3KOUA

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
237
Chain Sequence
RWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVEAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD38 molecule
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
molecule tags Hydrolase
total genus 84
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3kouA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kouA02
4I8XA 1VSUA 1G6KA 2HK7A 1LSJA 1PQUA 2GN6A 2PY6A 5IZ4A 1YJ8A 3JQEA 4BKUA 3V1UA 1T2EA 3G17A 4IGEA 4IJWA 2VTDA 1Y5RA 4OOFA 4FR5A 4OYRA 4L8VA 3TWOA 3AOGA 3FRJA 3JYNA 2GUGA 1DO8A 1WLYA 4GLLA 3AM5A 4Y9DA 1E77A 2I3AA 4XGNA 3ZW8A 5AVOA 5EN4A 1MX3A 1KEVA 1YVEI 2NM0A 2UAGA 1E6EA 1NQ5A 3GT0A 2OP1A 2PK3A 2Y05A 4ND5A 3AM3A 4BUCA 4N5NA 4WEOA 3WGZA 1H9AA 2JFFA 3WGGA 3RIHA 6LDHA 5LC1A 4E5PA 2YDYA 5DNAA 3GPIA 3ETDA 5T64A 2X4GA 3RC9A 1BTOA 1Y8QB 1DEHA 2JKVA 2CZCA 4XIJA 3F1LA 5TIIA 1T2DA 1J6UA 1YJQA 3L6OO 4LISA 5JLAA 1V3TA 5C7LO 4JX8A 2VT2A 5ENVA 5THQA 3EHEA 5H83A 1B16A 3QV1A 1ZEJA 4XYGA 3L07A 3ZWYA 2B37A 2RBEA 3K30A 3GUCA 4P38A 3VH1A 4DQUA 3NDJA 3KTDA 1JTVA 1ISIA 4YBZA 2DQ4A 4RPKA 4H7PA 5F21A 1G1AA 2JFGA 3PYMA 4URFA 2O4CA 4MVJD 4IDBA 4RPGA 5T57A 4D42A 1LRJA 2DBRA 2X7HA 4NJMA 3BMOA 4ALKA 1V35A 1UDBA 1YB1A 2GRAA 4OAQA 2FPIA 3TDKA 3UKOA 1TT7A 3WNVA 4AJNA 4CM4B 1OBFO 3E48A 5C5IA 3LC2O 5JDIC 1ADFA 1Z45A 1F8GA 4W7HA 4IZIA 4BNVA 5H81A 2CF6A 3KEOA 1L1FA 4DPLA 4FD3A 4TSKA 1NTOA 1DFIA 4UEOA 5A02A 1XCBA 4II3A 1SAYA 1V3VA 3HUDA 4KOAA 1NQTA 4Z9YA 2P91A 5BNIA 3DMYA 2VYVA 3FI9A 2WJPA 3BTOA 1KYQA 3RSHA 5KTKA 3I52A 3DBVO 5B4UA 1KVSA 4JXKA 3INRA 4DBZA 1JVBA 1BXGB 1W0CA 2D0IA 4E2YA 3NTQA 5EINA 2J6IA 4RQUA 5KOIA 1DLIA 1U9JA 3U49A 4G2NA 4CLHA 3BMCB 3HZZA 1AHHA 3B1FA 4ROSA 4BNHA 3PLRA 4KDFA 1S6YA 4FPXA 2CY0A 3WLEA 1MGOA 1UJMA 2NWQA 3GC6A 1DRUA 4XIYA 1QP8A 4NNJA 1N92A 1PJ3A 3MTGA 2YJZA 1LC0A 4GSKA 4JN6B 3H9QA 1JAYA 4J1QA 3DZIA 4JNKA 4RF4A 2VRCD 3OFSA 5C3MA 2DFDA 4J7UA 2Y99A 4J3FA 2VTEA 1NNUA 2O7QA 3AI1A 1YKFA 1K6IA 2HMWA 4OKNA 3C7DB 1K2WA 2OOSA 2XXJA 5JMWA 1Q0QA 4PLYA 2FRDA 3PWSA 3H9JA 3I23A 3OQ1A 3NDIA 4XZ3A 3WQSB 3FTNA 3VH4A 3GVIA 4CM9D 2FPGA 5AOVA 1N2SA 5L95A 3DMTA 5A05A 4BNYA 1P1IA 3T7CA 1XYGA 3C1TA 1C0IA 1GQ2A 4MVJM 2Z95A 5DP2A 4YRBA 2P4QA 3GN2A 1DSSG 5I9LA 3GHYA 1Y8QA 4ZICA 3RAJA 1ZK2A 3I3OA 4K1LA 5AXBA 1SOWA 1M6WA 3G1UA 3RUHA 3WQRA 4E33A 1NM5A 3KO8A 2X8LA 4KDEA 3W8FA 4ALMA 3HNPA 1TVEA 2CUKA 1GUZA 2HMVA 5H82A 1E3SA 1DHTA 1N7HA 1HYGA 1WP4A 4PLVA 5AQ1A 5HBRA 3VKVA 4HXYA 4J0FA 3D3EA 2GERA 1WZEA 3L9XA 1ZH8A 4YCAA 2FSVA 3W8EA 2DTEA 1FDSA 5KWEA 5L7YA 3PXXA 1HKUA 4CM6A 3D5QA 2YW9A 2OL4A 1UDAA 4ZGWA 4BO1A 3HWRA 3NTOA 4BL5A 4MP8A 4YRDA 2VWQA 5KKAA 4ND3A 3MZ0A 3NRCA 2ZB7A 4I5DA 3LT2A 4YA6A 4NR0A 4R68A 5K9ZA 3GQVA 2JL1A 3FD8A 1M75A 4MKXA 3K5PA 1ADCA 1AGNA 2Q1WA 5L51A 3DBHA 5L9AA 5DULA 4U8GA 3O03A 3PIIA 1DOHA 3AUTA 2A94A 4BV9A 3D0OA 3UH1A 1O8CA 2W2KA 3HDYA 2DLDA 3TNLA 1PS0A 5AXAA 2EXXA 4BGEA 1ZXBA 1HDRA 1HEUA 1PJCA 2FN7A 1LNQA 4YT2A 4Y6PA 3WGQA 4QEDA 5CG1A 3A1NA 5U9CA 1LRLA 1BXGA 1ZVMA 1UZMA 1E3IA 2C82A 3ZHBA 3BMCA 4WOKA 4QECA 4UUPA 1E7RA 1LDEA 2WEKA 1EVJA 4Y67A 4YJGA 1HDCA 5L4LA 3FWNA 3MJSA 4TROA 2J3IA 2FY8A 2IE0A 3EUWA 2PH5A 5I8ZA 3JQDA 1QYDA 4M55A 2PKRA 4DYVA 4EDFA 3DMTC 2AG8A 2Q1UA 4K28A 4BV8A 3OICA 4WCFB 3ZDFA 4H16A 2W2LD 3OETA 2HO5A 4MPDA 4LN1A 4IDDA 4J4HA 4GX5A 2EIHA 5EJ2A 2PZKA 1B3BA 1NHWA 1Q7BA 4RQTA 3BHIA 1V9LA 3JCZA 1P0FA 1DLJA 1Z82A 5K6AA 5CG2A 4BNFA 3ANLA 4CMJA 4WEQA 1ADGA 1FF9A 1E1LA 3RU7A 1U3UA 2FR1A 1HL3A 4MOWA 2JAHA 1ZO8A 3A06A 1KEWA 4NBRA 5FWNA 1HSOA 3C24A 4LMPA 3BAZA 5EPOA 1I2CA 3GG2A 3DC2A 4BVAA 3IJRA 1P77A 4MJLA 4AJ4A 4FOOA 4AJOA 5AYVA 3QP9A 1FDUA 2QYTA 2VCYA 2YYYA 4GVLA 5A9RA 2JD1A 2H6EA 3G79A 3NGXA 3O8QB 4ZD6A 9LDTA 3NEPX 3HJAA 4ILKA 4OHUA 1EK5A 5FI5A 4D7AA 2XPCA 4A5OA 2VOJA 4NBWA 4OOEA 2PGLA 4FFPA 3DBLA 4CJXA 4DBVO 3ADOA 3D5TA 2X9NA 3FNHA 3LLVA 4BMSA 3GY0A 4CQLA 1B8VA 4DA9A 1R15A 2EGHA 3VPFA 5KJ6A 4PVCA 2Q1SA 4YRAA 1A4IA 5IAAA 2PV7A 3VH3A 1Y6JA 5K0ZA 3JD1A 2GD1O 4BGVA 4FW8A 3GFBA 3ZZNA 3GH3A 1TLTA 2DC1A 3NX4A 1VL0A 2A92A 3PRJA 3FHLA 1RWBA 4KTVE 1MXFA 2OFPA 3LZ6A 2NVWA 1FMCA 1U5CA 4O63O 5A3JA 1ZJYA 3PHGA 2BI8A 4GX0A 3KRTA 4MKRA 5LDGA 3BYZA 1W4ZA 4WECA 1I3MA 3ZNNA 5KVSA 1XLTA 4NK4A 4CUZA 4P4GA 2EKPA 1QLHA 4OXYA 2R2GA 5L7WA 4E5NA 1ZK3A 4Q3AA 3JYPA 4HADA 1C1DA 3RKRA 3TZQA 2DTDA 3GVHA 1T2FA 2IEDA 3KV3O 4KWIA 4DMLA 4D43A 2TMDA 3TF5A 1YONA 2QW8A 2C2YA 5JDCA 3TZ6A 2C5AA 3GNSA 4BNMA 3ZWOA 2TMGA 1E6UA 3LQFA 1F06A 1PJTA 2XOXA 5DZSA 2B5VA 5HS4A 3X2EA 1D4FA 1H6CA 1B8PA 1QRRA 2EEZA 4PG7A 2GCGA 4W82A 1JA9A 1DRWA 1JWBB 2DUUA 4CLOB 1B0AA 1PIWA 5K6AC 4G65A 2NTVA 2HSDA 4K9DA 3H9GA 1VJ1A 1HWYA 2VHZA 3ONDA 2AE1A 1PJSA 4R9RA 1GYQA 2CDCA 4IZHA 5EMHA 1QV7A 1KERA 4MVJP 4DXHA 3DZFA 4EEZA 3F9IA 5FYDA 2PZJA 4ZRNA 1Y81A 1PSDA 4B3IA 4UVGA 3HN7A 1O95A 1VJTA 2NTJA 1R0KA 1DJQA 3ZNOA 3KYDB 1PR3A 3OECA 4B8WA 4BO6A 1ARZA 3D3WB 3IKVA 4H3VA 3EW7A 2VHVA 2G17A 3C7AA 1GV0A 5IZCC 3LU1A 4Z0PA 1UUFA 4NPCA 4WCFA 3F46A 5TJ9A 4D41A 3AY6A 1YQXA 4HFJA 1UR5A 3W4JA 1UXKA 2ZATA 