3KOUA

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
237
Chain Sequence
RWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVEAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
molecule keywords CD38 molecule
molecule tags Hydrolase
total genus 84
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3kouA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kouA02
3DAPA 5T6BA 2D2IA 7ADHA 3PYMA 4BHTA 4IXTA 4ESOA 5IDXA 4PG6A 1E7MA 3BMOA 3RJ5A 4BNXA 3TZQA 4CR6A 5KVVA 4MVJG 3EYWA 4J3FA 1S6YA 1YO6A 3FWZA 1ULUA 3GY0A 3BXXA 3GGPA 4RDHA 8LDHA 3MJTA 2GPTA 2VYVA 3VZRA 3O8QA 1SC6A 4XZ3A 3RBZA 4AJHA 3VTZA 1MFPA 4GSLA 3KRTA 3L4BA 3RUFA 3ZW8A 4CQLB 1J6UA 4K9DA 1TLTA 3S2IA 2GO1A 4XKJA 1DHRA 2AEJA 1NP3A 4J43A 5JDCC 2R6JA 3S2FA 3C7AA 1X0VA 1I30A 5ER9A 3VVBA 1ZK1A 5F1OA 1OC2A 4G81A 4XRRA 1RYEA 3Q2KA 1ZW1A 4R1TA 4NIMA 3DZBA 4DPLA 3ICCA 1Q7CA 3HN7A 3QVXA 3P19A 2AQKA 5DBGA 2PKQP 1JAXA 2Z1MA 2ZTMA 2BH9A 5C37A 4EJ0A 4ND3A 4BGVA 3K9QO 1Y9EA 3PK0A 3D3EA 1P1RA 4PVDA 5CDTA 3KB6A 1EUCA 4PCVA 1PGNA 5TLSA 3WOHA 4DMLA 3PJDA 2C5AA 1Y8RA 2VRCD 5I7SA 4RL6A 5H83A 1NVTA 4FW8A 3N7UA 4O6VA 1KEVA 3N58A 2QQ5A 1LDEA 5HM8A 1B3BA 3B20A 1EEHA 1O6ZA 3BMCB 4QUKA 1KIFA 1LRKA 1LLQA 1ADBA 1SCUA 3AJRA 3LF1A 1QSGA 4U6SA 2GGSA 5A3VA 1U7TA 4Z0PA 5CG2A 2C0CA 4FFRA 4HY3A 1R16A 1BDMA 2X7HA 3NDJA 1PWZA 4R1SA 4BGUA 5A02A 2J3HA 4PLPA 2DBVO 5TNXA 4JNKA 3GH3A 2BFMA 2YHIB 1FDVA 3C8MA 2NTJA 5T67A 5HTOA 4CLRB 3OM9A 3B70A 3GEMA 5FI3A 3ZHXA 4FIZA 3JQBA 1DO8A 3EZLA 4DYVA 1ZSNA 1X14A 4WUVA 1MFZA 2I5PO 1GPJA 3V8BA 2CUKA 1EE2A 1ENZA 3KEQA 5KJ6A 3RCBA 5EIOA 3ZWWA 1HLDA 2PV7A 4E5PA 4EUEA 4Q3DA 3UICA 1WNTA 4A10A 3KUXA 1P0FA 4HP8A 5LDHA 3WICA 2ZTVA 1HDCA 3WDSA 4BGEA 2VHVA 4P4GA 3PYXA 5DOVA 1NTOA 2FMUA 4EEXA 3DR3A 1DJNA 5TX7A 3RC7A 2OOSA 3TOZA 3L9WA 2WYWA 4ZA2A 5KKCA 1ZNQO 3MJCA 3D3WA 3U5TA 4C7JA 1J49A 4EUHA 4JLWA 3F6YA 5K6AC 2D5AA 5JXWA 1LUAA 4IINA 2CFCA 4XDZA 3NGLA 2I66A 3SX2A 4RVHA 2DAPA 1Z73A 3PFWO 4WNCA 4MKRA 3ZWNA 4ZQHA 4O1MA 3A1NA 4GPD1 2Q4EA 1A71A 4P22A 2FPIA 2G76A 3RBXA 5KJ1A 2R2GA 5L53A 2OZPA 3JSAA 1OAAA 3NTQA 4FJ2A 5JPIA 1BVRA 2C07A 3CSDA 4H15A 1U8XX 4BNVA 2FR1A 4BNWA 1I33A 4WK6A 3C24A 4BNGA 5JDIC 1BVUA 4EUFA 1ORRA 1ZO8A 4L73A 2BD0A 2WYVA 2YY7A 5T8KC 2X5OA 4KTVE 4XR4A 2QX7A 3VZPA 1ADGA 2ZTUA 3TOXA 1AHHA 4TRRA 4D3FA 4A03A 3DL2A 3WWYA 2HU2A 1AN9A 3I6IA 1SOVA 3LF2A 4DREA 4OKIA 1WMBA 2Q2VA 2BI7A 2WEKA 2Y1FA 3GOHA 1KY4A 3GFBA 3STHA 3JQ9A 4FCCA 1VKNA 4MVJH 4DC1A 2P2SA 4XB2A 1NR7A 1ZJZA 3WMWA 1UP7A 3GVPA 4PG4A 1V8BA 3F46A 3VTFA 1GQ2A 1EK6A 2PFGA 1GY8A 4FC7A 4ALIA 4YT2A 3OA0A 2Y1EA 3KLMX 1R4NB 1PZHA 5CEEA 3ZU4A 4AJJA 4D3SA 5A9SA 2VWPA 2V6FA 3KEOA 2E6UX 2X0NA 5J23A 4J2HA 4P38A 4Z3DA 1ONPA 2B5VA 2EEZA 4NBRA 2P9GA 4J4HA 1GADO 1ISHA 2WM3A 4GKBA 3Q2IA 1Q0QA 3SVTA 1QORA 1YQDA 2O48X 3UFXA 3IP3A 1KVRA 5HS4A 1EVYA 2Y0DA 4DMMA 5BNIA 1NFFA 2NQ8A 1UXJA 4MKZA 4BIIA 3VZSA 4A26A 3JQ6A 4AJEA 3I23A 3IAHA 2WD8A 4Q3BA 2JL1A 4CV3A 2J8ZA 4HBGA 4CQMA 3BMNA 1XSEA 4FB5A 1TB4A 3PHJA 3SXPA 1HEUA 2RIRA 4G2NA 1RM0A 4PIVA 2IXBA 3RFVA 3K92A 3EUWA 4HFJA 2Y99A 2WE8A 3FPLA 2XOXA 3BHMA 3U4IA 1YVEI 3KSDO 1ISMA 1MGOA 4MO2A 1H9BA 4JJIA 4JBHA 5FI5A 2PWZA 3VC7A 2C20A 1JDJA 2AG5A 2IE0A 2Z95A 1VPDA 1CJCA 3GG9A 3QHAA 4MPDA 2VNSA 2YFHA 2I3GA 3QSGA 2I65A 1BG6A 4EJ6A 5TC4A 2GZ3A 3ZU5A 3PP8A 4Q3EA 1VJ1A 2CDBA 4CR7A 4OAQA 3GA0A 4KUEA 1CERA 4W4TA 1CDOA 4E2YA 4OXKA 2WE7A 1HTBA 4HKTA 2GN8A 1I3MA 1AGNA 4OMUA 2I76A 2QW8A 4GL4A 3FPCA 3ETGA 5H81A 3L0DA 1KEWA 2QYSA 1YGYA 5A4DA 2SCUA 1ML3A 4CM8B 4HFRA 2EV9A 4YACA 3H9QA 4L4XA 4CMBA 2IEDA 2O7QA 3FNEA 4ZGWA 3MWEB 1G6KA 1HXHA 4E30A 1QYCA 4L76A 3VDQA 2HLPA 2Q2WA 1IE3A 1WVGA 3V1UA 3QY9A 2VRCA 1YJQA 3AU8A 4TKMA 5T57A 1LC0A 1NYTA 1UZMA 1T26A 3HQ4O 1N7GA 4DVJA 2D4AA 1LLCA 2HMUA 3H4VA 1MP0A 4U0JA 2JCXA 3HJAA 3VVCA 2AW5A 1QXSA 4L8VA 5F1PA 2ZYAA 3ZWBA 4XQCA 4R1UA 1ZVMA 4JROA 4HFMA 3DC2A 2BELA 2X5JO 3RAJA 3W8DA 2X9NA 3KLPX 5FFFA 4WEQA 2VWQA 5U4QA 1O8CA 1EVJA 3EK2A 2CVZA 1YBVA 4BQPA 1HF3A 2FZEA 1H0KA 4A27A 1NPTO 4NDNE 2VWGA 3TWOA 3T7CA 3UGKA 1PR3A 1I3LA 1HSZA 1R0LA 2BFPA 2ZK7A 3FF4A 5CDGA 4D42A 2DLDA 1SB8A 5EL0A 3ZWVA 1LEHA 5CEFA 3S2EA 2D5CA 4Q3AA 3HG7A 1HZJA 4IGEA 2C54A 4J16A 2P5UA 3QWHA 5EJ2A 4ID9A 4AJNA 4DGSA 3A9WA 4MVJD 1I5RA 4M49A 3IL2A 3D5QA 4W82A 2GASA 4NFSA 2BGLA 1SNYA 1BGVA 1VI2A 5BR7A 3EVTA 5A1TA 4CM6A 1EZ4A 2RHCA 1V3TA 3WTCA 1DLJA 3W4KA 1UJMA 1SBYA 5JSFA 2YDYA 2EKLA 4K26A 5IXYA 3WNQA 2DUUA 4UVEA 3T7EA 4I1IA 4LMPA 1FDTA 3QW2A 1P0CA 4LMRA 1P9LA 3KHUA 3FWNA 3OIFA 1DBVO 3PRJA 4JGBA 5C7LO 3DDNA 1LSJA 3ZWPA 1C1XB 1NVGA 3JQCA 3JTMA 1A9ZA 4AJIA 3F1KA 4BNFA 4G65A 5TSDA 4B7UA 1PGQA 4RVGA 4TRJA 1T25A 1JU9A 2B83A 3AY6A 5DZSA 4AG3A 4LRTB 3FR7A 2OHXA 3UCFA 2AQHA 3RJ9A 1PX0A 3S2GA 4J1QA 1BXZA 1CWUA 2D1YA 1XKQA 5JYEA 2J5KA 3MOIA 1A7AA 1NQAO 4E5NA 4B4WA 2C2YA 4UREA 2IZ1A 2WWRA 3DOCA 3ZWAA 3I83A 5JCXA 3UUWA 3ST7A 3VKVA 1EK5A 3NKLA 3KVOA 1UP4A 3E82A 4YYZA 1LDBA 1IULA 4R51A 2GN4A 2Q50A 1NHGA 1Z7BA 3KYDA 4NFHA 4IY1A 2GRAA 3W6UA 1EQUA 2DTEA 2F1KA 4DIFA 5IG2A 4NNJA 4WLNA 5CP8A 4UEJA 1HETA 1TI7A 