3KOZE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (anaerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kozE02
3KOXE 3KOWE 3KP0E 3KOYE 3KP1E 3KOZE
chains in the Genus database with same CATH superfamily
3FYDA 5FLXS 1XC8A 1I94M 4QOZC 2CE7A 2QP9X 1NY6A 4QHSA 2F5NA 1HT1E 4L6V6 3GRRA 2DAEA 1VEGA 1N33M 1Z5CA 2JY6B 2VQEM 3FTEA 4CHTB 3GLGE 1TH2A 2R0IA 1IXSB 2JY5A 1TR8A 2DAKA 1J7KA 2QENA 4LJ7A 1K3WA 4DBGB 2VQFM 1G8PA 2LVPC 2KNZA 3LVVA 3AV0A 4WW0A 5DYIA 2FOIC 3KVWA 2LH0A 4JXJA 4K0KM 4LCBA 3U60A 4LJ8A 4DV0M 4R71A 2AHMA 3TL4X 2LVQD 4W5WA 1HT2E 5EXSA 1Z6TA 3C3DA 5F3WA 2BJVA 3TE6A 2G8LA 2MJ5B 3I4YA 3T15A 3VK8A 3WHLA 3D8BA 2R4EA 1D0LA 1E94E 8CATA 2JP7A 2BWBA 5JI2E 2OO9A 2YFQA 3KOZE 5ITRA 1MX0A 1WGLA 1T43A 5EP2A 3W0FA 1XNQM 3FUWA 3U60B 2W82A 5IWAM 3RGSA 1XB2B 1WHCA 2K47A 4RF0A 4RKUF 4GITA 5FTKA 3L26A 3GLFA 4G4QA 2FH0A 4GC9A 4IBDA 4LJ4A 4IBGA 3SHFA 4ANRA 2F5QA 3K9OA 4MGIE 4JI8M 3LMMA 1Z5AA 1MN3A 2CFOA 3UGJA 3LQQA 3PFIA 3B7NA 5FTJA 3T1YM 2DWLA 4AKHA 2QBYB 1H6UA 4NOOB 2UU9M 1D0KA 1K82A 1KSFX 5FTLA 3GQ5A 2Y20A 2KZSA 3H4MA 4YHHM 1VEKA 2I7PA 1IN8A 1N77A 2XZUA 1IXZA 1D2NA 4F1IA 1L2DA 2KRUA 3FRIA 3NWLA 5FSWA 4L16A 5KQDA 3SASA 1CUKA 2L4FA 4IBFA 5EQTA 1XHBA 3RE8A 1HQCA 3RFWA 3J2PB 3GRUA 4R3DA 4LY6A 5KPZA 1GJSA 4FCVA 2DAIA 4DV5M 4KLNA 3K1JA 4DR6M 2C9CA 3U6DA 4GHLA 1IY0A 2LVNC 2NQ8C 3FD9A 1JR3D 4DV2M 1L1TA 4MM3B 3HY5A 2DHRA 1OAIA 1NV8A 1A5TA 3ILKA 4LZZA 4BB9A 4DR7M 1NO1A 3DOAA 3KW6A 3B9PA 5EP1A 1I4WA 3HU2A 3TWLA 3AKZA 5ITXE 2R62A 2XSZA 3A45A 4X66M 2UXBM 3IECA 4LGMA 2JNHA 2LHCA 1IBLM 2LNHC 3KFUG 3LQRA 4IBEA 3U6CA 1IFYA 4FW9A 4G4NA 2C5RA 5LMNM 3SATA 4FWDA 2CP8A 2OOBA 4CISA 3FUXA 1GABA 2D7EA 3EIHA 1NY5A 2CHGA 5EXPA 4DUYM 1IN7A 4XGIA 3QWLA 4CJ6A 1QUSA 2ZBKB 4AZFA 4PD2A 3KOYE 2XSZD 2LXEA 5ITQA 1NJGA 2DZLA 4OU7A 3DFZA 4M9ZA 2DNAA 2Y21A 4G3OA 3ZH9B 1J09A 3UJNA 1WJ7A 2O25A 1LTMA 1G71A 3VDUA 5E6JA 3GPYA 3LCUA 3TWMA 1SXJA 3ZCBB 1PGYA 2C96A 2J5YA 2Q2EB 1J5EM 1E9SA 2HHHM 4LJ9A 4DV7M 1ZV1A 3GLFB 1IY1A 2EKFA 4B7FA 4NXNM 2ZAOA 2DXIA 4HLQA 1DGGA 1F4IA 4X62M 4L15A 4GC5A 4NC6A 1L2CA 1NHWC 1OAOC 2HKJA 2L6OA 2X4AA 3AFHA 4EIWA 2UUBM 2D7HA 4FWHA 2BNKA 4KHPM 3BBZA 5DNYA 2MROB 3KS8A 5C18A 5H37D 4DR1M 1R4GA 3GPPA 4B7HA 1OJLA 2CV1A 1DV0A 1EIJA 3KSXA 1QANA 1WIVA 1E9RA 2Z4SA 3HX3A 4LFAM 3HHZA 3U6EA 4II7A 4IBBA 4MGZE 5KPRA 3DZDA 2L7HA 3KOWE 3B74A 3L27A 5KQ8A 3I04M 2L4EA 4PT5A 4LF4M 1TH4A 2KW0A 4LF9M 1PJIA 3FUTA 4NSRA 1ZQ9A 3L28A 3WHKA 2YR0A 4OW0A 1QAOA 4UN2B 5EP3A 3HJ8A 1JR3A 3GO8A 5ITYA 3T6PA 2XZFA 3NBXX 2RGHA 2LHGA 3J81S 3E9SA 1JQJC 5L8RF 2R44A 4A3VB 1L2BA 4OVZB 2V1CA 3UK6A 1NSFA 3RGPA 3SAVA 2C9OA 3I4VA 