3KMUB

Crystal structure of the ilk/alpha-parvin core complex (apo)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
AFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin-linked kinase
publication title The pseudoactive site of ILK is essential for its binding to alpha-Parvin and localization to focal adhesions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 3kmuB00
2E9KA 2K3SA 2VZCA 1SH5A 5L0OA 1V5KA 1AA2A 4EDMA 1H67A 1WYPA 3F7PA 3FERA 1WIXA 5BVRA 1MB8A 4EDLA 3HOPA 4B7LA 2D86A 2D87A 3KMUB 2D89A 1SH6A 1QAGA 1UEGA 2D85A 3I6XA 1VKAA 3HORA 2VZDA 1WYRA 5A36A 5A37A 2K2RA 2WA5A 2L3GA 2EE7A 1PXYA 3JALM 2DK9A 3REPB 4TXIA 4Q57B 1P5SA 3HOCA 2YRNA 2JV9A 2R0OA 1UJOA 1DXXA 2QJXA 1BKRA 5A4BA 1WYNA 2D88A 2EYIA 2R8UA 1AOAA 4Q59A 2WFNA 1WKUA 1WYQA 2WA6A 3JARM 1P2XA 1WYOA 2VZGB 1WJOA 5A38A 2EYNA 1BHDA 2WA7A 4TXKA 1PA7A 1RT8A 1TJTA 1WYMA 3KMWB 5J8EA 2VZIB 4EDNA 3CO1A 1WYLA 3JAKM 2RR8A 2QJZA 3KY9A 4Q58A
chains in the Genus database with same CATH superfamily
2E9KA 2EQOA 2HL9A 2K3SA 1SH5A 2VZCA 5L0OA 1V5KA 1EUVA 1AA2A 4EDMA 1H67A 1WYPA 3F7PA 3FERA 1WIXA 5BVRA 1MB8A 4EDLA 3HOPA 4B7LA 2D86A 2D87A 2HKPA 2WDTA 3KMUB 3VP7A 2D89A 1SH6A 1QAGA 1UEGA 2D85A 3I6XA 1VKAA 3HORA 2VZDA 1WYRA 5A36A 5A37A 2K2RA 2WA5A 2HL8A 2L3GA 2EE7A 1PXYA 3JALM 2DK9A 3REPB 4TXIA 4Q57B 1P5SA 2VE7A 3HOCA 2YRNA 2JV9A 2R0OA 1UJOA 1DXXA 2QJXA 1BKRA 5A4BA 1WYNA 4DDPA 2D88A 2EYIA 2R8UA 1AOAA 4Q59A 4LVRA 2WFNA 1WKUA 1WYQA 2WA6A 3JARM 1P2XA 1WYOA 2VZGB 1WJOA 5A38A 2EYNA 1BHDA 2WA7A 5FMUA 4TXKA 2VE7C 1PA7A 1RT8A 1TJTA 1WYMA 4LVPA 5FMTA 3KMWB 2IGPA 5J8EA 2VZIB 2WE6A 4EDNA 3CO1A 1WYLA 3JAKM 2RR8A 3EAYA 2QJZA 3KY9A 4Q58A
chains in the Genus database with same CATH topology
2E9KA 2K3SA 2VZCA 1SH5A 5L0OA 1V5KA 1AA2A 4EDMA 1H67A 1WYPA 3F7PA 3FERA 1WIXA 5BVRA 1MB8A 4EDLA 3HOPA 4B7LA 2D86A 2D87A 3KMUB 2D89A 1SH6A 1QAGA 1UEGA 2D85A 3I6XA 1VKAA 3HORA 2VZDA 1WYRA 5A36A 5A37A 2K2RA 2WA5A 2L3GA 2EE7A 1PXYA 3JALM 2DK9A 3REPB 4TXIA 4Q57B 1P5SA 3HOCA 2YRNA 2JV9A 2R0OA 1UJOA 1DXXA 2QJXA 1BKRA 5A4BA 1WYNA 2D88A 2EYIA 2R8UA 1AOAA 4Q59A 2WFNA 1WKUA 1WYQA 2WA6A 3JARM 1P2XA 1WYOA 2VZGB 1WJOA 5A38A 2EYNA 1BHDA 2WA7A 4TXKA 1PA7A 1RT8A 1TJTA 1WYMA 3KMWB 5J8EA 2VZIB 4EDNA 3CO1A 1WYLA 3JAKM 2RR8A 2QJZA 3KY9A 4Q58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9K A;  2K3S A;  2VZC A;  1SH5 A;  5L0O A;  1V5K A;  1AA2 A;  4EDM A;  1H67 A;  1WYP A;  3F7P A;  3FER A;  1WIX A;  5BVR A;  1MB8 A;  4EDL A;  3HOP A;  4B7L A;  2D86 A;  2D87 A;  3KMU B;  2D89 A;  1SH6 A;  1QAG A;  1UEG A;  2D85 