1TT5A 3CIFA 2UV8A 3GDGA 3WLEA 4OJNA 5IZ4A 1PL7A 4PVCA 1GU7A 2E49A 3DMTC 2IEBA 4XGIA 2EW2A 2OBYA 2Y67A 4YJGA 4CLOB 3WJ7A 1C0KA 1LLDA 4ONEA 3ZV6A 4N7RA 3H6KA 3H3FA 3F1LA 1HT0A 2PZMA 4HNHA 1P74A 4CL8A 1PQUA 4NPCA 1DDOA 4LVCA 4YQYA 1SO8A 1KVSA 4W7IA 1PSDA 1UUFA 1EFLA 1EFKA 4BNYA 3KOUA 5L4LA 2NVWA 2G17A 1U4SA 4ZQEA 1I24A 2RCYA 3B1KA 4XQGA 1J4AA 2QHXA 2CVOA 2I99A 2PZLA 1I0ZA 3GNSA 4GQAA 4TROA 4CMHA 3PWZA 4BKRA 4D41A 2WSBA 1M6WA 2JHGA 3LT2A 3OF2A 4AFNA 3WTBA 5THKA 1SPXA 1EE9A 2NWQA 1NXQA 3E03A 4URFA 3QIVA 3ORFA 4N5MA 3FBGA 4C4OA 5A04A 1JVBA 3JQAB 1UDCA 3Q0EA 4BB5A 4E2ZA 4AJ1A 2HDHA 3GDFA 5IXSA 1C1DB 1TXGA 3QE3A 2VTDA 3VPFA 1YL7A 3L77A 3L6DA 2GERA 2JD1A 2V65A 2V6GA 3NT2A 4YTEA 1B26A 3UAGA 4CM4B 5ADHA 4E31A 3TFOA 1D7OA 1GYQA 4A7PA 4U5QA 5I7FA 1E77A 3ANLA 1BW9B 1WWKA 2W2KA 5CDYA 1NWHA 4GLLA 1JWAB 4R41A 5EQFA 1GQYA 4FR5A 3KYCA 4RORA 5ER6A 4WE3A 2GUGA 4U0KA 2FP4A 5TF4A 1IHYA 3GPIA 3W1VA 4MVJF 3V5NA 1P1FA 4R1NA 1VLLA 2B0JA 3OQ1A 5T5QA 4IM7A 4AJOA 4CM7A 3RASA 2W90A 4Z9XA 1UXKA 2HMWA 4NJMB 5HA5A 1X7GA 1KEUA 1DPGA 4I8XA 4B7CA 1I2ZA 1Q7GA 2Q1SA 1Y81A 4R5HA 4RF5A 3H7AA 3RKUA 3D4OA 1U3UA 1PJCA 2UDPA 1EUDA 3FN4A 1EBFA 2DUWA 2VYND 4F46A 4IMPA 2UVDA 4XYMA 1YDEA 5L51A 4ZQFA 1MLDA 5IJZA 1GFSA 3NTRA 3OSUA 4XJSA 2WYUA 2B5WA 4MVJP 5I9NA 4GLOA 3QRWA 3RIHA 4FFLA 1FDWA 1KVTA 1F8GA 3PIIA 1C0IA 1ZEJA 1ZSYA 3PTZA 4S1VA 2DTXA 1R4MA 4JBIA 1NNUA 1A4UA 4FC6A 4DRYA 3I52A 3BTUA 1MB4A 3NEPX 2X0IA 1TA4A 3RD5A 3ONEA 4GWGA 5COBA 1LDGA 4B8WA 2BGKA 4PG8A 5TS3A 1E6EA 3ZWXA 1H9AA 1U8FO 4CODB 5JLAA 4MVJE 5EERA 2DM6A 4PZDA 3DZJA 2YDXA 5DCWA 5DOZA 3ZU3A 4OM8A 1KS9A 3AM3A 2H1SA 1N9GB 1E7SA 2EHDA 2A92A 1N2SA 3GEGA 1R66A 4QO8A 1UDBA 2EIHA 4WCFB 4L4SA 3WFIA 3INRA 4ALLA 4U7WA 5KJFA 1BXGB 4UAGA 2X0RA 2ZYGA 2P91A 4XA8A 1LI4A 2EJWA 2VHXA 3P7MA 3QVOA 4CUZA 4BO5A 1J0XO 2R00C 2YQ5A 1ARZA 2I67A 2WD7A 1M2WA 3GGGA 2YV1A 3WQQA 3TRIA 3TZCA 4FOOA 3GZNA 4D46A 4NU5A 3V2GA 4YRBA 5F5NA 3KBOA 4JX8A 2PD3A 1GV0A 2AHRA 3KXDA 4YPOA 1YOVB 4Z3KA 1FDUA 1A4IA 3FTNA 5FF9A 3H5AA 1PZGA 1VC2A 2OL4A 3JYLA 1YKFA 3HUDA 4A2CA 1GCUA 3D5TA 2J3IA 1ENOA 1DAPA 1GYPA 2AE2A 3OIGA 1V6AA 3OQ6A 4A5OA 2X86A 4MVJA 3F4BA 1E5LA 4LISA 4NI5A 3DHYA 4EJMA 3U3XA 2PZJA 3GRPA 3ADOA 4K6FA 4BO9A 4PG5A 1NQTA 1ZCJA 3RUCA 4TRMA 1DEHA 4QSMA 1E7WA 1P3DA 2PTGA 4RLSA 3BMOB 2H6EA 3OP4A 1EVZA 4S3MA 1FF9A 2YV3A 3DZGA 3E48A 1NAHA 4NK4A 4IDFA 4AJ2A 4GVXA 2HKIA 1GZ3A 3UKOA 3O8QB 1F06A 4YJHA 4CLXA 3IC5A 3GVHA 5TT0A 3LC7O 1PJ2A 2GCGA 1YONA 2QIOA 3PDUA 3GN2A 4GI2A 3G49A 4IDBA 1CF2O 1X0XA 1P1IA 3F4LA 3WS7A 1YDWA 3PXXA 3U4CA 5K6AA 3GVXA 3JD3A 2P4HX 1R37A 1PGOA 4CQLA 1EVIA 1DC3A 3WNVA 2OGUA 2YYYA 4RZIA 3M6IA 3DMYA 1SAYA 3BTOA 2O3RA 3H5NA 4OHUA 3F47A 5AOVA 3PWKA 4JIGA 5B1YA 3GGOA 4TZTA 3WBBA 3JV7A 3M2PA 1KBZA 1MC5A 1GUFA 1LNQA 1N1GA 3KO8A 1PS0A 2YJZA 3F5QA 4CMCA 2IODA 3FRJA 1LSOA 4L74A 2QYTA 3PJFA 5HS6A 1K2WA 2NTNA 4MP6A 1IZ9A 1QR6A 2P9EA 4HXYA 1H6BA 4D45A 4ZJUA 1QRRA 3R0IA 1HYHA 1HDOA 1WMAA 3ETDA 5JDIA 3DAFA 2O2SA 3OJOA 1S7CA 2HRZA 1LRJA 2BGMA 3CXRA 2D59A 1E5QA 2Q1WA 4NBWA 4BO6A 4GWKA 4BO4A 1BHSA 1T2EA 1XU9A 3WBFA 5CHEA 1UZLA 1XYGA 4WCFC 4CV0A 3ONDA 2NLOA 1HRDA 1UZNA 4YBZA 1XR3A 4J90A 5I7EA 3GMDA 1O0SA 2UUOA 5ITWA 2E37A 2EXXA 2Y0CA 3AFMA 3X2EA 3ICPA 2Y93A 1KEPA 2FOIA 2FZWA 1ZH8A 1H94A 1DIAA 1C0PA 3PI7A 4YT4A 5HWSA 2I6TA 2Q3EA 4F6LA 3F3SA 2O3TA 3LSYA 2EF1A 5C7IO 3NT5A 3AI3A 3R3JA 3G3EA 3JQ7A 1PIWA 3LQFA 4J49A 5IZCC 4B4UA 1X7HA 3ABIA 3RROA 3DOOA 4FGWA 4RF2A 3S8MA 3GN1A 2OUIA 4IDAA 3C7DB 3LVFO 4QEDA 5KOIA 5IN5A 2OORA 1PZEA 1PWXA 3EHEA 5KJCA 4DTIA 4KMSA 4OOFA 4CMIA 3WQSB 3GAZA 3OJ0A 1M66A 1E3SA 3E9QA 3PVZA 4L4RA 1I3KA 1Y6JA 4H7PA 1ZXLA 1I10A 3JQ8A 4FPXA 4DQXA 4BL5A 1K6IA 1OBFO 1A9YA 2BF7A 4PLTA 5LDGA 3WG9A 3QA9A 3GMSA 3KZVA 6ADHA 4DYDA 2DTDA 1Z74A 1XA0A 3BMQA 3CE6A 1LJ8A 5TJHA 3CZMA 3D3WB 2H63A 4XYGA 2XF8A 4GX2A 4WLUA 3OEWA 4DXHA 4ZQGA 3PQFA 4I5DA 4IJUA 2VHYA 1Y1PA 1VRWA 1DAOA 4X54A 2B37A 4F3YA 3QLJA 3NX4A 5JO9A 2EWMA 1RJWA 2VWHA 1VSUA 1R0SA 1WW8A 2ZB3A 1D1SA 1B8UA 3A06A 3HFGA 3P2YA 4ZN6A 3D64A 2GDZA 4ND2A 2O4CA 3WIEA 1E7QA 3RVDA 9LDTA 2EJVA 3HNPA 4OO3A 1KC3A 2VYNA 4ALJA 3DHNA 3HWRA 2P5YA 4E21A 1Y9AA 3DAGA 4W7HA 2W98A 3O26A 5JCJD 1WXDA 3GR6A 2Y0EA 4WASA 3C1OA 3OEYA 3NTOA 2BFOA 5G0UA 2Z5LA 1VKOA 4UVGA 5ICSA 3I4CA 3IS3A 2VOEA 4HNGA 1U4OA 1ISGA 3E9NA 3VH2A 4LVUA 5IDWA 1D4FA 4N18A 3GPDG 1YB1A 3V2UA 4MKXA 4GMFA 4F45A 1GZ4A 3IUPA 2ILTA 1ZK3A 4Z6KA 3UVEA 3B6ZA 2J5QA 1EQ2A 3FNGA 3WX0A 3ZV3A 3GAFA 3OIDA 1YBMA 4LW8A 2OMEA 4J1NA 3DQPA 3PYLA 4FGSA 3BYZA 4J7UA 3K96A 1HYEA 1ZBQA 4RCVA 1UP6A 1ZZEA 5COAA 3JQDA 2QRKA 4J0EA 1IY8A 5I9MA 3LLVA 3T4XA 4NG5A 3RBVA 5A9SB 4KP7A 5ENVA 3DZHA 3P5SA 4OIMA 5F3RA 3FI9A 4BVAA 1J5PA 1JA9A 2C82A 2ZTLA 3LLSA 4WLOA 3HZZA 1B0AA 4WJZA 3ZI0A 2JD0A 3AUUA 3K8ZA 4RDIA 1IHXA 4YAGA 1U3TA 4GMGA 2O3SA 2XAAA 3GRKA 3HE3A 3D1LA 3WMXA 3E18A 3KYBA 5FEUA 4HUJA 1Y5RA 1DRVA 1WLYA 4ND1A 1GUZA 3UW3A 4D43A 3ZH2A 3Q9NA 1NAIA 3BMNB 4CQMB 3RUDA 5F21A 3KETA 3IKVA 3GVCA 3ROKA 4DIBA 2PGJA 3CKYA 4MVJI 1DJQA 1DIHA 5CG1A 4OXYA 5DBFA 3GQVA 3HADA 1K3TA 