3KOUA

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
237
Chain Sequence
RWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVEAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CD38 molecule
total genus 84
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3kouA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kouA02
3DL2A 1X0VA 3LF2A 1LSOA 3HDYA 3DHEA 1WW8A 5CDUA 4CV1A 1AHIA 1E3LA 4HY3A 1E5QA 3ZWMA 2GSDA 3B1FA 1A27A 3RI3A 1B8PA 2DFDA 4A5OA 4L73A 3V2HA 1LQTA 2NV6A 1DHRA 4B4VA 1O5IA 4OM8A 3GA0A 5A3VA 3U0BA 2RH4A 2ZTMA 5ICSA 3JQGA 4D41A 4FW8A 3FTPA 2H1SA 4GMGA 4TKMA 5BNTA 1T1SA 1YJ8A 4RF5A 1L7EA 1GL3A 1WXDA 1ZK1A 3ICPA 2NTNA 1B14A 3M1LA 4KDFA 7ADHA 1VL8A 4R54A 4DA9A 1TB4A 1UDAA 5EQFA 1MLDA 1CERA 2ZQYA 4K6CA 3D3EA 2AHRA 4OYRA 4QXMA 3JD0A 4RVSA 1WDMA 2UUPA 3H3JA 2DFVA 5AVOA 3R1IA 4KQXA 4L4XA 4NI5A 1VJ1A 4L8VA 3JQAD 4R9RA 1NM5A 1NVTA 1VC2A 1RM5A 4ZRNA 1EVIA 5FF9A 3ZW9A 5EERA 4M55A 1C0LA 3T4EA 3G17A 1ZIDA 3WIEA 1PS9A 4H3VA 3QVOA 3D4OA 2VZ0A 4J4HA 4WUVA 4KTTE 1KVTA 3CZMA 4BNHA 3IKTA 3VTFA 3UXYA 5JO0A 4RVUA 1P45A 2QX7A 3E9MA 4KUHA 3TF5A 4N5NA 3LQFA 4S1VA 1XELA 3VDRA 4LVCA 2DTEA 3GHHA 4LSMA 1T2CA 3KSZO 4YQYA 4MOWA 4RJTA 1PL8A 3H9EO 3ZU3A 3CMCO 1JAYA 2NU6A 1GR0A 2NWQA 3WB9A 4YAJA 3DEYX 1X1EA 1HSOA 4IXTA 3INRA 4DPLA 1H2BA 4P4GA 1X13A 4N7RA 1HE2A 3K73O 5JCJD 3I9MA 3IMFA 4H7PA 5ENDA 4BO1A 2BRUA 4RPHA 2QYSA 4DREA 3E8XA 4J2OA 4OKNA 3SLKA 2XXJA 4P4NA 3SJUA 5B4VA 1QYXA 3F5QA 3G1UA 3WFIA 5MGBA 4II3A 3RASA 3FSRA 3HZZA 3QQPA 5KVCA 1PJQA 3K31A 3D1LA 2WE8A 4M87A 4YDRA 3VH3A 3QLJA 1ISIA 2D2IA 3GUCA 2OORA 3HNPA 1UXIA 3H5RA 3FTNA 4R9SA 1FMCA 1JN0A 1GFSA 2DUUA 1PJTA 4XQ9A 2W2LA 5L4SA 3QVWA 2UVDA 2OO5A 3CXRA 1HZZA 4EW6A 4I1IA 2A35A 2ZCVA 1OC2A 5JCJA 4IDBA 2EHDA 5KVVA 2VYVA 1DIGA 4PGFA 4ALNA 1CF2O 4B8ZA 4XWYA 2CY0A 3Q2IA 4YTEA 3FWNA 1K3TA 1JLLA 3WGIA 4RPJA 3V5NA 3WNVA 4RF4A 1J5PA 3NDJA 4AJ2A 1EVYA 4ZD6A 4GX1A 4NMHA 4BNJA 3RJ5A 3JYNA 2J6IA 2OP1A 4O1MA 1P1JA 1YKFA 1X7HA 2QYTA 4PLTA 4PIVA 1E1NA 3DB2A 3GGGA 4LRSB 4L75A 1V3UA 1U1IA 3A14A 2FR1A 2LDBA 3NV9A 4NG5A 1BVRA 3R0IA 1KVQA 1R4NA 2J3IA 2BLLA 2CVOA 4BO8A 4YBZA 4KZPA 2YJZA 1F12A 3ADPA 4XX0A 2O50A 1ISGA 3K2BA 3E5MA 4DWVA 1M66A 3O8QB 3ADOA 3WBBA 2DT5A 3G49A 3CEAA 1YXMA 3D7LA 1NFFA 3GVCA 3FNEA 3HADA 1ZEJA 3BMQB 4QX6A 3GFBA 1IUKA 4EZBA 3VPXA 2YQ5A 5ENVA 5JAQA 2DPHA 4PG4A 4CL3A 3PFFA 4GVLA 1K6IA 3UHAA 3H65A 2EGHA 1RPNA 4E5KA 5G0VA 1DOHA 4DXHA 4U6SA 1A72A 3QY9A 5ILOA 2PTGA 3VKUA 3RFVA 2Y05A 1PU2A 3ZV5A 3D4NA 5GZ1A 1Q7BA 4TKLA 5COAA 2Z1MA 4ND2A 4CQMB 1ZSNA 4I5FA 4AJEA 1U5CA 2AMFA 2AQHA 4LVUA 5ER6A 4HNGA 2XF8A 4EJ6A 3OF2A 3IL2A 2NU9A 3A9WA 1QR6A 3DONA 2VRCD 4PLVA 4PRKA 4A2CA 4AICA 3FNHA 1TT7A 1QLJA 3TN7A 1R37A 2WYWA 2X23A 3FBGA 3PGJA 3S2FA 1ONPA 3KYDB 2X6TA 1JA9A 3KYBA 4XYGA 4RO0A 3RD5A 4F3YA 3E9QA 2JFHA 5DT9A 2AEJA 1BXKA 3BTUA 3GFGA 1YO6A 1SZJG 2Y1OA 4Y6PA 4LCJA 1PZFA 4LSWA 3PFWO 4XGNA 4XIYA 3SVTA 4CLEA 1EVJA 2X1HA 4I9HA 2DPGA 2PY6A 4TVBA 3M1AA 2Z95A 1M67A 1S6YA 2AEMA 4QECA 4CM6A 4BNTA 2P2SA 3JD4A 2QG4A 4QO8A 4A10A 3B6ZA 5JPIA 1YOVB 2D5CA 4AG3A 1QYWA 2FZEA 4DVJA 4RQUA 5ADHA 3INTA 4O59O 1OZAA 2YQ4A 1BTOA 4XQCA 3CMMA 3H2SA 1QKIA 1MC5A 4DTIA 2P9GA 3RU9A 3P7MA 3WLFA 3N58A 4RPGA 2QRKA 3AM4A 1NTOA 4BNNA 4TRJA 4J7UA 3VVCA 5IDXA 3D0OA 4RLHA 5B37A 2BGKA 4J16A 4PRLA 2NUAA 1AGNA 1HWYA 2JHFA 3H5NA 2PA3A 3PHIA 1WVGA 3ZH2A 3L4BA 3BMCA 3H7AA 1U28A 5JAIA 5IXSA 4DYVA 3QJ5A 3PPIA 3AW9A 2RIRA 4R1SA 1NVMB 2EERA 3ZWAA 3PRJA 4EJMA 4YRAA 4PFJA 4YCAA 4UUPA 3TZQA 4WECA 2A4KA 5LDGA 2QRJA 4IDFA 4XRGA 2VHZA 4IPTA 2WD8A 3VZRA 1I3LA 4W9NC 4DBZA 5TJHA 2CSUA 4IS2A 3JYLA 4UVGA 1KEUA 3D3WA 4KUEA 2B5WA 4CR6A 1Y8RA 5MDHA 1E3WA 2HJRA 3FI9A 4CQMA 8ADHA 5EJ2A 3L77A 3GN2A 3W8DA 4BVAA 3K8ZA 4I5GA 1SBYA 3GOHA 3VAZA 1LDGA 3MTJA 2GNAA 1I36A 4Z6KA 4YYZA 4NIMA 2Y0EA 2P4HX 3JQ7A 3ON5A 2FPPA 1Q0QA 4NBWA 2YZ7A 1BWSA 4PVCA 2WDZA 1TA4A 3PEFA 5L51A 1EQUA 4XR9A 3F1LA 1R0SA 3DTTA 3FNGA 4IGFA 1I01A 2DBVO 4XB2A 3RC1A 4R4JA 2XPCA 2ZIZA 1HRDA 4CLRB 1SNYA 2HK8A 3AM3A 4XYBA 3VZQA 1ZH8A 3WMWA 4XCVA 1UZNA 4E0BA 4R16A 1PQUA 1BMDA 3PJEA 4XDYA 4CM8B 1LC3A 3EMKA 2PWZA 2JD1A 4B7XA 2Q3EA 4BO9A 2VUTA 4TQGA 3X2FA 3V2UA 1GYRA 2AA3A 3U5TA 2C7GA 4Y98A 3Q6IA 1HDXA 3C1TA 3BXXA 4RZHA 2FR8A 4BUCA 1UAGA 1W6UA 3PZRA 4D46A 2YYYA 4CQMD 1HLPA 2PD4A 4XGIA 3S2EA 1SEPA 5HS4A 4UEOA 1CJCA 2FHSA 4GX0A 4NFHA 4MP3A 2J3KA 1DIBA 3ETDA 4A7PA 1KEPA 1HTBA 3F1KA 2AE2A 3GZNB 4ZQGA 2DC1A 3QWAA 2I76A 1BXGB 3WJ7A 3KOUA 3ONDA 3QVTA 4TZTA 4I9NA 2HKIA 1R0LA 2WTBA 1E7MA 2FY8A 4IINA 1NAHA 1LTHR 3NEPX 4NFSA 4R5MA 1GQQA 4Y67A 1BRMA 5TC4A 4R1TA 5I7VA 3AOGA 1GQ2A 3NTRA 1PJ4A 1UUFA 3F4BA 4E2YA 1G6KA 3ASUA 2X9VA 5JDIA 3U09A 4J9UE 4CMAA 3C7CB 2EGGA 4KTVE 2WWRA 5L7WA 4Z0TA 3JD1A 1DBVO 1DAPA 2JFGA 5DBGA 4YPOA 5EINA 4MP8A 4MVJI 4UVDA 2Q1WA 4CLRA 2AG8A 4KWIA 4ALKA 3NJ8A 2D0IA 3RU7A 2C0CA 3QE3A 4WJZA 3JYQA 5CEJA 3RC7A 3I9OA 1K6XA 2VHYA 1A9ZA 1NVGA 2R00C 3LC1O 1HEUA 3HHPA 2HU2A 4J3FA 4W4TA 1EDOA 1VM6A 4II2A 1IPFA 2ZJ1A 1H6BA 1U9JA 4ONEA 2JAHA 1Z45A 3I5MA 2ZB8A 5DBFA 1NQOA 3NT5A 4M54A 