4D81A 1PJQA 1DO0A 1WGNA 3QYEA 4IBKA 3GLIB 2KZUA 5KO3A 2X49A 4IBCA 2EO2A 3HHYA 2JWSA 1FJGM 2K0BX 2KNAA 4YY3M 3J7BA 1D0MA 1GKIA 2KA6B 4IBJA 4CIZA 1VDDA 4AQYM 2A5YB 2O5RA 3GLHB 2XLJA 3QAUA 1G3IA 2OPFA 5IT9S 2R4JA 4Q7JA 1IBMM 1IXRC 2EJSA 4LJ6A 3C9PA 4Z8XA 4JI1M 2UXCM 3MHVC 1GO5A 1R6BX 1E32A 2C98A 2DHYA 3GLGA 1DGBA 2C99A 4M0DA 3SC3A 4IBIA 2L09A 2DAGA 5ITUA 2EA0A 4DUZM 3U6PA 3TPZA 2MH8A 3D8LA 5EJCA 2WZJA 2QZ4A 1C7YA 2VIIA 1SXJD 2KRKA 2DWMA 1YUBA 4P16A 5EP4A 2DWNA 1XXHB 1KYIA 1QDRA 2UUAM 2Z4RA 3W0LB 1PRBA 2N35A 5DFLA 1SXJE 2F5OA 4L78A 4AG6A 2DAMA 2ZTCA 4WURA 3KP1E 3HJQA 3HU3A 4MGKE 3A46A 2DZNB 3HHXA 3U6LA 1EFUB 2ZM6M 1PJTA 1SXJC 1ZMVA 2Y0QA 2RRUA 3FYCA 5A2QS 1IN6A 3FKEA 5BR8M 4GMQA 1FNNA 2MR9A 2XFTA 3R8FA 2JY8A 2FFJA 2V6ZM 3ZQJA 3AL0C 4IIWA 1Q3CA 4JN6A 4I4LA 4PCZA 1XMOM 1L8QA 1Q02A 1TTEA 4QHTA 3AJIB 3VFDA 1HQYE 3U6OA 1R2ZA 2APLA 2CWBA 1TGUA 3VKGA 1HR0M 4LFCM 3H4JA 1GL6A 2D7GA 2JA2A 3PVSA 3B7QA 4LJAA 3T38A 3C58A 4LF5M 1YE9A 1JR3E 4L8RC 4OX9M 3JR4A 2Z3XA 2YNMD 3NBIA 4B3MM 2CRUA 4I5SA 1ZMWA 3R9XB 4HL4A 3UZUA 2KHHA 3SBJA 1IN4A 1DGHB 3J7AS 1R5LA 3CF2A 2LBCA 3FTFA 3FRHA 3MJ5A 2I7NA 2BWEA 4QNMA 2UUCM 2EKKA 4M9SA 1KFVA 3IHPA 4LG2A 1C1KA 3GLHA 3M7GA 2H1RA 3DA1A 2E5LM 4FCWA 4M0WA 4MGHA 3HKPA 3SFZA 3E21A 4GH9A 1T6OA 3QYBA 3KP0E 2JZ0A 1S3SA 1UM8A 3J80S 2FS1A 3SYKA 1XMQM 2R65A 1IBKM 1T3TA 2XF3A 3AOGA 3AOEA 2F5PA 2DZOB 1IN5A 3F92A 3I01M 3THGA 2CV2A 4XK8F 1PJJA 4JI7M 1NHGC 3IG5A 3Q8XA 3TWKA 4FVMA 1AIPC 2DKLA 2J7OA 2R45A 3FUUA 3EIEA 1RU3A 2HWJA 2MGWA 1QYRA 2RKOA 2ZTDA 3HHWA 4DR3M 4IJFA 3PNVA 3A42A 1GJTA 1N36M 1N75A 2KXEA 5FTMA 1AUAA 1N34M 1IY2A 1QUTA 3PXGA 1TF0B 4MGYE 3U5ZA 4KO8A 5FTNA 1NNJA 4X64M 1OTRA 1IXSA 2XH9A 4FCTA 2CEAA 3U6SA 3U6MA 4LF7M 3SHGB 3AOEC 5IREB 4LRTA 3HU1A 2ZANA 3KDSE 2VF7A 4WP2A 1JB0F 1PM5A 3K2LA 4CGYB 3IG8A 2JZ1A 1OQYA 2DVWB 1V33A 4TUWA 1QAMA 3L2AA 1QQWA 2J7NA 3I51A 3BXWA 1GL7A 4OVZA 2LVAA 4NXMM 4NL4H 4GHAA 1PJSA 2CUZA 1Q3BA 4F2LA 2CV0A 4D80A 1XXHE 1QDTA 1YLAA 2X8AA 2H5XA 2O01F 4JI4M 3U61A 3UMMA 3FUVA 4LF6M 5E26A 1TH3A 2HL7A 4GRIA 1IQPA 5EXTA 3U5ZB 3VLFB 4FD2A 2UXDM 1VG5A 5LMUM 3L29A 1EE8A 2L7IA 2WSEF 5IZ7D 3HJSA 4I81A 3GLIA 2VF8A 2LVOC 2DI0A 3GLFE 4JI3M 3MMPA 2WSCF 4DR4M 4JI6M 3JAMS 4ITQA 1L1ZA 4IJEA 1W5SA 1WR1B 2XGNA 4DR2M 1XNRM 3B7ZA 4QOSA 3LW5F 4BBAA 5C1BA 4DR5M 4QNRA 2RGOA 3GQ3A 2FNAA 3CGWA 3LCVB 3HWSA 4RF1A 3KSJA 3GLIE 1IM2A 4BLCA 3U6QA 2BJWA 2LWXA 3T1HM 4PDGA 5KPTA 1DO2A 3CF6E 2WSFF 2KNVA 4GKJM 1V92A 1K3XA 3VK7A 5BPVA 4MB7A 3KOXE 2HCBA 4AG5A 4GIPA 2ZAMA 4REZA 2G5GX 2LTUA 1QZMA 2P5TA 2QPAA 2YQZA 3HZJA 3K92A 3FTCA 3KXEC 5ITXA 7CATA 5JI3E 5ITTA 3GPXA 3U61B 2R46A 