4AICA 3GT0A 4Q39A 3L07A 5JAZA 1YH3A 3R6DA 4CL3A 4Y98A 3TPCA 4QX6A 4R3NA 3FTPA 4TMFA 3GZ4A 1U28A 4CV2A 1Z75A 3U49A 4YEDA 1KVQA 4LRSB 3Q9UA 3GHHA 1WDMA 3DBLA 2X23A 3H5RA 3MZ0A 2AXQA 4B4VA 1ISFA 3Q6IA 3OHSX 4L0QA 3JQEA 5KTKA 4KDEA 4BO8A 4NZ9A 3ZZNA 2P4QA 1HKUA 3DZKA 3BTVA 3GUCA 4KQXA 3G17A 1U1IA 1ULSA 4UUOA 1LX6A 4EITA 2O3UA 3GF4A 4LK3A 4YB8A 3ZNOA 1L1FA 4E12A 4ALNA 2AEFA 1XIVA 4GSKA 1EBUA 1T2AA 4M87A 1X1EA 3OJLA 3MJVA 2PLAA 3CH6A 1I8TA 1TVEA 3HDJA 3R3SA 4PLFA 4WKGA 1LA2A 3N74A 5EINA 5TT1A 3E5MA 5CDSA 4J7CA 2EKPA 2Y1CA 4J4BA 1YQGA 1R0KA 3ADPA 1QKIA 1JTVA 2YQ4A 3UXYA 4D0SA 2VHZA 4LGVA 3CMMA 1V3UA 1PZFA 2VZ9A 1UAGA 4EDFA 2OBNA 4E5YA 4NBUA 2AMFA 4RO0A 2OO5A 1ONOA 3WGOA 3NJ8A 3AM5A 3B1JA 2ZQZA 4M55A 1CYDA 1U2DA 2JFFA 3WQRA 5MGBA 1NX6A 2RBEA 4BNHA 1DOHA 1WDKA 3DMTA 3JQGA 4IQ0A 2EKQA 4UVDA 4B79A 2GD1O 4BO2A 4MOWA 2VUTA 3W4JA 3H9JA 2O3QA 3BIOA 3H9UA 1XQ6A 3WB9A 3WR5A 4QT0A 3MTJA 3T4EA 4MIEA 3E5RA 5JMWA 2O50A 2JJYA 3NDIA 5G2OA 4BNKA 4AVYA 3OFSA 3JQFC 3ZNQA 1UXHA 4IZIA 3LT4A 5JNLA 4DBVO 3PHIA 3GVIA 5G0VA 3EY4A 2CVQA 3WYEA 3VPGA 5TIIA 1RKXA 1LXCA 1P77A 2ZCVA 4BO7A 5THQA 2A94A 2JAPA 3GFGA 4J2OA 4JQCA 3COSA 4R4JA 4CMEA 1D3AA 3JYPA 3ZWYA 3Q3CA 3U62A 3ZGYA 1LSSA 3FBTA 1HWYA 2AA3A 1YJ8A 3U4HA 4J9UE 2HUNA 2NACA 2JCYA 2X58A 3ASVA 3UCXA 2JAHA 3GNTA 2CSUA 3PEFA 1K6JA 1GV1A 3AOEC 6LDHA 4RQUA 1T4DA 3ITDA 1ISJA 1W73A 2VCYA 1MXHA 4XCVA 1XHLA 5ITVA 2E82A 1H2BA 1GYRA 4IUYA 4II2A 3L4SO 1W8DA 1XEAA 4INAA 2C29D 4J1TA 1A72A 1L7DA 3OJEA 4CUJA 3W8EA 1TT7A 1YQXA 4DQUA 1NPDA 4M89A 1NR1A 1Q1NA 5EQDA 4MP8A 1B16A 2X0JA 4ND5A 3I9OA 1LDYA 4OYRA 4QO7A 1MX3A 1HDXA 1K0UA 3K30A 4NBVA 5CEJA 2Q2QA 3FNHA 5EPOA 2AQ8A 3FD8A 2VRBA 3SBOA 3ETEA 1UR5A 3CPSA 4R5MA 4UUNA 3HDYA 3C1AA 3TNLA 5BSGA 1GTMA 2YUTA 4IS3A 3WGGA 2C2XA 2VZ8A 4TVBA 4CJXA 1Y8QA 1MUUA 2JCVA 3LU1A 3H2SA 5JCJA 4E5MA 3ZWCA 2JD2A 1X1TA 1T2DA 1SB9A 3MJSA 3DTYA 4AJKA 5KCZA 3PQDA 1QYXA 1MG0A 2V7PA 4ZICA 4J1SA 1TT5B 1NPYA 1U5AA 4IBOA 5JAMA 3MJEA 4CM9D 4CMAA 3DXFA 3ENKA 1H2HA 4WCDA 4CMJA 3G1TA 4YJGB 4EEZA 4EYEA 2BFAA 2HMTA 1T4BA 1C0LA 1DIBA 4XRGA 1E7RA 2ZYDA 4E2WA 2NTVA 1HE2A 1PQPA 1H93A 2Y1DA 1HYGA 1SOWA 1YL6A 3JD2A 1VJTA 3FNFA 2VN8A 3UHAA 4NR0A 4WOJA 2XXJA 5AYVA 4PZEA 1N8KA 3IJPA 1HE5A 4W9NC 3LC1O 3TFQA 4PRLA 3AFNA 3Q11A 3CZRA 2DT5A 1SZJG 2NU6A 1R15A 1G0OA 2GF2A 3NGXA 4D7AA 1AE1A 5CPBA 4P8RA 4YWJA 3MCVA 4ROSA 5L45A 1SMKA 1GD1O 1E3WA 2GLXA 2HO5A 3DTTA 4UUMA 2B35A 2FR0A 2GYYA 3EMKA 4PZCA 4DBZA 4E13A 3RI3A 3DEYX 3H65A 1U2GA 2Q99A 1GL3A 1IOLA 5EESA 3RFXA 1YL5A 4YCAA 2R00A 1U9JA 1GQQA 1DC6A 1DSSG 1PJ4A 2G1UA 3OA2A 4FJ1A 2AEMA 3WIDA 4MDHA 2RAFA 3Q1LA 3QWAA 5CAEA 3GLQA 1T24A 4XD2A 2UAGA 3DHEA 5AXCA 4MIYA 3A14A 1FXSA 2GZ2A 3NAQA 4CLEA 4I5EA 5BSEA 3LZ6A 4Y9DA 4QXMA 2OXIA 4GGPA 2W2KB 3ZV4A 2VNAA 3HHPA 4GVLA 1P31A 1U5CA 3KYCB 3TDKA 4BO0A 1DC4A 2QG4A 3INTA 1B7GO 1XGKA 3EVNA 2C59A 3DBRB 1NQOA 1T1SA 2YFQA 2X8LA 2NQTA 3WGQA 2NVUA 4JJFA 2CDAA 3HDQA 4N5LA 1XWFA 1BTOA 3BZUA 4BNJA 3C1TA 4IXWA 4BKOA 2P9CA 4EZBA 3LK7A 4R9SA 3CEAA 3IOYA 5U1PA 5I7VA 5I9LA 3PHGA 4BV8A 5HRUA 1JN0A 3E9MA 1JKFA 1PS8A 4KTTE 4IGFA 1M6HA 3R1IA 1T2CA 3D7LA 1OOEA 5JDCA 1KYQA 3PGJA 4IPTA 4PGFA 3CTMA 2H5LA 3TZKA 4R54A 1X15A 1PL8A 1ZMTA 3S1LA 1M67A 3JYOA 4BMVA 2OFPA 1E6UA 3RUEA 4RPJA 5LC1A 1Z82A 3HFSA 1R4MB 1LRLA 1YB4A 1PGJA 4ILKA 4ZD6A 3I9MA 4J91A 4K1LA 4BO3A 4KZPA 5GY7A 3M2TA 3H3JA 4O59O 4D0RA 2VT3A 2GN6A 4N54A 3EDMA 3ROPA 4E32A 4UULA 5EMHA 3H9EO 2WJPA 2NU9A 2O2YA 1I01A 3I3OA 4FFOA 4CM1A 4Y6RA 1MXFA 4RF4A 4Z9FA 1LLUA 1VL6A 1YS4A 3DBHA 1E3EA 1DXYA 1XG5A 3M1AA 1Z7EA 2FPGA 4IQ8A 4NMHA 2YV2A 3I4FA 1LQUA 4G5HA 4BMSA 2CF5A 2JFGA 4XIYA 5BSFA 3KV3O 4Z0HO 3QQPA 4KDFA 1GUYA 4IMRA 4PLZA 5ES3A 4NU6A 4NJOA 1JWBB 2D8AA 3UN1A 3F5SA 3G0OA 3RQSA 3H2ZA 5B4TA 1PGPA 2IYPA 1M75A 1B8VA 3PHLA 2AE1A 3O9ZA 4NK5A 5A06A 4WCFA 3ANNA 2WD7B 4PFJA 2HMVA 1ID1A 1XQ1A 3GZNB 5A03A 4D3DA 1H5QA 4YT8A 2Q46A 2Q49A 4H3VA 3QJ5A 2X22A 4RPKA 5KVQA 4ALMA 4J6FA 4YJFA 2O7SA 1UAYA 4ZRMA 1KVUA 2VQ3A 2GZ1A 4I9NA 2VT2A 1W6UA 4WOKA 5G4KA 1B14A 3ASUA 1KETA 1O94A 1X7DA 1NBOA 1H6CA 2G0TA 5IZCA 4Q3NA 4YRDA 3CUKA 3MJ4A 4YA6A 3WJAA 1AXGA 5K9ZA 4NBTA 3TF5A 3O38A 4RVDA 1BWSA 4HADA 4OOEA 3D4PA 1P45A 3PPIA 1OZAA 2IRWA 4OQYA 3AM4A 3AOGA 5F5LA 2RH4A 2A35A 2TMGA 1H6AA 3LT0A 4P4NA 4IIUA 4N5NA 3AUAA 4YJHB 2FY8A 2QRLA 4YAIA 2FPPA 4EW6A 2RH8A 2FRDA 1E6WA 5AVOA 4I08A 4KWHA 4J0FA 2V6MA 2OP0A 3QWIA 5TGDA 3SLKA 4I9UA 3AK4A 3C85A 2I9PA 2DC1A 4PLVA 4BB6A 5TQVA 1VL0A 2IZZA 4BKUA 2HAEA 2GN9A 4FFMA 3VKUA 5CFZA 1B15A 1Q0LA 4JXKA 1VE9A 3RUIA 3WWZA 5C3MA 4IDDA 4YQZA 1I2CA 3DB2A 4LSMA 5I8ZA 5I8WA 2BRUA 4ZHSA 1ADCA 1E7YA 3QWFA 5U9CA 4CV1A 1EMDA 2ZQYA 3OETA 1NHWA 4RVUA 4Q9NA 1LQTA 3ZDFA 3JYNA 1Y8RB 3F9IA 3LT1A 3QV1A 5G0WA 4WGGA 1YXMA 4M54A 3DONA 2NNLD 1ZUD1 4D79A 1O95A 3QVTA 5K0ZA 2V6BA 3W6ZA 4P4LA 4BKPA 3GC6A 4GGOA 3E1KA 5JC8A 1GPDG 2UUPA 3KTDA 1BMDA 4UEOA 3VDRA 3WGYA 4BGIA 1B2LA 5T8KA 2CF6A 2WTBA 3RSHA 3V1YA 2J6IA 5GMOA 4CM5A 4DLLA 5A5EA 3WLFA 3ZHZA 4EI2A 4FBGA 5ICMA 2DBZA 4H16A 3PGXA 3RU7A 4DA9A 2GNAA 2O23A 3KM0A 4CM9A 3JD4A 