1V0JA 3JQBC 5ADHA 3KXDA 3CEAA 4DTIA 1DJNA 3PVZA 5BNFA 3WIDA 1K5HA 1H2BA 1P1FA 4NMHA 4WLVA 5KCZA 4PLTA 3KYCA 4ZQGA 4ESOA 3OJLA 1YBVA 3I9MA 2ZQZA 2C2XA 2A35A 4PGFA 3B1KA 1GUFA 3DR3A 3AUAA 1L7EA 3EY4A 2HMTA 2DPGA 1U3WA 2IXBA 1Q7CA 3MOIA 3RD5A 1HLPA 4D79A 2UYYA 1R4NB 1O9BA 3IDSA 3RUFA 1PGNA 4BNJA 4BMVA 2E4AA 2P9GA 5L7TA 4GX1A 5B1YA 3O8QA 1KOLA 4RCVA 3L6DA 3V2HA 4D44A 3AY7A 4FFMA 1PJBA 4IGFA 1NPYA 4CV2A 4PLHA 5I7SA 2EJWA 4IS3A 3WGIA 3JYLA 2IYOA 2D2IA 4YQYA 1YRLA 3KETA 4E31A 3VAZA 5JS6A 3DHEA 2O3SA 3GN1A 3MWEB 1BGVA 1QYXA 3UFXA 3UW3A 1DDOA 1X0XA 5ILGA 4S1VA 5G0VA 4DPKA 3ZV6A 4MKZA 3PWKA 3DO5A 5T5QA 1ZEMA 2BKAA 2YV2A 1E0DA 4P4LA 1E5QA 3GGPA 5T8KC 1LDGA 2X0RA 4TQGA 3S2FA 4AJ2A 3M1LA 5CP8A 4JP2A 1XELA 3NAQA 2HCTA 2BFMA 4EZBA 3UVEA 4O6VA 3ZV3A 1I2BA 1PL6A 1NWHA 2VQ3A 4B7UA 2F1KA 2VZ8A 2Y66A 4EUHA 1GQYA 4O1MA 1U8FO 1NX6A 4M89A 1E1MA 2JJYA 3PJFA 4MP6A 5T6BA 4IIUA 2VWPA 1DIRA 2AMFA 3JYOA 1ZSVA 4IDEA 5DDIP 3RASA 4R3WA 4W7IA 4YAJA 3GNQA 4J0EA 4DIBA 4CL3A 3AFMA 4ID9A 3BMQA 5IZCA 1R0SA 2B4QA 4CLOA 3W6UA 3A28A 5TQVA 1P45A 2I9PA 4U5QA 1D1TA 1GADO 1E92A 3RVDA 3IAHA 3U4IA 3Q2KA 2PKQP 1X1EA 3F4BA 3Q0EA 1HLDA 3WWYA 1P31A 3JQAA 3SLGA 1XGKA 1EQ2A 1ID1A 3C3XA 4S3MA 3FTPA 1HYEA 4NH4A 5L53A 5T67A 3KYDA 5JXWA 2J5QA 1XHLA 3ZWMA 4MIEA 1E7QA 3DQPA 3D3WA 2B4RO 3HB4X 4E2XA 4CMEA 4RVSA 2D5CA 4IQ0A 4MP3A 3PI7A 3UHAA 3DHNA 3QRWA 1IZ9A 2NQTA 3OA0A 4NJMB 4OSPA 5JCJA 5FI3A 4E12A 3FNFA 1XEAA 5CPBA 2G1UA 2VUSA 1E1KA 4I08A 1KY4A 4KP7A 2PGJA 4W6ZA 4A10A 1NAIA 4BO8A 2OBYA 3WNQA 5JYEA 1L7DA 1DC6A 1M6HA 3QVTA 3WFIA 3BXXA 1VC2A 2FZWA 4BO9A 4YT8A 1SMKA 5G4LA 4CQMD 3S2GA 2OXIA 1PZGA 3DZJA 1ZMTA 1KVTA 5G0UA 3L0DA 3PDUA 3MJEA 3CKYA 4ZU3A 1R4NA 4HWKA 4M8SA 2PR2A 3QHAA 3F5SA 2ZB3A 3OMLA 4WOJA 1GAEO 2GDZA 3QA9A 4WK6A 2Q50A 3SC4A 3E6AA 5TF4A 2GO1A 1EVIA 2BHLA 1B7GO 1GEGA 3P5SA 2PD3A 4BOYA 3RFXA 5JDIA 2QZZA 1KETA 6ADHA 4D0RA 2YHIB 3MJVA 1DIGA 3O26A 2CMDA 5TC4A 3AUUA 4HP8A 1DIBA 2X58A 3AI2A 3PWZA 4FGWA 4UUOA 3V2UA 1U7TA 1P44A 1B14A 2Q2WA 1LLDA 4GLOA 4IJKA 1GEEA 4JBGA 5DCWA 1VJ0A 3EYWA 3M2TA 3I9OA 4FJ0A 4C4OA 5GZ1A 3ZU2A 3AK4A 1H0KA 3HHPA 4BMNA 3KVOA 2FHSA 3VVBA 3SC6A 7MDHA 3N74A 1NHGA 3DFZA 5COQA 4J2OA 3T7EA 1IULA 1PEDA 2Y1GA 4M1QA 4UUMA 1XG5A 2YY7A 1AUPA 2OGUA 3FNGA 4ZQHA 5J23A 4K26A 4BNZA 4L74A 1WAMA 1XKQA 4F6CA 4J43A 2BFAA 4CMEC 2NU8A 4XJSA 3CIFA 3RWBA 4GWKA 3DDNA 1E7WA 4KMSA 5MGBA 4XWYA 2X86A 3U4CA 4RJTA 1H2HA 3UXYA 1UAYA 1VM6A 2OHXA 3PJGA 4NG5A 1EBFA 3CTMA 1PQPA 3KHUA 3ITKA 4FJ1A 4FS3A 2ZTUA 1OC2A 3COSA 1CIVA 2HKIA 3HSKA 3VHRA 2I6TA 4F45A 1QSGA 2WM3A 3FR7A 3JQ8A 2Y0EA 3UUWA 1GZ6A 4E2ZA 4YPOA 2A9FA 4ZA2A 4QQRA 1H93A 4EJ0A 3GZ4A 1BXZA 3SVTA 5G0SA 1VKOA 2B0JA 1PWZA 3PZRA 1YQDA 4QUKA 1NQAO 5IDWA 2EP5A 3MWDB 4FSHA 3MTJA 3TPCA 5BQFA 2VHXA 3NKLA 3CXRA 1YWGO 1I33A 4TVBA 3KYBA 5IDQA 4J7XA 4QFCA 1NFRA 4Y6SA 3H2SA 3C8MA 2C29D 2PNFA 4BGIA 4XJTA 1LXCA 4QSMA 1KC1A 3U9LA 1BXKA 4HY3A 1K3TA 4O59O 3CSDA 3R1IA 3QVXA 5A5EA 1UP7A 4DYDA 3JQCA 4GQAA 4BO0A 3K96A 1Y7TA 1YOVB 2P5YA 2R00A 3Q9UA 1C0KA 1W8DA 3DBHB 3IJPA 1ENOA 1N9GB 4CMHA 5TS3A 4RDHA 1HE4A 5G0WA 2W2KB 2X23A 3LYLA 1ONPA 4Q9NA 3D4PA 2PZLA 1ISMA 4XDZA 4EGFA 4TRNA 1EK6A 1LSSA 2QRLA 2O3TA 4QXMA 4YJFB 4TMFA 3U0BA 1W73A 3NJ8A 4BKQA 4ND2A 3QW2A 5JSFA 2OBNA 3VVCA 4L4RA 4O0LA 4CMIB 4LCEA 2VHYA 3Q9NA 3V1YA 3OJFA 1E1NA 3I9JA 4JGBA 4Z3KA 3WTCA 2EG9A 3G1TA 2IEBA 4TKMA 4NDNE 4YJGB 2DVMA 5ITWA 3WS7A 4RVUA 1UAGA 4AJLA 4CMGA 3NTRA 2YHIA 2B36A 4JCOA 4R1NA 4JLWA 1UDCA 4ND4A 4XQGA 3NT4A 1WDLA 5CDUA 4GKBA 4WLFA 3H5AA 1EDOA 2O48X 3DOCA 1N7GA 3JD4A 1Y1PA 3ST7A 1XWFA 4NJOA 3UAGA 5AXCA 1ZK1A 1SO8A 3K2EA 1WW8A 4RVHA 4KZPA 4Y8VA 1ML3A 4XYBA 3S2IA 3PP8A 3OHSX 1EVZA 3CZMA 4J91A 5KJFA 2J8ZA 2CDAA 5KVCA 4U6QA 4IBOA 3C85A 3ETGA 1ZKMA 3TQHA 1E3JA 4YAKA 4NBVA 4PVDA 3WR5A 2NV6A 4P22A 1P9LA 4EUEA 1DBVO 4GMFA 1PJ2A 2ZK7A 4HFMA 2NU6A 1WZIA 8LDHA 5IJZA 2HJRA 4Q3DA 4E13A 3S2EA 5KJCA 1Y9AA 5L3ZA 4XYEA 4DUPA 2BF7A 4Z3DA 5TGDA 4OMUA 3M1AA 3D1LA 1SBYA 1ZW1A 2ZJ0A 1UZLA 1CETA 3PQEA 3ZHXA 4EITA 5JC1A 1MP0A 2ILTA 3S1LA 3E9NA 1WDMA 1U4OA 5TSDA 1RJWA 3DBLB 4OO3A 2WD8A 3VH2A 4U7WA 4IS2A 2R00C 1LLCA 3IP1A 1ENPA 2HJSA 3HDJA 2Y68A 1RM0A 4CQLB 4J9UE 2CFCA 4RPJA 3PHHA 4INAA 3GAFA 5CEEA 3DWFA 4ZN6A 4FFNA 3U62A 1LDBA 1XU9A 3VKUA 4GPD1 4RPHA 4CUKA 4JBIA 1IL0A 3FR8A 3CINA 1GUYA 2G0TA 4QTZA 4XGKA 2YFHA 4B3HA 5KKCA 3I1JA 3RC7A 4D3FA 1DC3A 4L9RA 2DFVA 2GZ1A 2WMDA 4TZTA 3I9NA 1V8BA 4NBTA 3INTA 1FDTA 3WLFA 4WCDA 3UCFA 4RGBA 1C1DB 3A9WA 4GSLA 1YOVA 4CLEA 3GUYA 4FBGA 4CV3A 1B15A 4J1SA 4RO0A 1N9GA 2IDZA 3SBOA 4U0JA 3PK0A 3GG9A 3MEQA 2O23A 4YWJA 2AG5A 1HE3A 2HAEA 4W9NA 3WICA 4R5HA 4YJFA 4X54A 3IQDB 2Z1NA 3TFOA 3C1OA 3DTTA 3ABIA 4IQGA 1K0UA 3H4VA 1P3DA 4IMPA 5THKA 3WQQA 4CMIA 4Z0TA 5L40A 2CNBA 2J3JA 1PGPA 4R51A 1KC3A 1P1JA 4W99A 1LUAA 5EERA 3VC7A 5DBIA 4DLBA 4K6FA 2NADA 3OJ0A 1XSEA 3D4OA 4J1NA 1OC4A 4MVJI 2YV1A 3ZW9A 5TJHA 3Q1LA 1YBAA 4NU5A 2YHUA 4L0QA 4AL4A 1TT5A 1U3TA 3H6KA 4A73A 4JIGA 1K6JA 3W4KA 5KNLA 1N1EA 4Q3CA 2BMAA 5CEFA 2NU9A 1LX6A 2EJVA 1JKFA 1PS8A 1VL8A 1YDEA 2DAPA 3JSAA 4RF3A 