4GQAA 1GY8A 3RUAA 4IUYA 4IZHA 2FWMX 3ENNA 3UVEA 4PZEA 2JL1A 1R12A 3FD8A 4RGBA 1JAXA 3AUAA 5A02A 5AXDA 3ZNNA 1PGQA 4AL4A 4E3ZA 2NADA 4FJ1A 3TZHA 1H0KA 2GASA 4XIJA 5I9MA 5C5IA 3WR5A 3GGOA 4IMPA 2W2KA 4D7AA 2EIHA 3AY6A 1OI7A 4BNZA 2FN7A 3NRCA 3U4IA 1P1KA 3WSWA 5T8KA 4E2ZA 1IE3A 2C59A 3HSKA 1E3SA 5JDCA 3JQBC 4OAQA 1PJ3A 3AFNA 1IULA 3OP4A 1DIRA 1YRLA 1XSEA 4FOOA 1ML3A 3CIFA 4BNIA 5I9LA 5IG2A 4ITUA 4CLOA 1HL3A 2I66A 4OOFA 4DPMA 3GG9A 5G0TA 5HA5A 5CDGA 5F1OA 3OJFA 4NK4A 4YJGB 4R41A 2ZYDA 4RL6A 1GV0A 1A7KA 3QRWA 3TPCA 2FP4A 4NNJA 2P91A 1ENYA 4J1SA 3HDHA 4RVGA 3B1JA 1A4UA 1SO8A 3CTMA 4D43A 3HUDA 5JY1A 2UV8A 3DMTC 1K6JA 3EUWA 1ADCA 2NVUB 4AJIA 1MP0A 2GR9A 1ZJYA 5T5QA 3BIOA 1MG5A 3KSDO 5DP2A 3ZU5A 5AXBA 4GLLA 5L40A 2O3JA 3ZWYA 1KC1A 5KNLA 3HN7A 1KOLA 1PZGA 4GKVA 5LDHA 1W73A 2HMUA 1JTVA 2I65A 1P31A 3VOSA 4MVJG 3E5RA 4NR0A 1GPJA 3ZHXA 1H93A 2BI7A 4TVOA 1BDMA 1P0FA 4DRYA 1O95A 3HDQA 4BNWA 1U3WA 4ILKA 4OKIA 4YJDA 4MDHA 3JQ8B 1PSDA 3ZV6A 3MJSA 3O9ZA 4RF2A 1EZ4A 4E4YA 1N7HA 4ZICA 2EG9A 3AY7A 1YS4A 3PYXA 4DGSA 3UN1A 2C82A 2D59A 1KETA 3ABIA 3IIEA 5L3ZA 4GH5A 4DUPA 2O48X 2AQKA 4NQZA 1Y8QA 4Q3BA 2EKQA 1I2CA 1N9GB 1ZFNA 4E32A 1HDGO 4LRTB 4RVFA 2P5YA 3OMLA 3UGKA 2AXQA 4Q3DA 4Q3EA 4CV2A 5KOIA 4MVJD 3DOOA 3WS7A 1WZEA 2VHXA 5IDYA 3PDJA 5B1YA 2B83A 4NBUA 4XJSA 5TIIA 2UUOA 3GVXA 3CPSA 3KV3O 4FSHA 5IZCA 4EJ0A 1CEQA 3P19A 4UAGA 5IDQA 4C4OA 4J0FA 1LQUA 5FFFA 2C2YA 2WYVA 1KVRA 1CQJA 5AQ1A 4Q3NA 4MVJE 3DAPA 5JO9A 4RVDA 2O3RA 5B12A 4P8RA 1VKOA 2NQ8A 3E03A 2VNSA 1Q7CA 3INGA 2ILTA 1KEVA 1UZMA 5L7TA 1Z73A 3QWHA 3RWBA 2Z5LA 2GF2A 3QWIA 5TS3A 3DBRA 1MA0A 4FFOA 4R3NA 4X54A 1T25A 3BYZA 3H9UA 1MFPA 2EKLA 4YJFA 1VI2A 4RF3A 3AOEA 4YWJA 1UJMA 1NFQA 2Y1DA 4GLOA 2AE1A 3IUPA 3PQEA 4IJWA 4WNIA 3LT0A 4E2XA 1QYCA 3FR7A 4F45A 3ZU4A 3U4DA 1EUCA 3KYCA 2VWQA 5BNIA 5C3MA 1ADBA 3JQAB 4Z9XA 1GEEA 4L9RA 4Z9YA 2I9PA 1WDKA 3I6IA 4TSKA 3PQFA 3I52A 2JFFA 3UFXA 4IJKA 3VDQA 4K1LA 1DRWA 4BQPA 2PKRA 1YOVA 1CIVA 4FN4A 4WASA 3R3SA 1HDRA 3PJDA 2B35A 1R16A 3K6JA 4ZU3A 2Q49A 1LSUA 3VC7A 2VOEA 4LISA 2GYYA 4DC1A 4N18A 1EK5A 3ZW8A 1C1XB 1EDZA 1HKUA 3EHEA 4HFMA 4OH1A 1RKXA 2C07A 2PFGA 4JJGA 4BO3A 4JQCA 1M75A 4WEOA 4IS3A 4IQGA 5IJZA 4BQRA 1H2HA 5DZSA 4YJHA 5L4NA 2ZTUA 5JBIA 3L0DA 4CLHA 1DLIA 4INAA 5A3JA 1XGKA 3JQDA 5ES3A 3W4JA 4DIFA 1D1TA 1WMAA 4D45A 1GYPA 4FGWA 1UAYA 4OXYA 1EK6A 5A5FA 1GTMA 2IZZA 4M1QA 5CAEA 1XIVA 1Q0LA 4IY1A 5A1TA 1QLHA 2OUIA 1AXGA 3PQDA 5BR7A 1R6DA 4FFLA 5A9SB 2VUSA 4UEJA 4YJFB 1LDMA 1M6WA 1TT5A 1VKNA 4OOEA 4BNMA 1T2DA 4EI2A 2X0IA 3NDIA 2CF6A 4I8XA 1MC4A 1NHGA 2JD2A 4QT0A 2DU8A 3ZNPA 4J2HA 4D3FA 1MFZA 3PGXA 4H15A 1ZUD1 2QHXA 2C7VA 3I3OA 2O2SA 4PG7A 4MVJF 4F6CA 1HZJA 3RUDA 4BO7A 5G0UA 3M2PA 1KY4A 2FSVA 3AU8A 2YV1A 5H82A 2HK9A 1YL5A 3DR3A 4GMFA 3WNQA 1SAYA 1I8TA 3ROQA 2IRWA 2RHCA 4RORA 3DZJA 4HWKA 3WFJA 1KIFA 3WWZA 4E5MA 2IEBA 4QEDA 5AXCA 2YHUA 1ENPA 3DWFA 4EEZA 4HFJA 4GWGA 4GVXA 4DMLA 1G1AA 2W98A 4WE3A 2NACA 5KJFA 2YY7A 5TT1A 4RPLA 1U4SA 1ZMOA 1KERA 2Q1TA 3ZZNA 1XQ6A 4JK3A 1O6ZA 2O4CA 5K0ZA 3Q0EA 4GL4A 3PYMA 3VZPA 1HETA 2VQ3A 4F6LA 5JFOA 3WGOA 1NWHA 2NVWA 4WGGA 2A92A 1LNQA 3OH8A 4FD3A 1P33A 3MZ0A 1ID1A 3BTOA 3B1KA 4LN1A 2Q4BA 1BSVA 3MWDB 2VZ9A 4PLYA 3OIGA 1YGYA 2PGJA 1E7QA 3GZNA 3QVXA 4FFPA 2DUWA 1Z74A 1VLLA 1PR9A 2JHGA 5DULA 3ZGYA 2D5AA 4CL8A 1DC4A 3ZHZA 1LSJA 3WYCA 2Q1SA 3DOJA 2G17A 5JMPA 1UH5A 1D1SA 3V8BA 3HG7A 5HBRA 1N1GA 1GV1A 3CSDA 1ENZA 1HF3A 2PZMA 2GN6A 3PJFA 4GKBA 3VPGA 4MO2A 4E12A 1P1HA 4DLLA 3BHIA 1GEGA 1DIAA 3AUTA 1G0NA 2X5OA 1P3DA 3LF1A 2EJWA 3G3EA 3Q3CA 1K5HA 2W90A 4QQRA 4IM7A 4U6QA 4TMFA 1NXQA 3KB6A 1YE3A 1Z7BA 2E4AA 3OQ1A 3PWKA 4GWKA 1QSGA 1U5AA 1QV6A 4FB5A 4Z0PA 1QV7A 5F1KA 3E6AA 2NM0A 4J4BA 1C0IA 4XYEA 1EFLA 4BMNA 2GN8A 1E7WA 5BSEA 1DB3A 1V6AA 3SC4A 1PGPA 4WCFC 3C1AA 1NQ5A 3K92A 1V35A 3BMQA 3ONEA 1B16A 2G82A 4WKGA 1HXHA 3CZRA 4D44A 4YA6A 4NJMA 1Y5MA 4IDAA 2IE0A 1ONOA 3OIFA 1ARZA 2EEZA 3BTVA 4XJTA 2D3TA 4OQYA 5EESA 1E7SA 1SB9A 5CDSA 4O0LA 1MXHA 1DPGA 1YL6A 2JCVA 1ZKMA 4AJPA 4DLAA 3IAHA 5H83A 1D7OA 5FI3A 4IQ8A 1A5ZA 4YRDA 2JKVA 5CDYA 4NBTA 1WPQA 1IB6A 4GBJA 2NU8A 2BFAA 4D3DA 3KUXA 3RFXA 2R00A 3FR8A 1NX6A 4RVHA 5DBIA 1ZBQA 5A4DA 1OMOA 1XDWA 2JCYA 4NK5A 1SB8A 2WM3A 4WCFB 1LDNA 1WWKA 3GN1A 2VZ8A 3BMOB 2EXXA 4E5YA 1J49A 2J8ZA 2YFHA 2FRDA 2H6EA 1N8KA 2E48A 4WLUA 1LLDA 3QSGA 3HFSA 1O8CA 1AN9A 4IIUA 4Y6SA 1JWAB 5TLSA 2H63A 3BAZA 5DN9A 4W99A 4XEHA 2B69A 3N7UA 5KVQA 2WD7A 4OJNA 4XKJA 3GH3A 1R66A 1LDEA 8LDHA 3KO8A 4HV4A 4U8GA 4YJGA 4BO0A 5KIAA 1GD1O 4CUJA 2H5LA 4KQWA 3LYLA 2ZATA 5FI5A 5IZCC 3HJAA 4PG6A 4QSMA 4HKTA 2V7PA 1I3MA 2IEDA 2ZYGA 4ALIA 3BHJA 4JJFA 6LDHA 1K0UA 2HRBA 1C1XA 3LLSA 4P38A 1T4DA 4UUNA 5JE8A 3WGGA 2DQ4A 3AUSA 1IL0A 1HT0A 3ANNA 4XR4A 4KOAA 1D3AA 2Q4EA 3V1TC 4EUEA 1O94A 3L07A 1SMKA 2W4QA 2VUUA 4YAEA 4A27A 4Y8VA 4TRNA 4URFA 4IQ0A 1XKQA 1E7YA 4TRMA 4TROA 1F8GA 4PN3A 3EY4A 7MDHA 1V3TA 3F6YA 1PGNA 3AOEC 1BVUA 3I4FA 4EITA 2X5KO 4IGEA 4BB6A 3FBTA 1ZNQO 2D4AA 2DTDA 3S1LA 3LZ6A 4GI2A 2PLAA 4JP3A 3PXXA 4BIIA 2IODA 1IHYA 1YB5A 3ULKA 4KMSA 1TLTA 