5JS6A 1PJ3A 5T64A 5JBIA 1JQBA 1O89A 1XCBA 1HE3A 3BMCA 4II3A 3UCEA 1V3VA 1JKJA 4E4YA 1RYDA 1V35A 1M76A 4XGNA 5FWNA 2VUUA 2PKQO 4R9RA 3S55A 2ZIZA 4E2XA 2Q1UA 1N5DA 4RLHA 4KUHA 1NASA 1HDRA 1X13A 5L7TA 1NM5A 4IJWA 2DFVA 4M1QA 3ZN2A 4IDCA 4B8ZA 2B4TO 3JQ7B 1ZIDA 1GEGA 4GAEA 2YHIA 3WSWA 4CLRA 1E3LA 5AXBA 2IDZA 4BQRA 3DOJA 3DFZA 2JKVA 4I9HA 4RGBA 2PR2A 4I5FA 1C3VA 1W0CA 4CMIB 2ZATA 1BSVA 4MINA 1LBEA 1OFGA 5GZ6A 4M86A 1NFRA 5CDUA 1VJ0A 1E1KA 3JQ8B 4IJVA 1ZJYA 4Y6PA 2P68A 2JHFA 4GX1A 5A5FA 4GH5A 3CINA 2BMAA 2HK8A 1HL3A 2BLLA 3PWSA 3ZWOA 4I5GA 3U4DA 3M1LA 2NM0A 5DNAA 3AI2A 3BMQB 2CZCA 2Q45A 3ANMA 3L4BC 1H6DA 5B37A 4XDYA 2NVBA 1F8FA 4W99A 4JK3A 5JC1A 1DIRA 3QP9A 2VTEA 2O3JA 4IQGA 3NUGA 3JD0A 4YJDA 2UYYA 8ADHA 3BHJA 1NQ5A 1IZ0A 1E92A 2PGLA 1W4ZA 3SC6A 3TZHA 1PJBA 1NFQA 2A9FA 3WGZA 4E0BA 2Q4BA 2E48A 4IIVA 4XYEA 2PZKA 1I36A 3MWDB 1DB3A 1N1EA 5BSHA 2DPGA 1F17A 1B3RA 4BNLA 2W4QA 3K31A 4ITUA 1D1TA 1PJTA 2NADA 1D8AA 3PIDA 5JAQA 5B4UA 4NH4A 3VOSA 3ROMA 4XIJA 4O63O 5L7WA 4BNTA 1G1AA 1HDYA 2X5KO 3BA1A 4BNNA 3TQHA 4NQZA 2PK3A 3ULKA 4Y67A 3AW9A 4OSOA 1PJLA 1CETA 1JAYA 2EW8A 4B4OA 5L4NA 2EERA 4B3HA 4DPMA 5G0SA 2D0IA 1DIGA 1F12A 1WZIA 1BRMA 4RVFA 5KJEA 4LSWA 2OP1A 3CMCO 4YAJA 3I9LA 1P1JA 1V0JA 3C3XA 4TWRA 4LN1A 1QV6A 2NV6A 4OQZA 4BUCA 4K28A 4YAKA 2Z1NA 2J3KA 3VPSA 4ND4A 3I9NA 1A7KA 4YRAA 4WLEA 2W2LD 1E1LA 1Y7TA 2B69A 4XYBA 5EN4A 3L9XA 4XQEA 1R12A 5C7OO 4IDEA 4Z9YA 3SEFA 1CQIA 1R4NA 3AUTA 1WPQA 3JQBC 4EGFA 1ZK4A 3PHHA 4IDGA 4KUGA 4ZRNA 4A0SA 1K6XA 4ZU3A 4OH1A 4JP2A 2E4AA 3EAGA 3RFTA 1JVSA 3U9LA 3AU9A 3DWFA 5KKAA 4JJGA 5LCXA 4C7KA 3PZRA 4CUKA 4FFNA 3JQAD 2HMSA 5DBIA 5H82A 3IDSA 4RJTA 4GX0A 1A5ZA 1GEEA 2DU8A 1E1NA 2CDCA 3PDJA 5JYDA 1HSOA 4HV4A 3LC2O 5G0TA 3ENNA 3JQFA 3JD1A 4W6ZA 4PLGA 1UH5A 2ZJ1A 1QV7A 2W8ZA 5JW6A 2DPHA 3IQDB 2NU7A 4YVFA 5KWEA 1RM5A 5IDQA 3PJEA 3AUSA 4YR9A 4PG7A 2EP7A 4R01A 1ADFA 1YWGO 3ZWMA 1DLIA 3GG2A 3FR8A 4AJPA 1SEPA 3DO5A 1QMGA 2VUSA 4TVOA 4CLDA 2C7VA 4WPGA 2B4QA 4XGKA 3PLRA 4HWKA 1CQJA 3DBLB 4FSHA 4KQWA 4CMKA 3I6QA 2G5CA 3K6JA 1Z6ZA 2BI8A 5BQFA 3IIEA 3U0BA 3AY7A 1PL6A 4FN4A 4JCOA 2BHLA 1PTJA 3WSVA 3E8XA 1N92A 3W8FA 3AOEA 3INGA 4RPGA 1EDOA 4WNIA 2X4GA 4ZVVA 5L3ZA 2J5RA 5B4VA 1O5IA 3O03A 3FCOA 3PFFA 5F1KA 4MVJM 1Q0HA 5ENDA 3UF0A 1FK8A 4O5OA 2ZCUA 3RC2A 3TN7A 4WECA 1ZK0A 2HJSA 1YRLA 4J7XA 7MDHA 4DLAA 4LCEA 4PN3A 5IDYA 2GSDA 3RKRA 4CM8A 1I32A 4BO1A 4FJ0A 1DFIA 3MTGA 2POQX 4HFNA 4B3IA 1IB6A 4GKVA 3JQ9C 4QTZA 1RM3A 4XQ9A 1R6DA 5JE8A 5GZ3A 5DCYA 4FS3A 4WLVA 2H9IA 2RHRA 2G82A 2VZ0A 1I2BA 1Z45A 3HDHA 4AJ4A 3K73O 4BNIA 4DL9A 5AXAA 2O4UX 1E3IA 4ZQBA 2DFDA 4TZKA 5C5IA 2IZ0A 3GNQA 3FHLA 4CLHA 5KVCA 4DLBA 1OC4A 4DPKA 1YB5A 1Q7BA 5FYDA 1QP8A 3JCZA 3ONFA 5A9RA 2B36A 4NFYA 4YT5A 3HSKA 4XWYA 4YAEA 2Y66A 1E3JA 5AXDA 3VZQA 5TJ9A 3JQGB 1ZXBA 1SEVA 2Y68A 4E5KA 4MP3A 4XB1A 1OI7A 2AG8A 4GX5A 5DDIP 9LDBA 1NVMB 4RPHA 1JW9B 3KSUA 4XJTA 4RV9A 2HCTA 2HK9A 3IMFA 3DFUA 2NUAA 4RVSA 3VH4A 5CPFA 4DC0A 5KIAA 3D0OA 3RUAA 3ZNNA 1DFHA 4U8GA 4FOSA 4BV9A 1F14A 1PU2A 3TJRA 5MDHA 3MEQA 4XEHA 3WYCA 4W9NA 5A3JA 4BS9A 1Y5MA 4DQVA 1E1MA 4BMNA 2DVMA 4QECA 3I5MA 3HB4X 2B4RO 2PGDA 1CRWG 2X9GA 5ILGA 1MA0A 1RM4A 2ZB8A 3IKTA 1V9LA 5DT9A 4AL4A 1GZ6A 3OECA 1FJHA 3KSZO 1P33A 2X9VA 3TSCA 1IL0A 3ROQA 1PS9A 4R3WA 2PD6A 4PLWA 1RWBA 1BDBA 3QVWA 4XR9A 2AQIA 3FSRA 1IYZA 5DF1A 1AHIA 1PQWA 1QLHA 3ZHBA 2ET6A 3OICA 4R69A 2DBRA 4O0LA 3OJFA 1P44A 2J3JA 3LYLA 2VYVD 1A27A 3DZIA 3PLNA 3C7CB 3G79A 5L9AA 3WGHA 2VHWA 3L6EA 4K6CA 3DBVO 1LC3A 4CR8A 4TSKA 2VOJA 1MG5A 2PA3A 1C1XA 1ZMOA 4FDAA 1XLTA 3SLGA 4L75A 1LDNA 1IPEA 3K2EA 1YBAA 1RPNA 4IZHA 4TRNA 1JLLA 2FSSA 2TMDA 2IXAA 4PLYA 3RUHA 4DWVA 1AUPA 4R68A 4QFDA 4BKQA 4QQRA 4OSPA 3U09A 4FQ8A 5BNFA 1K89A 3PQEA 1O9BA 1XELA 1QYWA 3ZNPA 4L9RA 3NYWA 3V1TC 2Y1GA 1Y8QB 3A28A 3D4NA 1KY5A 3KYDB 1F0YA 3VAZA 1ZSVA 5JAIA 5L40A 5DULA 1CEQA 5BNTA 3I9JA 1EUZA 3NJ4A 2EP5A 4F6CA 2HRBA 3I1JA 4IS2A 1P1KA 1VL8A 4E3ZA 2XPCA 4KOAA 2EG9A 3K2BA 3OMLA 3ZU2A 3SJ7A 4UEKA 1T2FA 3WXBA 3TL3A 3RC9A 1MV8A 2YZ7A 4M8SA 5KNLA 3EC7A 1GCOA 3BHIA 1HDGO 1VM6A 3X2FA 5GZ1A 5JFOA 2BKAA 4CMGA 1TEHA 1WAMA 3BAZA 4JBGA 4CLOA 2JFHA 3W4IA 4Y8VA 2PH3A 4B3JA 3VH3A 3QVSA 4PLCA 1U7HA 1U3VA 4BNUA 1ZEMA 2HK7A 4AJLA 4ALKA 1Q2XA 3GEDA 5DN9A 2WDZA 5BT9A 1UDAA 3P2OA 1GDHA 3HN2A 1KOLA 3ZV5A 1ENYA 3EZYA 2W2LA 1ENPA 4YDRA 4JN6B 2ZB7A 3OBBA 5B12A 3V2HA 1AXEA 1L7EA 4YXFA 2EGHA 4U6QA 2FSVA 3ZW9A 2ZKLA 4HX5A 1E3WB 2FR8A 1OMOA 1WP4A 2EGGA 1I3NA 1LTHR 2HQ1A 4OKNA 3RC1A 1DFGA 4OL9A 3SJUA 1GAEO 4DUPA 3VH1A 2IYOA 1C14A 2PY6A 2X6TA 4CMEC 1G0NA 4J4TA 3JQAA 4RPLA 5IF3A 3OH8A 2C5EA 5G4LA 3ZHYA 4UUPA 5DP2A 4DIOA 2ZJ0A 1C1DA 2PNFA 5A05A 1ZKMA 1QLJA 1LDMA 2GR9A 2ZB4A 4TKLA 1PEDA 2QZZA 3AI1A 5COQA 3DZFA 4QFCA 1PR9A 1FMCA 4CM4A 3EW7A 4JP3A 4PLHA 2FHSA 2NSDA 3GDOA 4D44A 3LDHA 3I9KA 3IP1A 4BNMA 3E6AA 3ITKA 2NU8A 1BW9A 3UOGA 3H8VA 4BOYA 5HBRA 2CMDA 5JO0A 5AQ1A 2NVUB 1ZFNA 1LSUA 1EDZA 1P1HA 4EBFA 1VSVA 4OXNA 2Y05A 3BTSA 1LU9A 5KVSA 3NRCA 1JKIA 2X1HA 3DBRA 3H9GA 3HB5X 2PKRA 4R16A 4NJMA 3NT4A 1HLPA 3NV9A 1GR0A 2CY0A 3PZBA 