4XQEA 5F5LA 5IN4A 2O50A 1TXGA 3C1AA 4HUJA 3WBBA 3C7CB 4AJEA 3IOYA 4MVJG 3HN2A 1AE1A 3FPCA 4OJNA 4FIZA 4YACA 4B3JA 3OQ6A 2BH9A 3H9EO 2GYYA 1VI2A 4UREA 2AE2A 3TJRA 2X22A 3QWIA 1PWXA 1GDHA 1HE5A 3WSWA 5HWSA 2O2YA 4WLUA 4AFNA 5TNXA 3OP4A 2Y93A 5GZ3A 1T2CA 3BIOA 2VYND 1E7MA 4I5GA 3L77A 4GH5A 3ROKA 1IHXA 2I3GA 3KYCB 3KLMX 3QWHA 4GVXA 4M87A 1SC6A 2ZB4A 5B4VA 2RH8A 4JJGA 1EE2A 3A14A 4DVJA 5KVVA 1ISJA 2H9IA 3I9KA 2H5LA 3NV9A 4LW8A 5I9NA 5CDSA 3NT5A 1H94A 1N1GA 3O38A 3X2FA 3IC5A 2YFQA 1R12A 1MFZA 2HRZA 2BELA 4R41A 1J5PA 2V6FA 1DFGA 2HMUA 5KVQA 1A9YA 3TL2A 4ZHSA 3F47A 1DAOA 3TZKA 3IUSA 5F1KA 3U4HA 1BWSA 5JPIA 5TLSA 3E1KA 4J9VA 4O5OA 4E30A 4WASA 2ET6A 1BDBA 4YXFA 3M6IA 1PR9A 4J90A 3ZV5A 3JQBA 4IPTA 1VL6A 2YUTA 1NR1A 4K6CA 4XDYA 1QKIA 4JP3A 4PG8A 1ZXLA 1QMGA 3FBTA 1EUDA 1ZK4A 4TZKA 4DGSA 5COBA 1W6UA 2B4TO 1PJLA 2RHRA 4CLRA 4WE3A 2NU7A 2ZYDA 1R16A 3GZNB 1X13A 1T4DA 3E03A 4NK5A 2WYWA 2PD4A 4W9NC 2VWHA 3IP3A 3OEYA 4GAEA 5ER6A 5JCXA 3JQFC 1AXGA 4DIOA 4Y98A 1MC4A 2JCVA 2EW2A 1SEVA 3LDHA 4DPMA 1C1XB 3PYLA 4RZIA 4CR6A 1DPGA 4R4JA 4EUFA 3UICA 3D64A 4L73A 4WLOA 4ALIA 4OGWA 1LDMA 3KB6A 2ZB8A 4MVJA 1DIHA 1GZ3A 4CM7A 1T24A 4PG6A 3EK2A 5DF1A 5L4NA 1H5QA 1E5LA 1UZNA 2I66A 1GCUA 3T4XA 3TZCA 3ZU3A 3PGJA 3SXPA 5G0TA 4BIIA 1BVUA 1JWAB 2AHRA 3LT0A 4YEDA 3B6ZA 1KEUA 4NFSA 2HK8A 2Y1DA 3B20A 1ZUD1 3MJCA 1EDZA 1GV1A 1P1KA 4CODB 4GMGA 4E6PA 3BMQB 3O4RA 3PLNA 4LCJA 3WTBA 1Z7EA 2DBZA 3DZBA 5DOZA 3E82A 1YB5A 1MV8A 5DCUA 3LF1A 2DBQA 2QRJA 1R66A 2NVUA 3W1VA 1T1SA 4A2CA 2IXAA 3F1KA 1CEQA 1K6XA 3P7MA 1I36A 5T8KA 3JD3A 3QVOA 3JQAB 5JO0A 4N18A 4BKOA 5C7IO 5CDTA 2Q4EA 1E3EA 2ZYGA 4Z9XA 2G5CA 1O5IA 1JW9B 4JQCA 1T26A 2O4UX 4M86A 1YS4A 2PTGA 3GR6A 2YV3A 3JTMA 1ZFNA 2CD9A 3CH6A 4HBGA 1HTBA 1YQGA 2FMUA 2HQ1A 4RVFA 1I32A 1GY8A 2NQ8A 4IQ8A 2PD6A 1DXYA 2Q4BA 2IYPA 1SZJG 7ADHA 2UV8A 2EWMA 2WDZA 2DT5A 3LVFO 1T2AA 3UGKA 3ICCA 1M67A 4P4NA 2UUPA 2BFPA 2EKQA 5B37A 1CDOA 5A9TA 1LDNA 4BO3A 1TB4A 3WJ7A 2AQKA 1LBEA 4QX6A 5EESA 4JK3A 3WDSA 4CUJA 5GY7A 3HFSA 2VRCA 4QO8A 4OQYA 4Z9FA 4PZDA 2I67A 4J4TA 2IODA 2FR8A 1N8KA 2I5PO 3T4EA 4A03A 4F6LA 3RBVA 2X5OA 1AXEA 2EF1A 1EE9A 3ASUA 5BSEA 1QYWA 1C14A 3HDHA 3EVTA 3WX0A 2Y1CA 1YL6A 3ZWXA 3HE3A 4OIMA 3ZV4A 2WD7A 4XB2A 2VYVD 4D3DA 4II2A 4CM9A 3ZWWA 3I83A 4YAGA 1KS9A 4AJJA 3UCXA 4N5MA 4DL9A 3GVCA 3K6JA 4WGGA 1RYEA 3RUIA 1PZHA 4R3NA 5FF9A 3WG9A 1XU7A 3ROQA 1HDXA 3K31A 3PFFA 1A9ZA 2GF2A 2C7VA 3IMFA 2ZQYA 2C54A 4A0SA 1D3AA 4E2WA 4FC7A 4DC0A 2Q3EA 3GZNA 2X0IA 2QYSA 4XKJA 3EC7A 2OZPA 3PPIA 3WMWA 1PGJA 1E3WB 1IY8A 1A7AA 3RJ5A 3ZN2A 1NPDA 1TEHA 3VTZA 3ANMA 1Y9EA 2X9VA 1GU7A 1IB6A 1B8UA 3LK7A 3RQSA 1C1XA 3TN7A 4YT5A 1NBOA 3OH8A 2VZ0A 5DP1A 1BDMA 3JQ9A 3PZBA 2C5EA 3L4SO 1HDZA 1U28A 1XIVA 2PZMA 1MUUA 3FWZA 4R9SA 1I2ZA 4JROA 4RF2A 3VPGA 4CMCA 3BZUA 4XYLA 3RCBA 1ZSYA 5JAIA 4NFYA 4J49A 2G76A 3L9WA 1NQOA 5I7VA 1Q1NA 2JCYA 3IIEA 2W98A 5ICMA 1EUZA 3UCEA 4FDAA 5IG2A 4CV1A 2Q1TA 1EZ4A 3LC1O 2GZ3A 1E6WA 3ZU4A 4EI2A 5JFOA 3V8BA 2EP7A 3ZNQA 3R6DA 1Z74A 4R69A 2H63A 3JQ8B 4CMKA 3LLSA 1HXHA 5ITVA 1NFFA 4I5FA 3PJDA 4A7PA 5IXSA 1LSOA 1ULSA 1GFSA 3Q3CA 3AU9A 4TRRA 1HF3A 4Q3BA 4RDIA 2PH3A 2VWGA 3OQBA 3UN1A 4IJUA 1IHYA 2EGGA 3WIEA 4OL9A 1ULUA 4ZQFA 3BHMA 1U3VA 3ICPA 1PJ4A 1QG6A 2YDXA 4N54A 4FQ8A 2O3UA 5IN5A 2Q49A 2Y67A 4HX5A 3F3SA 5BT9A 1PJQA 4D46A 2O3QA 2AEJA 2RH4A 3O9ZA 1DAPA 4IINA 2FSSA 1M2WA 1LTHR 1YXMA 1ZMOA 4J7CA 2W2LA 4TWRA 1SB8A 3PTZA 4PIVA 1BRMA 2E37A 3AFNA 2YQ5A 3DOOA 3NDRA 4ALNA 4R54A 1WDKA 3TOZA 4IXTA 5JNLA 4CR8A 3I9LA 4I9UA 1NP3A 2Q2QA 2QIOA 5JYDA 1J49A 1F12A 4U6SA 3PYXA 2D3TA 4MIOA 3DZHA 5I7FA 1XQ1A 5DBGA 1UXIA 2EV9A 3RUCA 2OO5A 1RM4A 1YL5A 3CMMA 4PZCA 3W4IA 3E9QA 2QG4A 3ZU5A 1I30A 3JQ9C 1OI7A 3H3JA 4XA8A 4R5MA 2WE7A 3HG7A 4CM5A 3FNEA 2GNAA 3H65A 4FB5A 4UUNA 1A5ZA 3QLJA 4OXKA 1HE2A 1ZJZA 4L75A 3WWZA 1MLDA 1GQQA 4WNCA 1EBUA 4NZ9A 2HK9A 2PKQO 4Q3NA 3GVPA 4FN4A 3QVWA 3EGOA 1YGYA 1E3WA 1Z73A 3RROA 1UXGA 3VZPA 3GAZA 4ZJUA 4UEJA 3ZH2A 3GGGA 1YE3A 1A72A 2PA3A 3KSDO 1X7GA 2DTXA 3BA1A 1PGQA 1UXHA 2X6TA 3VZQA 5ICSA 1I01A 2QZ9A 3E5RA 4RLHA 5CHEA 1LQTA 1WXDA 1ISFA 1AHIA 1RM3A 4PLFA 1U7HA 1O0SA 4YVFA 3PDJA 5A3VA 1U2GA 5JW6A 2WYVA 3AWDA 3QWBA 1WNTA 1IYZA 4IDAA 3ZWPA 1BMDA 3U09A 5KJ1A 4JJIA 1I10A 3LSYA 3VDQA 3VDRA 1FDWA 1WPQA 2GN4A 4DQVA 1FK8A 3SEFA 5FFFA 1X0VA 3GEDA 4YJDA 4WNIA 2Z1MA 1KVQA 3TFQA 3CUKA 4DRYA 1O89A 3BMNB 3ENKA 1AN9A 1U1IA 3DAGA 2O2SA 5A4DA 3AUSA 4Y6RA 4Z6KA 1O6ZA 3TSCA 5DCYA 4BNWA 2X5KO 5G2OA 5AXDA 5IDXA 2NACA 3RJ9A 1NVGA 1A4UA 1MXHA 1O94A 2XF8A 3GMSA 3S8MA 2FZEA 3DB2A 2VZ9A 3ZWCA 3KEQA 4WLNA 3BHJA 4WUVA 1CYDA 4BO7A 2JD2A 2PWZA 2NLOA 2UUOA 4KUEA 3OSUA 4AJIA 3GHHA 3PHLA 1JN0A 3VOSA 3AW9A 1FJHA 1UP6A 2NSDA 4N5LA 4PFJA 3H3FA 3I6QA 4FCCA 4CPDA 1F14A 4G5HA 1NWCA 2X5JO 4DQXA 1CF2O 3EZYA 4PLWA 1P74A 3PHIA 2Y1OA 3KSZO 1QLJA 2P5UA 3ZHYA 4CM8B 4EYEA 1HDOA 5U1PA 3AY3A 1LQUA 2HDHA 5BR7A 4HFRA 3GRPA 5TT0A 3GNTA 4BB5A 4WKGA 3NGLA 3DAFA 1XDWA 3QSGA 2J5RA 1MG0A 2HRBA 1HETA 2DUWA 3CMCO 4XQ9A 3JQ7A 1ZIDA 4DLLA 5A9SA 3K73O 2GN8A 4CQMB 1SNYA 1ISGA 3L4BC 3DZKA 3AOEA 5EQFA 