3KMTA

Crystal structure of vset/sah/h3 ternary complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A612L protein
molecule tags Viral protein
publication title Dimerization of a viral SET protein endows its function.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3kmtA01
4H12A 5EG2A 5HQ8A 5KJMA 4J83A 4RZ0A 5EX0A 5CCMA 3DALA 4NJ5A 1ZKKA 4QEOA 4IJDA 2F69A 1N6CA 5LSXA 3N71A 3S8PA 3HNAA 3F9YA 3F9ZA 4O30A 3CBOA 3M57A 2RFIA 4BUPA 2QPWA 1N3JA 4MI0A 4O6FA 1MVXA 4YNMA 3M58A 4YPAA 4NVQA 1MUFA 5KJNA 3M53A 5EX3A 4YPEA 4Z4PA 4J8OA 4I51A 1MVHA 5TH7A 5JHNA 3S7BA 4IJ8A 3QWWA 3M5AA 3QWVA 3S7FA 2IGQA 5LSZA 3KMAA 1ML9A 3M55A 3VUZA 1H3IA 3RAYA 5KJLA 5F5EA 3SW9A 4JDSA 1XQHA 3BO5A 3CBMA 4J7IA 5T0MA 3MO5A 5T0KA 2W5YA 2BQZA 3OXGA 4YPUA 3SWCA 5CCLA 3M56A 3PDNA 3MO0A 1N6AA 1O9SA 5ARGA 4JLGA 2R3AA 4YNDA 5KJKA 4LDGA 2JV0A 4FMUA 3RJWA 3S7JA 4YNPA 5JJ0A 5JIYA 3DB5A 3CBPA 4MI5A 3EP0A 5CPRB 1PEGA 1MT6A 3OOIA 5F6LA 3OS5A 3IHXA 3F9WA 5ARFA 5HI7A 4C1QA 5AYFA 4AU7A 3TG5A 3MO2A 3OPEA 3KMJA 3QWPA 3OXLA 5F6KC 2W5ZA 5T5GA 4QENA 5JINA 3FPDA 3K5KA 2G46A 5TEGA 3OXFA 4QEPA 3RQ4A 3F9XA 4J7FA 3RU0A 3S7DA 3TG4A 3M54A 4WUYA 2O8JA 4E47A 3M59A 3KMTA 5F59A 5TTFA 3RIBA 3VV0A 3MEKA
chains in the Genus database with same CATH superfamily
4H12A 5EG2A 5HQ8A 5KJMA 4J83A 4RZ0A 5EX0A 5CCMA 3DALA 4NJ5A 1ZKKA 4QEOA 4IJDA 2F69A 1N6CA 5LSXA 3N71A 3S8PA 3HNAA 3F9YA 3F9ZA 4O30A 3CBOA 3M57A 2RFIA 4BUPA 2QPWA 1N3JA 4MI0A 4O6FA 1MVXA 4YNMA 3M58A 4YPAA 4NVQA 1MUFA 5KJNA 3M53A 5EX3A 4YPEA 4Z4PA 4J8OA 4I51A 1MVHA 5TH7A 5JHNA 3S7BA 4IJ8A 3QWWA 3M5AA 3QWVA 3S7FA 2IGQA 5LSZA 3KMAA 1ML9A 3M55A 3VUZA 1H3IA 3RAYA 5KJLA 5F5EA 3SW9A 4JDSA 1XQHA 3BO5A 3CBMA 4J7IA 5T0MA 3MO5A 5T0KA 2W5YA 2BQZA 3OXGA 4YPUA 3SWCA 5CCLA 3M56A 3PDNA 3MO0A 1N6AA 1O9SA 5ARGA 4JLGA 2R3AA 4YNDA 5KJKA 4LDGA 2JV0A 4FMUA 3RJWA 3S7JA 4YNPA 5JJ0A 5JIYA 3DB5A 3CBPA 4MI5A 3EP0A 5CPRB 1PEGA 1MT6A 3OOIA 5F6LA 3OS5A 3IHXA 3F9WA 5ARFA 5HI7A 4C1QA 5AYFA 4AU7A 3TG5A 3MO2A 3OPEA 3KMJA 3QWPA 3OXLA 5F6KC 2W5ZA 5T5GA 4QENA 5JINA 3FPDA 3K5KA 2G46A 5TEGA 3OXFA 4QEPA 3RQ4A 3F9XA 4J7FA 3RU0A 3S7DA 3TG4A 3M54A 4WUYA 2O8JA 4E47A 3M59A 3KMTA 5F59A 5TTFA 3RIBA 3VV0A 3MEKA
chains in the Genus database with same CATH topology