1ISIA 5L4SA 1PJQA 4MJLA 1QYDA 4NHEA 1UXIA 4A73A 1DC5A 1HZZA 4Y6SA 1N7HA 1DRUA 3NDRA 4PRKA 3OQBA 3VHRA 5JY1A 2QRJA 5IN4A 2FN7A 3MOGA 2WMDA 5L7YA 3UH1A 3GUYA 3TL2A 1PJSA 4UVHA 4E33A 4CM3A 4Z0TA 5IAAA 1MC4A 1KC1A 5L95A 3VPHA 1E0DA 1U3WA 1T1RA 2I3AA 3QWBA 4RF3A 2CD9A 3ZCXA 3GK3A 4GBJA 1IUKA 3DBHB 1FDSA 3AWDA 2Y1OA 1HDZA 3ON5A 3B1FA 2DQ4A 3A4VA 1UXGA 4XX0A 2FWMX 2DBQA 2YHUA 3G1UA 1N9GA 4KWIA 1ZK2A 3WGIA 4LCJA 2LDXA 3TZ6A 4WEOA 4BNZA 2DKNA 2PD4A 5JMPA 2XXBA 1QYVA 5JY6A 3VPXA 1BXGA 2C7GA 1BXKA 3IUSA 3PJGA 4FD3A 4FFPA 1XU7A 3EGOA 4TQGA 1K5HA 2A4KA 5ILOA 4J9VA 3WYBA 5TRTA 1XDWA 1HE4A 2HSDA 3L6OO 4MIOA 3SC4A 4UVIA 3RWBA 1IPFA 1KERA 3IJRA 4YJFB 2CNBA 3AY3A 4E6PA 4OGWA 1CIVA 1DHTA 4WLFA 2YW9A 4B7XA 5IFLA 1B8PA 1YOVA 5G4KB 3RU9A 1WDLA 1DRWA 2Q1TA 3JYQA 4CQMD 1YE3A 3WGTA 4RQTA 5DCUA 2QZ9A 2F00A 4CPDA 1NWCA 4Q3CA 1ONNA 3WFJA 1QG6A 4RZHA 5A9TA 2D3TA 4XYLA 1WZEA 2LDBA 3O4RA 2PH5A 3GHYA 4IJKA 5DP1A 3K5PA 2HJRA
chains in the Genus database with same CATH superfamily
2VPXA 1O87A 5T6BA 3WE7A 4JLNA 4JZKA 1OWPA 4AIIA 7ADHA 3KLNA 5IDXA 1XJCA 2ERXA 4H59A 4JB0A 3NHRA 3TZQA 3RFCA 3FPAA 2BTOA 4MVJG 4V1CA 4UE2A 4H3HB 1YO6A 3NXKA 2AMJA 3PSAA 4GKAA 1UK8A 4OK6A 4WXYB 4UFOA 3GGPA 3NUZA 8LDHA 2GPTA 3OZGA 4TYYA 3P9ZA 1JMKC 3O8QA 1R10A 3LH5A 2ZJOA 1DKPA 3BL8A 4V0RA 1ZKDA 4XUCA 4AROA 3VTZA 2DOKA 3B7WA 4JC4A 1D7AA 5FOTA 2V5AA 2XITA 1C7ZA 3B82A 2CNLA 3SQLA 4K9DA 1W9HA 3O8OA 2GO1A 5HZMA 3HXOA 4B8YA 2AEJA 1NP3A 2HCBA 3P2EA 4LXQA 5EWJB 4OEHA 5ER9A 3N2IA 4KN6A 5EJGA 4OKSA 4ETWA 1XMPA 3LQQA 4KXVA 1Z47A 5A2GA 2DKOA 5ICGA 5LP6A 3L79A 1NY5A 1CW2B 1U0HC 3L7NA 4HF7A 3ZCSA 4TVSA 2IYNA 3Q2KA 1ZW1A 2F17A 1QNFA 1E94E 2ZBVA 4R1TA 1TCCA 2JK1A 1EG7A 4Y9UA 4DPLA 5LYJF 4ZVOA 5JXIA 1JAXA 1L5FA 2Z1MA 2ZTMA 3KAJA 3CR8A 1NW6A 2JZCA 4ND3A 3T5TA 1FX0B 4BGVA 4PVDA 5CDTA 1GPNA 3RSQA 2AOXA 1EUCA 1PGNA 3HU3A 1S3GA 521PA 1X87A 2FSUA 4UPDA 4ARAA 2UUAB 2KSQA 2OGWA 3T61A 3KD3A 4P9NA 4C4SA 1OI4A 2QRHA 4FNGA 1CZOA 5DWVA 1KEVA 2VT6A 4P3XA 4BJ1A 3KPYA 2QQ5A 2O06A 3N58A 4L7VA 5HM8A 2FSHA 2XOEA 4QUAA 3KJIA 3D3KA 1ZMBA 2D13A 3KDAA 2WICA 3L8MA 3PFKA 1ZQ1A 2R62A 2YBEA 5EWLA 3ZXSA 1E1CA 3HGQA 1S0UA 3BMCB 3BWBA 4C5AA 2IDMA 4RCZA 1XJQA 3K8OE 1QK4A 1C9YA 3LF1A 4K9RA 5LA6A 5ICEA 1COZA 1IXZA 1SJ9A 5AUQA 1KEKA 2WPNA 3QZUA 1U7TA 5KAPA 2PJUA 5JALA 2PMCA 2NPIA 4FFRA 5CCDA 4A0HA 2OQRA 3ZEIA 4KIWA 3C4JA 4H1WA 5IJ9A 3UW1A 1RLJA 4R1SA 4K3VA 5A02A 5F2EA 2HGZA 1Y4SA 2C8VA 5TNXA 2IXEA 2L0XA 1QHHB 2FXVA 1CUZA 2H1IA 4REMA 5AHOA 4NEGA 2HIGA 1Q0UA 5HTOA 4MYUA 2F9LA 3OM9A 1LQ2A 4DCSA 3QXHA 2F3SA 2H00A 3GEMA 3OWHA 4OHBA 1V3QE 2FN8A 2W2NA 4P34A 4XDHA 2AZMA 2PKWA 3AR4A 2QN7A 1D9ZA 4H4DA 1AS0A 5AVWA 3ZDXB 5C9ZA 5GJVC 4PHGA 1MFZA 2I5PO 2W0MA 3B9QA 1JDSA 2OGTA 2YFYA 3GBVA 3R5SA 4LXXA 1L7NA 4J3NA 4AZ0A 3AB8A 3H8WA 3OE7D 3VO8A 3DLAA 4I3FA 3RCBA 1J99A 3ZWWA 4YDQA 2VL7A 4NHOA 3GJ4A 2PV7A 4E5PA 2H7YA 5A3QA 1YQQA 1HNWB 2BHNA 3HVKA 3UICA 2BBSA 3A6PC 1WNTA 3V8PA 4FLEA 3BSFA 1XCGB 4KQ9A 2PMEA 4M99A 2PUFA 2CXPA 2ID4A 3KB1A 4HPWA 1AK2A 4BGEA 2VHVA 4FT2A 4LF5B 1I5EA 2J0UB 5DJ5A 2BHTA 2I8LA 3N2ZB 5TX7A 1I1NA 2OOSA 4PRZA 1XK7A 3DT6A 1M34B 3GLHE 2B0CA 2XD9A 4O4HB 1RPAA 3NIDB 4LPKA 4BWFB 4B44A 1TYEB 2KBFA 3ZHRA 4LV5B 4EUHA 3JZDA 1T8PA 4OFBA 2C4TA 1UM8A 1YDFA 3BJEA 4RGBA 2V5UA 2XGOA 4QU0A 4IRMA 2XVYA 2IOFK 2DAPA 2BSXA 1QE5A 5JHHB 2C2HA 1B43A 4KPFC 3X1KA 2ZU0C 4MWDA 3C41J 2P3QA 1ZN8A 2JVKA 1ECBA 2PLRA 3BZBA 4IHKA 1K8YB 3A1NA 1VPEA 4GPD1 1A71A 2BFWA 1DI0A 3BAFA 4O1MA 4RJLA 1BA2A 2G76A 1QK5A 4HQOA 4D25A 1TQ4A 4CKYA 3E9RA 3F6SA 2PT6A 2JJ1D 2PGOA 4CFZA 4TUYB 3MWDA 1YMUA 1UKBA 1SCKA 2C07A 1MC8A 1RTTA 1ZOIA 3UBTA 3UHJA 3W6NA 1U8XX 3DE4X 2VJBA 3GLGB 1E32A 2BCEA 5ED0A 4BNGA 5JIBA 3C24A 1BFUA 1FOEB 1ORRA 2XVMA 2I22A 1QIKA 4D8XA 4BEBA 2WWYA 5IT9A 2NSHA 2EC5A 1ADGA 3IHKA 1AHHA 2O2XA 4Y1EA 3EGIA 4TRRA 3DYIA 3PC6A 5FADA 4D3FA 3GLHA 2PANA 5GTDA 4Z86A 3QXJA 3COVA 4I4TF 1AN9A 2JANA 2O8EB 1NRIA 4JFAA 4OKIA 5KNDH 2WEKA 2Y1FA 4N5IX 1MV5A 2ZVJA 1A82A 1A9SA 1RYMA 3NWBA 1VKNA 4EZEA 1M7HA 4FFSA 2P2SA 3G2OA 3BREA 3KKMA 1H3FA 1N2XA 3KJFA 1YB6A 5EKTA 3L1HA 1O77A 3C14C 1A5BB 4PG4A 2IXFA 1OXSC 4OCZA 1QWOA 1R1DA 2J7PA 4RPCA 4P6VF 1GY8A 4GUDA 1Z3CA 2B7CA 4D4HA 3AP3A 3OA0A 2Y1EA 1UODA 3KLMX 1PZHA 2QQGA 3GLRA 4DM4A 2PUBA 2GEJA 3RJZA 1IBSA 4AJJA 4EG6A 1V11A 1Y6QA 2ETXA 4PTYA 5A9SA 2PUCA 1NC1A 2V6FA 4ME6A 2QX8A 3N8DA 4J2HA 2G9NA 5AHWA 4G85A 5CB0A 2WSSD 2P9GA 3NWJA 2QSJA 4NVRA 3CLSC 3AGQA 1BH6A 4GKBA 2M6KA 4NZZA 3RK4A 3SJCA 4EQZA 5IK2D 2FQXA 3FTEA 2NYUA 3ETJA 4Q7QA 1FTWA 3ELUA 3SVTA 2CBXA 3CLTC 5H8WA 1S7GA 5I4CA 1QORA 3JZFA 4P93A 3UH0A 3IP3A 2F7SA 3NC0C 4YFVA 2NO4A 1VMKA 1EVYA 2QMOA 1IMJA 2Y0DA 3A36A 3MPOA 1DAMA 3HBLA 2X7JA 4HTAA 4AJEA 2Q4TA 2HEIA 3JQ6A 3IAHA 1VP3A 1L5GB 4CV3A 4YMHA 4Q5IA 1PVDA 2QVGA 4HBGA 1X1RA 3RF7A 4YQEA 5AW6A 1AN0A 3BGIA 1W36B 3EUWA 4HFJA 3RIGA 5EZYF 3DT9A 2VP5A 2EWVA 3AFOA 2WE8A 2XUPA 3P0FA 4EG7A 3RYFA 4Q4AB 2YN0A 3BHMA 1ZD4A 3B1VA 5DHAA 1YVEI 3KSDO 5CIYA 3RSOA 2I2FA 1MGOA 2WTXA 1B73A 1XV5A 4RPIA 2XUIA 3THYB 1JDNA 1J9GA 1TMOA 3ZZTA 1M2VB 2OLKA 