A;  3I6X A;  1VKA A;  3HOR A;  2VZD A;  1WYR A;  5A36 A;  5A37 A;  2K2R A;  2WA5 A;  2L3G A;  2EE7 A;  1PXY A;  3JAL M;  2DK9 A;  3REP B;  4TXI A;  4Q57 B;  1P5S A;  3HOC A;  2YRN A;  2JV9 A;  2R0O A;  1UJO A;  1DXX A;  2QJX A;  1BKR A;  5A4B A;  1WYN A;  2D88 A;  2EYI A;  2R8U A;  1AOA A;  4Q59 A;  2WFN A;  1WKU A;  1WYQ A;  2WA6 A;  3JAR M;  1P2X A;  1WYO A;  2VZG B;  1WJO A;  5A38 A;  2EYN A;  1BHD A;  2WA7 A;  4TXK A;  1PA7 A;  1RT8 A;  1TJT A;  1WYM A;  3KMW B;  5J8E A;  2VZI B;  4EDN A;  3CO1 A;  1WYL A;  3JAK M;  2RR8 A;  2QJZ A;  3KY9 A;  4Q58 A; 
#chains in the Genus database with same CATH topology
 2E9K A;  2EQO A;  2HL9 A;  2K3S A;  1SH5 A;  2VZC A;  5L0O A;  1V5K A;  1EUV A;  1AA2 A;  4EDM A;  1H67 A;  1WYP A;  3F7P A;  3FER A;  1WIX A;  5BVR A;  1MB8 A;  4EDL A;  3HOP A;  4B7L A;  2D86 A;  2D87 A;  2HKP A;  2WDT A;  3KMU B;  3VP7 A;  2D89 A;  1SH6 A;  1QAG A;  1UEG A;  2D85 A;  3I6X A;  1VKA A;  3HOR A;  2VZD A;  1WYR A;  5A36 A;  5A37 A;  2K2R A;  2WA5 A;  2HL8 A;  2L3G A;  2EE7 A;  1PXY A;  3JAL M;  2DK9 A;  3REP B;  4TXI A;  4Q57 B;  1P5S A;  2VE7 A;  3HOC A;  2YRN A;  2JV9 A;  2R0O A;  1UJO A;  1DXX A;  2QJX A;  1BKR A;  5A4B A;  1WYN A;  4DDP A;  2D88 A;  2EYI A;  2R8U A;  1AOA A;  4Q59 A;  4LVR A;  2WFN A;  1WKU A;  1WYQ A;  2WA6 A;  3JAR M;  1P2X A;  1WYO A;  2VZG B;  1WJO A;  5A38 A;  2EYN A;  1BHD A;  2WA7 A;  5FMU A;  4TXK A;  2VE7 C;  1PA7 A;  1RT8 A;  1TJT A;  1WYM A;  4LVP A;  5FMT A;  3KMW B;  2IGP A;  5J8E A;  2VZI B;  2WE6 A;  4EDN A;  3CO1 A;  1WYL A;  3JAK M;  2RR8 A;  3EAY A;  2QJZ A;  3KY9 A;  4Q58 A; 
#chains in the Genus database with same CATH homology
 2E9K A;  2K3S A;  2VZC A;  1SH5 A;  5L0O A;  1V5K A;  1AA2 A;  4EDM A;  1H67 A;  1WYP A;  3F7P A;  3FER A;  1WIX A;  5BVR A;  1MB8 A;  4EDL A;  3HOP A;  4B7L A;  2D86 A;  2D87 A;  3KMU B;  2D89 A;  1SH6 A;  1QAG A;  1UEG A;  2D85 A;  3I6X A;  1VKA A;  3HOR A;  2VZD A;  1WYR A;  5A36 A;  5A37 A;  2K2R A;  2WA5 A;  2L3G A;  2EE7 A;  1PXY A;  3JAL M;  2DK9 A;  3REP B;  4TXI A;  4Q57 B;  1P5S A;  3HOC A;  2YRN A;  2JV9 A;  2R0O A;  1UJO A;  1DXX A;  2QJX A;  1BKR A;  5A4B A;  1WYN A;  2D88 A;  2EYI A;  2R8U A;  1AOA A;  4Q59 A;  2WFN A;  1WKU A;  1WYQ A;  2WA6 A;  3JAR M;  1P2X A;  1WYO A;  2VZG B;  1WJO A;  5A38 A;  2EYN A;  1BHD A;  2WA7 A;  4TXK A;  1PA7 A;  1RT8 A;  1TJT A;  1WYM A;  3KMW B;  5J8E A;  2VZI B;  4EDN A;  3CO1 A;  1WYL A;  3JAK M;  2RR8 A;  2QJZ A;  3KY9 A;  4Q58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...