4B7GA 1DGHA 3ZC7B 3GRYA 2DENA 4AKIA 1UFZA 4GKKM 4D82A 4JYAM 4LGYA 4PDIA 4DV3M 2M5ZA 4NRWA 2F5SA 1TDZA 3TQSA 1OIPA 3VDPA 1ORYB 1R2YA 1V34A 3B89A 4DV1M 3JR5A 2CHQA 4JI0M 3GPUA 2R18A 3CTWB 1VDLA 4LF8M 1GVNA 2VDBB 3L25A 3E46A 1WXQA 3V76A 1X37A 2Z8YM 4DV4M 4NSOB 3CF0A 4RNAA 1G41A 2B3TA 3A98B 4LJ5A 4KODA 1NV9A 1G59A 1G4AE 4DV6M 2QQ8A 2CHVA 2JY7A 4M9XA 3GQ4A 2KDLA 1OFIA 2QNJA 4S12A 4R7GA 2QBYA 1Z5BA 1NVMA 2Z7JA 4JI5M 1DGFA 3C3EA 1MU5A 3GP1A 3E4RA 1OKSA 3J27B 3KS4A 3PNYA 1YSYA 4XBOA 1QZEA 4G4OA 3VKHA 4ZPXA 3SYLA 1NJFA 5EXXA 4LRSA 3BOSA 4AKGA 1BVSA 3SMSA 3K9PA 3SMPA 3SAUA 4AI6A 3SAWA 1Q39A 4G4RA 3MK6A 1XXHA 4B3TM 2KEBA 3HGIA 1ZMUA 2K9DA 2L2DA 1QAQA 2DWZB 4NRVA 1Y8GA 4AW4A 4JV5M 1SG9A 1HNZM 3Q8GA 1XWIA 2HAKA 4GEWA 4FWGA 3OTOM 3GLGB 2GQFA 1HNWM 2M60A 4JI2M 2QCUA 3FE3A 4G6ZA 4B3RM 2JUJA 3W68A 1P3QQ 1ZAEA 2G3QA 1GLNA 1HJPA 3GLHE 4LZJA 1VQ1A 3K8ZA 1MJGM 2ERCA 3M0EA 2R6FA 4Z6YA 4MH0E 1QVRA 3SARA 1SXJB 3GRVA 5DYGA 3LVWA 2FE8A 3FTDA 2F4VM 4LFBM 2K6BA 1R7RA 5GKNA 2GNOA 1W5TA 4KT0F 2OQ4A 4Y28F 4L4UA 3W67A 2Y0TA 4P17A 1LV7A 4I8OA 1Z59A 1HNXM 1OFHA 2QHOB 2XFSA 4B3SM 2QSFX 2JXNA 2OOAA 3M6AA 4HEOA 4X65M 2EUCA 2XEPA 1OIZA 4B08A 1NNUC 1N78A 2V1UA 1TDHA 1N32M 1VEJA
chains in the Genus database with same CATH topology
3FYDA 5FLXS 1XC8A 1I94M 4QOZC 2CE7A 2QP9X 1NY6A 4QHSA 2F5NA 1HT1E 3GRRA 1N33M 1Z5CA 2VQEM 3FTEA 4CHTB 1TH2A 1IXSB 4LJ7A 1J7KA 2QENA 1K3WA 2VQFM 1G8PA 4WW0A 3LVVA 3AV0A 5DYIA 2FOIC 3KVWA 2LH0A 4JXJA 4K0KM 4LCBA 3U60A 4LJ8A 4DV0M 2AHMA 3TL4X 4W5WA 1HT2E 5EXSA 1Z6TA 5F3WA 2BJVA 3TE6A 2G8LA 3I4YA 3T15A 3VK8A 3WHLA 3D8BA 2R4EA 1E94E 8CATA 5JI2E 5ITRA 2YFQA 3KOZE 1MX0A 5EP2A 1XNQM 3W0FA 3FUWA 3U60B 2W82A 5IWAM 3RGSA 2K47A 4RF0A 3L26A 4GITA 5FTKA 3GLFA 4G4QA 4GC9A 4IBDA 4LJ4A 4IBGA 3SHFA 2F5QA 4MGIE 4JI8M 3LMMA 1Z5AA 2CFOA 3UGJA 3T1YM 3LQQA 3PFIA 5FTJA 2DWLA 4AKHA 2QBYB 1H6UA 4NOOB 2UU9M 1K82A 1KSFX 5FTLA 3GQ5A 2Y20A 2KZSA 3H4MA 4YHHM 2I7PA 1IN8A 1N77A 2XZUA 1IXZA 1D2NA 1L2DA 2KRUA 3NWLA 5FSWA 5KQDA 4L16A 3SASA 4IBFA 5EQTA 1XHBA 3RE8A 1HQCA 3RFWA 3J2PB 3GRUA 4R3DA 4LY6A 5KPZA 4FCVA 4DV5M 4KLNA 3K1JA 4DR6M 2C9CA 3U6DA 4GHLA 1IY0A 2NQ8C 3FD9A 1JR3D 4DV2M 1L1TA 4MM3B 2DHRA 3ILKA 4LZZA 4BB9A 4DR7M 3DOAA 3KW6A 3B9PA 5EP1A 1I4WA 3HU2A 3TWLA 3AKZA 5ITXE 2R62A 2XSZA 3A45A 4X66M 2UXBM 4LGMA 1IBLM 2LNHC 3KFUG 3LQRA 4IBEA 3U6CA 4FW9A 4G4NA 2C5RA 5LMNM 3SATA 4FWDA 4CISA 3FUXA 2D7EA 3EIHA 1NY5A 2CHGA 5EXPA 4DUYM 1IN7A 4XGIA 3QWLA 2ZBKB 4AZFA 4PD2A 3KOYE 2XSZD 2LXEA 5ITQA 1NJGA 4OU7A 3DFZA 4M9ZA 2Y21A 3ZH9B 1J09A 3UJNA 3VDUA 5E6JA 3GPYA 3TWMA 1SXJA 3ZCBB 2C96A 2Q2EB 1J5EM 1E9SA 2HHHM 4LJ9A 4DV7M 