4KUGA 1LRLA 1FDTA 4FGSA 3NDRA 5EIOA 4PLPA 4ZQHA 1WZIA 4LW8A 2GCGA 4D0SA 2OP0A 1OC4A 1PL7A 1U3TA 3CINA 1ISFA 1Y8QB 2O7QA 2WD7B 2X86A 2YHIB 3E18A 3S2GA 1YONA 2IDZA 1V8BA 1HDCA 3MWEB 2FSSA 3ZWVA 1PZEA 4XQEA 4HFRA 3GR6A 3RC2A 1CRWG 2OBNA 2VYVD 3V1UA 4B3IA 1NPDA 4EEXA 1ISJA 4L0QA 2A9FA 4EGFA 3DMYA 1DIHA 1BDBA 1I30A 1E5LA 3E1KA 3ZU2A 3JQ6A 4CUZA 3CE6A 3HQ4O 4B7UA 2C5AA 3GRPA 4E5PA 5A03A 1MXFA 3JSAA 4DYDA 3SBOA 4BNXA 3DHNA 2WEKA 3D4PA 4CM4B 3DO5A 1ZK2A 1PS8A 5TRTA 1XHLA 5JC1A 4RDIA 3BMNB 3KYCB 3T4XA 3U4HA 1RM3A 4NFYA 1U8XX 1PTJA 4YAKA 4YT4A 1JVBA 2Y66A 2EKPA 2UYYA 4K9DA 3KSUA 3A1NA 5CEEA 3DBHB 1EMDA 2J3JA 4MINA 3O8QA 4RZIA 3UICA 4L76A 4CMEA 2GERA 4FFNA 3IQDB 3PIIA 2HK7A 2D1YA 1H6CA 1U8FO 4IDGA 4WOKA 5TNXA 3AUUA 3O4RA 4BO2A 5EN4A 4OGWA 1S7CA 1F0YA 3ROKA 4MIYA 1RJWA 1Y7TA 3FNFA 1HYHA 3GNTA 2EW8A 4ZGWA 1GYQA 1MB4A 3UH1A 2YV3A 2BFMA 3RUIA 5CHEA 5A05A 2VYNA 1SC6A 3MJVA 3MOGA 1JW9B 4XA8A 3RUHA 2NVBA 4CM8A 3UF0A 4PG8A 1F14A 5T67A 2HMVA 2PH5A 2DLDA 4WK6A 1XU9A 3TRIA 1ZSYA 4M89A 2O23A 4M8SA 4BNUA 3V2GA 3NAQA 4GAEA 5CPFA 1N92A 1B8UA 4R1UA 3WG9A 1V9LA 2GZ3A 3MJEA 4JNKA 5K6AC 2PK3A 3H9GA 3UCEA 3OA2A 3DHYA 5THKA 1N9GA 2Q2VA 3GVHA 1KS9A 1ZVMA 1GUYA 1XWFA 2NLOA 5HM8A 4CM4A 1DJQA 2ZTLA 3JYPA 3H9QA 2W2LD 1E77A 4O5OA 5HRUA 3P5SA 3OM9A 1YBVA 2RBEA 2I6TA 5U4QA 2VTDA 4YXFA 5C7LO 5L45A 3X2EA 3RKUA 5CG2A 2HMSA 4GGOA 4RPKA 2ZTVA 1VPDA 4YR9A 4GX2A 3U4CA 1I3NA 3A28A 5KKCA 1EE9A 4GSLA 4HXYA 4TWRA 3GAZA 3WYEA 4QFCA 3VH1A 4O6VA 4AJ1A 3D64A 3ANMA 4L74A 4NPCA 4WLVA 1BW9B 3DZFA 4Q39A 4Q9NA 1T26A 1YBMA 2ET6A 4TRRA 3WX0A 1Q7GA 5BSHA 1E3JA 3U9LA 3ZNOA 1VE9A 3CKYA 4ZN6A 1I5RA 2HMWA 3OJ0A 3D5QA 2Y1GA 4XZ3A 3DZKA 2P5UA 3W8EA 4BNGA 1EBFA 1VL6A 5G4KB 1YH3A 1PGJA 3LT2A 3I83A 1KEWA 3GT0A 4NBRA 2ZYAA 1C3VA 2YV2A 4CMHA 3IJPA 2X4GA 3OJEA 2HCTA 2DM6A 2VHVA 2ZB7A 1HYEA 4UUOA 3TZCA 2BH9A 4YB8A 4W6ZA 2H9IA 1V3VA 1W4ZA 4CM1A 3AK4A 3GMSA 3EW7A 5DP1A 5CDTA 1M76A 4IMRA 1Y6JA 3W6ZA 3PHJA 3SLGA 3QWFA 3CUKA 3ITDA 3VPSA 5BT9A 1XCBA 1E3IA 1ADFA 3A06A 1PJSA 1E6UA 2O7SA 3JD3A 1PJLA 3BA1A 3IJRA 4ZRMA 1YDWA 3BMCB 3F4LA 2NQTA 5IF3A 3S2IA 4AFNA 1NR7A 3KXDA 1P44A 2BGLA 4B8WA 3FWZA 5I7SA 4P4LA 1I33A 4ZHSA 5L95A 4BO6A 3TL2A 3OICA 2IYPA 4N54A 5DDIP 4MJLA 4BKRA 2UDPA 2CNBA 3BHMA 3PHLA 5TT0A 2ZB4A 3R6DA 3I6QA 4UVEA 4OSPA 4B4WA 4ZQBA 3M6IA 3PK0A 1H9BA 4E2WA 4YQZA 1UDBA 3WTCA 1DEHA 2AQ8A 2GLXA 1U3VA 2W8ZA 2XXBA 3SEFA 1Q2XA 2I67A 2YW9A 4PG5A 1YVEI 5JMWA 4ZJUA 2YDYA 4FOSA 2ZJ0A 1E3WB 4F46A 3TDKA 1KY5A 4JROA 4IDCA 1EUZA 1YJQA 3I9NA 4D79A 5BNFA 2X9GA 3L4BC 2V6GA 1OBFO 5T6BA 1PJ2A 2EV9A 4FC6A 1M6HA 3WBFA 3NT2A 1JKIA 1NP3A 4NHEA 1N1EA 1EEHA 3GPDG 3GDOA 4IDDA 3GQVA 4OQZA 1DLJA 2HLPA 2GPTA 2Y1EA 1GQYA 4P22A 3RAJA 5AXAA 2Y0DA 1BG6A 1E1LA 3JD2A 1BGVA 4N5LA 4WLEA 1JQBA 4GX5A 3K9QO 3RUFA 1OFGA 3DBLB 3DFZA 2CZCA 3GC6A 3W4KA 1T2AA 3HE3A 1DRUA 1R4NB 1K89A 4BKUA 3R3JA 2A94A 1BXGA 4ND5A 5BQFA 1ZJZA 4A26A 5EQDA 4EUHA 1X1TA 1W0CA 3K96A 5DCWA 4WPGA 4A03A 5KJEA 3ETEA 1LSSA 4N5MA 1PJBA 1LDYA 3IC5A 3CH6A 4LCEA 4Z3KA 1FXSA 2V6FA 1U7HA 2HSDA 4E13A 3M2TA 5DCYA 1QYVA 1KC3A 3L9WA 4MPDA 3U49A 2EP7A 2BKAA 1WMBA 4BNYA 5A9SA 1J6UA 2BGMA 2Q1UA 3BMNA 5IDWA 1R4MA 3L6EA 1PL6A 2VYND 3H9JA 4AJLA 4J90A 1DFGA 3IUSA 3PJGA 3GEGA 3UOGA 1YQDA 4HNHA 1Y1PA 3LVFO 1ONNA 1DC5A 2VTEA 2X7HA 2B37A 3NX4A 3G1TA 1LU9A 2PZLA 3QVSA 4GPD1 4EDFA 4CM5A 5TSDA 5IXYA 3GNSA 2X0JA 4BKOA 4WEQA 1IZ0A 3KLMX 3GVIA 5U1PA 3AI2A 1GU7A 4DIBA 5KKAA 2ZK7A 1TEHA 4ZA2A 4UVHA 1ZSVA 4ESOA 5CFZA 4BMVA 1DXYA 3OJLA 2GRAA 1LEHA 2GUGA 3O38A 4J7XA 4BGUA 5DOVA 1X7GA 1I32A 4AJ4A 2TMDA 2YFQA 4CLDA 2X58A 4ROSA 1LLUA 1Z7EA 4ZQEA 4MVJH 1UP6A 2WE7A 1HE5A 1MV8A 1ZO8A 4W7IA 4XYLA 1RYEA 2Y1FA 1DO8A 4FFRA 4R3WA 5I8ZA 5DOZA 3DC2A 1VJTA 3RBXA 2GD1O 5HWSA 1ZCJA 2TMGA 1PZHA 1P74A 3PYLA 1B7GO 2NNLD 3VVBA 5G4KA 2BF7A 4JBGA 1R4MB 3IDSA 2CVZA 1E7RA 1O89A 3GGPA 3IKVA 3GLQA 3HB4X 4OO3A 1W8DA 4E30A 4BOYA 3ZDFA 3GUYA 4FR5A 1IOLA 5GY7A 3GMDA 2YHIA 2DAPA 4YT5A 5L9AA 4J43A 2Q2WA 1XEAA 1RM4A 4IIVA 3DFUA 1GDHA 2PGLA 2IYOA 2O4UX 4BMSA 3AI1A 2WYUA 4FBGA 1B0AA 3O26A 3WSVA 2RHRA 5HTOA 1Q0HA 4BNFA 2AQIA 1U7TA 3MJCA 5IFLA 3I9JA 3G0OA 1IZ9A 1N5DA 1ORRA 3RBZA 3WGQA 1PGOA 1O0SA 2PKQP 4RLSA 3GK3A 3HDJA 5EPOA 5JAZA 3ZCXA 2Y99A 3DZHA 2YUTA 1V0JA 5I9NA 1Z75A 3E48A 4OIMA 5FEUA 3QIVA 3JQBA 1A7AA 1H5QA 4FQ8A 4XB1A 5KJCA 1T2EA 4PLHA 1GCOA 4CMCA 3PTZA 3EDMA 2P4QA 3KEOA 4CMBA 3RROA 2QIOA 3WYBA 2EJVA 5JDCC 4KP7A 1EFKA 3OQ6A 1FDWA 3DAFA 2B4RO 3D3WB 4NBVA 5IN5A 5F21A 1MX3A 3TNLA 5A9TA 5I7EA 3JQFA 3PHHA 2RH8A 5COQA 5KVSA 1VJ0A 3LSYA 1UXKA 3FF4A 1ULSA 4JBIA 1DC3A 1EE2A 3FHLA 3JQ8A 3EGOA 5TX7A 3ONFA 3DBHA 5IZ4A 1BHSA 5C7IO 4JCOA 4Z3DA 4CMIB 5DNAA 2Q45A 4TZKA 3PIDA 3ZHYA 4JX8A 5KTKA 3W8FA 1A4IA 3G79A 5LCXA 1QRRA 2B4TO 3ZWXA 4YAIA 1XYGA 2VRCA 1C1DA 2DKNA 3PZBA 4NJOA 5TGDA 4BGIA 3SX2A 4UUMA 2YDXA 3C8MA 2P9EA 1DDOA 3RIHA 1D8AA 5TQVA 4PVDA 2Y67A 1RWBA 4I08A 5G2OA 1UZLA 1GUFA 4ALLA 2CMDA 3AJRA 3GG2A 4BGEA 2VOJA 1NQAO 1DJNA 4L4RA 1Y9EA 5C7OO 1UXGA 2J5QA 4WLNA 4PLFA 1FK8A 4BNVA 1B2LA 6ADHA 3MJ4A 4R51A 1B3RA 1DFIA 3JQ9A 