1GPJA 3GK3A 4AICA 3KOUA 2OUIA 4P8RA 4XR9A 3GEGA 4I9NA 2O3RA 1J4AA 1EQUA 2D1YA 3WGYA 3H5RA 4B4OA 4QT0A 1TT5B 4XR4A 5B4TA 4ONEA 5LCXA 5CEJA 3UF0A 3QQPA 4JBHA 4BNTA 3PHJA 5HRUA 4XB1A 3GDFA 1SB9A 4YAEA 4NQZA 1CQJA 1T25A 1HDGO 4I1IA 2V6GA 3DHYA 2JHFA 4D0SA 5MDHA 3RUEA 3P2YA 4FC6A 5ILOA 1V3UA 3OF2A 1ENYA 3PIDA 1LSUA 3ON5A 3EMKA 4Q3EA 4E5KA 2ZTLA 4OM8A 5HA5A 3RFTA 3NUGA 1ENZA 3STHA 2GPTA 4FJ2A 1JVSA 5BSGA 1LJ8A 2DM6A 5JAQA 2IZ1A 3HFGA 4OKIA 2FOIA 2NUAA 1Q2XA 2B83A 4AJHA 5HTOA 1DFHA 4RZHA 1Z75A 4EW6A 3DEYX 5TRTA 3ANNA 5F1OA 4PLPA 1J0XO 3U5TA 1ZZEA 1UXJA 4BKRA 1CERA 4XQCA 4LVCA 3OIDA 3QY9A 3WBFA 2HUNA 4NBUA 4EJ6A 2D8AA 4PG5A 4RPLA 5F5NA 2B5WA 1FDVA 4WJZA 2JHGA 4BNIA 1VRWA 3BMNA 3VTFA 3K2BA 4QO7A 1RPNA 2W4QA 2GN9A 3DZGA 2E6UX 4IDFA 3S55A 1UH5A 4CMAA 2IZ0A 1WMBA 2V6BA 4BO5A 4J6FA 2F00A 1N5DA 4MO2A 3TL3A 4GL4A 4J4BA 4J1TA 5GZ6A 4UAGA 4AJPA 5IFLA 4CLRB 2ZYAA 3ZCXA 3ADPA 3VZSA 1PTJA 4TKLA 4CR7A 1XA0A 1I3NA 2GR9A 4AG3A 1WVGA 3AOEC 3OBBA 2EW8A 5TT1A 4N7RA 1QYCA 1QXSA 3E9MA 1P33A 4PCVA 4TRJA 1C0PA 4M49A 1MC5A 1IUKA 3WGHA 1SCUA 2AQ8A 4C7KA 3PGXA 4FFOA 2VHWA 4GX2A 2BLLA 1EFLA 4R1UA 3OJEA 1HDYA 3FPLA 1PZEA 2A4KA 2FR0A 4DLAA 3RUAA 1LLQA 1WWKA 5JAZA 4CM8A 4TVOA 3HDQA 1QV6A 2VT3A 5A04A 1PU2A 1C0LA 3RFVA 5JY1A 2ZKLA 5CFZA 2D59A 1GPDG 4B4UA 2ZJ1A 1PGOA 2PGDA 4NFHA 2JD0A 4LMRA 4PLZA 2NVBA 2Y0CA 3GF4A 3HQ4O 3N58A 4KTTE 3H5NA 4DREA 5BNTA 2X0JA 1DC4A 3CPSA 4IY1A 4CM4A 1NVTA 4GI2A 5L4SA 5EL0A 1RKXA 4NIMA 4CQMA 3JQFA 4DMMA 5L45A 4CM1A 2C20A 4PRLA 4F3YA 1Q7GA 2Q99A 1EEHA 4R1SA 1TA4A 4WLEA 2J3HA 2NVUB 1XR3A 1KVUA 1PL7A 1SOVA 4UVDA 3K8ZA 3KUXA 4LSWA 2POQX 2JAPA 2IZZA 4CMBA 2B69A 3VPHA 3B1JA 1MB4A 1IZ0A 2EHDA 3RC2A 1IE3A 1Z6ZA 3AI3A 2CDBA 3VPXA 1VPDA 1X1TA 3JQAD 3ZWNA 1G0OA 3V5NA 1NYTA 4NI5A 3MCVA 3SX2A 1X7HA 2Q2VA 1NFQA 3TRIA 1GYPA 3CE6A 3G3EA 2QRKA 1I3LA 4ND1A 1D7OA 3N7UA 2C07A 2O7SA 3OJOA 3WOHA 1EUCA 1ORRA 4F46A 2Q45A 1MG5A 1E7YA 3DFUA 1ZBQA 3Q11A 2WYUA 4BS9A 1VKNA 3WFJA 5FEUA 5JCJD 1ZSNA 3QVSA 1BHSA 1NASA 4IXWA 2J3KA 2BRUA 2J5KA 3QWAA 1DC5A 1T1RA 3B70A 5JBIA 1QYVA 2JFHA 3H8VA 2P4HX 4BNXA 3MOGA 4MDHA 3OM9A 1Z7BA 3OA2A 5BSFA 2E49A 3SLKA 5CPFA 1IPFA 1GZ4A 3QE3A 1KVRA 4IIVA 5ER9A 3ZWBA 4A26A 3EZLA 1NR7A 2RHCA 4LRTB 4I5EA 1G0NA 1P1RA 2AW5A 4E3ZA 4EJMA 3E5MA 2WD7B 4LK3A 1EVYA 1SEPA 4E32A 4PRKA 5TX7A 3WMXA 1BG6A 1GD1O 1D1SA 1PS9A 1YB4A 1S7CA 3VZRA 1R4MB 5IXYA 1B2LA 1VLLA 1Q0HA 4FGSA 3GFGA 3DXFA 2HU2A 4HNHA 3GLQA 2Y1EA 1HYHA 3WXBA 1I0ZA 1YDWA 1JU9A 1NPTO 1BW9B 2BD0A 2XAAA 3ONFA 4J2HA 4YYZA 2C0CA 3Q2IA 2BGMA 1KEPA 3ENNA 3HADA 3JQGB 1K89A 1DHRA 4LSMA 3RUDA 4GWGA 3W8DA 5DOVA 3ONEA 4L4XA 1KIFA 2O3JA 1PX0A 3G49A 2AQHA 5COAA 1U2DA 5B12A 2NNLD 4AJ1A 2AEMA 4YQZA 1OOEA 1RM5A 1IOLA 2UDPA 3PEFA 5JAMA 3QJ5A 4YAIA 1I8TA 2Q46A 2VOEA 4E0BA 5HM8A 4B4VA 4PN3A 2I99A 1KBZA 2CVQA 2PLAA 1H6AA 3Q6IA 4R01A 1ZNQO 4XGIA 2AA3A 1U5AA 4BO4A 2XXBA 5F3RA 3ZGYA 2LDBA 3BTSA 4LRSB 3IKTA 2EERA 3WJAA 4RL6A 4D3SA 1JQBA 1LDYA 4PLCA 4PZEA 5EIOA 1ISHA 4FOSA 3R0IA 1X14A 3ZHZA 4CLDA 4KQXA 1LI4A 1GYRA 2ZTVA 5IF3A 2FP4A 3DOJA 4GGOA 3OEWA 1TI7A 4BKPA 3NT2A 2BGKA 2UVDA 4MVJF 4HFNA 1HSZA 2WWRA 3ORFA 2CSUA 4B4WA 4KQWA 1X7DA 4M54A 4RLSA 4D45A 3TZHA 4MINA 4IJVA 2OORA 5A5FA 3ITDA 1A7KA 4FFRA 5EQDA 3HB5X 1LLUA 1OFGA 2VNAA 4YTEA 5JY6A 1DRVA 3ZI0A 1HZJA 4L76A 3LT4A 4MIYA 3DBRB 1P1HA 4AVYA 3ROPA 1UP4A 4GGPA 3EVNA 3WYEA 2PFGA 3A4VA 3P2OA 1C3VA 1HRDA 4MVJE 1LRKA 4BB6A 3IS3A 2R6JA 4IM7A 1YBMA 3I5MA 4HV4A 1YL7A 3KLPX 1WMAA 5U4QA 3KSUA 4CLXA 2YQ4A 3H7AA 2RIRA 5ES3A 5JE8A 1I5RA 1P0CA 3AM4A 3PQDA 4GBJA 1A71A 4YB8A 4AJKA 1CQIA 1Y5MA 3OIGA 3GGOA 3WSVA 3BTUA 3GOHA 4R1TA 3GDGA 1PZFA 1YO6A 4BHTA 1I24A 2BGLA 2P9CA 1QR6A 4KWHA 2HLPA 2I76A 5DBFA 1GTMA 5DT9A 1MA0A 4BNLA 3DAPA 1F17A 3FCOA 2V65A 3ETEA 2ZTMA 4J16A 3V2GA 3QIVA 4G81A 4XCVA 3FF4A 1E3LA 2OP0A 2Y0DA 2QX7A 4CM3A 5CDGA 5CDYA 1H9BA 1Y8RB 4KUGA 3LF2A 5JO9A 1OAAA 4YDRA 5A03A 1E7SA 3K9QO 1Q0LA 2V7PA 3PQFA 3WGOA 8ADHA 1LU9A 5G4KB 4FFLA 3E18A 4L4SA 3I6IA 2QQ5A 1R0LA 4ITUA 3V1TC 4XRGA 2CF5A 1JKIA 1R4MA 5IDYA 3FSRA 3P19A 4E21A 3WYCA 1NVMB 3AU8A 3GMDA 3BTVA 4BNGA 2AEFA 4JJFA 1EFKA 5KIAA 2X9GA 4UVIA 1BW9A 3DL2A 4W4TA 2G82A 2GGSA 2LDXA 4C7JA 5BSHA 2DKNA 2JCXA 2GZ2A 1VSVA 3G0OA 3JQGA 2D5AA 5F1PA 3GVXA 3SJ7A 3LT1A 1M76A 1A27A 2VN8A 1X15A 1F0YA 2DU8A 3DONA 4ZRMA 1JAXA 4DC1A 4EEXA 1ADBA 3KM0A 4Z0HO 3RC1A 3ZWVA 2W90A 3VPSA 3FN4A 2ZCUA 5JDCC 2VUTA 4RV9A 4RF5A 1JLLA 4EBFA 3JD0A 1R6DA 3GPDG 4ZVVA 3JYQA 3F4LA 3GEMA 4OH1A 5C7OO 4RVGA 1ZCJA 4YJHB 3I4CA 3TOXA 5LDHA 3EAGA 1V6AA 3GA0A 2E48A 3EDMA 4PLGA 4UVHA 3RBXA 3QWFA 3F6YA 3R3SA 1F8FA 2WTBA 4IDGA 4NHEA 4OSOA 4BNKA 5HS6A 1IPEA 3INGA 2VRBA 2P2SA 1LA2A 4E4YA 4CL8A 1YH3A 1ONNA 4UULA 4BGUA 2EKLA 3JQ6A 3E8XA 3H9UA 1ZK0A 3D7LA 4B79A 1GR0A 1D8AA 3H2ZA 3NJ4A 3U3XA 3JV7A 4DWVA 2ZIZA 4TRMA 3M2PA 3RBZA 2C59A 3MJTA 3MJ4A 4YR9A 4PG4A 3ROMA 1NXQA 3IUPA 4WCFC 1JDJA 1LEHA 2Z5LA 2SCUA 2W8ZA 1I3KA 3DBRA 2FPPA 1HZZA 4XX0A 1QORA 2BI7A 2D4AA 4IUYA 5CAEA 4NU6A 3RU9A 2P68A 4B7CA 2QHXA 2Y1FA 3U4DA 4DIFA 4XRRA 5C37A 4I9HA 2DBVO 1FXSA 1CRWG 3I4FA 2OMEA 4LVUA 