1CQJB 3CNHA 4V0QA 2AG5A 2IE0A 2Z95A 3N2EA 2DUMA 4IOKA 1VPDA 2E4WA 3GG9A 1DE0A 1V45E 3BBPA 2A1IA 5KHOC 5LB2A 2ZZMA 4MPDA 3WK5A 1RVV1 5BQPA 1FYVA 2RHGB 3ISVA 1NNI1 2GBGA 4MRMB 2I65A 1BG6A 3QKRB 4EJ6A 3GGCA 3PP8A 1L8OA 1VJ1A 1FS4A 3B3FA 4YMIA 4KUEA 1CERA 4PGMA 3N2NA 3EVDA 4GEKA 3TW4A 4W4TA 4W1PA 4XWKA 4CEJB 3A3KA 2REBA 5JAOA 2XUJA 1Q0RA 1Q7TA 5BNZA 4CEIB 3UANA 3DE0X 1HTBA 5D3ZA 3U9TA 1IQRA 3ZJTA 3BRWA 2PJZA 2ALJA 3QEMA 4KJXA 1TNDA 4OMUA 4GL4A 5H81A 3WXMA 3OQMA 3I76A 3OIYA 4ZPJA 4ARZA 1IJFA 1GQSA 3W5HA 1IIBA 4HFRA 1EB8A 3O90A 5AHKA 1VA4A 1RXEA 2DMRA 4CT4B 1MABB 3H9QA 3P9RA 4C14A 4JSYA 2DXIA 3RJMA 5CX1B 3KQLA 3G7SA 3MWEB 4LVOA 1OIWA 4E30A 1QYCA 3P9YA 4NCAA 5JXGA 2ACVA 1P5RA 1E2GA 3AU8A 5T57A 3K6SB 2NUTA 1FUKA 3RRFA 3ZY4A 3EQZA 2QY6A 3T0IA 1PBNA 4DVJA 1ND6A 1LLCA 2HMUA 4O3MA 2A8YA 4U0JA 2YHAA 2JCXA 2EZUA 1NXXA 3BFXA 3VVCA 3L8FA 1JJIA 2ATIA 4L8VA 4JI2B 2QLTA 2VP0A 2G04A 4YCJA 3EASA 1ZVMA 4MQFB 3SXUA 5FR2A 3I8XA 3NHJA 1SXJB 3RAJA 4I4NA 3RHZA 3I2HA 1SBQA 1OTHA 5ECWA 4POAA 5ERYA 5UKDA 1DWUA 1GQFA 2FX5A 3BERA 1X8XA 2PIDA 4MB2A 3UTDA 2YZKA 4G4JA 1EWVA 3WL5A 4AMUA 3EBOA 2CVZA 2NUAB 3T7RA 3ETCA 4K0RA 4BQPA 1QGYA 2KYRA 4KBYA 4ZMSA 1OWLA 4NDNE 2VWGA 3SSMA 4FGZA 3T7CA 1Z6QA 4OX9Y 1I3LA 1ISRA 2BFPA 2Q8QA 5FL7A 2R68A 2PWBA 1QAMA 4XFDA 4EPRA 2Q5JA 3LO5A 4LA4A 5KYYA 3KQNA 1UFVA 3L0BA 4HAXA 1SC4A 3X1XA 4DEYA 5ES4B 1IZ8A 1WO8A 4O2LA 3VKGA 1TKBA 5JD6A 4KAJA 4RY2A 1DJPA 2XUZA 5EIHA 3A9WA 4MVJD 2V7XA 3H2KA 1EBBA 1DWOA 3IP9A 4MCJA 3H0CA 4OHOA 4AX4A 1BE8A 3EG9B 1XO1A 2DWPA 4AKIA 3CO5A 3IL2A 2FW9A 1ATZA 1W49A 3LK6A 1MMFB 4NFSA 2BGLA 1LW6E 1CJKC 4RAOA 2A5GA 4Y2RA 1BGVA 5BR7A 5KDOA 3QUQA 4KK4A 4RJKA 3EF3A 3QXSA 5FD8A 3STTA 3B3JA 2BFFB 2VTBB 1WRBA 1SBYA 3K16A 1E20A 4G37A 5ALGA 5IXYA 5AUPB 3U13A 3TLGA 4KFRA 4CGZA 3W77A 1UBLS 4Z7NB 1D5CA 2A5DA 4AWXA 3JATA 4MW1A 1P0CA 4G4GA 5CH5A 2E1RA 2VDUE 3KHUA 3OIFA 3K0CA 4Z4EA 1FYXA 1VXRA 4FZ3A 4E4TA 1MOQA 5C7LO 3DDNA 1LSJA 3ZWPA 1JJBA 1C1XB 1PW7A 1U6KA 3A05A 3VFDA 3JQCA 3JTMA 3DNMA 1VTKA 2IP1A 1JLLB 1IEWA 2ODEA 3NTXA 4AJIA 2W6OA 4NYIQ 5H59A 3T15A 3MMXA 3TLKA 4F06A 3M6AA 1PK9A 1JU9A 1WMDA 3G9XA 3SGLA 2D54A 1FBTA 2FPSA 2F3RA 2P9FA 3UCFA 1F51E 1M7BA 1PX0A 5G3YA 4KMMA 4Y1GA 4FNMA 1KI4A 1LW7A 1XKQA 2C9MA 2K7ZA 4U2EA 5CNMA 5BNWA 4QARA 3GDHA 5K0CA 1EP2B 3TEMA 3ZVNA 2C2YA 1JLSA 4II7A 4RSMA 3CRRA 4UREA 3PQ6A 4HDNB 2IZ1A 1OH7A 3DOCA 4JX9A 3ST7A 2YWEA 1EK5A 1GPAA 3IOMA 3N2KB 3NKLA 5C1IA 1UP4A 3E82A 3ADCA 4HDOB 1JEYA 2GPWA 3K70B 9GPBA 1LDBA 4XVQA 1NHGA 1TW3A 4K03A 4NFHA 3TTWA 1YR8A 1DZ3A 3L05A 1XYVA 3W6OA 3W6UA 5IG2A 4WLNA 2WZBA 4G4SO 5LU9A 1K92A 1L5OA 3GDGA 4H1VA 4XFJA 3R9IA 2QL5A 3PEEA 3WLEA 5B3KA 1GJRA 5IZ4A 3GLFB 4PVCA 2W4MA 2E49A 4C0XA 4RABA 1Y6GA 3E7WA 3FY4A 3S1AB 2IHUA 1IPHA 2OCKA 3HC7A 3ICOA 3LFUA 3MTEA 4XGIA 3V9AA 3WJ7A 3DLTA 2BSQA 1T3TA 3EVZA 4DLTA 1HNNA 3AHJA 1HT0A 3AKCA 3EN0A 4J0DA 4N48A 3U4AA 3I3SR 1GP2A 2JAXA 2G9ZA 2DFTA 4LG1A 1NQUA 3PR2B 4I3GA 1EAYA 4MV0A 2VDNB 1Y33E 2JIOA 3E1GA 1UUFA 2JZOA 4QDKA 3NTVA 2HDNB 1EFKA 4LQDA 5IBRA 3KOUA 3QU4A 3D5EA 2XNDD 4Z3OA 3EQ8A 1EFDN 5HK8A 2RJNA 1JB1A 4GPAA 1U5BB 3TRKA 3PR1A 4BKRA 2CB9A 1K97A 1P8AA 2HXYA 5THKA 4B6SA 1TZBA 5GPBA 1W5SA 4A91A 4Z1MA 3L7KA 4BX9A 4DJJA 3ETLA 4ESEA 5A04A 1ML4A 4TTJA 4ZOLB 5FOSA 4JKYA 4MX8A 1L4GA 3O4HA 3Q0EA 5IMBA 1IN7A 2PSJA 2Q8PA 2UZ3A 2WKSA 4BB5A 1LF0A 3LHSA 3FDIA 4KN9S 5IXSA 4CXMA 2HL6A 3LPDA 1UCFA 4LUCA 1TXGA 4CM5A 2EDCA 2ZBFA 1G8PA 4TTAA 2VTDA 1SQSA 3RARA 1YL7A 3TL6A 3GLIA 2VXOA 4HAZA 4DQDA 3P2MA 3PE3A 4FQ5A 2IUFA 3ESBA 3NT2A 4UATA 4YTEA 1DRJA 1QR2A 1UT6A 2UUCB 3PE6A 4POOA 1K7SN 1SQ5A 1VIAA 5DM70 4A7PA 3EH1A 4EPTA 4F96A 2GBIA 1EPUA 2WU3A 2J30A 4LPSA 1C3OB 2PL3A 3G8YA 4CI0B 2NU8B 3ANLA 2W42A 4LHYA 5CDYA 1QVRA 2FLWA 3KYCA 1KWKA 2B2NA 1L5MA 2M6RA 1E1QD 1KIAA 2GEDA 3P96A 2I3DA 5LXTF 3I2JA 2JCSA 4MRNA 2GLTA 3JWEA 4WE3A 3SDBA 1PAUA 3SYTA 3V4VB 3WO1A 4DV2B 2GZMA 4BRSA 3Q3GE 3HB1A 3W78A 5K05A 1BNCA 1T0BA 3HFJA 4MVJF 4WY5A 1II0A 1P1FA 2YOFA 1YK0A 4R1NA 3VSAA 2H17A 3HJHA 3BT7A 1HQDA 2NUPA 4CF4A 4CM7A 1CUSA 1ZL0A 4CRWB 1IDN1 1URPA 2W90A 3H1FA 3NEAA 4Z9XA 3TVTA 4F71A 5AVTA 3FTDA 1ODTC 3IAFA 1Q7GA 4X66B 1IVSA 4R5HA 3H7AA 1E9FA 3GOQA 2UDPA 2Q5QA 1EUDA 5BUQA 1FUUA 1E3QA 1N5IA 1F5SA 2YS7A 1S3SA 1D2CA 2UVDA 3ER9A 2ZYTX 1H05A 2RK3A 2B1QA 3L3BA 3A4LA 2H31A 3BS4A 3C98A 3NALA 3PNPA 4IRUB 4E7PA 5IJZA 2QPAA 3KQHA 1P9WA 1CR1A 1WV0A 2L69A 1B41A 1T6NA 2WYUA 4XSHA 4BLQA 2FI1A 2G88A 4GLOA 1GM5A 1X1CA 4YGYA 3RIHA 3RTDA 1FDWA 5LZ2A 4GD3Q 1SC3A 3PE4A 5C1DA 2NU9B 5LP6F 2DTXA 2G0AA 2OXTA 5BMOA 721PA 1JFTA 4X1YB 5K03A 3RVKA 4LXUA 1I6LA 3T1YB 1A4UA 3IBFA 4FC6A 2OPHA 3NWPA 3QVLA 3I52A 3STYA 1TEZA 2H1FA 3NEPX 2QUHA 2X0IA 1TA4A 5F23A 4U2BA 4CYMA 4EKDA 3LTNC 1E2LA 3OE1A 3U39A 5BWCA 3G5LA 5I4BA 3SJZA 4MRSA 3OX1A 4OQXA 4MQEA 3BB4A 4RHEA 4D4IA 1EX9A 2YDXA 4N0PA 1FDRA 3NB0A 2W6QA 4XX0B 3WYGA 2H0QA 4OM8A 4LIPD 2BMFA 2H1SA 1TK9A 1E7SA 1NKVA 2EHDA 4O02B 2PE5A 1A9XB 2X0KA 4UPEA 1R66A 1T6ZA 3IAS6 2ZI6A 2O2JA 1N6KA 1TE2A 4L4SA 3WFIA 3INRA 2WK1A 3NBUA 4REOA 2GAFA 1K4YA 1BXGB 2C00A 