3GLFB 1IY1A 4B7FA 4NXNM 2ZAOA 2DXIA 4HLQA 1DGGA 4X62M 4L15A 4GC5A 1L2CA 1NHWC 2L6OA 2HKJA 2X4AA 3AFHA 4EIWA 2UUBM 2D7HA 4FWHA 2BNKA 4KHPM 5DNYA 3KS8A 5C18A 5H37D 4DR1M 3GPPA 4B7HA 1OJLA 2CV1A 3KSXA 1QANA 2Z4SA 1E9RA 4LFAM 3HHZA 3U6EA 4II7A 4IBBA 4MGZE 5KPRA 3DZDA 2L7HA 3KOWE 3L27A 5KQ8A 4PT5A 4LF4M 1TH4A 2KW0A 4LF9M 1PJIA 3FUTA 4NSRA 1ZQ9A 3L28A 3WHKA 2YR0A 4OW0A 1QAOA 5EP3A 3HJ8A 1JR3A 3GO8A 5ITYA 2XZFA 2RGHA 3J81S 3E9SA 1JQJC 4A3VB 1L2BA 4OVZB 2V1CA 3UK6A 1NSFA 3RGPA 3SAVA 2C9OA 3I4VA 4D81A 1DO0A 4IBKA 3GLIB 2KZUA 5KO3A 2X49A 4IBCA 2EO2A 3HHYA 1FJGM 4YY3M 3J7BA 1GKIA 2KA6B 4IBJA 1VDDA 4AQYM 2A5YB 2O5RA 3GLHB 2XLJA 3QAUA 1G3IA 2OPFA 5IT9S 2R4JA 1IBMM 1IXRC 4Z8XA 4LJ6A 4JI1M 2UXCM 3MHVC 1R6BX 1E32A 2C98A 3GLGA 1DGBA 2C99A 4M0DA 3SC3A 4IBIA 2L09A 5ITUA 2EA0A 4DUZM 3U6PA 3TPZA 3D8LA 5EJCA 2QZ4A 2VIIA 1SXJD 2KRKA 2DWMA 1YUBA 4P16A 5EP4A 2DWNA 1XXHB 1KYIA 2UUAM 2Z4RA 3W0LB 2F5OA 1SXJE 4L78A 4AG6A 4WURA 3KP1E 3HJQA 3HU3A 4MGKE 3A46A 2DZNB 3HHXA 3U6LA 2ZM6M 1SXJC 2Y0QA 3FYCA 5A2QS 1IN6A 3FKEA 5BR8M 4GMQA 1FNNA 2XFTA 3R8FA 2FFJA 2V6ZM 3AL0C 4IIWA 1Q3CA 4JN6A 4I4LA 4PCZA 1XMOM 1L8QA 4QHTA 3VFDA 3AJIB 1HQYE 3U6OA 1R2ZA 1TGUA 3VKGA 1HR0M 4LFCM 1GL6A 2D7GA 2JA2A 3PVSA 4LJAA 3T38A 3C58A 4LF5M 1YE9A 4L8RC 4OX9M 3JR4A 2Z3XA 2YNMD 3NBIA 4B3MM 4I5SA 3R9XB 4HL4A 3UZUA 3SBJA 1IN4A 1DGHB 3J7AS 3CF2A 3FTFA 3MJ5A 2I7NA 4QNMA 2UUCM 1KFVA 4M9SA 4LG2A 1C1KA 3GLHA 3M7GA 2H1RA 3DA1A 2E5LM 4FCWA 4M0WA 4MGHA 3HKPA 3SFZA 4GH9A 3KP0E 3SYKA 1S3SA 1UM8A 3J80S 1XMQM 2R65A 1IBKM 1T3TA 2XF3A 3AOGA 3AOEA 2F5PA 2DZOB 1IN5A 3THGA 2CV2A 1PJJA 4JI7M 1NHGC 3IG5A 3Q8XA 3TWKA 4FVMA 2J7OA 2R45A 3FUUA 3EIEA 3HHWA 1QYRA 2RKOA 4DR3M 4IJFA 3PNVA 3A42A 1N36M 1N75A 2KXEA 5FTMA 1N34M 1IY2A 3PXGA 4MGYE 3U5ZA 4KO8A 5FTNA 1NNJA 4X64M 4FCTA 2XH9A 2CEAA 3U6SA 3U6MA 4LF7M 3SHGB 3AOEC 5IREB 4LRTA 3HU1A 2ZANA 3KDSE 1PM5A 3K2LA 4CGYB 3IG8A 2DVWB 4TUWA 1QAMA 3L2AA 1QQWA 2J7NA 3I51A 1GL7A 4OVZA 4NXMM 4NL4H 4GHAA 2CUZA 1Q3BA 2CV0A 4D80A 2X8AA 4JI4M 3U61A 3UMMA 3FUVA 4LF6M 5E26A 1TH3A 2HL7A 4GRIA 1IQPA 5EXTA 3U5ZB 3VLFB 4FD2A 2UXDM 5LMUM 3L29A 1EE8A 2L7IA 5IZ7D 3HJSA 4I81A 3GLIA 4JI3M 4DR4M 4JI6M 3JAMS 4ITQA 1L1ZA 4IJEA 1W5SA 2XGNA 4DR2M 1XNRM 4QOSA 4BBAA 5C1BA 4DR5M 4QNRA 2RGOA 3GQ3A 2FNAA 3HWSA 4RF1A 3KSJA 1IM2A 4BLCA 3U6QA 2BJWA 2LWXA 3T1HM 4PDGA 5KPTA 1DO2A 3CF6E 4GKJM 1K3XA 3VK7A 5BPVA 4MB7A 3KOXE 2HCBA 4AG5A 4GIPA 2ZAMA 4REZA 2G5GX 2P5TA 1QZMA 2QPAA 2YQZA 3KXEC 3K92A 5ITXA 3FTCA 7CATA 5JI3E 3GPXA 5ITTA 3U61B 2R46A 4B7GA 1DGHA 3ZC7B 3GRYA 4AKIA 4GKKM 4D82A 4JYAM 4LGYA 4PDIA 4DV3M 2M5ZA 4NRWA 2F5SA 1TDZA 3TQSA 3VDPA 1ORYB 