2DPHA 3WB9A 4KUHA 3ZNPA 1PL8A 4H15A 5JMPA 4ALJA 4HKTA 4B8ZA 2VUUA 4MVJH 2CVOA 4RORA 4BQRA 4BQPA 2RCYA 2C7GA 5A1TA 2I65A 4IMRA 3GDOA 2CVZA 4UEKA 2BFOA 4WPGA 1B3RA 4IDCA 4UVEA 4XD2A 2GSDA 9LDBA 3D4NA 4E5MA 3PFWO 3R3JA 3JD2A 3BMOB 1BSVA 2ZCVA 4Q39A 2VYNA 2YZ7A 2WE8A 2NTNA 1GL3A 3JQ7B 3NYWA 4OQZA 2HMSA 3FBGA 3OIFA 5DN9A 4A27A 5A06A 5A9SB 3KZVA 4YT4A 1B26A 2B35A 2E82A 1R37A 1OMOA 1Y8RA 4CV0A 4OXNA 2AXQA 5ENDA 5I8WA 1SPXA 1NAHA 3LC7O 4ZQBA 1M66A 1EMDA 3UOGA 1U4SA 1BVRA 3RI3A 5G4KA 1MFPA 2X1HA 3CZRA 3DTYA 4ZQEA 2V6MA 2GASA 1H6BA 4XYMA 2X0NA 1U8XX 1JKJA 3PJEA 1T4BA 2IRWA 3WGTA 4ALLA 1OZAA 3ZWAA 2AQIA 3ASVA 4RVDA 2GLXA 2RAFA 5JC8A 1GCOA 3K92A 3RKUA 3AJRA 1DB3A 4LGVA 1VE9A 4E5YA 1KY5A 4XEHA 1XQ6A 5I7EA 3F5QA 1H6DA 1CJCA 1LC3A 1ONOA 3IL2A 4R16A 4QFDA 3SJUA 4U0KA 1DIAA 3GRKA 3L4BA 2H1SA 3W6ZA 1HT0A 2P9EA 1RYDA 3ULKA 3KBOA 5GMOA 5KJEA 2FWMX 2WSBA 4GKVA 1PQWA 4HNGA 2VNSA 3WYBA 3L6EA 4BO2A 4B7XA 5I9MA 4YJHA 4BNNA 1CWUA 4BNUA
chains in the Genus database with same CATH superfamily
1VSUA 3ROEA 1I51A 3A1TA 2GN6A 3O1HB 4BKUA 8GPBA 1T2EA 2QPAA 4ARIA 2IYXA 4IJWA 4Q9IA 1NZJA 4IL5A 3HP4A 4A2PA 1Y80A 1XFAA 1B1AA 3TWOA 1J8YF 4PFQA 3LWDA 1X1CA 3DOUA 3SY8A 5HTKA 4GLLA 3AM5A 2IZ6A 5E6UB 4C4PA 3EFEA 3LX8A 4XGNA 2OKCA 3EOZA 3EZFA 4KR2A 2V7WA 1Q5PA 1QHNA 1YOBA 1U65A 1MX3A 1ESNA 1KEVA 1Q21A 2J85A 2NM0A 1BE1A 2UZ3A 3MBOA 2Y05A 1DRKA 1Z6PA 2P1RA 1CFZA 3A6FA 3AM3A 1W1UA 3C8ZA 4N5NA 3WGZA 4XCXA 1IM2A 1CBUA 1YNSA 4ENUA 1EYZA 4E5PA 4FYMA 4UQOA 2I22A 4AUKA 2GFQA 1VJGA 4ZPXA 2X4GA 1E5DA 2PBLA 2OA0A 5FTJA 5AVKA 3GEIA 1YNOA 2FXIA 4LZNA 2V7BA 3NWOA 4WZBA 3FWPA 4XOIA 4LISA 1DTWA 2QT9A 3L6OO 3P9IA 5HKOA 3LWBA 4RK5A 2PGIA 2ZRNA 2VT2A 2AOUB 3KWFA 5K0GA 5AI0A 4XYGA 3ZWYA 1Z4PX 2W6ID 4LY0A 1QX3A 4B9EA 2ISSD 4NKRA 2W83A 3EZ2A 3GD5A 1Y89A 1OILA 1U2TA 2H8KA 1JTVA 1ISIA 4A15A 2JGIA 4FYWA 3MN1A 3NCHA 1FJGB 4JGGA 4RPKA 4FVTA 3LL4A 1GR1A 1S0UA 3KCNA 2A6PA 1SN7A 3P20A 3KSRA 3LIPA 2XUPA 3DVQX 4DCTA 1EX9A 1N2OA 2QJTA 3GFFA 1II0A 1M6VA 4URFA 3JQRA 4D42A 2O7VA 2X7HA 3EUFA 4NJMA 3BMOA 2X6RA 5FPSA 1TRHA 3ZK9A 3ZBUA 3NM5A 4F4JA 1OHHA 1YB1A 1TQDA 4OAQA 5EQJB 4X1KB 2FDRA 3FCSB 2WUDA 4MA0A 2C57A 5DLEA 4AJNA 4CM4B 2ZT5A 5KMGB 4COKA 1TJ5A 4JODA 1GSOA 4S1PA 4LDJA 3VR2A 4OX9Y 3LC2O 4I1SA 1ADFA 1F8GA 4B46A 3PNKA 2Y3IA 1FYFA 2YWEA 4ARBA 2YKGA 4GXNA 5DV9A 4URYR 1OBHA 4DPLA 4FD3A 3ZXIA 1LK5A 3FAZA 4UEOA 4ZI5A 5A02A 4Q47A 2WB4A 4II3A 3SYKA 3F8WA 1R9GA 1SAYA 3PF9A 1E98A 1MF7A 2HSGA 3I64A 1NQTA 3KWJA 4M4SA 4C06A 5BPHA 1I1OA 4CKEB 3DMYA 2XV1A 3FI9A 4PV7A 4DDUA 3VPBA 3R5JA 1N6RA 3UWMA 5KTKA 5P8WA 3DEZA 3N0VA 5JARA 1P6UA 2FGKA 3WMFA 3GLGE 1NJGA 4RIFA 1E2GA 1LKZA 1TYCA 3GRZA 3LCVB 1JLKA 3QOYA 4PRYA 3NTQA 3R6GA 4RA9A 5CRIA 5AI4A 2GVNA 4D3XA 4LF7B 1U9JA 2QRGA 3NBQA 2B25A 4FHZA 2YN0A 1ACLA 3F6BX 3O83A 4G2NA 1SG9A 5EZYB 1HRKA 4D97A 1Q20A 3IXMA 4ROSA 4R1LA 1S6YA 4P3XA 3BJRA 3N76A 4M0PA 1UJMA 4MSUA 3FDIA 4MA5A 3DVLA 1QP8A 4FT4A 3K1JA 3MTGA 4UM5A 2YJZA 2BHTA 3SF8A 4EZIA 1Z2EA 3ADKA 2P9ZA 3T3NA 4GSKA 5FR1A 4QULA 3H9QA 5J5CA 4DJFC 4OHMA 4J1QA 3C14C 4DA7A 4D9FA 1C30A 4EDHA 4HVCA 1WULS 3VNAA 2ZANA 1WUYA 3EA0A 2W4IA 4C5CA 5JQGF 1TVKB 2JAUA 2VTEA 3SAJA 3SZOA 4ZGBA 5F7OA 1ZAYA 1NNUA 2O7QA 2XCIA 1KXJA 4INJA 1WOMA 1K6IA 1S2IA 2AMVA 3IVCA 3TD2A 4EKNB 5JMWA 1Q0QA 4PLYA 2XEXA 4HZGA 4RSMA 1XZJA 2NZ2A 1VBMA 4JKYA 1PRYA 5ITSA 3H9JA 3I23A 2I03A 5TT1A 1OH7A 1RZRA 5SYAA 1KR5A 5SYMA 3DG9A 2FOLA 4BAUA 1R3DA 1JHYA 1BHQ1 5JMOA 2QK4A 4ZJZA 1D4AA 5A05A 5B3KA 4PNZA 1Z6XA 1P1IA 3LD9A 3UAXA 3C1TA 3ML1A 1QG2A 2Z95A 1TYBE 4BJ5A 4LWZA 4BB0A 1T0BA 4ZICA 3BSWA 3OC6A 5KYTA 1P61B 2X8JA 4K1LA 2C97A 4OLHA 4ZYUA 2FZKA 1SXJD 5JXHA 2JLQA 4UDYX 1Y9JA 2CLLB 3AKYA 1PR0A 3VU3A 4KDEA 4ALMA 1DBPA 2Z8XA 1N5MA 4L5BA 3N2LA 5JWRA 1Z5OA 4WKNA 3FOAA 1TVEA 4TS4A 4FD2A 4P0TA 1GHTA 1E3SA 3NANA 1E2JA 1HYGA 2W4MA 1E1RD 1K3UB 4MARA 4PLVA 2HL6A 1ISPA 2FMIA 4J0FA 4OHZA 4GMKA 5A6VA 2ZSBA 1IXYA 4UMDA 1ZH8A 2QQ0A 2RH9B 4FYKA 4YCAA 3W8EA 2B1IA 3QPAA 2DTEA 3R77A 2EARA 5JZVA 3DR5A 4DV0B 2YCBA 5L7YA 3PXXA 4HQLA 4CDGA 4CKZA 2YW9A 4L7QA 4NZYA 3WJ1A 1Q0RA 1EFUA 3Q72A 4ZCRA 1L8LA 1XJQA 4JA2A 1C8KA 1NZFA 4NE2A 4ZV7A 5T4BA 1BXRA 2WMYA 2DULA 3JQPA 3EGDB 2VH5R 1H2AS 1HH4A 3NRCA 1JHMA 2HSJA 5JZOA 2X40A 2VC2B 5HPYB 2FP4B 1MAWA 4WA8A 4F1WA 1Z18A 4MR8A 4MQMA 3IE1A 4UTRA 1ZC3A 1TJPB 4AY6A 4MKXA 2KE5A 1H8ED 3DP9A 4NYJR 4RSGA 2ZIXB 3R8FA 2E4YA 3DBHA 2JZNA 1PHRA 3DLHA 1S8OA 3FE2A 4QTTB 3O03A 3PIIA 3QFCA 2QL6A 4QJ5A 1XF9A 2CEAA 1U1CA 3EF0A 3INNA 4I46A 3UG7A 3D0OA 2CMFA 1LV7A 3K0EA 4BV9A 1KWGA 3V80A 2B6HA 3HDYA 1QRAA 3KUDA 4Y7CA 4DLVA 3TTUA 4LS3A 4X0EA 1O6BA 3WRVA 1SUAA 5AXAA 3SC2A 3RS4A 4C0JA 2HJHA 3IKJA 1HDRA 4DG8A 3W2GA 1I5EA 3DHVA 3ER6A 2QL7A 3HVKA 3PUYA 2BM9A 6CHYA 1DIOB 4Y6PA 4I36A 1RBMA 4FSXA 2P62A 1OAOA 4QEDA 3TB4A 3D5EA 5JUWA 3OZGA 1BXGA 1XKXA 4Z2YA 2BFNA 4HDQB 1P3JA 4WVFA 1W96A 3W3ZB 1QF6A 2JA1A 3QYFA 5ES4B 2G9ZA 3ZHBA 1CZHA 2J6CA 1E7RA 1LDEA 4D3YA 1AC5A 5C8XA 4Y6OA 3FWNA 2EL9A 2HDNB 4TXNA 4DNFA 2FY8A 4XPIA 4WJLA 2P6OA 4Q82A 1QYDA 4E08A 1EJ0A 3DMTC 4MO9A 4GU5A 4WHMA 