2HUNA 3ZWNA 1I2ZA 2Q99A 3OHSX 3VH4A 2ZKLA 3HWRA 3P2OA 4IZIA 2VT3A 3UKOA 4CR8A 1E3EA 4CJXA 1U2GA 2QZZA 1J0XO 4Z9FA 3DZBA 1GPDG 2BELA 4XRRA 3V1YA 5JYDA 4E33A 2QW8A 1NASA 5F5NA 2VHWA 2C20A 4J1QA 3OBBA 3IS3A 4K6FA 1T2FA 3F9IA 3U3XA 3ZV4A 4JN6B 3UCXA 1MGOA 4PZDA 5LC1A 5JXWA 4JLWA 3QV1A 2FZWA 4LMPA 3EC7A 1HYGA 1ISMA 2X22A 3JV7A 5DF1A 3WGZA 1Y9AA 4G2NA 3C24A 1IHXA 5A06A 2V6BA 1EQ2A 1NPTO 4PLWA 1D4FA 3ZN2A 4MP6A 1P1FA 1E6WA 1PS0A 5G0WA 2B4QA 3UCFA 4A73A 2C2XA 2HAEA 4IJVA 5A9RA 3IOYA 1B15A 3WGHA 3I9LA 1BW9A 3KM0A 3LC2O 3DZIA 4XYMA 3P2YA 2I3AA 1L7DA 5GZ3A 3QA9A 1WAMA 4MVJM 3VH2A 2NU7A 2C29D 2PD3A 2PNFA 4D3SA 1HDYA 1A9YA 1PEDA 2I99A 3ENKA 1YB1A 4H16A 1PWXA 3SXPA 4GSKA 1UXJA 1NBOA 5COBA 1YQXA 4HP8A 2VT2A 2VWPA 1QYDA 3JQFC 2PZKA 4FS3A 4CMEC 5THQA 1JDJA 4WNCA 2RCYA 3EAGA 2ZQZA 2F1KA 3HN2A 2V6MA 4O63O 2Y68A 4JBHA 2AG5A 1RM0A 3PDUA 2I3GA 3NT4A 2P9CA 4Q3AA 2R6JA 3KZVA 3H3FA 4B4UA 3MOIA 2HO5A 3COSA 4DPKA 3ASVA 4DBVO 3TOZA 3H8VA 3B70A 3GEMA 1AE1A 3JTMA 4QUKA 4R01A 4G5HA 4PZCA 4E31A 1X14A 5L53A 3NGXA 3NJ4A 1J4AA 3GDFA 1X0XA 1KYQA 4M49A 4J4TA 1TVEA 5KWEA 4B4OA 4ID9A 2CDCA 1KVSA 1GZ3A 3C7DB 3HFGA 5I7FA 1HDOA 2JJYA 5ER9A 1KVUA 2CF5A 2O3QA 3PLRA 1NYTA 1JU9A 3EZLA 2O3TA 2BFOA 4CM9A 4JXKA 1AUPA 2CVQA 1ZK3A 1E0DA 1K2WA 4YT2A 5JLAA 3UW3A 4ND3A 4PLZA 3FPLA 2FMUA 5FYDA 1C14A 3TFQA 1LXCA 1GAEO 4BV9A 2J5RA 9LDTA 1GZ4A 2B36A 3RKRA 2C5EA 4XDZA 5JYEA 2JCXA 1ZMTA 1Y5RA 1TT5B 2UAGA 5TJ9A 3DBRB 3QWBA 4DL9A 4IXWA 3TWOA 4FJ0A 5CPBA 1R15A 5JAMA 1Y81A 4D0RA 1VL0A 1FJHA 1SEVA 2LDXA 4U0KA 4HX5A 1T1RA 2FPIA 1I10A 1X7DA 1I3KA 4J91A 3VKVA 1VSUA 3H5AA 3KHUA 4NZ9A 1M2WA 3PI7A 4KDEA 4M86A 1CWUA 1YBAA 1VRWA 3GHYA 1L1FA 4Z0HO 4EBFA 2PZJA 2OL4A 2EW2A 1JWBB 4OSOA 5A5EA 5B4TA 4NU6A 4PLGA 3RUCA 4J6FA 3QHAA 3F3SA 3AY3A 1P1RA 1SPXA 2QZ9A 4FFMA 3DOCA 4ND4A 4Y9DA 3JQEA 4ND1A 5BSGA 2BMAA 3LU1A 4MKZA 1DAOA 3QP9A 4CLXA 1GCUA 1LI4A 1EUDA 2OMEA 1Z82A 5CG1A 1DFHA 4CQLB 1CQIA 3VPFA 5KCZA 2SCUA 1TXGA 1H6DA 2XOXA 2Y93A 2IXBA 3OETA 4L4SA 2Y0CA 3ROPA 3ZWOA 4DQXA 2PR2A 3SC6A 3RJ9A 1DSSG 2DTXA 4AJKA 2Q2QA 2HJSA 1I24A 4YJHB 3KBOA 1FDUA 3OIDA 3VPHA 3L6OO 2EWMA 5ITWA 1AXEA 5CP8A 4YRBA 4W7HA 3WOHA 3AFMA 4QO7A 3GF4A 1XLTA 2P68A 1I2BA 2X5JO 4WOJA 1MG0A 3I4CA 4QFDA 3ZV3A 4AJNA 1FF9A 1P77A 2X0NA 3DDNA 5IN4A 5H81A 2ZB3A 4UULA 3T7CA 5IAAA 5HS6A 3E9NA 1C0PA 1ZW1A 3ETGA 3K5PA 4K26A 3TZ6A 3L6DA 3KRTA 1VSVA 2B5VA 4FPXA 5GZ6A 3TFOA 2FOIA 4DLBA 4UREA 1G0OA 3ZWPA 3K2EA 4FIZA 4EUFA 1ZXBA 5K6AA 1LJ8A 2X8LA 3WXBA 2IXAA 2AW5A 2B0JA 5FWNA 4FJ2A 2OZPA 3ZWCA 5CEFA 1LDBA 3FN4A 4OMUA 2JD0A 1LBEA 4E5NA 1PJCA 1SOWA 1F06A 3OSUA 4LGVA 2E49A 3RVDA 3HB5X 2HQ1A 1RYDA 3PVZA 4WLOA 1AHHA 1F8FA 4RDHA 3GAFA 4JJIA 4U0JA 3S55A 4J7CA 1QXSA 2GZ1A 2Y1CA 3STHA 2D8AA 1DHTA 3TZKA 1UR5A 2GO1A 1ULUA 3ANLA 2C54A 5G0SA 3ROMA 2OFPA 3BZUA 4IDEA 3JQAA 5ILGA 1YL7A 2O2YA 4FC7A 4IJUA 2DVMA 2Q46A 2GGSA 3K30A 1GZ6A 3KVOA 3LT4A 3NTQA 3C7AA 1YDEA 4NU5A 3C1OA 4FDAA 2OOSA 3JQCA 4HFNA 1B26A 2OGUA 4B79A 1SOVA 3QW2A 2Q50A 3EVTA 5C37A 5T57A 3UUWA 3WJAA 1HSZA 4B3HA 3DAGA 3PWSA 3IP3A 2VN8A 4HUJA 3ST7A 4CMGA 2GDZA 4EYEA 3IP1A 3EVNA 2RAFA 4QTZA 3H4VA 1NAIA 3WQSB 4RCVA 2R2GA 3W6UA 1SCUA 1GADO 3L9XA 4MKXA 5BSFA 1ENOA 4K28A 5JC8A 2VNAA 4J1TA 3RUEA 2ZCUA 3KETA 1JVSA 1UXHA 1ZK0A 3GEDA 3WLEA 3MJTA 3RFTA 1FDSA 1NPYA 2X0RA 3W4IA 5B4UA 2PGDA 3B20A 5JDIC 3GVPA 2QRLA 3ZWBA 3I23A 4OXKA 2DBZA 4I5EA 4A0SA 3ZWWA 3C85A 1ADGA 3VTZA 4DC0A 4J9VA 1JKFA 3ZNQA 4W82A 1CDOA 3W1VA 3JQ9C 2VCYA 3WICA 3RCBA 2PD6A 3WGTA 3RQSA 1BXZA 3ZHBA 4BB5A 4E6PA 3GY0A 4U5QA 4C7JA 4LK3A 1O9BA 2BD0A 4PLCA 3TSCA 2CDAA 4R69A 9LDBA 2E37A 2CUKA 4G81A 4UEKA 4CR7A 1Y8RB 3EK2A 3VZSA 1NWCA 3FRJA 3RSHA 2OBYA 1OOEA 1Q1NA 4HADA 3F5SA 4CMIA 2O3SA 3GZ4A 2IZ0A 5DCUA 1U4OA 3PHGA 4W9NA 4CM7A 2DBRA 1WP4A 4MIOA 3F46A 1ZXLA 4YEDA 1UP7A 2HDHA 3C3XA 3GPIA 4CM9D 4BNKA 3RC9A 2VWGA 4FCCA 5TF4A 4XD2A 4BO5A 3FPCA 1DC6A 3GDGA 1C1DB 1I0ZA 2FR0A 4NJMB 5K9ZA 1ISHA 1XG5A 3T7EA 2G0TA 1UDCA 1MUUA 2E6UX 4I5DA 4YVFA 2WSBA 4J49A 3ICCA 3D5TA 4JP2A 4U7WA 2EP5A 1HLDA 1E92A 2X9NA 5JW6A 1XQ1A 3TL3A 4R5HA 4CQLA 2VRBA 5EL0A 1T24A 3F47A 3NTOA 4ALJA 3JQGB 1PIWA 1F17A 3LLVA 5J23A 3TJRA 1LC0A 4JIGA 3O03A 1A71A 4LMRA 2O3UA 2G1UA 3ITKA 4UVIA 4CMKA 1LUAA 4CLOB 3A4VA 5F1PA 3WTBA 3AM5A 1H94A 4RQTA 5U9CA 3BMOA 2XAAA 1GUZA 1B8VA 2NTVA 1E1MA 3WDSA 2PKQO 3EYWA 1PR3A 1WDLA 1LX6A 3OQBA 3MTGA 1IYZA 1XR3A 1NHWA 3OECA 1UP4A 4MIEA 5AOVA 4CV0A 3MEQA 2F00A 4MVJP 2W2KB 1LRJA 4WCDA 3LK7A 4J1NA 2VWHA 2OXIA 2FPGA 3JQ7B 4YT8A 1TI7A 4KWHA 4HBGA 4XGKA 1WLYA 1NNUA 5T64A 4BHTA 3GRKA 1U2DA 1P1IA 1ZZEA 4YAGA 3KYDA 1CYDA 3L4SO 2DBQA 2IZ1A 4AJJA 2JAPA 5F5LA 5JCXA 4AJHA 4ALMA 1IY8A 1HDZA 4NH4A 3VHRA 1NR1A 4BO4A 4B3JA 2PV7A 4CODB 4CUKA 3WIDA 2BI8A 1QP8A 4DQVA 3JYOA 4CPDA 4RV9A 4R1NA 3ZI0A 4E21A 2V65A 4CMJA 2CFCA 3N74A 3DXFA 4C7KA 3FCOA 1PWZA 4MKRA 4ZVVA 3MCVA 5EMHA 3DMTA 1E6EA 4NDNE 2J3HA 4BL5A 3H6KA 3OA0A 2NSDA 3LC7O 3EZYA 4DQUA 1WNTA 2NVUA 3Q11A 4OHUA 2EF1A 1KBZA 3PWZA 2E82A 2AEFA 1N7GA 1ZK4A 3WQRA 3KLPX 3E82A 3GNQA 2GN4A 3KEQA 2GN9A 4S3MA 1B3BA 2Z1NA 1N2SA 