1R2YA 4DV1M 3JR5A 2CHQA 4JI0M 3GPUA 2R18A 3CTWB 4LF8M 1GVNA 3L25A 1WXQA 1X37A 4DV4M 4NSOB 3CF0A 4RNAA 1G41A 3A98B 4LJ5A 4KODA 1G59A 1G4AE 4DV6M 2CHVA 4M9XA 3GQ4A 4S12A 1OFIA 4JI5M 4R7GA 2QBYA 2Z7JA 1NVMA 1Z5BA 1DGFA 3GP1A 1MU5A 3E4RA 3J27B 3KS4A 3PNYA 1YSYA 4XBOA 4G4OA 3VKHA 4ZPXA 3SYLA 1NJFA 5EXXA 4LRSA 3BOSA 4AKGA 3SMSA 3SAUA 3SMPA 4AI6A 3SAWA 1Q39A 4G4RA 3MK6A 1XXHA 4B3TM 2KEBA 3HGIA 1QAQA 2DWZB 4NRVA 4AW4A 4JV5M 1HNZM 3OTOM 1XWIA 1HNWM 4FWGA 3GLGB 2M60A 4JI2M 2QCUA 4G6ZA 4B3RM 1ZAEA 1GLNA 4LZJA 3K8ZA 3M0EA 2ERCA 4Z6YA 4MH0E 1QVRA 3SARA 1SXJB 3GRVA 5DYGA 3LVWA 2FE8A 3FTDA 2F4VM 4LFBM 1R7RA 5GKNA 1W5TA 2OQ4A 4L4UA 2Y0TA 1LV7A 4I8OA 1Z59A 1HNXM 1OFHA 2XFSA 4B3SM 3M6AA 4X65M 2EUCA 2XEPA 4B08A 1NNUC 1N78A 2V1UA 1TDHA 1N32M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOX E;  3KOW E;  3KP0 E;  3KOY E;  3KP1 E;  3KOZ E; 
#chains in the Genus database with same CATH topology
 3FYD A;  5FLX S;  1XC8 A;  1I94 M;  4QOZ C;  2CE7 A;  2QP9 X;  1NY6 A;  4QHS A;  2F5N A;  1HT1 E;  4L6V 6;  3GRR A;  2DAE A;  1VEG A;  1N33 M;  1Z5C A;  2JY6 B;  2VQE M;  3FTE A;  4CHT B;  3GLG E;  1TH2 A;  2R0I A;  1IXS B;  2JY5 A;  1TR8 A;  2DAK A;  1J7K A;  2QEN A;  4LJ7 A;  1K3W A;  4DBG B;  2VQF M;  1G8P A;  2LVP C;  2KNZ A;  3LVV A;  3AV0 A;  4WW0 A;  5DYI A;  2FOI C;  3KVW A;  2LH0 A;  4JXJ A;  4K0K M;  4LCB A;  3U60 A;  4LJ8 A;  4DV0 M;  4R71 A;  2AHM A;  3TL4 X;  2LVQ D;  4W5W A;  1HT2 E;  5EXS A;  1Z6T A;  3C3D A;  5F3W A;  2BJV A;  3TE6 A;  2G8L A;  2MJ5 B;  3I4Y A;  3T15 A;  3VK8 A;  3WHL A;  3D8B A;  2R4E A;  1D0L A;  1E94 E;  8CAT A;  2JP7 A;  2BWB A;  5JI2 E;  2OO9 A;  2YFQ A;  3KOZ E;  5ITR A;  1MX0 A;  1WGL A;  1T43 A;  5EP2 A;  3W0F A;  1XNQ M;  3FUW A;  3U60 B;  2W82 A;  5IWA M;  3RGS A;  1XB2 B;  1WHC A;  2K47 A;  4RF0 A;  4RKU F;  4GIT A;  5FTK A;  3L26 A;  3GLF A;  4G4Q A;  2FH0 A;  4GC9 A;  4IBD A;  4LJ4 A;  4IBG A;  3SHF A;  4ANR A;  2F5Q A;  3K9O A;  4MGI E;  4JI8 M;  3LMM A;  1Z5A A;  1MN3 A;  2CFO A;  3UGJ A;  3LQQ A;  3PFI A;  3B7N A;  5FTJ A;  3T1Y M;  2DWL A;  4AKH A;  2QBY B;  1H6U A;  4NOO B;  2UU9 M;  1D0K A;  1K82 A;  1KSF X;  5FTL A;  3GQ5 A;  2Y20 A;  2KZS A;  3H4M A;  4YHH M;  1VEK A;  2I7P A;  1IN8 A;  1N77 A;  2XZU A;  1IXZ A;  1D2N A;  4F1I A;  1L2D A;  2KRU A;  3FRI A;  3NWL A;  5FSW A;  4L16 A;  5KQD A;  3SAS A;  1CUK A;  2L4F A;  4IBF A;  5EQT A;  1XHB A;  3RE8 A;  1HQC A;  3RFW A;  3J2P B;  3GRU A;  4R3D A;  4LY6 A;  5KPZ A;  1GJS A;  4FCV A;  2DAI A;  4DV5 M;  4KLN A;  3K1J A;  4DR6 M;  2C9C A;  3U6D A;  4GHL A;  1IY0 A;  2LVN C;  2NQ8 C;  3FD9 A;  