2JLYA 5IJ9B 1L5OA 1VA5A 3KTOA 3MM4A 5AW3A 1BOOA 4IMJB 3OICA 5DHAA 3T5BA 4YCBA 1GPWB 1PLLA 1XRPA 3VR0A 4Q4HA 5FH9A 1XXHA 4H16A 2W2LD 3WDKA 4F56A 5K4GA 3I1IA 4O4JB 4LN1A 3K0KA 4J4HA 4G0UA 3M4JA 1HNWB 2PPLA 3IP7A 2HJWA 2J48A 3KXPA 3OPMA 4RQTA 4RM2A 1QZTA 4V0LA 4DWOA 2H9YA 1FFHA 4P34A 4W6QA 3TLYA 1T34A 4BNFA 3ANLA 2J1LA 4WEQA 1YFZA 3IEIA 4GZLA 3RU7A 4RU1A 4N3CA 1U3UA 2FR1A 1JEJA 1HL3A 2Q2OA 4L3VA 1L6RA 4ZI7F 2JAHA 4C3OB 2IH4A 1KE1A 2YV5A 2OK8A 1G8HA 3TQOA 3DZDA 1P7CA 2RHJA 4KLAA 2C8JA 3ZCPA 2E4UA 1NBEA 4KKXB 4DA8A 8AT1A 4AF6A 1IATA 3OZAA 3WL4A 1I2CA 4Q4AA 2VPQA 4X3PA 4BVAA 1Z34A 3CLRD 1OI4A 3GX1A 3N2KB 2BL4A 5TB5A 5IM4A 1Z5GA 2O8BA 4FMCB 3F5FA 1EFRA 2VYCA 3IAUA 2DLCX 2XQKA 4GVLA 1HK7A 1QS0A 1MJNA 3G8AA 1GZSA 3G79A 3L84A 4ZD6A 4V0KA 2WT8A 9LDTA 1SY7A 2IA5A 1CG6A 3NEPX 4N4AA 4OIFA 4ILKA 2A84A 4LI0A 3DOIA 4RIHA 3W8RA 3IQHX 3L7MA 4E7PA 4D7AA 2XPCA 1YA4A 2QSUA 1ZESA 2VOJA 3D43A 3G8DA 4NBWA 4I3HA 2FSPA 4B33A 3N53A 3CVWA 4CJXA 4DBVO 3ADOA 1TPYA 3Q7TA 3D5TA 1AKWA 1ECBA 2ZYWX 3GY0A 4CQLA 5JPDA 2DMRA 2RMKA 3I2JA 2IDJA 4D6PA 5T3YA 2Y6VA 4XM1A 3VPFA 5KJ6A 4DV6B 2VSFA 2DY1A 4FCVA 1P7YA 4TLAA 1A4IA 1KTVA 3AMVA 3I8XA 2V9ZA 1XZLA 1Y6JA 1YVUA 2QTZA 2WG2A 4YCJA 2G3YA 3SNHA 5JS2A 1TM2A 4BGVA 5K0ZA 3KR2A 4FW8A 3NR2A 1SCDA 1TLTA 2DC1A 4K6HA 1NC3A 2A92A 2I78A 3GFVA 1TF2A 3RYFB 3BQ9A 5A4AA 3SR3A 2OCDA 2I71A 3TZBA 1CV2A 1NOKA 2POCA 4JAVC 4ZXPA 1SHTX 3WIVA 1ZJYA 2IUYA 3PHGA 4HC4A 1J0CA 4PW0A 4WERA 1VIDA 2BI8A 3RT1A 4MKRA 5LDGA 4PSKA 3A9SA 1W4ZA 3ZNNA 1MVOA 1RKBA 2PJRA 4CUZA 1QLHA 3EQ8A 5DBOA 2R2GA 1DOZA 5L7WA 2V5AA 3LY5A 4HADA 3RKRA 5A7FA 4Z9BA 2RGNC 2TMDA 2FAXA 3P8ZA 5JWOA 4CF3A 1JFSA 1SBCA 1IMJA 2C2YA 1LPOA 3VGJA 3I1YA 3TZ6A 5JDCA 2C5AA 5DO9A 3FY4A 1KHHA 2V59A 4RTOA 1LS6A 1U7ZA 2H4WA 2TMGA 5DX8A 1E6UA 3LQFA 4C0SA 3C6XA 2B2XA 1F06A 1ULHA 4X1IB 3QXGA 5JEEA 1AHPA 4D9MA 2RAPA 2PJDA 2LIVA 2XGGA 1ZH4A 4WBNB 5GINE 4CIBA 1A9XA 3IT0A 1JWBB 1O94D 1ZGCA 2DUUA 2I1WA 3HYTA 1B0AA 3DV2A 3KJFA 4KB5A 4QELA 4CIYA 4DA4A 2WINI 4G0OA 2G0NA 3H9GA 4AS2A 1A2QA 5BRNA 2XMCA 1QTQA 5I7UA 5DGCA 2V58A 4AS3A 1RXSA 2VDNB 1EB8A 3GEBA 3RF7A 3UGTA 4UM8B 3WP0A 4HX9A 2F4VB 1SRQA 3RHFA 3R7WB 3GCDA 4UVGA 1EWVA 2F1RA 1R0KA 1UOOA 1YJCA 2Q3JA 1WEKA 3ZNOA 1MPXA 3BD6A 3IQIX 1F2DA 3NHUA 4BO6A 5KUTA 1FFYA 1Q3TA 2Z04A 4BQQA 5AW1A 3K0FB 4DJTA 3EW7A 4KQ9A 4WZAE 3MQ4A 2BGTA 2R85A 4NPCA 2OD9A 1MHTA 1ZVKA 3F46A 5AHKA 4DV7B 4M88A 3OUUA 5KQPA 3AY6A 1L8OA 2VVTA 2YCLA 1YQXA 4HFJA 2XAUA 4JLNA 4URZR 3W4JA 1UXKA 1DP4A 1KDYA 1AB5A 3NXKA 5HZGA 1DAHA 5LP6A 1SKAA 3O2NA 4AMZA 1PNQA 2EQAA 5LDDC 3CEAA 4HDAA 4NBKA 4P31A 1G9XA 5EYPA 1H0SA 2D2FA 3RTAA 2OVFA 2R6AA 4DILA 4S04A 1G8YA 3U4GA 2RKBA 2DKOA 1W0KA 1U5BA 3KQOA 3KYCA 4Q7KA 4RKRA 4ZQGA 5LN1A 3OJLA 4OJKA 3I9MA 2IHKA 5K3FB 4EG7A 3OQMA 2O59A 1P4JA 3CZ5A 4L1KA 4TXMA 3B1KA 1GUFA 5IKOA 2C2OA 3DR3A 1Y37A 4DMHA 2ACVA 1QLWA 3EY4A 3FMVA 3U3KA 2XYGA 3V4OA 1FJXA 4LF6B 2Z83A 1P0IA 3U17A 2CL7X 1QB7A 1FPMA 1TTQB 4UMEA 4D79A 2B20A 3R2JA 2YINC 5AKLA 3K0CC 4M0UA 3HV0A 4DE5A 3SXUA 4U2EA 2IYNA 1M83A 4LHWA 4KR0A 1QTIA 2NN3C 1JDBC 3DMPA 4NF2A 1KOLA 5C4GB 3LQKA 2ACKA 1WU8A 3U7EB 4QKQA 4DHEA 3QEKA 3V33A 2R9VA 1M2OA 1KU0A 3DOFA 2J6HA 1RLMA 2E5WA 3E8MA 3JU3A 5FPQA 4FQ7A 4C87A 3D31A 4IIJB 4QUIA 2A0YA 1RWWA 5DWVA 4JLKA 5FNVF 4A92A 1RBZA 3SYNA 4PLHA 5I7SA 2EJWA 1JE1A 4E1AA 4LRYA 3N7AA 4JY7A 1VCIA 2D2IA 2VPYA 3AVPA 1H2EA 3OU6A 1YRLA 1SCKA 2RAVA 5CLHA 3CZ4A 2LGJA 4U3JA 3VAZA 5JS6A 3B3AA 2VLIA 3GN1A 2BUBA 1QYXA 2Z5FA 1AJEA 1DDOA 1M2KA 4X20A 5HIAA 1DBIA 3QTBA 2UYCA 1RRMA 5ILGA 4BU0A 1B6RA 3CBQA 3IBCA 3QJYA 2RKOA 3RRJA 3IKMB 3ZI4A 3ZV6A 2Y0PA 3S7ZA 1SZPA 3LPAA 3DO5A 1YQUA 2R751 5IRCD 1E1QA 1E3DA 5T5QA 1H9CA 3B85A 1E0DA 2UUAB 4P4LA 2D5IA 1WZ2A 1VIMA 1RWMA 3S2FA 1OCEA 5K2MA 3C98A 3M1LA 1XELA 4HBZA 2COKA 1VG8A 1X8JA 2A59A 3D7RA 2IQ5A 2HCTA 1UMDA 2H5IA 4EOGA 3ZXUB 4H59A 1I2BA 1U98A 1H05A 2NPOA 4TL7A 2YC2C 4JI5B 2FZLA 4B7UA 4M0MA 2F1KA 3F96A 4H1WA 2Y66A 1GQYA 3ILXA 1NTRA 2BF4A 4LRUA 4O1MA 5FL7D 5INTA 5KTSA 4RKFA 5MFPA 1NXSA 2PL1A 4G86A 4KQ1A 4Q1VA 5H8WA 1RT9A 2NZUG 2R1ZA 2SKCA 3SIXA 2AMFA 1QWOA 2BBTA 2QXUA 4N1AA 5DDIP 1CF4A 3PGVA 1BX1A 3E3NA 2WHPB 2WAAA 4MUMA 4Q3KA 2D1TA 4W7IA 4YAJA 4DSNA 4MV3A 3ORSA 2QJWA 4J0EA 1EX1A 4BX8A 4PC1A 1KJIA 4ID9A 3UMVA 3BMQA 2FG6C 3WK8A 2IYAA 3IP9A 4LXTA 1N1DA 2VEOA 2Y2VA 4E5VA 4CLOA 1KJ8A 2FJUA 4I6GA 3NMUF 3P27A 4U5QA 1J39A 2B1JA 4QGAA 5IAEA 1JU3A 1D1TA 1GADO 1E92A 3G0GA 3LQ2A 3ICVA 2BFDA 1V26A 3JWJA 5DTQA 3H9BA 3PVCA 4BQEA 5HUJA 1HLDA 5EZQA 3SLGA 2ZUVA 1HI9A 1I94B 2PGOA 3LVRE 5FOWA 3WV5A 5REQA 4UHDA 2VQ6A 3UY4A 3VTAA 4NH4A 5L53A 1RQPA 3TM5A 1K5DA 2Q6VA 2ZVQX 3VV3A 2FQQA 1JHAA 5JXWA 3ZWMA 4V1CA 8MHTA 1ML4A 1E7QA 2E1PA 3D3WA 2OWEA 4PYLA 4KNYA 2ADMA 4CMEA 2CUTA 3ILSA 2VBFA 4C07A 1E96A 1JEQA 1VYUA 1V6SA 3QRWA 3DKRA 1WZCA 4TV9B 1YS7A 2XX3A 1KNXA 2LIPA 1Q77A 1OE0A 2OR3A 4IHAA 4NJMB 2REBA 3D1JA 3UHJA 4DLWA 5CFNA 1NSFA 2G7MC 1BWPA 4PX2A 4C05A 5JNSA 2G1UA 4I08A 1E1KA 1TUEA 4KP7A 4TPKA 5K0LA 4A10A 1NAIA 1OKKD 3AJEA 3L06A 5ESXA 2P9HA 3R5KA 2C58A 2ZWIA 3NEAA 4X7PA 3BJMA 