5AYVA 4MVJA 4BS9A 1FDVA 1LLCA 1P9LA 1E1KA 4CM3A 3I9KA 3DQPA 3OEYA 4DIOA 1R0KA 5T8KC 4B7CA 3DBLA 3WMXA 1JKJA 1QORA 1LRKA 2BHLA 3RBVA 2WMDA 2PH3A 2WJPA 4AJOA 4BNLA 4BV8A 4DMMA 1YWGO 4Q3CA 2J5KA 1CETA 1H6AA 3WQQA 5ITVA 3DZGA 3UAGA 3AU9A 1QG6A 3I1JA 1U3UA 4ZQFA 3S8MA 1PX0A 4WLFA 4WCFA 1LLQA 2G76A 4XQGA 5G4LA 5JY6A 4OXNA 1P0CA 3TQHA 1OAAA 3Q9NA 3AWDA 3AI3A 3NUGA 2GZ2A 5GMOA 5KJ6A 3WGYA 5ICMA 4D42A 4GGPA 2OHXA 3ORFA 5L4LA 1PQPA 4R68A 3NKLA 3DTYA 3PLNA 3U62A 1C0KA 1NFRA 5JNLA 1XA0A 3OEWA 3LDHA 5JSFA 1Z6ZA 1NQTA 4YACA 2I5PO 3DBVO 2CDBA 4CV3A 1XU7A 2HRZA 1QMGA 2QQ5A 3Q9UA 1H9AA 4J0EA 4IBOA 4BKQA 3Q2KA 1LA2A 3NYWA 4OL9A 3BTSA 4JGBA 2HMTA 1T4BA 3NGLA 3KTDA 1X15A 1EBUA 1HE4A 1DRVA 1IPEA 4G65A 3SJ7A 5KJ1A 4Y6RA 1EVZA 1HE3A 3LT1A 1ZEMA 2POQX 4I9UA 2BFPA 1YB4A 3Q1LA 1PQWA 2CD9A 5L7YA 3JCZA 3H2ZA 4PCVA 5A04A 2G5CA 2NTJA 5F3RA 4AVYA 4BKPA 5I8WA 3WWYA 3OJOA 1YQGA 3PP8A 3OFSA 5JS6A 3TOXA 4BGVA
chains in the Genus database with same CATH superfamily
2I6GA 1ILEA 1W29A 2R9VA 3HKBA 1Z2CA 5L3SA 5D3ZA 1M6EX 3AYZB 3GP3A 2V5UA 2HT6A 1AHIA 1W25A 2Q9CA 4QQNA 2WHRA 4R7TA 3W6PA 3A1TA 2FW1A 3TKYA 1N3BA 1SC4A 4NTZA 4UQLA 3B1FA 4J2TA 4N0DA 3RI3A 1J00A 1B8PA 4UZEA 4WW0A 4A5OA 4PQYA 1FNSA 1LQTA 2NTEA 2HIAA 4MV9A 4XPZA 3RT1A 3L93A 3GA0A 4PICA 3EH1A 4RHXA 4TLDA 1KDZA 3OOWA 1US8B 4J76A 4PRYA 4CTKA 4D41A 5ICSA 1H2YA 1VZ3A 1Y6QA 2HF9A 4I8DA 1FYVA 2IEYA 1L5WA 3PEEA 1YRBA 3AX6A 2IU3A 2VJKA 4BFXA 1DP4A 1VP9A 4RF5A 3VUEA 2IW3A 1P8JA 2AK3A 4B2YA 4IXDA 1HH4A 3A6ZA 1ZM7A 4ZMRA 5AJHA 2AN9A 5KQLA 3CT6A 4NBLA 3UT6A 4W1PA 3ZD9A 7ADHA 4B73A 4X84A 1CU1A 3CCCA 5G40A 3ZH9B 1NW6A 1JR4A 4YMGA 2BFBA 5JAIA 2YXEA 5EQFA 2E55A 4TLMB 3OZVA 5AW6A 2ZQYA 4K9MA 1VOTA 1XZAA 4FZVA 4KXQA 5FDFA 4F84A 3FWPA 2VTKA 2O8DB 3NOXA 4LRYA 3R1IA 4GP9A 1YQ9A 1KFBB 4KFRA 3THYA 4R9RA 4F9FA 4DCNA 5C7OO 1ECPA 3LPAA 2PZ8A 4Y6LA 3M3HA 1RM5A 5AHRA 1EVIA 4NOJA 4IHJB 3H3XA 4M55A 1OVMA 2WUFA 1C0LA 1PK9A 1PL0A 2CDNA 1UPTA 2A3NA 3QXXA 1PS9A 3HGMA 4Q02A 1CY6A 3AR8A 4WNAB 3RYCA 3SFVA 4WUVA 4DDTA 1HX7A 1CF9A 3BCUA 3U7JA 5LJLA 3IKTA 3O8OA 5A6SB 3VTFA 3UXYA 1G20A 1JEDA 2Q5QA 2RHWA 3ELDA 4RFLA 4EG7A 1I7PA 4M8KA 4Z54A 1VG9B 1IJKA 2MSEB 4N5NA 4X8MA 1T0JB 4CIWA 3WA6A 5LLDA 4WOCA 2O8CA 4P58A 5M34A 2WPNA 4RJTA 1VLVA 1FY2A 3I6ZA 2J0SA 4AUKA 2ZWAA 3VR0A 2R85A 3RSGA 1JSZA 1NC3A 1WUTA 2CNDA 3I9V6 4HMQA 4EQ6A 1GR0A 2ZSJA 4HX9A 1H2EA 2F59A 3GBVA 4FUTA 4LDAA 1OH6A 2C99A 2AN1A 1Z0DA 4IXTA 4UUAA 2PS0A 5DYYA 1H2BA 3ZJUA 5LU8A 3TR6A 2A0WA 1X13A 4EOGA 3GO4A 4U2DA 5BR1A 3K73O 1KZ1A 2BYTA 2XWJI 4UNQA 4H7PA 4A0QA 3SDBA 2YJNA 3MQ2A 3TQIA 3N8NA 5HF9A 1K5GA 1X7XB 4EPRA 5ALMA 3A9VA 4JITA 4J2OA 4OKNA 1YVUA 4NICA 4MPRA 4ZOLB 3SLKA 2XXJA 3A3OA 4B71A 4BZQA 3T5AA 2XUPA 3K0FA 2EX0A 3UAWA 2C8JA 4CIYA 1GKUB 2GXQA 3PRKE 3SOPA 1CQIB 1QYXA 1XZQA 3PDCA 4J0JA 4B83A 1KEZA 5JBNA 5MGNA 1DCMA 1ONSA 2XCQA 4MMXB 3WK6A 3GLGB 2ID7A 4KQ9A 1R8QA 4G8CA 2ZJYA 2NT3A 5MN6A 1T13A 4J0QA 2QV0A 4II3A 4TYNA 4MJ7A 4M0MA 3RIGA 1PJQA 4LY9A 4QPNA 5JROA 2BH2A 4KVAA 4CIBA 3V8PA 1FS6A 2OD2A 4BX3A 2ZYIA 2BMVA 3VH3A 2H4JA 4U7PB 3ROTA 4ZVMA 2PMDA 2BDTA 3VYVA 3ABRB 1JV2B 4L5AA 3GMTA 3NC1C 4Q1BA 2M6KA 4IYJA 4JLPA 5H59A 5CBPB 1DXOA 2QJOA 1J8YF 3SXUB 2XAUA 5C1BA 3QKRA 3QX8A 1OZ0A 1R6AA 1U0OC 3CKLA 3QVKA 4DA4A 4BP9A 3T5GA 2AX3A 1WDWB 2DPYA 1CJBA 1F9EA 3A2KA 2VSOA 5CIWA 3EDRA 1YMQA 4EHHA 1G20B 2OB1A 1LLFA 4GBED 4KPGA 4ZQCB 4RULA 1DKMA 3GLTA 4IDBA 3JR7A 5EZYB 5LD2C 4MXDA 3H5TA 3U80A 1OF1A 4AUNA 1H22A 5KYYB 2RJNA 4RJJA 1OFVA 3RG2A 3A25A 2BW0A 3PDHA 2B30A 3Q2IA 1UBJS 2CN1A 3CUEF 4C30A 3WGIA 3JVVA 4RPJA 3WNVA 4FHFA 5EIBC 1J5PA 3ESAA 4AJ2A 1EVYA 4IWYA 3IEIA 4GX1A 4NMHA 2FPOA 3PE3A 1OWMA 3E7PA 4O1MA 1CUYA 1P1JA 4YECA 1ZIXA 5D6OA 4B3BA 1DWQA 1YKFA 1X7HA 3TTSA 4DJDC 2J3QA 4L0MA 3H19A 4PLTA 1J0BA 4Q3LA 2PYDA 1ZJ6A 4BMCA 4LRSB 1I1QB 5BMVF 1SU6A 4KR6A 1RWQA 1FPQA 4EGCB 1EX9A 5LYJF 2XQGA 3BB1A 2WLTA 3R0IA 1EKXA 1QVVA 5T4EA 2JARA 1R4NA 4D99A 2ZUFA 1GGKA 2YJZA 2DFTA 2BY4A 3EA0A 4OQMA 4L22A 4ZYWA 4M6WB 1QQTA 2FG7C 3O4VA 1BJTA 4ZOBA 2CC2A 1DJLA 4FIDA 1XLVA 3ADOA 4HSGA 2FWBA 3LO5A 3WBBA 4RK0A 3CEAA 1YXMA 3D7LA 5JG7A 3L0SA 1NV8A 2J9FA 3GVCA 3PQ3A 4EY7A 2B92A 2K7ZA 3ORRA 3BMQB 3PKJA 4QX6A 5HIAA 3CEMA 4AY6A 3ECCA 4KLZA 2QD1A 2DPHA 3IQGX 2ATVA 2GPBA 3AC0A 3PFFA 3V32A 4GVLA 2FMFA 4E3WA 2JFWA 4RAQA 1K6IA 2Z4RA 3TSAA 1KBOA 3D7KA 3WAGA 1ZN7A 2P9QA 3VR6A 2PX5A 2JNWA 1Y9JA 2W2PA 3B60A 3WIUA 4NAUA 4U9HS 7REQB 1PDOA 1WQ4A 3QY9A 4IVQA 5JTUA 1XTZA 3VKUA 5C8ZA 2Y05A 2QP4A 2XT9A 1UBSB 1PU2A 4ZU1X 3ZY4A 5JMOA 5JWRA 4QGHA 1PCXA 1EHCA 3WISA 3KQPA 5BR4A 2IXTA 3RS9A 3GFRA 2E5LB 5DXJA 3TE6A 2EFGA 1VGQA 3F6RA 4KWEA 4AJEA 5FWXA 1U5CA 1ISPA 4LF4B 4HNGA 4ZTUB 4QJ3A 3IL2A 4CFSA 1D0VA 2Q3HA 3C70A 3A9WA 2CL6X 4E2FA 3DONA 1FZQA 4ZJPA 1DTEA 4PRKA 4PTZA 3GYGA 3FNHA 4EJSB 1TT7A 1ABBA 1V11A 1QP7A 2BFDA 1P29A 3GCGA 2C95A 2X23A 1WMEA 1ONPA 4IIJA 4DOMA 1JNYA 2XWPA 3HVIA 3ET4A 5AJZA 5J40A 4XYGA 3IURA 3BREA 3KYBA 3QU9A 2C2WA 4RO0A 4XGQA 3RD5A 2HYIC 5HIKA 2XH8A 2XA2A 3F78A 4BE9A 2RGDA 3QE9Y 2GOYA 2TMYA 4US2R 3BTUA 1Y1QA 2R6HA 