3KORA

Crystal structure of a putative trp repressor from staphylococcus aureus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
b'SMQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative Trp repressor from Staphylococcus aureus
rcsb
molecule keywords Possible Trp repressor
source organism Staphylococcus aureus
molecule tags Transcription
total genus 30
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.10 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A TrpR-like 3korA00
2XDIA 3FRWA 3WRPA 3KORA 1TROA 1TRRA 3SSWN 2OZ9R 1RCSA 3SSXN 1MI7R 1CO0A 1JHGA 1ZT9A 3G1CA 1WRTR 1WRSR 1WRPR
chains in the Genus database with same CATH superfamily
4YQCA 4YQ5A 1OY5A 3IEFA 4YQ7A 4YPWA 1RCSA 3AXZA 4YQSA 3KNUA 1WRSR 4YQKA 4YQPA 1WRPR 4YQ3A 3WRPA 4YQAA 1TRRA 3KORA 4YQ4A 4H3ZA 2OZ9R 4YVGA 4YQ2A 4YQ0A 4YQNA 4YQJA 1CO0A 3QUVA 4IG6A 4YQOA 4YQIA 1UAMA 1TROA 4YQDA 4MCCA 5D9FA 1UAJA 4YQ6A 3SSXN 4YQBA 4YQLA 1MI7R 4YPZA 1JHGA 4MCBA 4YVHA 4YQQA 3KY7A 3G1CA 1UAKA 4YPYA 4YQTA 4YQGA 4YVJA 1UALA 2XDIA 3FRWA 1P9PA 3SSWN 4YVIA 4YQ9A 4YQ8A 4YPXA 1ZT9A 4H3YA 4YVKA 4YQ1A 1WRTR 4MCDA 4YQRA
chains in the Genus database with same CATH topology
2XDIA 3FRWA 3WRPA 3KORA 1TROA 1TRRA 3SSWN 2OZ9R 1RCSA 3SSXN 1MI7R 1CO0A 1JHGA 1ZT9A 3G1CA 1WRTR 1WRSR 1WRPR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDI A;  3FRW A;  3WRP A;  3KOR A;  1TRO A;  1TRR A;  3SSW N;  2OZ9 R;  1RCS A;  3SSX N;  1MI7 R;  1CO0 A;  1JHG A;  1ZT9 A;  3G1C A;  1WRT R;  1WRS R;  1WRP R; 
#chains in the Genus database with same CATH topology
 4YQC A;  4YQ5 A;  1OY5 A;  3IEF A;  4YQ7 A;  4YPW A;  1RCS A;  3AXZ A;  4YQS A;  3KNU A;  1WRS R;  4YQK A;  4YQP A;  1WRP R;  4YQ3 A;  3WRP A;  4YQA A;  1TRR A;  3KOR A;  4YQ4 A;  4H3Z A;  2OZ9 R;  4YVG A;  4YQ2 A;  4YQ0 A;  4YQN A;  4YQJ A;  1CO0 A;  3QUV A;  4IG6 A;  4YQO A;  4YQI A;  1UAM A;  1TRO A;  4YQD A;  4MCC A;  5D9F A;  1UAJ A;  4YQ6 A;  3SSX N;  4YQB A;  4YQL A;  1MI7 R;  4YPZ A;  1JHG A;  4MCB A;  4YVH A;  4YQQ A;  3KY7 A;  3G1C A;  1UAK A;  4YPY A;  4YQT A;  4YQG A;  4YVJ A;  1UAL A;  2XDI A;  3FRW A;  1P9P A;  3SSW N;  4YVI A;  4YQ9 A;  4YQ8 A;  4YPX A;  1ZT9 A;  4H3Y A;  4YVK A;  4YQ1 A;  1WRT R;  4MCD A;  4YQR A; 
#chains in the Genus database with same CATH homology
 2XDI A;  3FRW A;  3WRP A;  3KOR A;  1TRO A;  1TRR A;  3SSW N;  2OZ9 R;  1RCS A;  3SSX N;  1MI7 R;  1CO0 A;  1JHG A;  1ZT9 A;  3G1C A;  1WRT R;  1WRS R;  1WRP R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...