3ONVA 4QE3A 1K97A 1UKEA 3SEAA 1SMKA 4ODIA 5KX5B 4RH1A 3NHWA 3RHTA 1L4HA 2XNCA 4H4EA 1PZGA 1RYFA 1PFVA 2GQ0A 2YIDA 4KXMA 4Y1FA 2PSJA 1TYAE 3L0DA 3MB8A 2H4YA 3K72B 2EX0A 2VDJA 4KXFB 2B2CA 1OFIA 3V7WA 3CKYA 3A2LA 4M60A 4FWTA 2O2DA 2XQJA 4C08A 3GP3A 1V39A 2JARA 3EIUA 2E6KA 3MJHA 4BJHB 2ZB3A 2NO0A 3KJGA 3KLNA 3LGXA 4UCQA 4DWWA 1N2XA 5BSFA 3RYHA 4GLFA 2Q50A 2RKWA 3MIIA 1T6ZA 3SC4A 2VJCA 2OSBA 3OCWA 1C2TA 1L4LA 4P84A 1KJWA 1KIAA 1GEGA 3NUQA 4ZHQA 221PA 2LKCA 4BOYA 3RFXA 5JH7B 1QGYA 1Y6QA 2G36A 3IHKA 1RWVA 3MJVA 5AKJA 5H02A 1YZUA 2CMDA 4PXSA 5BN5A 1D7AA 3HYCA 3W5DA 1DIBA 1G5HA 2X58A 4FGWA 1NE7A 3I73A 3WLMA 2IBMA 4JOCA 3WWOA 4K46A 4M7WA 2Q2WA 2B8NA 3NW9A 5IARA 4IJKA 2CUNA 4DIDA 3SF8B 3LLUA 1TIKA 2HSWA 4TTAA 5DM60 1U9IA 4JBGA 5E3JA 5H0IA 3O6VA 4AAYA 3DAYA 3F8SA 3M2TA 2L19A 5GZ1A 1CR4A 1IBMB 4TYMA 3B6EA 4O2AF 3HN6A 4RM3A 3TNDA 5AK5A 1W5BA 1OGIA 1DQSA 2FHSA 1LK7A 2GBLA 1DG9A 4JDPA 3VVBA 4BVJA 7MDHA 4DR7B 2Z3ZA 1NHGA 4J2OA 5AW5A 2FDXA 2HWKA 5JZMA 4RZQA 3PHCA 3A1EA 1WM1A 1XG5A 2VDKB 2OGUA 3SZ3A 3FNGA 4ZQHA 5J23A 4BNZA 1DDIA 2FWJA 5FQNA 3B8EA 3GH1A 2DR0A 3ESXA 1WAMA 3L6RA 4L74A 3WRXC 4OYYA 2HA5A 1PBTA 3AR9A 5BUCA 2BEVA 3QX8A 1P2GA 2AUMA 1BJTA 3CIFA 4MYHA 4GKAA 2DWUA 1A8PA 4ND7A 4TWJA 3ACCA 3DDNA 4KX5A 1OXUA 2J45A 4KMSA 3A58B 4O4IB 4XWYA 3TI7A 1VE6A 2OE2A 2VUIB 3RKSA 1T43A 2ECQA 1YA8A 4UDNA 5F5XA 1H2HA 1T6BY 3UXYA 5DI3B 1SOAA 1VM6A 5JCOC 1OX5A 1KPGA 4NG5A 4AULA 2OAQ1 2IHUA 1GGMA 3DL4A 5HQ3A 3D6AA 4FCTA 1HQKA 2ZTUA 1Y5IA 2YJNA 2HKIA 4NP6A 5DGTA 4JBYA 1MVLA 4IYRA 5F98A 4HPJB 2LR0A 3PFGA 3GGCA 3UUWA 3GU3A 4E2ZA 4HAIA 2DG2A 4GZ6A 4OBBA 5FBWB 3K4QA 3DDOA 5B6PA 2IY8A 2YZNA 1W85A 2HIMA 2C9OA 3DAHA 2B0JA 3I2FA 4RLQA 4WBXC 5FORA 5EIWA 1MW8X 5BSRA 5IDWA 1K7FB 2AK3A 3A9VA 4G0PA 2AG1A 4DDWA 3N8NA 2BEUA 1I1QB 2ADOA 1ZM7A 4IOMA 1KPHA 2JBAA 3NG1A 3NKLA 5BQFA 1JAZA 4RQBA 3CXRA 4M1WA 4RWZA 3I2HA 4PZ0A 3KYBA 2QE7A 5A5GA 2C04A 3A7DA 1NFRA 2AI3A 3E5NA 4YAWA 1W9HA 2PNFA 1X19A 4V0RA 3HZRA 5K8LA 3NPMA 1MEJA 2FN3A 2CLIB 1N33B 3BC1A 3QVXA 5BOSA 2BP7A 2DWQA 3CRNA 4ZOEA 1UP7A 2AYYA 4DYDA 3ESCA 1RKVA 3N7TA 3ZQ6A 1FS5A 4GQAA 4JGIA 2OCLA 4RJIA 4WK4B 4NYMR 1ZNZA 2YJ4A 1GZ7A 1VPLA 4CDRA 2JBHA 3T0GA 3UA3A 5ERGB 1JXAA 3DBHB 1S3IA 3B7WA 1SUDA 2PRJA 3IJPA 4WZBE 3QU5A 1N9GB 2WP0A 1KYXA 4D9EA 2H2IA 3MJFA 5EJ5A 5KINB 1QGAA 3UXHA 3D8RA 1HE4A 5G0WA 2GF9A 4G9GA 2X23A 3LYLA 1G4AE 2QYOA 2QSZA 3RE1A 4F2PA 3QPBA 1FNCA 3SC2B 2ECPA 4HDKA 2ZDHA 1OV6A 2LCFA 4MUEA 4S0XA 1MB9A 1M2FA 1VLJA 2CC2A 1DGQA 1UJ4A 3O8OB 2OBNA 1CB0A 3CRRA 3UT5A 4L4RA 3VVCA 2DWOA 4CMIB 1ONBA 4TVKA 2H8GA 3B2QA 4LCEA 1W46A 6AT1A 3Q9NA 1CUXA 4KO8A 4ZXFA 2IIQA 1VE7A 5K99A 3I9JA 4TKVB 1QGDA 4Z3KA 4DIEA 1WCYA 2IEBA 3ABOB 1FRFS 3BKXA 1PSZA 4NDNE 4TKMA 2TMKA 5ITWA 1XZBA 4PSAA 1KDZA 2WIJA 3Q3IA 4CMGA 1Z0UA 4TMZA 1KMIY 4II7A 4C89A 2ZYIA 3VU8A 1L7XA 4XQGA 1CE8B 3NT4A 5B1EA 1F5SA 1AVTA 4XD7A 5IJWA 4KIJA 3U4QA 5TEWA 5ALUA 3IE0A 5JTTA 3AONB 1F8YA 4Q4HB 5JPCA 2EYUA 4YGXB 3ZHRA 5K3DA 1MC8A 1AA9A 1M74A 4PQEA 3ST7A 2WZCA 4QG7A 1R5JA 1SO8A 3EG5A 2O5VA 1WW8A 1DJOA 2CYAA 3B1VA 4Y8VA 3NC4A 3ZE9A 5DTRA 1A8QA 3RAEC 1RPAA 1T2NA 1T4CB 3PP8A 5HF8A 3CZMA 2BISA 4W8GA 4V02A 5FAXA 2PX2A 2GESA 5C34B 4OBEA 5JISA 1YZFA 2CDAA 2REQB 5E9WA 3J80A 4AZSA 5KVCA 4U6QA 2XUKA 3NC0C 1EDBA 4IBOA 4B7AA 2NSJA 2PUJA 3AESA 1E3JA 2V54A 4JI4B 4YAKA 5A4JA 2WC1A 4NBVA 3BICA 4PVDA 2FVYA 1P9LA 3V42A 2R1TA 4POOA 1DBVO 2CLFB 2XCUA 3O1JC 5BMVA 3I6YA 1Z38A 2X5NA 3MAGA 4JUFA 4LK2A 2ZIAA 5BQOA 2XY4A 3OLYA 5LQRA 4RXTA 1RWKA 2ZK7A 3PCRB 8LDHA 3SBXA 1QQ6A 1QO9A 4FNMA 1WJGA 4MV1A 1YMVA 4QXOA 3VRHA 5KJCA 1GG2A 3PITA 1PKXA 4XYEA 2HADA 2XNDA 1IQPA 2OECA 4Z3DA 4HH1A 2FCRA 4KFRA 3CJQA 4BC1A 2ZM5A 1LWOA 1ETUA 2ODWA 2W6JD 5DX1A 4J7AA 5HFAA 1ZUIA 1MP0A 5IBCA 1FIUA 4UM9B 1RJEA 2ILTA 3S1LA 5DNVA 1J90A 3E9NA 4OMDA 5IAKA 1TMOA 3LDAA 1MJ5A 3LBIA 3NAMA 4ML3A 3FSGD 4QXRA 4ZCIA 5JD4A 2HMAA 2VO1A 1TCVA 3VO1A 2UXBB 1BQEA 4R6XA 2C3UA 1ETHA 3IOCA 1RM0A 4CQLB 5C1PA 3PNVA 3WK7A 1CYEA 4G09A 2WT4A 3DM5A 1CS4C 1Z4OA 1UFQA 2A1TR 1CS0A 3M8KA 3PHHA 3N0RA 1YR8A 2NU7B 4KZKA 3WHPA 3KE9A 2Z2YA 5DIFA 1X1SA 4BFSA 4OJQA 3MWDA 2VP2A 1SUIA 3WB2A 1G19A 4D96A 1X7WB 3EMBA 3FROA 3WLAA 2PFSA 1VG9B 5F52A 2J9RA 4OI1A 1XU9A 4OFXA 4GPD1 3VKUA 4N3NA 1XMQB 2CNDA 4I0WB 2QW1A 3GUZA 1IL0A 1QIHA 3U44B 4P4TA 3U9SA 4C4XA 5KC9A 2BEJA 3CINA 3EASA 5JI2E 2ATXA 1GUYA 1E4YA 4JVNA 2AFHB 4XGKA 3RIEA 4DABA 3D6HA 3I1JA 1RZ3A 1JG7A 3HMQA 3KEFA 4L9RA 2OUKA 2H0RA 3OM8A 1V47A 3RYIB 1G5IA 2FMKA 3S1AA 1OPXA 4HAZA 5ECGC 3S27A 3WLFA 4DCPA 3L1KA 1QBGA 1WBDA 5IVHA 1YK1A 3R5TA 3ZJUA 4KX3A 3FTDA 3UWSA 4UU1A 4N5HX 4QTUB 4GSLA 1YOVA 3OWHA 4BEJA 3HR4A 2PWBA 2FA9A 4D9BA 3LECA 2WWYA 2B1GA 3ZGVA 2VP6A 5DEIA 3P9SA 4J1SA 4MYSA 4BQFA 4QPPA 2A86A 3NZEA 3PK0A 3GG9A 3DEFA 3MEQA 4GKKB 2A5GA 2GEDA 4C0BA 1GVNB 3UJBA 1UBTS 4FBMA 3PC4A 3I0NA 1HE3A 1PT9A 2AJBA 4W9NA 3WYGA 4EY4A 4HYTA 5DM1A 5AOBA 5CT8A 4EPTA 1A5AB 5CT5A 3LYHA 3IEUA 4RZXA 3SOPA 3TFOA 3TOSA 2I4IA 2HLDA 1WMFA 1UPXA 3IMCA 3WQQA 1P3DA 3O0TA 3F97A 1VLHA 3G5UA 5G1NA 5THKA 5CITA 3EA5A 4DLTA 2C92A 2COUA 