1JR3 D;  4DV2 M;  1L1T A;  4MM3 B;  3HY5 A;  2DHR A;  1OAI A;  1NV8 A;  1A5T A;  3ILK A;  4LZZ A;  4BB9 A;  4DR7 M;  1NO1 A;  3DOA A;  3KW6 A;  3B9P A;  5EP1 A;  1I4W A;  3HU2 A;  3TWL A;  3AKZ A;  5ITX E;  2R62 A;  2XSZ A;  3A45 A;  4X66 M;  2UXB M;  3IEC A;  4LGM A;  2JNH A;  2LHC A;  1IBL M;  2LNH C;  3KFU G;  3LQR A;  4IBE A;  3U6C A;  1IFY A;  4FW9 A;  4G4N A;  2C5R A;  5LMN M;  3SAT A;  4FWD A;  2CP8 A;  2OOB A;  4CIS A;  3FUX A;  1GAB A;  2D7E A;  3EIH A;  1NY5 A;  2CHG A;  5EXP A;  4DUY M;  1IN7 A;  4XGI A;  3QWL A;  4CJ6 A;  1QUS A;  2ZBK B;  4AZF A;  4PD2 A;  3KOY E;  2XSZ D;  2LXE A;  5ITQ A;  1NJG A;  2DZL A;  4OU7 A;  3DFZ A;  4M9Z A;  2DNA A;  2Y21 A;  4G3O A;  3ZH9 B;  1J09 A;  3UJN A;  1WJ7 A;  2O25 A;  1LTM A;  1G71 A;  3VDU A;  5E6J A;  3GPY A;  3LCU A;  3TWM A;  1SXJ A;  3ZCB B;  1PGY A;  2C96 A;  2J5Y A;  2Q2E B;  1J5E M;  1E9S A;  2HHH M;  4LJ9 A;  4DV7 M;  1ZV1 A;  3GLF B;  1IY1 A;  2EKF A;  4B7F A;  4NXN M;  2ZAO A;  2DXI A;  4HLQ A;  1DGG A;  1F4I A;  4X62 M;  4L15 A;  4GC5 A;  4NC6 A;  1L2C A;  1NHW C;  1OAO C;  2HKJ A;  2L6O A;  2X4A A;  3AFH A;  4EIW A;  2UUB M;  2D7H A;  4FWH A;  2BNK A;  4KHP M;  3BBZ A;  5DNY A;  2MRO B;  3KS8 A;  5C18 A;  5H37 D;  4DR1 M;  1R4G A;  3GPP A;  4B7H A;  1OJL A;  2CV1 A;  1DV0 A;  1EIJ A;  3KSX A;  1QAN A;  1WIV A;  1E9R A;  2Z4S A;  3HX3 A;  4LFA M;  3HHZ A;  3U6E A;  4II7 A;  4IBB A;  4MGZ E;  5KPR A;  3DZD A;  2L7H A;  3KOW E;  3B74 A;  3L27 A;  5KQ8 A;  3I04 M;  2L4E A;  4PT5 A;  4LF4 M;  1TH4 A;  2KW0 A;  4LF9 M;  1PJI A;  3FUT A;  4NSR A;  1ZQ9 A;  3L28 A;  3WHK A;  2YR0 A;  4OW0 A;  1QAO A;  4UN2 B;  5EP3 A;  3HJ8 A;  1JR3 A;  3GO8 A;  5ITY A;  3T6P A;  2XZF A;  3NBX X;  2RGH A;  2LHG A;  3J81 S;  3E9S A;  1JQJ C;  5L8R F;  2R44 A;  4A3V B;  1L2B A;  4OVZ B;  2V1C A;  3UK6 A;  1NSF A;  3RGP A;  3SAV A;  2C9O A;  3I4V A;  4D81 A;  1PJQ A;  1DO0 A;  1WGN A;  3QYE A;  4IBK A;  3GLI B;  2KZU A;  5KO3 A;  2X49 A;  4IBC A;  2EO2 A;  3HHY A;  2JWS A;  1FJG M;  2K0B X;  2KNA A;  4YY3 M;  3J7B A;  1D0M A;  1GKI A;  2KA6 B;  4IBJ A;  4CIZ A;  1VDD A;  4AQY M;  2A5Y B;  2O5R A;  3GLH B;  2XLJ A;  3QAU A;  1G3I A;  2OPF A;  5IT9 S;  2R4J A;  4Q7J A;  1IBM M;  1IXR C;  2EJS A;  4LJ6 A;  3C9P A;  4Z8X A;  4JI1 M;  2UXC M;  3MHV C;  1GO5 A;  1R6B X;  1E32 A;  2C98 A;  2DHY A;  3GLG A;  1DGB A;  2C99 A;  4M0D A;  3SC3 A;  4IBI A;  2L09 A;  2DAG A;  5ITU A;  2EA0 A;  4DUZ M;  3U6P A;  3TPZ A;  2MH8 A;  3D8L A;  5EJC A;  2WZJ A;  2QZ4 A;  1C7Y A;  2VII A;  1SXJ D;  2KRK A;  2DWM A;  1YUB A;  4P16 A;  5EP4 A;  2DWN