4H12A 5EG2A 5HQ8A 5KJMA 4J83A 4RZ0A 5EX0A 5CCMA 3DALA 4NJ5A 1ZKKA 4QEOA 4IJDA 2F69A 1N6CA 5LSXA 3N71A 3S8PA 3HNAA 3F9YA 3F9ZA 4O30A 3CBOA 3M57A 2RFIA 4BUPA 2QPWA 1N3JA 4MI0A 4O6FA 1MVXA 4YNMA 3M58A 4YPAA 4NVQA 1MUFA 5KJNA 3M53A 5EX3A 4YPEA 4Z4PA 4J8OA 4I51A 1MVHA 5TH7A 5JHNA 3S7BA 4IJ8A 3QWWA 3M5AA 3QWVA 3S7FA 2IGQA 5LSZA 3KMAA 1ML9A 3M55A 3VUZA 1H3IA 3RAYA 5KJLA 5F5EA 3SW9A 4JDSA 1XQHA 3BO5A 3CBMA 4J7IA 5T0MA 3MO5A 5T0KA 2W5YA 2BQZA 3OXGA 4YPUA 3SWCA 5CCLA 3M56A 3PDNA 3MO0A 1N6AA 1O9SA 5ARGA 4JLGA 2R3AA 4YNDA 5KJKA 4LDGA 2JV0A 4FMUA 3RJWA 3S7JA 4YNPA 5JJ0A 5JIYA 3DB5A 3CBPA 4MI5A 3EP0A 5CPRB 1PEGA 1MT6A 3OOIA 5F6LA 3OS5A 3IHXA 3F9WA 5ARFA 5HI7A 4C1QA 5AYFA 4AU7A 3TG5A 3MO2A 3OPEA 3KMJA 3QWPA 3OXLA 5F6KC 2W5ZA 5T5GA 4QENA 5JINA 3FPDA 3K5KA 2G46A 5TEGA 3OXFA 4QEPA 3RQ4A 3F9XA 4J7FA 3RU0A 3S7DA 3TG4A 3M54A 4WUYA 2O8JA 4E47A 3M59A 3KMTA 5F59A 5TTFA 3RIBA 3VV0A 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H12 A;  5EG2 A;  5HQ8 A;  5KJM A;  4J83 A;  4RZ0 A;  5EX0 A;  5CCM A;  3DAL A;  4NJ5 A;  1ZKK A;  4QEO A;  4IJD A;  2F69 A;  1N6C A;  5LSX A;  3N71 A;  3S8P A;  3HNA A;  3F9Y A;  3F9Z A;  4O30 A;  3CBO A;  3M57 A;  2RFI A;  4BUP A;  2QPW A;  1N3J A;  4MI0 A;  4O6F A;  1MVX A;  4YNM A;  3M58 A;  4YPA A;  4NVQ A;  1MUF A;  5KJN A;  3M53 A;  5EX3 A;  4YPE A;  4Z4P A;  4J8O A;  4I51 A;  1MVH A;  5TH7 A;  5JHN A;  3S7B A;  4IJ8 A;  3QWW A;  3M5A A;  3QWV A;  3S7F A;  2IGQ A;  5LSZ A;  3KMA A;  1ML9 A;  3M55 A;  3VUZ A;  1H3I A;  3RAY A;  5KJL A;  5F5E A;  3SW9 A;  4JDS A;  1XQH A;  3BO5 A;  3CBM A;  4J7I A;  5T0M A;  3MO5 A;  5T0K A;  2W5Y A;  2BQZ A;  3OXG A;  4YPU A;  3SWC A;  5CCL A;  3M56 A;  3PDN A;  3MO0 A;  1N6A A;  1O9S A;  5ARG A;  4JLG A;  2R3A A;  4YND A;  5KJK A;  4LDG A;  2JV0 A;  4FMU A;  3RJW A;  3S7J A;  4YNP A;  5JJ0 A;  5JIY A;  3DB5 A;  3CBP A;  4MI5 A;  3EP0 A;  5CPR B;  1PEG A;  1MT6 A;  3OOI A;  5F6L A;  3OS5 A;  3IHX A;  3F9W A;  5ARF A;  5HI7 A;  4C1Q A;  5AYF A;  4AU7 A;  3TG5 A;  3MO2 A;  3OPE A;  3KMJ A;  3QWP A;  3OXL A;  5F6K C;  2W5Z A;  5T5G A;  4QEN A;  5JIN A;  3FPD A;  3K5K A;  2G46 A;  5TEG A;  3OXF A;  4QEP A;  3RQ4 A;  3F9X A;  4J7F A;  3RU0 A;  3S7D A;  3TG4 A;  3M54 A;  4WUY A;  2O8J A;  4E47 A;  3M59 A;  3KMT A;  5F59 A;  5TTF A;  3RIB A;  3VV0 A;  3MEK A; 
#chains in the Genus database with same CATH topology