5GJBA 1KC3A 4IDQA 5EERA 5DBIA 1XSEA 1VB3A 4RK1A 3R7BA 2YV1A 5J2TF 521PA 1JSCA 1CK4A 3A9RA 4UTXA 5C2JB 3PXAA 1GGFA 4OEHA 4ZO9A 1U3TA 3TFWA 1K6JA 3W4KA 4RFSB 4Q3CA 3MVEA 1W36D 1RVDA 2VLBA 4B35A 1LX6A 1JJIA 4QARA 1XI2A 1PS8A 1G7CA 4XQEA 1QDUA 2AX3A 2OZLA 2WKRA 4X1OA 5AK3A 4FEGA 5F5LA 1EGHA 5IN4A 3RYCA 3WBBA 4TLMB 3GFRA 4OLFA 2AFRA 2WU3A 1AE1A 2DR2A 4YACA 1X42A 4B3JA 2BH9A 3VMFA 1OJLA 3BXEA 4PQGA 1THTA 4ZT6A 2V74B 4AX8A 2ID4A 1RLJA 1T9KA 1PL0A 4DRXA 3G23A 3D3JA 4QBFA 2QY9A 4KAFA 4LE0A 1REQA 1JR2A 4LTNA 1L5WA 1KSFX 4C0AC 3ZX5A 3RFFA 2JI4A 3EXHA 4FN5A 4MWSA 1MO4A 1RI2A 1X94A 2IPXA 3JPWA 4I5GA 4J94A 1COWD 4DM4A 4GH5A 2BGGA 4RUKA 1IHXA 3KYCB 4GVXA 4WY5A 2CJFA 3RSQA 5AKEA 2RH8A 4P1ZA 3TX2A 4MQUA 2WYOA 4DVJA 4YUWA 1DE0A 3HBFA 4WFKA 2H9IA 1CIPA 1JFLA 4LW8A 4B17A 2FDCA 1X3SA 3NONA 3K70C 5CDSA 3NT5A 4ZKEA 4OAOA 3O38A 3M5WA 2I87A 5DYWA 5FYDA 1R12A 1WO8A 1YHYA 3JRNA 3LA8A 1X2BA 2BELA 2FZ4A 1XYVA 1J5PA 2V6FA 3B7PA 3DT8A 3FYHA 2V7GA 4PFSA 4NY1A 3VC3A 4F97A 5JPIA 2R6FA 2QM7A 3E1KA 3R3ZA 1NVBA 3AUKA 4O5OA 4RIGA 3ZD6A 3SS8A 1BDBA 2BCJQ 4F3TA 1P62B 1LGYA 1P39A 2PL3A 3M6IA 1PR9A 4TUYA 1LBSA 4YQEA 5LQJA 4J90A 4WIAA 1TNDA 4IPTA 5KSWB 1V7ZA 1VL6A 1X1RA 1T5IA 2JHPA 3QX7A 1XXHE 2MHCA 3UHOA 4XDYA 1HE1C 4JP3A 1VLMA 4KVGA 3NYRA 4PN7A 1EUDA 3PQ4A 4A0GA 4RTKA 2OMKA 1N6NA 3OZWA 1INLA 2B4TO 1EGAA 2Q9UA 4I55A 4BE4A 4R71A 5K8JB 4WE3A 3HJTA 3GZNB 1OFVA 1X13A 2QLNA 2YWJA 4NV0A 5CR9A 4YRJA 5I6DA 1TYZA 4QOIA 4Q0MA 4G4SP 1PJRA 4NK5A 2GPSA 2VWHA 5E7MA 3NETA 3G2LA 1N5LA 3VU1A 4B83A 3JQFC 1CC1S 3T1HB 3ZUGA 1MC4A 3TTXA 1QNLA 2F9MA 4BV2A 5M2QA 4DPMA 3RS8A 3PYLA 4D4LA 4KWEA 4EUFA 3GT3A 1K66A 1YE5A 2C00A 3D64A 2V4MA 1OUMA 3QKRB 2J30A 4MUKA 3NDBB 4IVRA 5CMLA 3AVWA 4OGWA 1P7ZA 1SD2A 3TMYA 1TFRA 3H6GA 3HO8A 1OJ7A 1DUSA 4G1EB 1VYTA 4MVJA 3SM3A 1O0CA 1ISSA 2GK3A 4ID3A 2ZS7A 4XE5A 4ZWNA 4B76A 3OLWA 5L4NA 1L5HA 1UZNA 2GJ4A 1FCJA 1GCUA 3T4XA 2FPRA 2ZG6A 5LZ4A 3IGFA 4KO3S 1FU8A 3TZCA 1DL5A 4K9NA 3ZU3A 2F6RA 3PGJA 4JNCA 3SXPA 2XTMA 2JGDA 4PHFA 5JG7A 1IEQA 5BUQA 2CD7A 3R4VA 3B8HA 3HA7A 3Q7RA 3AG6A 5DM70 1EDZA 3W3AH 4CODB 1U1DA 5C8YB 3AT1A 3BXFA 3BMQB 4YUVA 1Z7EA 1G20B 1T6XA 3CRVA 3DEKA 3PRHA 3DZBA 1YB5A 2YWXA 5DCUA 2IIBA 4RCZA 3RIXA 3KUCA 3HUEA 3QUQA 3KAJA 3W1VA 4ND6A 1J25A 3HR8A 3F1KA 3HV2A 4UD6A 4MI6A 4EMUA 1AQNA 5T8KA 3U26A 3QVOA 3GLFB 1OLSA 1IIBA 1KZ7B 1V3QE 1X80A 4BKOA 4DSTA 5JRDS 1UDXA 3P52A 1E3EA 1AQIA 2HQOA 3VR6D 4JQCA 5JEDA 1T26A 2O4UX 5REQB 1YS4A 3QVVA 1ABFA 2JASA 3LW7A 2PTGA 4BE9A 4CU2A 2FTKE 1D04A 1ZRMA 5CX1B 3T7SA 4W5OA 1CXZA 2PPVA 1YQGA 5BOVA 2FMUA 3F9RA 5PNTA 3SQMA 4Q4CA 2OTCA 2FPXA 5B55A 2WU4A 1H8HD 4IQ8A 1EA5A 2EEPA 4UPEA 1QTRA 1KO8A 1DXYA 4PY2A 1JUDA 4C0XA 2IYPA 1SZJG 3H8WA 3HCWA 1CP3A 1O5TA 3KQYA 4CFYA 3UGKA 3IAS6 1Z7WA 3T9DA 1QPGA 2UUPA 3SSOA 4P81A 3I37X 3B7GA 1MT3A 2OLKA 2REOA 1CDOA 3LA6A 4NLLA 4BLRA 4YUZA 2L17A 4MQEB 2H4ZA 2DQSA 1TX4B 1UODA 2LNDA 3WJ7A 1BU5A 3BORA 1DG1G 3LQ4A 4N3BA 4FFSA 2VRCA 3PNOA 4QO8A 2VBGA 2I67A 3DF7A 4FDTA 5AVUA 1QZ3A 2FR8A 1N8KA 2I5PO 4KE7A 2ZJAA 3CC8A 3T4EA 4WZ6A 4A03A 3EFOA 1HX7A 2X5OA 1C9NA 4Y6GB 1AXEA 3U7GA 3ASUA 2AN4A 5DLQC 1YZNA 3BQMB 2O1XA 4EPYA 4ETMA 5B57C 1QYWA 3HL4A 4XDGA 3VPAA 4IRXA 4YRKA 2OQ2A 4EG5A 1YL6A 2Q3MA 3HE3A 4P3YA 3ZV4A 2WD7A 1IOVA 2ADFA 2VYVD 3EEQA 2W9XA 4CM9A 3ZWWA 3HI6A 3UCXA 1YI1A 1SWWA 4EHBA 3Q3HA 3CJTA 3FZNA 4RMJA 2KHZA 3GVCA 1PZHA 2JGRA 2X3FA 3KKPA 4C6TB 1WW2A 2IYZA 1XU7A 3T7IA 3G9ZA 4F2DA 2PEZA 3K31A 2DRIA 1F2TA 3IMFA 1Y42X 2ZQYA 3M5DA 2A9QA 3TR0A 1F20A 3LC0A 5BN5B 1Z08A 2J9GA 3UT0A 1W2HA 2WF6A 2WM8A 4FC7A 3BH6A 2QYSA 3DNMA 2HN9A 1Z5PA 4HNAB 3WMWA 3KHSA 4U5XA 3BD7A 3LDUA 1A7AA 3ACDA 3EA4A 2NO5A 3ZN2A 1IN6A 1TEHA 1N5RA 5HCUA 3T8YA 3VTZA 8OHMA 3ANMA 1Y9EA 3RC8A 3AP1A 3UWOA 2D1QA 4B3TB 3ZHVA 1NVWQ 3IV7A 2GDJA 4UCWA 4XARA 1YAJA 1TADA 5J2UB 3AZPA 3RQSA 5KYUB 4CT4B 2YJ6A 2JDIA 3PGKA 1USUA 3LK6A 3V6MA 4FK8A 2VF4X 2VZ0A 4IGAA 1UADA 3VDXA 3YASA 2QX6A 4BUZA 1YZHA 1Z7YA 4CGYA 3LFUA 2C5EA 4N47A 3QGMA 4RULA 2YRWA 3QKUA 2QTHA 1N3IA 1HDZA 3TEFA 1U28A 2VEDA 1XIVA 3MCTA 3QI2A 4FFVA 4KGXA 4GUAA 3IJ5A 1VKZA 4MNTA 2I6UA 7REQA 3GJYA 3K9CA 5ECDA 2QN7A 1XTKA 1BYIA 4O2BA 2LCQA 3VPGA 3I01A 4XYLA 1YJ5A 1ZSYA 2F3QA 2ONYA 3DH0A 1ANKA 2WICA 4ON9A 3O9MA 4LWPA 4J49A 5J40A 3RDPA 2W2OA 2XQIA 5CCXA 3P9KA 3PF8A 4CQJA 1NQOA 3JWGA 5EE9A 3IIEA 4HRVA 1EA7A 1VGRA 4EH1A 2AFIB 1OWPA 1VDZA 3G5MA 4MUIA 1T5BA 3D8TA 3FPAA 5JD5A 5K8IA 1WCXA 1TE2A 5AIAA 5IG2A 1IZYA 1JECA 3CNEA 4IGKA 2OCPA 4C1NA 4CV1A 1OTHA 1GRQA 1ICIA 2MWMA 2GZ3A 4M0FA 3V8BA 4BFCA 5HBGA 5HQ3B 1CLEA 1VCHA 2JJ2D 4F4IA 1Z74A 1UFOA 2X2FA 4PZLA 1OX4B 2KMLA 2WIKA 2H63A 1THGA 3LLSA 4QDZA 2APJA 1RMTA 2EX1A 1G5PA 2GJSA 2WK1A 1UBFA 2XUIA 3I09A 4I5FA 4FFBA 4PU0A 4A7PA 4JLAA 5M5BA 1RRGA 2P65A 4YNBA 2H16A 1T91A 4FR0A 2CV0A 4RABA 3P32A 3PDIB 4GE0A 2JI9A 1OGJA 4K81B 5E0KB 1XNQB 3Q7IA 2BEUB 3OQIA 2O5CA 4A8JC 3LY8A 2UU9B 2J5BA 3HJHA 3IV6A 2A5FA 1X7XA 4PYJA 3A6DA 1TTPB 3ORHA 1WOYA 2CMKA 1Q95A 3EXIA 1FC0A 3BGDA 1EWRA 3MK31 2O3UA 3GLHB 1EAYA 3DJFA 4YECA 1R18A 2LPMA 3UJ7A 1OT5A 3F3SA 5BT9A 2LP4Y