9X A;  2O8J A;  5ARF A;  5JIN A;  5JJ0 A;  5KJM A;  3RAY A;  5F6L A;  4JDS A;  3QWP A;  3DB5 A;  5F6K C;  5AYF A;  3F9Z A;  5EX0 A;  3S8P A;  2JV0 A;  3DAL A;  3M56 A;  4YPA A;  4LDG A;  4J83 A;  4C1Q A;  3OS5 A;  3OXL A;  3S7F A;  3BO5 A;  3MO2 A;  4I51 A;  5TTF A;  2G46 A;  2RFI A;  2QPW A;  4QEN A;  3KMT A;  1O9S A;  3TG4 A;  3VUZ A;  1XQH A;  4NVQ A;  3OXG A;  3CBP A;  4JLG A;  3VV0 A;  4BUP A;  5KJN A;  3OPE A;  5JHN A;  4O30 A;  1H3I A; 
#chains in the Genus database with same CATH topology
 4J7I A;  3OOI A;  5JIY A;  3K5K A;  5KJK A;  4QEP A;  4YPU A;  5F5E A;  3PDN A;  3M54 A;  1PEG A;  3TG5 A;  1MUF A;  4IJD A;  3S7B A;  2IGQ A;  2R3A A;  4YPE A;  2F69 A;  4H12 A;  3RQ4 A;  5EG2 A;  3IHX A;  3EP0 A;  3QWW A;  4FMU A;  4MI0 A;  1N6C A;  3N71 A;  3M55 A;  4YNP A;  4QEO A;  5TEG A;  3F9W A;  3M5A A;  2W5Y A;  4RZ0 A;  5EX3 A;  3KMJ A;  5CCL A;  4IJ8 A;  1MT6 A;  1MVX A;  4Z4P A;  5T0M A;  3KMA A;  4J7F A;  4YNM A;  3M58 A;  3FPD A;  3RIB A;  5LSX A;  3MEK A;  5KJL A;  3RU0 A;  3S7J A;  5CCM A;  1ML9 A;  4J8O A;  3M59 A;  5ARG A;  3QWV A;  3M57 A;  1N3J A;  1MVH A;  3M53 A;  3SW9 A;  3MO0 A;  4O6F A;  5CPR B;  3MO5 A;  4E47 A;  3S7D A;  3HNA A;  2BQZ A;  3RJW A;  3CBO A;  4AU7 A;  1ZKK A;  4MI5 A;  5HQ8 A;  3CBM A;  5T5G A;  4WUY A;  1N6A A;  2W5Z A;  3OXF A;  5LSZ A;  3SWC A;  3F9Y A;  5HI7 A;  4NJ5 A;  5F59 A;  5T0K A;  4YND A;  5TH7 A;  3F9X A;  2O8J A;  5ARF A;  5JIN A;  5JJ0 A;  5KJM A;  3RAY A;  5F6L A;  4JDS A;  3QWP A;  3DB5 A;  5F6K C;  5AYF A;  3F9Z A;  5EX0 A;  3S8P A;  2JV0 A;  3DAL A;  3M56 A;  4YPA A;  4LDG A;  4J83 A;  4C1Q A;  3OS5 A;  3OXL A;  3S7F A;  3BO5 A;  3MO2 A;  4I51 A;  5TTF A;  2G46 A;  2RFI A;  2QPW A;  4QEN A;  3KMT A;  1O9S A;  3TG4 A;  3VUZ A;  1XQH A;  4NVQ A;  3OXG A;  3CBP A;  4JLG A;  3VV0 A;  4BUP A;  5KJN A;  3OPE A;  5JHN A;  4O30 A;  1H3I A; 
#chains in the Genus database with same CATH homology
 4J7I A;  3OOI A;  5JIY A;  3K5K A;  5KJK A;  4QEP A;  4YPU A;  5F5E A;  3PDN A;  3M54 A;  1PEG A;  3TG5 A;  1MUF A;  4IJD A;  3S7B A;  2IGQ A;  2R3A A;  4YPE A;  2F69 A;  4H12 A;  3RQ4 A;  5EG2 A;  3IHX A;  3EP0 A;  3QWW A;  4FMU A;  4MI0 A;  1N6C A;  3N71 A;  3M55 A;  4YNP A;  4QEO A;  5TEG A;  3F9W A;  3M5A A;  2W5Y A;  4RZ0 A;  5EX3 A;  3KMJ A;  5CCL A;  4IJ8 A;  1MT6 A;  1MVX A;  4Z4P A;  5T0M A;  3KMA A;  4J7F A;  4YNM A;  3M58 A;  3FPD A;  3RIB A;  5LSX A;  3MEK A;  5KJL A;  3RU0 A;  3S7J A;  5CCM A;  1ML9 A;  4J8O A;  3M59 A;  5ARG A;  3QWV A;  3M57 A;  1N3J A;  1MVH A;  3M53 A;  3SW9 A;  3MO0 A;  4O6F A;  5CPR B;  3MO5 A;  4E47 A;  3S7D A;  3HNA A;  2BQZ A;  3RJW A;  3CBO A;  4AU7 A;  1ZKK A;  4MI5 A;  5HQ8 A;  3CBM A;  5T5G A;  4WUY A;  1N6A A;  2W5Z A;  3OXF A;  5LSZ A;  3SWC A;  3F9Y A;  5HI7 A;  4NJ5 A;  5F59 A;  5T0K A;  4YND A;  5TH7 A;  3F9X A;  2O8J A;  5ARF A;  5JIN A;  5JJ0 A;  5KJM A;  3RAY A;  5F6L A;  4JDS A;  3QWP A;  3DB5 A;  5F6K C;  5AYF A;  3F9Z A;  5EX0 A;  3S8P A;  2JV0 A;  3DAL A;  3M56 A;  4YPA A;  4LDG A;  4J83 A;  4C1Q A;  3OS5 A;  3OXL A;  3S7F A;  3BO5 A;  3MO2 A;  4I51 A;  5TTF A;  2G46 A;  2RFI A;  2QPW A;  4QEN A;  3KMT A;  1O9S A;  3TG4 A;  3VUZ A;  1XQH A;  4NVQ A;  3OXG A;  3CBP A;  4JLG A;  3VV0 A;  4BUP A;  5KJN A;  3OPE A;  5JHN A;  4O30 A;  1H3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...