 4H12 A;  5EG2 A;  5HQ8 A;  5KJM A;  4J83 A;  4RZ0 A;  5EX0 A;  5CCM A;  3DAL A;  4NJ5 A;  1ZKK A;  4QEO A;  4IJD A;  2F69 A;  1N6C A;  5LSX A;  3N71 A;  3S8P A;  3HNA A;  3F9Y A;  3F9Z A;  4O30 A;  3CBO A;  3M57 A;  2RFI A;  4BUP A;  2QPW A;  1N3J A;  4MI0 A;  4O6F A;  1MVX A;  4YNM A;  3M58 A;  4YPA A;  4NVQ A;  1MUF A;  5KJN A;  3M53 A;  5EX3 A;  4YPE A;  4Z4P A;  4J8O A;  4I51 A;  1MVH A;  5TH7 A;  5JHN A;  3S7B A;  4IJ8 A;  3QWW A;  3M5A A;  3QWV A;  3S7F A;  2IGQ A;  5LSZ A;  3KMA A;  1ML9 A;  3M55 A;  3VUZ A;  1H3I A;  3RAY A;  5KJL A;  5F5E A;  3SW9 A;  4JDS A;  1XQH A;  3BO5 A;  3CBM A;  4J7I A;  5T0M A;  3MO5 A;  5T0K A;  2W5Y A;  2BQZ A;  3OXG A;  4YPU A;  3SWC A;  5CCL A;  3M56 A;  3PDN A;  3MO0 A;  1N6A A;  1O9S A;  5ARG A;  4JLG A;  2R3A A;  4YND A;  5KJK A;  4LDG A;  2JV0 A;  4FMU A;  3RJW A;  3S7J A;  4YNP A;  5JJ0 A;  5JIY A;  3DB5 A;  3CBP A;  4MI5 A;  3EP0 A;  5CPR B;  1PEG A;  1MT6 A;  3OOI A;  5F6L A;  3OS5 A;  3IHX A;  3F9W A;  5ARF A;  5HI7 A;  4C1Q A;  5AYF A;  4AU7 A;  3TG5 A;  3MO2 A;  3OPE A;  3KMJ A;  3QWP A;  3OXL A;  5F6K C;  2W5Z A;  5T5G A;  4QEN A;  5JIN A;  3FPD A;  3K5K A;  2G46 A;  5TEG A;  3OXF A;  4QEP A;  3RQ4 A;  3F9X A;  4J7F A;  3RU0 A;  3S7D A;  3TG4 A;  3M54 A;  4WUY A;  2O8J A;  4E47 A;  3M59 A;  3KMT A;  5F59 A;  5TTF A;  3RIB A;  3VV0 A;  3MEK A; 
#chains in the Genus database with same CATH homology
 4H12 A;  5EG2 A;  5HQ8 A;  5KJM A;  4J83 A;  4RZ0 A;  5EX0 A;  5CCM A;  3DAL A;  4NJ5 A;  1ZKK A;  4QEO A;  4IJD A;  2F69 A;  1N6C A;  5LSX A;  3N71 A;  3S8P A;  3HNA A;  3F9Y A;  3F9Z A;  4O30 A;  3CBO A;  3M57 A;  2RFI A;  4BUP A;  2QPW A;  1N3J A;  4MI0 A;  4O6F A;  1MVX A;  4YNM A;  3M58 A;  4YPA A;  4NVQ A;  1MUF A;  5KJN A;  3M53 A;  5EX3 A;  4YPE A;  4Z4P A;  4J8O A;  4I51 A;  1MVH A;  5TH7 A;  5JHN A;  3S7B A;  4IJ8 A;  3QWW A;  3M5A A;  3QWV A;  3S7F A;  2IGQ A;  5LSZ A;  3KMA A;  1ML9 A;  3M55 A;  3VUZ A;  1H3I A;  3RAY A;  5KJL A;  5F5E A;  3SW9 A;  4JDS A;  1XQH A;  3BO5 A;  3CBM A;  4J7I A;  5T0M A;  3MO5 A;  5T0K A;  2W5Y A;  2BQZ A;  3OXG A;  4YPU A;  3SWC A;  5CCL A;  3M56 A;  3PDN A;  3MO0 A;  1N6A A;  1O9S A;  5ARG A;  4JLG A;  2R3A A;  4YND A;  5KJK A;  4LDG A;  2JV0 A;  4FMU A;  3RJW A;  3S7J A;  4YNP A;  5JJ0 A;  5JIY A;  3DB5 A;  3CBP A;  4MI5 A;  3EP0 A;  5CPR B;  1PEG A;  1MT6 A;  3OOI A;  5F6L A;  3OS5 A;  3IHX A;  3F9W A;  5ARF A;  5HI7 A;  4C1Q A;  5AYF A;  4AU7 A;  3TG5 A;  3MO2 A;  3OPE A;  3KMJ A;  3QWP A;  3OXL A;  5F6K C;  2W5Z A;  5T5G A;  4QEN A;  5JIN A;  3FPD A;  3K5K A;  2G46 A;  5TEG A;  3OXF A;  4QEP A;  3RQ4 A;  3F9X A;  4J7F A;  3RU0 A;  3S7D A;  3TG4 A;  3M54 A;  4WUY A;  2O8J A;  4E47 A;  3M59 A;  3KMT A;  5F59 A;  5TTF A;  3RIB A;  3VV0 A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...