3TECE 2G4VA 4LCJA 1XK6A 5E8JA 2YXLA 4LSWA 3PFWO 2DZDA 1F0KA 4XIYA 4CLEA 3ZCRA 3F98A 2DPGA 3QFCA 4BQQA 5BWBA 4KREA 2VDMB 1P9OA 3D6TB 1QGYA 2DFNA 2MSKA 2OFWA 1TM2A 2AOXA 1YR3A 1K1EA 4DCVA 4HVCA 3FHJA 2P2SA 1FBTA 1ZNWA 1FTWA 3IUJA 4AZ3A 2ZIEA 1HQDA 2XQFA 3B6ZA 3FDJA 2JEYA 3OJXA 4IO1A 2D5CA 1TTPB 2BKUA 2MYNA 3R5XA 1UWVA 3INTA 4HHEA 1N5OX 3DHVA 4IZOA 4O59O 1OZAA 4DDUA 2YQ4A 1DWUA 1WULS 3CMMA 4JQZA 4O4JB 3FFAA 4TVKA 4V39A 4HATA 2R96A 3O93A 4DEYA 3G0BA 3RHFA 3RBAA 3AM4A 4M1YA 1AJEA 4BNNA 1SK8A 3Q8MA 3VVCA 3ZIAD 2I7CA 3UQZA 3D0OA 4RLHA 4EPTA 2BGKA 3H1TA 1R8YA 4OHWA 2OPHA 3TOVA 3VQTA 1R3UA 2DJ5A 3ZY5A 2NUAA 2VTBB 1N32B 1Z28A 1ZWKA 2YMQA 4GRIA 1ABFA 1SG0A 5HJ5A 1YK0A 4RETA 2WAAA 3H7AA 1TRKA 3PUKA 4ZAXA 1EIZA 1UKZA 1ZGHA 3HR7A 3ZZ0A 4UM9B 2VYCA 5IXSA 2E6KA 1EFDN 1RPJA 4FHCA 3OIWA 3AW9A 1M72A 2RIRA 2J85A 3GJZA 4OHXA 4R1SA 4Z4FA 1SFRA 1XZJA 1V48A 1J2JA 1W2HA 3BERA 2XMBA 3PRJA 1Q19A 3TQCA 4JI0B 2J45A 4YCAA 1KOGA 4TMKA 5ETJA 4A6XA 3DLAA 2B21A 4HLUA 1MKYA 4EG6A 4G1BA 3GT3A 1EFTA 2QRJA 3EPPA 1CULC 3PENA 5LDGA 1EB8A 2BBSA 5DBOA 2AUNA 2HGZA 5JQGB 5HQTA 4NSNA 4DJAA 4AZWA 1A2OA 4YP7A 1R8JA 2HA3A 2Q4TA 1U1FA 4PXAA 1G9SA 3ROGA 1XX6A 4W8GA 2H4YA 4KUEA 4CIAA 4TTRA 4CR6A 4HNRA 3Q6NA 1FU4A 2Q29A 2HJRA 3EXFA 3BK2A 3MGAA 4CI0B 4CQMA 3L77A 4MDEA 3BEDA 3UJ6A 2OENG 5EMJA 3K8ZA 3VYRB 4EFDA 4I5GA 4R1QA 3AMVA 5FA8A 3V80A 3MTJA 1J8QA 1ZGCA 2HA4A 3ZVLA 5GOZA 1T0PA 1CK4A 1MO2A 3KDSE 1M73E 1SKAA 2Y0EA 4NIMA 4Z6KA 1QGED 4NBWA 5AWFC 1A9SA 2H0RA 1J0DA 4RCZA 3L8DA 1UPAA 4MKGA 1TD1A 1HNNA 2O1XA 1BQ3A 2MU1A 3N9IA 4XR9A 5HG0A 1PW5A 2B8NA 2GM9A 1HC7A 2BGWA 1R0SA 1KO7A 1YUMA 2XRFA 3DEHA 2DBVO 5B7QA 4A0FA 2ZIZA 2AT1A 1RAAA 3I5XA 5LMNB 3BWEA 4K3VA 4MWGA 4KPFC 2HK8A 3AM3A 4XYBA 4MUIA 3C3PA 3VM6A 3WMWA 2JLBA 2YQZA 1R1DA 4ICIA 3ZGLA 1IN4A 2W4MA 1WCV1 5C1OA 3PJEA 1OB5A 4XDYA 5YASA 3BT7A 3BMXA 3LJKA 4WNYA 1KARA 2PWZA 1Q0ZA 2IHUA 3PD7A 4UTPA 3OTHA 4ZVQA 3RYFA 3FNBA 3X2FA 1B6SA 4CCAA 1FP4A 3K4HA 4L0CA 3KU4A 5CJ2A 4OKSA 1LPSA 3J81k 2OZLA 5HQ3A 1H23A 1HDXA 5J2UA 1WB4A 3U3MA 3ZV3A 2XTJA 1UAGA 3BH7A 3KHSA 3PZRA 4X61A 2MTBA 1PE0A 4H60A 4BUCA 4YN3A 4CQMD 3PFBA 1DAEA 1FXWA 2IHBA 2ZANA 1TU3A 2DCMA 2PD4A 2P90A 4XGIA 4FN5A 1E6KA 1U2TA 4R3UC 1SEPA 1GL6A 1SQ6A 5FOUA 5C2JB 3REGA 5L3VA 5CX4A 4F86A 3U1BA 1CJCA 5IKOA 4C2TA 3AHEA 5JD4A 2WYOA 4MP3A 2J3KA 2R68A 1DIBA 4I1PA 2W2NA 1CNFA 2AE2A 3GZNB 3PCRB 1SVLA 4BWGA 3AM1A 3AUKA 2ZR0A 2ZJOA 1CZNA 4Y9UA 6REQB 1CQZA 4Q7JB 2AXNA 3QVTA 4OUDA 4RU1A 1YDFA 4YAWA 3K9FC 5AVXA 5TC4A 3T3NA 4BP3A 4Y67A 3WK4A 2PBFA 1BRMA 2PQ0A 3RIMA 3TMYA 1XMXA 2QB5A 1RI4A 1K4MA 1UJ4A 3A4LA 3AHIA 3GEBA 1DRJA 3MELA 4US0R 3LUHA 4Y2HA 3L04A 1GQ2A 3KZMA 4EJ2A 4YLGA 2OYCA 3M0EA 4HEHA 3SIXA 2DR3A 5CB6A 4E2YA 1G6KA 5AHKA 2N42A 3VNQA 3U09A 1MT0A 4A1FA 1T3TA 4X1IB 2CL5A 3ACCA 1KZ9A 3MCZA 4JIMA 1E0JA 2CHEA 1XTQA 3H75A 2WWRA 3D9QX 3N2NA 4K9RA 4LSZA 2JEOA 2QR2A 1O58A 1XEFA 1ZD2P 2FFQA 4BQIA 1NRWA 4N9WA 1DAPA 2JFGA 5EMKA 5FR2A 2QTZA 3DEAA 4MVJI 4NU8X 1NDHA 2YWHA 1WF3A 3EZFA 3R4CA 4MB6A 4UVDA 3IIMA 4KQMA 4YJ2F 4RH0A 5DHSA 1R9MA 3G9TA 3EVCA 3JYQA 4PXSA 1E8DA 4BNDB 2FFHA 3KJHA 4QUGA 5CB8A 1A9ZA 3RRFA 1SBTA 3LC1O 2P3QA 1M7BA 3IOCA 2ZSDA 3HHPA 1JG1A 4YC7A 4AQYB 4J3FA 3RYHB 4CNBA 3KVVA 4BQNA 2IP2A 2JGFA 2ZJ1A 3KZXA 3LDUA 1IN1A 2DEUA 1ZUNA 2WNSA 3SIRA 1M1YB 2H92A 2ZR7A 3DT6A 5DBFA 2GWRA 2I2CA 4IJMA 4M54A 2VBIA 3RUAA 1W5BA 4IUYA 3CU5A 2Z3ZA 4CTJA 3UVEA 2PS1A 4AKSA 2OXEA 3JR3A 5LFAA 1E9EA 2YC2C 4RGBA 3UGTA 2Z2XA 3DD1A 1YHYA 3HYLA 3QKWA 5A02A 1JMVA 1PGQA 1AO0A 2CFIA 3IEMA 4E3ZA 4M7WA 2HCRA 1CP2A 1ST3A 1GSOA 2V7WA 2VDVE 2PX0A 1C9JA 3UWPA 4XIJA 4X93A 2R2AA 3GGOA 5C5IA 4IMPA 2GAIA 1JDTA 2W2KA 2F48A 3LPMA 4ZZ1A 1GFWA 1Z29A 2QLMA 3U4IA 2M6LA 3WSWA 1M83A 3TLMA 3V4FA 5T8KA 1VA5A 4UBLA 4E2ZA 3HSKA 2C59A 4EYKA 4QDKA 4YI3A 5JDCA 4Q16A 4A36A 1CZOA 2D1SA 2QMOA 3ECAA 1ECBA 4ARBA 5FBWB 1OVGA 1AQNA 4MWOA 4B6EA 1YRLA 1XSEA 2HHAA 3QEOA 2DPXA 4BNIA 3IAXA 1FXUA 1E59A 1W87A 3IVRA 4LWQA 4PWZA 2K2WA 3NAMA 5CVEA 3OCXA 5ESRA 4E1AA 3BRCA 3DEZA 1AS0A 3T7TA 4XOUA 2JI9A 5HA5A 1CJSA 4EG0A 3NUZA 4GMHA 5INTA 1RDFA 2XF2A 1XF9A 2ZYDA 4WZBB 1K3UB 3FYCA 3QRWA 5EXXA 3NKFA 3OIYA 4NNJA 3CSUA 2K6GA 3OOHA 3QKRB 3EAFA 3Q2OA 5SV2A 1SO8A 3CTMA 1TZJA 3KKMA 1QWOA 2UV8A 3DMTC 2YZGA 1Q1BA 3T54A 1L7VC 4B81A 3TNDA 1G7TA 4K1XA 4EYQA 3D4BA 2OBLA 3WRXC 2NVUB 5K03A 4AJIA 5DYWA 1MP0A 2BSQA 1TVCA 4ZCQA 1TFRA 5AVJA 5T5QA 4JXZA 1JBEA 3VPBA 1OXMA 1MG5A 2C4NA 2E4WA 3ABZA 3ZKWB 4PW0A 1QZXA 3P96A 2BAGA 2O3JA 4GLLA 2RGAA 2H17A 5DN6D 3CPEA 4X65B 1BA3A 4ML3A 2VH1A 4GKVA 2H52A 3A2MA 4DCTA 2O2XA 4DR1B 4UNNA 2OV1A 4K6KA 2I65A 1P31A 3A11A 3CUWA 4OHVA 4MVJG 1V2GA 3VOSA 3E5RA 2L82A 4NR0A 2I1VB 1FRZA 2Z1DA 4MUXA 2AKYA 4MV4A 4ZP1A 5K8LA 1QH8A 4QWMA 3LCUA 1P17A 2GAOA 1BDMA 5FCDA 3O5AA 1P0FA 3D6JA 4DRYA 1T5SA 2Z4TA 1E18A 1JBQA 4BNWA 2YHBA 3WIVA 1SCQA 2Q4DA 4H7HA 1JPVA 3JQ8B 3LX5A 1MVLA 4PAMA 4XR4A 4YJDA 5G3YA 4G0PA 2J41A 3EWNA 3TRKA 4BVGA 5EEGA 1QCDA 3QU2A 4I4LA 3HP1A 3LBFA 3RHTA 4P54A 4CIVA 2BTEA 3G2PA 2VSNA 4LX8A 2ZYWX 3H5IA 1V7ZA 3RAGA 3SIPA 1Y8QA 