A;  1XXH B;  1KYI A;  1QDR A;  2UUA M;  2Z4R A;  3W0L B;  1PRB A;  2N35 A;  5DFL A;  1SXJ E;  2F5O A;  4L78 A;  4AG6 A;  2DAM A;  2ZTC A;  4WUR A;  3KP1 E;  3HJQ A;  3HU3 A;  4MGK E;  3A46 A;  2DZN B;  3HHX A;  3U6L A;  1EFU B;  2ZM6 M;  1PJT A;  1SXJ C;  1ZMV A;  2Y0Q A;  2RRU A;  3FYC A;  5A2Q S;  1IN6 A;  3FKE A;  5BR8 M;  4GMQ A;  1FNN A;  2MR9 A;  2XFT A;  3R8F A;  2JY8 A;  2FFJ A;  2V6Z M;  3ZQJ A;  3AL0 C;  4IIW A;  1Q3C A;  4JN6 A;  4I4L A;  4PCZ A;  1XMO M;  1L8Q A;  1Q02 A;  1TTE A;  4QHT A;  3AJI B;  3VFD A;  1HQY E;  3U6O A;  1R2Z A;  2APL A;  2CWB A;  1TGU A;  3VKG A;  1HR0 M;  4LFC M;  3H4J A;  1GL6 A;  2D7G A;  2JA2 A;  3PVS A;  3B7Q A;  4LJA A;  3T38 A;  3C58 A;  4LF5 M;  1YE9 A;  1JR3 E;  4L8R C;  4OX9 M;  3JR4 A;  2Z3X A;  2YNM D;  3NBI A;  4B3M M;  2CRU A;  4I5S A;  1ZMW A;  3R9X B;  4HL4 A;  3UZU A;  2KHH A;  3SBJ A;  1IN4 A;  1DGH B;  3J7A S;  1R5L A;  3CF2 A;  2LBC A;  3FTF A;  3FRH A;  3MJ5 A;  2I7N A;  2BWE A;  4QNM A;  2UUC M;  2EKK A;  4M9S A;  1KFV A;  3IHP A;  4LG2 A;  1C1K A;  3GLH A;  3M7G A;  2H1R A;  3DA1 A;  2E5L M;  4FCW A;  4M0W A;  4MGH A;  3HKP A;  3SFZ A;  3E21 A;  4GH9 A;  1T6O A;  3QYB A;  3KP0 E;  2JZ0 A;  1S3S A;  1UM8 A;  3J80 S;  2FS1 A;  3SYK A;  1XMQ M;  2R65 A;  1IBK M;  1T3T A;  2XF3 A;  3AOG A;  3AOE A;  2F5P A;  2DZO B;  1IN5 A;  3F92 A;  3I01 M;  3THG A;  2CV2 A;  4XK8 F;  1PJJ A;  4JI7 M;  1NHG C;  3IG5 A;  3Q8X A;  3TWK A;  4FVM A;  1AIP C;  2DKL A;  2J7O A;  2R45 A;  3FUU A;  3EIE A;  1RU3 A;  2HWJ A;  2MGW A;  1QYR A;  2RKO A;  2ZTD A;  3HHW A;  4DR3 M;  4IJF A;  3PNV A;  3A42 A;  1GJT A;  1N36 M;  1N75 A;  2KXE A;  5FTM A;  1AUA A;  1N34 M;  1IY2 A;  1QUT A;  3PXG A;  1TF0 B;  4MGY E;  3U5Z A;  4KO8 A;  5FTN A;  1NNJ A;  4X64 M;  1OTR A;  1IXS A;  2XH9 A;  4FCT A;  2CEA A;  3U6S A;  3U6M A;  4LF7 M;  3SHG B;  3AOE C;  5IRE B;  4LRT A;  3HU1 A;  2ZAN A;  3KDS E;  2VF7 A;  4WP2 A;  1JB0 F;  1PM5 A;  3K2L A;  4CGY B;  3IG8 A;  2JZ1 A;  1OQY A;  2DVW B;  1V33 A;  4TUW A;  1QAM A;  3L2A A;  1QQW A;  2J7N A;  3I51 A;  3BXW A;  1GL7 A;  4OVZ A;  2LVA A;  4NXM M;  4NL4 H;  4GHA A;  1PJS A;  2CUZ A;  1Q3B A;  4F2L A;  2CV0 A;  4D80 A;  1XXH E;  1QDT A;  1YLA A;  2X8A A;  2H5X A;  2O01 F;  4JI4 M;  3U61 A;  3UMM A;  3FUV A;  4LF6 M;  5E26 A;  1TH3 A;  2HL7 A;  4GRI A;  1IQP A;  5EXT A;  3U5Z B;  3VLF B;  4FD2 A;  2UXD M;  1VG5 A;  5LMU M;  3L29 A;  1EE8 A;  2L7I A;  2WSE F;  5IZ7 D;  3HJS A;  4I81 A;  3GLI A;  2VF8 A;  2LVO C;  2DI0 A;  3GLF E;  4JI3 M;  3MMP A;  2WSC F;  4DR4 M;  4JI6 M;  3JAM S;  4ITQ A;  1L1Z A;  4IJE