5ICCA 3TM4A 3P7MA 3QVOA 1A7JA 1RJ9A 1QOZA 4Z4QA 5EWMA 1UBEA 3AL2A 3HJBA 3SLRA 3NHBA 1UMBA 4R31A 6AT1A 4Q34A 2I67A 3GGGA 5AW0A 1IWPB 1XCPA 1WKCA 3KJQA 4DMFA 3GZNA 4YXWA 4LGMA 3DM9B 4M37A 4D46A 5F5NA 2UYOA 3W04A 2PL5A 3KKPA 4DLSA 4GOLD 3ESRA 3KBOA 1IFXA 2FMKA 4JJ6A 3QOWA 4JX8A 4D5GA 3O2JA 4X1KA 3QLTA 5E1OA 3HL0A 4OQLA 5CIWA 1FJGB 2Q0HA 4B3SB 3GT7A 1A4IA 4F8EA 1G18A 4IGKA 4KQ6A 3RS4A 3WQBA 4EVIA 1P29A 2WINI 4F5YA 4G0VA 2OL4A 3QLVC 4UMEA 2H7CA 4A2CA 4YV0A 4PWYA 1JFSA 1UKZA 2F6RA 2J3IA 2VSFA 2BOVA 3BXOA 4M88A 5FLEX 3RKSA 4A5OA 5KTOA 5F3WB 2J41A 2PMBA 3DWEX 4LHZA 4NAHA 1YOBA 2PMKA 4LISA 4EJMA 3U3XA 4HYQA 1TCBA 4HTFA 4BO9A 2Y92A 4O2AF 4V0OA 3U3JA 2I55A 4B9AA 3ROGA 4TRMA 1GZDA 4BFZA 2RB5A 2XQJA 3FLBA 1SU6A 2W93A 2HBRA 3MIIA 4RLSA 4WK0B 1C4OA 3BMOB 3EVBA 3QX7A 1V37A 4UE6A 4UFNA 1QC5A 5EJ7A 1FF9A 1K4KA 2YV3A 1Z62A 4HUQA 4B84A 4YUAA 5HKKA 1Y5NA 2VZEA 4MDYA 3VX4A 1YAJA 2OWEA 1VCIA 2W58A 4FR0A 4OHZA 3DVSX 3TI9A 4CKBB 1WSAA 2O07A 4TSFA 3LC7O 5EHIA 1XAIA 5K3EA 3UGJA 2C9ZA 2GCGA 3EIUA 2IVZA 2QIOA 3MJRA 2CEKA 4HYYA 3D8UA 4DYHA 4CCSA 4I19A 1MO5A 2JHPA 1FRNA 2Q21A 1X0XA 2VXYA 3FDFA 1YFLA 1NN0A 2ZUTA 1YDWA 3A3PA 5CU7A 2VK4A 3JD3A 1R37A 1PGOA 1WE2A 4JB3A 4FI3C 3FF1A 2OCIA 4URWR 3WVNA 3H2HA 4RZIA 1CZHA 3DMYA 1SAYA 3BTOA 1N9KA 1YUMA 5AOVA 3M6MD 4UAJA 3ZIAA 1V2GA 3JALB 2MIIA 4N4AA 4Y1RA 5FUVA 3HPRA 5GIPE 1FSZA 1XFAA 1KBZA 1KL7A 1GUFA 3BPSA 3MFQA 4FZVA 1N1GA 3X0DA 3KO8A 3RVBA 3LMKA 4TWJA 5CT9A 3E7PA 1A95A 2WKRA 3F5QA 4JOQA 2QMZA 4JLJA 5HTKA 3FRJA 5FEMA 2CNOA 4R6XA 3D7RA 1M0SA 1KYVA 1LSOA 2Y2VA 3OP1A 3PJFA 2FXIA 1DQZA 2QAGB 3W7AA 1IZ9A 1WS6A 3E8SA 2P9EA 2O52A 3CNNA 4D45A 1YQTA 2Z8ZA 4TWAA 4UTOA 5BYJA 3O7MA 4S05A 1A1VA 1L8QA 1DOAA 1HYHA 1MO3A 1HDOA 2ZRCA 3LJKA 3PFBA 5AJXA 3ETDA 4RCYA 3DAFA 1H3EA 2P9JA 3CKKA 4B6FA 2DFLA 1LRJA 2BGMA 4J0HA 3D8HA 2IXGA 3N6RA 5DMXA 1RQRA 1ZU4A 4PRYA 1F2UB 1T2EA 5DGCA 2GYWA 5CHEA 1M1NA 5JPDA 4WCFC 1E3TA 3ACBA 3KKKA 3KZOA 1VE5A 1VFPA 2VPPA 2NLOA 4YBZA 2VYCA 5SY9A 1O0SA 3E7XA 2E37A 1WVIA 2B5OA 2EXXA 3X2EA 3CJQA 4A82A 2X2OA 4V2IA 1AZLA 1E9BA 2FJPA 3VYRB 1YFZA 2B78A 3JU3A 5BN5A 1DIAA 3GCXA 3PI7A 1RWKA 2Q3EA 3DVAA 4TQ9A 3VR6H 4BEJA 3JVIA 2O3TA 1VE6A 1AG9A 5C7IO 1P6UA 1SKYB 3AI3A 3SX4A 3PHBE 1PT8A 2AOWA 3G3EA 1N2JA 3JQ7A 4RW0A 5SZHB 3LQFA 1SXIA 1RQGA 2OK7A 3L01A 4JUAA 5J2UB 3B8EA 1OY1A 1KK0A 3OQIB 4INPA 4FGWA 2M32A 3REQA 4RF2A 3RROA 4JJAA 2JRLA 5FA5A 1QRDA 2FFJA 4H7HA 4EVRA 2B25A 2CKDA 1XCOA 3G0BA 1Y7LA 1NUQA 4JASB 4LYJA 4U2FA 2HJVA 1PWXA 2Z57A 1U7WA 1JT9A 4KI7A 1QFMA 3GARA 2AKYA 2X0DA 3TLEA 4D3ZA 3DWGA 1DV2A 1QAQA 4ZV7A 3W1EA 1DT3A 4BFUA 3QHQA 4LNAA 1G42A 1IC6A 1I7DA 4FYKA 4BQFA 1I4DD 1BJTA 3OKFA 3PS9A 4RK1A 4L4RA 4A3SA 4X7PA 4AQYB 4YAOA 1N6RA 2CE2X 2X40A 1I10A 3EFOB 4OB8A 1ULTA 4PPGA 4TYQA 4XPIB 3VI3B 3WOVA 3WK4A 3WSTA 1L7PA 4DQXA 5JRDS 3EXG2 4TYNA 1A9YA 1X7ZB 2QTLA 3GEBA 4YBRA 4EB3A 4JI8B 4PLTA 5LDGA 3WG9A 2R7KA 4WH0A 2QE7D 3EBLA 2XCLA 4KX5A 1Z9BA 2WWXA 3TQOA 4DYDA 2WYOA 3BMQA 5HE8A 1YC2A 3WMFA 3NP9A 4OHKA 1DG9A 3DEFA 4JD5A 3IXQA 2YZ2A 2BFEB 4XYGA 3E61A 3DLBA 4KO1S 7ABPA 3OEWA 4F6RA 4G1UC 4RBNA 4ZI5A 1H4TA 3BCHA 2VHQA 4KE9A 5TS2A 1LV7A 3ENWA 2ODAA 2VHYA 3LPCA 4M3NA 5LBUA 4X54A 5LYJB 4UDXX 4ZAFA 4F3YA 1PR0A 3OZXA 2V6JA 2OZEA 3J7TA 4GPIB 4ZAZA 4A4DA 3A06A 3X1YA 4CIWA 2HJHA 1B8UA 1Q44A 3C48A 3AHDA 2HHHB 1W59A 3K35A 5KNCA 5ALWA 2GDZA 2VJKA 3N8HA 3TDMA 3EGEA 1W4AA 5FTMA 1H2WA 1L7AA 2VPWA 4HH4A 4D0NA 3WIEA 3LLUA 4ENRA 2NZJA 3RVDA 4HNVA 1KWGA 1G20B 4QU9A 2EQ5A 1P1BA 4OO3A 4HEJA 4AG5A 5L3SB 2VYNA 3LDFA 3S99A 4ALJA 1ADJA 1CPYA 2VDVE 3T0FA 3HWSA 4W7HA 1P91A 3O26A 2IP2A 1WXDA 3KDPA 1Z6PA 1GZ7A 4GW3A 3C3AA 3IUJA 3RQIA 5HNKA 2CJXA 4WASA 4B80A 1JPNA 4N3BA 1NBAA 4D9IA 1H22A 4C4XA 4OJKA 1QONA 2FPXA 1G7RA 4JJ8A 5IXJA 4UVGA 1EJ2A 3I4CA 4GWLA 3KUUA 4Y6QA 1OJLA 2IU3A 1U4OA 1L9KA 4R8VA 3QTLA 3RWMB 1QRAA 3IMKA 3VH2A 4FCWA 5DH9A 3QELA 5IDWA 2V3CC 3IJ5A 2I4MA 4HVLA 3GPDG 1XEXA 1J97A 3CC8A 1YB1A 2VA9A 3N2LA 5CVTA 1IG0A 1QDEA 1A2OA 4LNHA 2P8JA 4C78A 2XQKA 1TUBB 2ILTA 3IUPA 3L41A 3TZEA 3UM9A 4AYWA 1VHTA 2J5QA 3FNGA 1WXQA 4LRYA 3T7DA 3ZV3A 1LPSA 16PKA 2CLLB 3GAFA 1GRQA 2QNBA 2A78A 5FPSA 4D6XA 2H4WA 3DQPA 3PYLA 4J7UA 1P7WA 1HYEA 3NRBA 5FULA 4P35A 2C3PA 4S1PA 1JHDA 2BISA 3JQDA 2QRKA 1ODCA 4FHDA 1IY8A 3LPMA 4U7FA 3SYNA 3SBXA 1T8RA 3HVHA 3NAGA 4NG5A 2H48A 3PUJA 3DZHA 1NVXQ 2Q28A 3KU4A 1HRKA 1WL8A 1I4EB 4LGYA 4NE2A 3MAJA 3HJCA 5A5DA 1J8QA 5LR6A 4OIMA 2ZSJA 5G02A 1XDGA 1EFHA 4PS0A 1NF9A 3FI9A 5F3RA 5HIIA 2C82A 3LLSA 4PFKA 1V95A 5CM9C 5SZKB 4HYTA 4CZ2A 2HT6A 5DLYA 2O54A 3ZI0A 1RXYA 1VJGA 3X1DA 3OX4A 3F7MA 1TA0A 3LUBA 1KSHA 2JD0A 3K8ZA 4KLAA 3AQIA 3DTVD 4OL0A 3UFXB 3OWOA 2CCGA 5ITZB 3KYBA 3S7ZA 1Y5RA 4EYOA 1V9CA 4ZAWA 3EPJA 4ND1A 4D82A 1IVYA 1E63A 2WAMA 1Z8DA 2WKPA 1GGJA 1YIAA 1NAIA 2R1VB 2HM7A 2WIAA 3RUDA 5JJ5A 1J1ZA 3SKXA 2C2MA 2BZ1A 5F21A 2BZ0A 5CLQA 3IKVA 3B2EA 4K2AA 5FPPA 4CTKA 1W581 2FEXA 4DIBA 1MJGM 4AMBA 4GM4A 1KJQA 2PA0A 1AQYA 3HADA 1S2NA 4WACA 3ZKWA 3DDCA 1U4NA 4F3CA 1YH3A 2IHBA 1E9CA 2QQ0A 4JB8A 2W2QA 3TPCA 1N1MA 4RXMA 2I4OA 3USCS 