1TTHA 4Q3BA 4TT3D 2EKQA 1I2CA 1OFUA 5C46F 1ZFNA 1HDGO 4LRTB 4EA6A 4QAQA 3JZDA 4Q3DA 1U6IA 4Q3EA 2QA5A 3DOOA 4C0WA 3C39A 4F2DA 3GPCA 4UXIA 4NBUA 4XJSA 2XLBA 2UUOA 4PGAA 3GVXA 3SM9A 3L6RA 1Z4LA 5TIIA 3UBMA 4EJ0A 1HK7A 5E4TA 4ZI3A 1C1HA 3QE0A 4U7DA 1TGYA 4IV5A 3P19A 5F33A 2EARA 4DLWA 1HOXA 4KQ6A 1OJLA 5IDQA 4FFSA 3VR5H 4J0FA 3CUVA 2XB8A 5FFFA 4IKPA 3GRFA 2A86A 2C2YA 1KVRA 1CQJA 3U37A 1Z17A 2R8YA 5AQ1A 5JFGA 2R1VA 3K9HA 1D4ZA 1O96B 1X8KA 2UVPB 4HAUA 1GKYA 2UZAA 2YWDA 1FSFA 2DPMA 5AI6A 5SY6A 4KN5A 1ZD4A 1Q7CA 3TB6A 3EUAA 1UZMA 2IVFA 3NBZC 1Z73A 3D3KA 3QWHA 3RWBA 5BT8A 3MJFA 1NXPA 4CFZA 4D4LA 4TYYA 1V7CA 1VJCA 2EQBA 1IK6A 1IXZA 1COZA 1E2GA 2GF2A 5HKLA 2R7KA 1CUXA 3BYZA 3ETNA 4XUEA 1G4UR 1MFPA 2RI1A 3NIBA 4W8HA 1S3SA 4RF3A 3AOEA 1U2DC 4YWJA 3LPLA 3PKIA 4WZBA 2DKFA 1NFQA 2VBGA 4Q7KA 2BFEA 1M2VB 3KJXA 2F1JA 3LA6A 1W93A 2AE1A 4NE9A 4WNIA 3X1MA 2EF0A 3UYLA 1RRCA 1PR6A 4AD8A 1NXVA 5GTDA 4F45A 3U4DA 1KO4A 1R7RA 3L8FA 4X7MA 2VWQA 4YV0A 5KS2A 1TAQA 5BNIA 2DLNA 2G9NA 3G85A 1ADBA 4X1KB 3KT3A 4OP1A 1GEEA 1T5OA 4A8JB 2A33A 4Z9YA 3EG5A 3PFIA 3I6IA 3BQNB 1CS0A 3G1WA 2SKCA 1FEZA 3UV7A 4DB2A 2I7TA 1QFJA 4GE0A 1DRWA 1L4MA 2VQSA 4BQPA 4EWLA 4FN4A 3WJ1A 2PHZA 1T0HB 2GEUA 3QYFA 2GA9A 2L19A 2BKVA 4GL2A 1N5KA 1OPXA 4X60A 1GA4A 1R16A 3DMPA 4RD3A 2ORWA 1LSUA 3D6UA 4PYQA 1ZRHA 4LISA 4BFTA 4DC1A 4WL0A 1R0YA 3FB1A 3C7TA 2OM2A 1HKHA 1A2BA 1EDZA 2R4UA 2ZRMA 2YYAA 3B3JA 3I1YA 4I2NA 4MR8B 4MRVA 4JJGA 1R0CA 2P7HA 3LUAA 3WP1B 1RJEA 2C88A 2OQIA 1N6PA 4LJ4A 1A7UA 1QZZA 4BQRA 3VC3A 3MG9A 4DA8A 2WLSA 1DKPA 5A4JA 4OK6A 5B1DA 3P9YA 5EY5B 2BJWA 1G291 1IJFA 3EXHA 4DIFA 3HTXA 4D45A 5LIPA 3IUMA 1U65A 5A5FA 4W5OA 1Z06A 2LUOA 1GTMA 2QPTA 4M9CA 5FOWA 3CH7A 1QLHA 1DMSA 1YZGA 2GZMA 2ZP1A 1RWVA 1CS4C 1SCDA 2C94A 4L07A 4Q5IA 1Y98A 2OBBA 3OZBA 2Z2YA 3KALA 3F7OA 4D57A 1VMAA 3C3YA 4KVFA 1T6YA 4ZO6A 3CKKA 3GT7A 2VUSA 3CNEA 1ZOOA 5HDBB 4PC2A 3FYHA 5KTTA 4QYWA 4YXWA 1TT5A 1VKNA 4OOEA 4YFYA 3SJBA 4BNMA 3NDPA 1T2DA 2YBEA 2D6FA 2CF6A 2ZS7A 4I8XA 1VDZA 2F90A 3FYUB 1RAFA 1MC4A 1R0BA 1NHGA 2P79A 1KL7A 2JD2A 4MCIA 5DSTA 3MT8A 1G5PA 4BZPA 1GGHA 4QJIA 4HDRB 4UHJA 2LGJA 3IVMA 3TW8A 4D3FA 3PGXA 2V0GA 2WG1A 5ULLA 1GZDA 4PG7A 5ITSA 1UOPA 5I7HA 1UQRA 2EYQA 3DE2X 3RUDA 4BO7A 1ZL2A 3OLCX 2WV7A 4H1TA 1AB6A 1MHTA 4HXGA 2NU6B 3WYNA 4PYOA 4P3XA 3AU8A 1ZCZA 3AGPA 3M1IA 3U2QA 1MX1A 1YL5A 3KPWA 4MLDA 4RH3A 1NM5C 1TEVA 5CJJA 1X6VA 4PHGA 4UMFA 5FA6A 3ZC3A 2WB2A 2AEEA 3E9YA 4D8XA 1Q1ZA 2I4MA 4NY1A 5FWDA 1EPUA 3DZJA 3BD9A 2QTWB 3LQYA 3LVBA 1KI9A 1QIHA 4QQFA 2O8EB 1KIFA 4K3UA 4E5MA 1HY3A 1YIOA 2IEBA 2B1IA 1G55A 1QQ7A 2JZNA 2YV4A 3T7DA 4PC7A 1E20A 4L28A 3W90A 4BJ3A 3DWFA 5JBQA 2ISSD 4HFJA 4DMLA 3UMVA 2V59A 1G1AA 1Z2AA 4NATA 2BBOA 3ER9A 1FS5A 2JFZA 5EIHA 4B2PA 3Q5DA 2HO4A 2HFJA 1YC5A 3HSSA 3FLBA 4IRMA 4EVIA 1Y6FA 4URVR 1M0EA 1BS1A 1U4SA 1BX0A 1D2HA 3CLUD 3FY4A 3VI3B 2R8ZA 2R11A 3ZZNA 1JALA 3KJIA 2NYUA 1O6ZA 2O4CA 4FVTA 4PFSA 5I7RA 2X2EA 2H7YA 5LQJA 4IHKA 4GL4A 4IOLA 3SC2A 2C7PA 4X0EA 1V26A 4FDVA 3ZWDA 5LBTA 5K01A 2VQ3A 3A0RB 2ZAGA 2ZYRA 4OFBA 3V4OA 3ZQJA 3KEFA 3OLYA 2XNCA 4RK1A 4MR8A 2A92A 1OH8A 5JOQA 3A58B 3MK31 1H3FA 1P33A 1ZDMA 1ID1A 2ZROA 1YR2A 2IY8A 1WM1A 4L8GA 1DMRA 3ZYCA 5JS8A 3GDWA 1MAUA 3H0EA 2VZ9A 4GZ5A 4DLXA 5FUQA 3EFHA 3TNFA 2JHAA 2ZIXB 4KPUB 2G9VA 3JQRA 5GADl 2CHVA 2YWRA 1VLLA 2AOVA 5EKXA 3ZD8A 2JHGA 3RSSA 3K9CA 1FYEA 1Y7PA 3OZEA 4LS3A 4CL8A 3TI9A 3I64A 4N49A 1A77A 5AVWA 1R74A 1XYVA 3ZCSA 2WJAA 3KB2A 1T5LA 1XQWA 3DE5X 2FB9A 3JWIA 4C1NA 4YUAA 3GLGE 2HU7A 5KYNA 2CLLB 1T10A 2JZOA 3ND6A 2AS0A 4CEIB 1K7XB 2ZE8A 5HBRA 1GV1A 2ZBUA 3B6IA 4LOKA 1ENZA 4HVAA 3SYKA 3LH5A 1HMYA 2W93A 3PJFA 4E12A 3RM3A 2HRRA 3V6MA 2GPSA 5BVHB 5AP9A 1IN6A 3BHIA 4KWCA 1DIAA 2QDXA 4OJNA 3MVEA 4GSYA 2QL9A 2IYQA 3LF1A 2AYXA 3O3MB 4ZEWA 3G3EA 3NP9A 4QLOA 2VBCA 4C6HA 4U6QA 4TMFA 5DCLA 1WVIA 1S2MA 3WL4A 1PBTA 1Z7BA 4KMMA 2A9RA 2O5RA 5CYPA 5TF0A 1X8XA 3TQRA 4KXYA 4Y0AA 3KQKA 1QSGA 2DJIA 1DJPA 3IMKA 3LDGA 1CQXA 2W2XA 2FKNA 4XYEA 4EA7A 3T15A 2EX1A 4BXOB 2A84A 4INPA 1UMCB 4X9XA 3UA3A 4DLTA 4XLZA 3Q8XB 2GB4A 3AERA 3CJQA 2JDIA 1NUPA 5FOTA 1DB3A 1V6AA 2R8OA 4GP7A 2DPLA 4IOMA 3TSOA 2KLBA 1NQ5A 3LCMA 1EAYA 3BMQA 4OCZA 3EVDA 5JATA 1FTQA 1M5RA 3KYJB 1HXHA 3UAOA 4YA6A 3LFHA 2ZI3A 3GROA 4URYR 1P2DA 2W5UA 1QK5A 1Y5MA 4IDAA 5K4AA 3OIFA 3R8XA 2V4MA 4UOEA 1NMXA 2EEZA 1HQCA 2B6HA 1A9TA 4XJTA 1BVYF 2WSSD 1XDZA 2OCAA 3KKZA 4UE2A 5H4HA 3U40A 1MXHA 4V0SA 3VJMA 4AJPA 1ZKMA 4CTMA 2Y0BA 2H57A 3T9AA 1Z62A 1T4GA 3O2JA 1VPLA 5ESWA 1D7OA 1P0IA 1O54A 1WOMA 3C4JA 4YRDA 1D07A 1XWWA 2ATIA 1ZVVA 2J4FA 2JKVA 5F3WB 1IBCA 4DCCA 1THGA 3AFHA 2BCGY 2W6ID 4NBTA 3NVKI 4E88A 1T5HX 2NU8A 2BFAA 4D3DA 3I6YA 3HL0A 3RANA 3RFXA 1CVLA 4RVHA 4P4UA 4Q47A 5DBIA 1ZBQA 4GP6A 1XN1A 2QT1A 3ZKAA 4WCFB 1B0ZA 1PT8A 1WWKA 3RHZA 3EGXA 2VZ8A 4H31A 2HU5A 4KHPB 2EXXA 1JHMA 1MTZA 1UC4B 4OXXA 1ZM3A 4YP9A 1VFNA 5DLDA 4EG5A 4RHCA 1AO3A 4JD5A 5AI4A 2OV3A 1Q3KA 4J0IA 1QAMA 1ZN8A 2BFNA 3PR1A 4X90A 1O8CA 1G4HA 1G2QA 3CSSA 4WACA 3OPYA 2Z56A 2PT7A 3C41J 1Z7YA 2HXYA 2R6DA 4OX9B 2DFPA 5DYGA 4A0GA 