3KORA

Crystal structure of a putative trp repressor from staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
SMQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible Trp repressor
publication title Crystal structure of a putative Trp repressor from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 30
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.10 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A TrpR-like 3korA00
1JHGA 1WRSR 1TROA 1RCSA 3SSWN 3SSXN 3G1CA 1TRRA 1CO0A 1WRTR 3KORA 1ZT9A 3WRPA 3FRWA 2XDIA 1WRPR 1MI7R 2OZ9R
chains in the Genus database with same CATH superfamily
4YVKA 4YQ3A 1TROA 1RCSA 4YPZA 3KY7A 4YQ2A 4YQDA 4YQ4A 4YQ5A 1ZT9A 1UAKA 3WRPA 4YQIA 4YQAA 1MI7R 4YQ8A 4YQLA 4YQ1A 4MCBA 4YVIA 4YQOA 4H3ZA 3SSWN 4IG6A 4YVJA 3SSXN 4YQKA 4YPYA 5D9FA 3IEFA 4MCCA 4YQ6A 4YQBA 4YQCA 1UAJA 2OZ9R 1JHGA 4H3YA 4YPWA 3G1CA 3KNUA 1OY5A 1WRTR 4YQGA 4YQ7A 3FRWA 4YVGA 4YQ0A 1WRPR 1WRSR 1UALA 1UAMA 3AXZA 4YQNA 4MCDA 4YVHA 4YQQA 1P9PA 4YQTA 4YQJA 1TRRA 1CO0A 4YQSA 3KORA 4YPXA 4YQPA 4YQ9A 4YQRA 2XDIA 3QUVA
chains in the Genus database with same CATH topology
1JHGA 1WRSR 1TROA 1RCSA 3SSWN 3SSXN 3G1CA 1TRRA 1CO0A 1WRTR 3KORA 1ZT9A 3WRPA 3FRWA 2XDIA 1WRPR 1MI7R 2OZ9R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHG A;  1WRS R;  1TRO A;  1RCS A;  3SSW N;  3SSX N;  3G1C A;  1TRR A;  1CO0 A;  1WRT R;  3KOR A;  1ZT9 A;  3WRP A;  3FRW A;  2XDI A;  1WRP R;  1MI7 R;  2OZ9 R; 
#chains in the Genus database with same CATH topology
 4YVK A;  4YQ3 A;  1TRO A;  1RCS A;  4YPZ A;  3KY7 A;  4YQ2 A;  4YQD A;  4YQ4 A;  4YQ5 A;  1ZT9 A;  1UAK A;  3WRP A;  4YQI A;  4YQA A;  1MI7 R;  4YQ8 A;  4YQL A;  4YQ1 A;  4MCB A;  4YVI A;  4YQO A;  4H3Z A;  3SSW N;  4IG6 A;  4YVJ A;  3SSX N;  4YQK A;  4YPY A;  5D9F A;  3IEF A;  4MCC A;  4YQ6 A;  4YQB A;  4YQC A;  1UAJ A;  2OZ9 R;  1JHG A;  4H3Y A;  4YPW A;  3G1C A;  3KNU A;  1OY5 A;  1WRT R;  4YQG A;  4YQ7 A;  3FRW A;  4YVG A;  4YQ0 A;  1WRP R;  1WRS R;  1UAL A;  1UAM A;  3AXZ A;  4YQN A;  4MCD A;  4YVH A;  4YQQ A;  1P9P A;  4YQT A;  4YQJ A;  1TRR A;  1CO0 A;  4YQS A;  3KOR A;  4YPX A;  4YQP A;  4YQ9 A;  4YQR A;  2XDI A;  3QUV A; 
#chains in the Genus database with same CATH homology
 1JHG A;  1WRS R;  1TRO A;  1RCS A;  3SSW N;  3SSX N;  3G1C A;  1TRR A;  1CO0 A;  1WRT R;  3KOR A;  1ZT9 A;  3WRP A;  3FRW A;  2XDI A;  1WRP R;  1MI7 R;  2OZ9 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...