4XM2A 1AB5A 3D2BA 3G88A 4TMFA 1KSJA 1SA0B 3DGFC 2Z9DA 1O97D 3LX5A 4KXNA 5BV0A 4CV2A 3AP2A 2Y1XA 2XGGA 1L4KA 4YEDA 2FKNA 1KVQA 3NG1A 3TCXB 5FWYB 4GU5A 3Q9UA 3PDIA 3GHHA 3DBLA 3H5RA 1XCMA 2D8MA 2IELA 3Q6IA 4L0QA 3JQEA 1N9ZA 5F3DA 3WBJA 4BO8A 1KFJB 2Q3FA 3C6BA 1DEXA 4WCVA 4FBMA 2YWRA 1WDTA 3DZKA 5EVJA 4C76A 4JLAA 1CE8B 4F97A 5ARBA 1GCAA 4HN9A 4KQXA 1Y3BE 2ZVQX 5JEDA 3DLCA 1T36B 3CRZA 1J0EA 1HY3A 4RSGA 1YB2A 2HA0A 4UUOA 4I4TB 3KAKA 4EITA 4YB8A 1E6MA 4FNAA 2OHHA 3LO8A 1Q0PA 4Z0NA 5IAGA 3ZNOA 1V4NA 3AYZB 2IPXA 4FCVA 1P3JA 2VSNA 4ND7A 1U90A 3SD7A 4ALNA 3HA3A 4M87A 4I1OA 4FX5A 1QBGA 4GI5A 3C3KA 4TM7A 3RAPR 3MJVA 2ZI7A 4Q3LA 5DHTA 1I8TA 3WIVA 1FRFS 1WBJB 1LA2A 1PFVA 4YCDA 5TT1A 4IWXA 2ECKA 4ZIRA 4J7CA 2EKPA 2WVAA 4J29A 2DR2A 3D6HA 3EF1A 3COZA 2Y1CA 3IVAA 3PUWA 5C34B 2HMYB 1YQGA 2QGZA 6REQB 3ADPA 2DE0X 4UU7A 3K09C 3HUEA 4C6RA 2O7RA 5E8JA 2ZYUX 4LGVA 3CMMA 1N7IA 3GJ5A 3M70A 4D0SA 1IJKA 3THSA 3A70A 1UAGA 3EXFA 4BN4A 1IWOA 5B55A 4NBUA 2AMFA 2QTBA 4RO0A 2OO5A 4TKUB 3ROFA 4CDMA 3OZIA 3B1JA 2WNIA 1G8JA 1ICEA 3AF3A 1PYOA 1P5JA 3KIPA 3M4JA 4YPFA 4DVGA 4E15A 2ZM6B 4JXXA 1Y1SA 4FFDA 1Y4ZA 2DFKB 4D4MA 2VCHA 1W19A 1WZCA 1MX9A 1Z68A 5MGBA 3VO2A 1J25A 4PYLA 2XE8A 2RBEA 5HVNA 4V03A 1WSWA 1DOHA 1CZKA 1U9ZA 1WDKA 3IHTA 4P83A 4E09A 4TXLA 4GPBA 3RYIB 3LRXA 3GFVA 3QOFA 5DHQA 3H9JA 5JWOA 1LV8A 2OKGA 2W2OA 3K0FB 2IU6A 1A8PA 3Q3IA 2CLKB 3E5RA 1X7YB 3HEAA 5JMWA 1NVVQ 3H5OA 4BNKA 2BR4A 3A9SA 3OFSA 1SM4A 2A1TR 1SXQA 1UXHA 4IZIA 4FYWA 4CNBA 1NC3A 4BEWA 3LT4A 3AR8A 1JI0A 2N75A 4HLCA 1G8AA 4QGHA 2NZUG 2X8WA 4NABA 1GSHA 5LMNB 1G2QA 1LY1A 2CVQA 2O8CB 1OXVA 4KVFA 3B6IA 4MDEA 5ALMA 5K3DA 1L4FA 1XDUA 4QU5A 5AM2A 5EJAA 4HAOA 4JQCA 4QJ5A 4R4JA 1D3AA 3JYPA 3ZWYA 3Q3CA 4BLUA 4LYFA 3L1VA 5ALOA 2PS1A 3FBTA 2J9FA 1XDDA 2K2QB 5KSWB 2FZ5A 3K1YA 2TYSB 3KBBA 2HUNA 5HKKD 2NACA 4UTXA 3SEZA 5AR1A 3UCXA 4NKRA 4C6SA 1X92A 1R6VA 2VAPA 5JFGA 1K6JA 1GV1A 6LDHA 4N5DA 4A5SA 5BWBA 2VCYA 3LXUX 5DNEA 4JU9A 1MXHA 3HM9A 4K9KA 1S3IA 2X8AA 1NU6A 2QENA 4WK2B 4UNQA 5ELMA 1H2BA 3NFRA 1FNNA 2QYOA 4JT9A 2QYHA 5EJ8A 2GILA 4INAA 3DXXA 1DKOA 3D9QX 4N7JA 1EJ6A 1S8FA 1Z0SA 4G1MB 4JVMA 4CUJA 2GAJA 2QY9A 4PAMA 2VDPB 3IVCA 2H65A 4QQFA 4DQUA 4LQLA 5KNBD 1AVTA 3OAAA 4AY6A 5EQDA 2ICAA 3PQ5A 4MP8A 3UB4A 4MS3B 2P62A 5ARDA 3V7WA 1A2BA 4EB6A 1IEXA 1LDYA 1U0TA 4FVTA 4HWSA 4ER5A 3SSOA 1K0UA 3K1ZA 3M9LA 1OT5A 3BJMA 2AQ8A 3FD8A 2WU1A 1SUAA 2MYUA 3Q7IA 5D5QA 1V5WA 3ETEA 4K2HA 5I7AA 1UR5A 5JJCA 5E1DA 3CHYA 1M1ZA 2VF8A 2ZR9A 3C1AA 4MQ6A 1LTKA 3TNLA 5JVDF 3W5UA 4M6WA 4IS3A 2X6RA 4UZFA 2C2XA 1N78A 4TVBA 3B1XA 1OXUA 4HXEB 4PSVA 4U63A 3RAFC 3ISJA 1SCQA 2JCVA 1O95D 2AW3A 2DPYA 4CCYB 3H2SA 5F2NA 5JCJA 4W5RA 4DT1A 2JASA 4WNYA 4G09A 2XIJA 1FB5A 2WIKA 3A6JA 3IUQA 4HS9A 1T2DA 3IXLA 5EG5A 4HDMB 2FW0A 4P4SB 1DBIA 1LCIA 4WOPA 2FPWA 1ABFA 5H16A 3UJHA 4NMLA 4F86A 1S2LA 3II6X 4PNZA 4ZICA 2QRMA 3R6WA 1A8QA 3C7KA 2H07A 2ZRLA 3I8OA 2QN3A 4Q7EA 1KEEB 2PL9A 3A37A 1T9CA 1X80B 2P6NA 4CMAA 3ENKA 4INOA 3G1TA 4YJGB 3IAEA 2VP2A 2I7TA 3VPCA 3K9WA 1RAAA 1T4BA 1C0LA 3C3BA 4XM1A 1E7RA 2ZYDA 4QOSA 3U26A 2AYZA 3HI4A 2NTVA 1A9OA 3L6UA 4X1IB 5BVHB 1PFWA 1AU9A 1PQPA 1H93A 4WESB 3V4ZA 4YMSA 1HYGA 2JJ2A 3PA6A 3VVMA 3UBMA 2PKEA 1YL6A 4HR7A 2A3RA 3JD2A 1VJTA 4HD8A 5TB5A 4EIWA 3UHAA 2Q6TA 3MWJA 3TGWA 2JJMA 3FOAA 3ZHCA 2AI2A 3SQDA 3AETB 4PC2A 2VC2B 4D9KA 5K8TA 2O8DB 3O3NB 3PWTA 1R5OA 1H4SA 1SCIA 5ECYA 3K2IA 1NNEA 3SP1A 5J3JA 1JG3A 1NT4A 2D74A 5KHLB 3HYCA 5FUYA 4NTZA 2VCEA 3N7TA 3R9XB 1JP7A 2XMPA 4ZVMA 3WGVA 5FOWA 1GTZA 3I6MA 1GD1O 2OK8A 3THXA 2LPMA 3GJ3A 4G8DA 5KQLA 4C43A 3EEOA 4UUMA 2RGEA 2IBMA 1K9SA 4WT7A 4DBZA 4E13A 5DYTA 3NYIA 2XCSB 1G5RA 3DEYX 2D2XA 4IVNA 3U6BA 1GL3A 1DADA 1NBMD 2Z6UA 1NTRA 4JEIA 3V3KA 1DO0A 3DTNA 5CT8A 3H1TA 4WADA 1PJ4A 2G1UA 3OA2A 4DAEA 1TADA 1W4BA 4MWTA 3B9RA 4Q1EA 3PXGA 3ZI4A 1Q1EA 4B3CA 1YTLA 2P3OA 1L8AA 4XD2A 1ZBDA 4DZZA 1NUHA 3QG1A 3WMGA 3E2MA 4DG9A 5B1IA 3DHEA 5AXCA 4BVBA 2BEWB 3A14A 1FXSA 2GZ2A 3JVVA 4JQYA 3E4CA 1SUWA 4ENPA 3NXSA 1VE3A 4Y9DA 1OXBB 1VHLA 4R1PA 3BORA 2O1SA 2W2KB 1Y82A 2RGGA 4U3JA 5NULA 3K0CC 1DC4A 2NPOA 1GVHA 1RQPA 3F8WA 1B7GO 3INTA 4L50A 3T3HA 2C59A 1XLTC 4IXNA 1NQOA 1YNSA 4MJXA 3TNJA 2GBFA 4JIMA 3C3CA 2FP4B 3DMFA 4RULA 2NVUA 2DFNA 4JJFA 5JCOA 1SWWA 3GJYA 3SBDA 4K6OA 1XWFA 221PA 3E4DA 1FDIA 5KCMA 2AJCA 3MW8A 2JARA 4IXWA 4TV8A 2JLZA 3RODA 1X3SA 4YR7A 4C01A 2ZS8A 3DDWA 4JEMA 3HBJA 4NE7A 3PHGA 2MINB 4BV8A 3HB0A 3PC8A 4KE7A 3V7UA 1FNDA 2BGNA 2LCFA 3E9MA 4M98A 1P18A 4L5YA 5G1PA 2I7XA 4X20B 1M6HA 4ZEWA 1RWNA 4LECA 3WDMA 5I4KA 1R9GA 2JFXA 2ZB2A 4RL4A 5CXXA 1VIVA 3D7LA 4MPJA 1VYHA 1ESZA 5KQSA 3WGUA 2HA6A 5C1OA 1Z34A 1XKTA 1ZUHA 2XKAA 4QODA 5LU8A 3KJGA 4IPTA 5J4HA 1ATIA 1FFHA 1X15A 2GNOA 3GLKA 4R54A 1PL8A 1OH6A 1M67A 1TVCA 1E6UA 4UQPA 5D3QA 2W2MA 5K2OA 2JLBA 3M1YA 3IMEA 5E6SB 4KLNA 2XDAA 3I9MA 2JFPA 2QJTA 4J91A 4K1LA 4KZPA 4NV3A 4GOXA 5GY7A 1XMJA 2IEYA 1SBCA 2ACEA 4KSCA 1ZD5A 3H3JA 1YIDA 4D0RA 1Z4IA 2GN6A 5FAKA 2HQSA 1Q83A 2ZPAA 1JU3A 5EMHA 3H9EO 2WJPA 3AYXB 4QYTA 2HXGA 4WN9A 4YREA 1SZPA 5ALHA 1VPTA 4XLTA