4KIFA 1RLMA 1FLVA 2DP4E 2SBTA 1BO6A 3GJQA 1D2GA 1GNTA 3GH3A 1KAMA 2DWOA 2HDOA 2Q8PA 4A6EA 3MRTA 1X9GA 3KO8A 1FFAA 3OU7A 5IKEA 4LE1A 3ME5A 3JASB 3R24A 3BIWA 2AMJA 4CUJA 1E2IA 4ND8A 3WB0A 2BP7A 2F64A 4HDSB 5IM4A 2ZATA 1O9GA 1JHXA 1QYRA 2V98A 1JEEA 1OWOA 1VCMA 4PN7A 2ZYGA 2GXSA 3BHJA 3LHFA 3HVJA 4DN6A 3W04A 2XVZA 4MV3A 4P38A 3CQ9A 4UUNA 4UE3S 1SOUA 2QIPA 3FAZA 5C81A 4A15A 1PYOA 2DQ4A 4N4AA 1IL0A 1IOVA 1PKEA 1BCSA 4LC1A 4KOAA 2QL5A 5GAJA 3V1TC 3Q3HA 4LOAA 2IYRA 3ZGZA 5BR8B 3L07A 2KWIA 3T3OA 2HNAA 2WJ4A 4B47A 3D3QA 3WIBA 2Y1LA 3HRHA 2VUUA 3OT1A 1OV4A 3W9YA 5FQNA 2IH4A 5ECGC 3W9SA 3L2OB 3VR1A 4TRMA 1TQDA 1U5BB 1L4HA 1V3TA 1VMDA 3AF0A 3KTAB 3AOEC 5LQAA 2K5UA 3WZ2A 1AUOA 3E7DA 3ZE2B 4EITA 2X5KO 1VHDA 3FBTA 3S1LA 4D4JA 2DTDA 2B1JA 4BIIA 4DARA 2R1TA 4A23A 2CJFA 4NYIR 3QHPA 4QHTA 4WBNA 1YDMA 2EJUA 3ZHCA 1LRLA 3FJOA 3H0CA 3DDZX 4OAPA 4KITB 5JZOA 4KGXA 4ZQHA 1TADA 1MJGM 3AR4A 4G4SO 5JZMA 4M0PA 1L3BA 3IQFA 3BZWA 4K8OA 5T4HA 2C2ZA 3S0JA 2O7QA 2V9ZA 3K0HA 4UXHA 3R6LA 4JY7A 4KACA 5MN5A 1G2IA 1W4BA 3ZEIA 4DXAA 4P5PA 3KD3A 3OUUA 3ZWVA 1LI5A 1PZEA 3CNBA 4C0XA 1T9HA 5BWOA 2QG6A 4S2EA 2WILA 1T15A 4RV4A 3WRYC 3OQOA 2OBNA 2YVAA 2Z3WA 2Z5FA 4MKFA 3V97A 4B3IA 1IBSA 3HJFA 1XPOA 3OLQA 4EEXA 1YNSA 2Z8YA 1MH1A 2QORA 4EHLA 4S04A 1DIHA 1BDBA 3TXAA 3ZU2A 5DLPA 4CUZA 4B0OA 1U2SA 1MW9X 1PNVA 4HBZA 2C5AA 1OXKB 1MXFA 1AU9A 4FZ5A 2HNBA 2SKDA 3GJRA 1QPZA 2AL7A 4J0GA 4A2QA 3NHRA 3UK6A 3FXAA 3K20A 3RRJA 3WAKA 1D6JA 2HV9A 2CZGA 1DG9A 5HCIA 1TAUA 1ZIPA 4MW1A 4PO9A 3BXOA 5JC1A 4RDIA 1W4CA 2CJWB 3T4XA 5HOQA 4YAKA 1Y63A 2BKXA 1MH9A 1GA1A 1JVBA 3B1XA 5KUTA 2IW1A 2Y66A 5KTPA 2I71A 2QVBA 2XVXA 3RG8A 3F0TA 3HBAA 4DV6B 4LJKA 3SQOA 1NP6A 3DBHB 1NBAA 4UBMA 2AC2A 5DM4A 3QMPA 3QKUA 2ACVA 3EZGA 4DV2B 1U7PA 2HK7A 3GJXC 3E9EA 4CL0A 3EPLA 2PUEA 5CLJA 5M7EA 3JRXA 1K68A 5LN1A 2GYUA 4ZT5A 4S05A 3MSCA 4AF8A 3HY3A 1CT9A 1TK3A 3AUUA 1TZCA 1DO0A 4OAOA 4PNEA 3O4RA 5TEWA 1DBWA 2HYDA 3VHXB 4BO2A 3E4DA 1F0YA 3ROKA 4XWKA 5FXMA 3HBNA 2EW8A 2YYZA 1GYQA 2HSJA 2WAMA 1P62B 3GFTA 5PNTA 1T6NA 2VAMA 1KPGA 2JRCA 4LRWA 2JIQA 4Q3KA 2XECA 3M9WA 3WGMA 1SC6A 2IU4A 3X1KA 4FCTA 4RV5A 1CKEA 1V1RA 4G85A 4XA8A 4BVKA 3UF0A 4PG8A 2VPXA 3T61A 4KIUA 2HMVA 2C2HA 1O4VA 2NGRA 2WW8A 1RVDA 2XUGA 2IYUA 2Z43A 4KDRA 4QTXA 1ZSYA 4HWSA 4WK6A 4BQOA 3GLIB 3Q4GA 2MR6A 4M89A 3M5CA 1SULA 1M5UA 3B52X 4M8SA 3V2GA 3WGNA 4ZVKA 2P2ZA 1VSBA 1GVHA 2WAOA 3NRBA 4GAEA 4IF6A 4R1UA 4JNKA 4M0FA 5K6AC 4R2WA 1EGQA 3H9GA 1LJUA 1T29A 4V3CA 4YONB 1Z4NA 3IJ5A 1D4AA 2Q2VA 1B6TA 1TQ2A 3LZCA 4NABA 1UJ2A 1KS9A 4XX1A 1ZVMA 1Q21A 2GN1A 3R9IA 5KOJB 5LOVA 1OJ7A 2IE8A 1ZD5A 2IPXA 1NXOA 4ASUA 2DF8A 4CM4A 1HNZB 1YCHA 3PB3A 1Y8ZA 4IHAA 2W2LD 1E77A 4O5OA 4ZWNA 4AUEA 4IX9A 1QNFA 1L4LA 1U1CA 2WZCA 3P5SA 3FUWA 4RC9A 2I6TA 4UOQA 2M6SA 2IEGA 2YIJA 5U4QA 4EMUA 4YXFA 5DJ5A 5C7LO 1K8RA 3U81A 3X2EA 5EIXA 2D7DA 3K1TA 2HMSA 3NAZA 3WL7A 3WO1A 2ZYTX 3NMUF 1UBOS 3TCNA 1NOIA 2ZTVA 4OFXA 4YYEA 5BN3A 5HZGA 2O05A 3A28A 5AQEA 1EE9A 3PEWA 3X44A 3HGQA 2UVPA 1QGZA 1C41A 2AHOA 2SNIE 1S2LA 2AMLA 1JU4A 4MW5A 1Z36A 3MJDA 4O6VA 4DIDA 3MGKA 4L74A 3U3OA 2IYZA 1C8BA 1IM5A 5LD2B 2CHUA 2A0KA 1L4FA 2XA1A 3JAKB 3O47A 2GZAA 3OURA 3F6SA 1WV0A 4IIHA 3E23A 5FUVA 1OKKA 2Y0PA 3U9LA 3G2HA 2JFVA 3HACA 1VE9A 3HSYA 4O4HA 1VJDA 1YBHA 3CKYA 2ZW9A 4UDOA 4MDYA 5TEVA 3TXYA 3VSDA 4XWGA 3WLHA 1O5OA 4I66A 1GN8A 2NOAA 4XZ3A 3DZKA 2AUMA 4OHBA 5D2CA 2OXTA 3UB4A 2NUAB 2XNDD 1NDQA 1EVLA 5G4KB 4HRXA 5G53C 3TR5A 2O8EA 1PGJA 3FA2A 4UM5A 1JB1A 3MAAC 3PA8A 2ZKIA 4LDNA 1HO3A 1OY1A 1SHLA 3I83A 4Z4QA 1Z4MA 2RHDA 1RPTA 3VO9A 1PYDA 3CLSD 3BM5A 1QAQA 4CMHA 2WG0A 1MAWA 1NVEA 2YV2A 1ATIA 1QTIA 3IJPA 3OJEA 1XN4A 1HUQA 3F97A 1DBQA 2GRUA 2VHVA 2ZB7A 5JV5A 1HYEA 1TO2E 2B8EA 2PMEA 1TX4B 4FKBA 3TZCA 1CXZA 4NONA 1Z16A 2H9IA 2V7TA 3C5WP 3D4IA 3MLBA 4Y7CA 5AK3A 3AK4A 4PHHA 3U0VA 3S7ZA 3DR5A 9ABPA 2ORYA 1JJAA 2HMYB 1D2CA 2RIPA 1J21A 2IYEA 3O1LA 4IMRA 2GYVA 2QN3A 4OHCA 5FUWA 1AV6A 4WADA 5BT9A 1XCBA 3EGVA 1JFRA 3Q7PA 1E6UA 3EGDA 4O02B 5C8YA 2Z9BA 3OZTA 2HZBA 4ZRMA 2QL6A 4Q4HB 2I2FA 4WSOA 3F4LA 1XQVA 1Q2UA 3TRJA 3O2SB 3DOUA 4KGVA 5I9TA 1ZZGA 5DWVA 1UFKA 4HAOA 3KXDA 2DECA 4Q24A 3UOAB 4KPUA 3KXLA 4P84A 5SYAA 2BGLA 2I87A 4B8WA 3P4YA 1E2HA 4FE4A 4P4LA 2ZYSA 3A0UA 5B36A 1EP1B 3QLUA 4EO9A 5ES4B 5JI3E 1W581 2YJ5A 2ZSFA 4TTSA 4X6LA 3TL2A 5DDIP 4MJLA 4DDHA 5G02A 3DCNA 2FQQA 4QYIB 2CNBA 4LQLA 2NO7A 3DLPX 4P1ZA 1QJ4A 3H99A 3PHLA 5IUNC 2ZB4A 4O4HB 3IQEA 3R6DA 4MWBA 4LI3X 1H5UA 1P80A 2ZBDA 3PK0A 4E2WA 5HJ7A 1UDBA 1Z25A 1UKCA 2AQ8A 2GLXA 1SVUA 4MVCA 4G23A 3PU6A 1F3OA 3K09C 1J97A 3SHVA 1YVEI 4R6WA 3QFTA 2I4TA 5JMWA 4ZJUA 5E1MA 1JU3A 1QG2A 2FX3A 4WKNA 3QI7A 4I50F 3HYTA 4GC9A 2EFCB 2WABA 3L82B 4R8KA 4EABA 4EX6A 2Q6VA 3G7UA 3D02A 1PT9A 4C76A 2OFXA 3DEKA 2NYRA 1Z4KA 4Y6QA 3V00A 4RHUA 5I5EA 1TGVA 1FP4B 3E9ZA 1TZMA 4CF5A 3U17A 3HHEA 1KI6B 3ZK8A 1CVIA 3KFLA 1N1EA 4UU0A 5EHIA 5BV7A 1EEHA 1JBKA 4H3HB 2I2XB 2BPOA 4OQZA 5CW1A 2NZYA 3JSXA 4DLSA 1EUDB 2RAPA 4P22A 3OCJA 3RAJA 3PC8A 3OF5A 4L7VA 2JI7A 2NQ2C 4GOJA 1IBMB 1LK0A 4WLEA 1Q7RA 1KJ9A 3KWJA