A;  1W5S A;  1WR1 B;  2XGN A;  4DR2 M;  1XNR M;  3B7Z A;  4QOS A;  3LW5 F;  4BBA A;  5C1B A;  4DR5 M;  4QNR A;  2RGO A;  3GQ3 A;  2FNA A;  3CGW A;  3LCV B;  3HWS A;  4RF1 A;  3KSJ A;  3GLI E;  1IM2 A;  4BLC A;  3U6Q A;  2BJW A;  2LWX A;  3T1H M;  4PDG A;  5KPT A;  1DO2 A;  3CF6 E;  2WSF F;  2KNV A;  4GKJ M;  1V92 A;  1K3X A;  3VK7 A;  5BPV A;  4MB7 A;  3KOX E;  2HCB A;  4AG5 A;  4GIP A;  2ZAM A;  4REZ A;  2G5G X;  2LTU A;  1QZM A;  2P5T A;  2QPA A;  2YQZ A;  3HZJ A;  3K92 A;  3FTC A;  3KXE C;  5ITX A;  7CAT A;  5JI3 E;  5ITT A;  3GPX A;  3U61 B;  2R46 A;  4B7G A;  1DGH A;  3ZC7 B;  3GRY A;  2DEN A;  4AKI A;  1UFZ A;  4GKK M;  4D82 A;  4JYA M;  4LGY A;  4PDI A;  4DV3 M;  2M5Z A;  4NRW A;  2F5S A;  1TDZ A;  3TQS A;  1OIP A;  3VDP A;  1ORY B;  1R2Y A;  1V34 A;  3B89 A;  4DV1 M;  3JR5 A;  2CHQ A;  4JI0 M;  3GPU A;  2R18 A;  3CTW B;  1VDL A;  4LF8 M;  1GVN A;  2VDB B;  3L25 A;  3E46 A;  1WXQ A;  3V76 A;  1X37 A;  2Z8Y M;  4DV4 M;  4NSO B;  3CF0 A;  4RNA A;  1G41 A;  2B3T A;  3A98 B;  4LJ5 A;  4KOD A;  1NV9 A;  1G59 A;  1G4A E;  4DV6 M;  2QQ8 A;  2CHV A;  2JY7 A;  4M9X A;  3GQ4 A;  2KDL A;  1OFI A;  2QNJ A;  4S12 A;  4R7G A;  2QBY A;  1Z5B A;  1NVM A;  2Z7J A;  4JI5 M;  1DGF A;  3C3E A;  1MU5 A;  3GP1 A;  3E4R A;  1OKS A;  3J27 B;  3KS4 A;  3PNY A;  1YSY A;  4XBO A;  1QZE A;  4G4O A;  3VKH A;  4ZPX A;  3SYL A;  1NJF A;  5EXX A;  4LRS A;  3BOS A;  4AKG A;  1BVS A;  3SMS A;  3K9P A;  3SMP A;  3SAU A;  4AI6 A;  3SAW A;  1Q39 A;  4G4R A;  3MK6 A;  1XXH A;  4B3T M;  2KEB A;  3HGI A;  1ZMU A;  2K9D A;  2L2D A;  1QAQ A;  2DWZ B;  4NRV A;  1Y8G A;  4AW4 A;  4JV5 M;  1SG9 A;  1HNZ M;  3Q8G A;  1XWI A;  2HAK A;  4GEW A;  4FWG A;  3OTO M;  3GLG B;  2GQF A;  1HNW M;  2M60 A;  4JI2 M;  2QCU A;  3FE3 A;  4G6Z A;  4B3R M;  2JUJ A;  3W68 A;  1P3Q Q;  1ZAE A;  2G3Q A;  1GLN A;  1HJP A;  3GLH E;  4LZJ A;  1VQ1 A;  3K8Z A;  1MJG M;  2ERC A;  3M0E A;  2R6F A;  4Z6Y A;  4MH0 E;  1QVR A;  3SAR A;  1SXJ B;  3GRV A;  5DYG A;  3LVW A;  2FE8 A;  3FTD A;  2F4V M;  4LFB M;  2K6B A;  1R7R A;  5GKN A;  2GNO A;  1W5T A;  4KT0 F;  2OQ4 A;  4Y28 F;  4L4U A;  3W67 A;  2Y0T A;  4P17 A;  1LV7 A;  4I8O A;  1Z59 A;  1HNX M;  1OFH A;  2QHO B;  2XFS A;  4B3S M;  2QSF X;  2JXN A;  2OOA A;  3M6A A;  4HEO A;  4X65 M;  2EUC A;  2XEP A;  1OIZ A;  4B08 A;  1NNU C;  1N78 A;  2V1U A;  1TDH A;  1N32 M;  1VEJ A; 
#chains in the Genus database with same CATH homology
 3FYD A;  5FLX S;  1XC8 A;  1I94 M;  4QOZ C;  2CE7 A;  2QP9 X;  1NY6 A;  4QHS A;  2F5N A;  1HT1 E;  3GRR A;  1N33 M;  1Z5C A;  2VQE M;  3FTE A;  4CHT B;  1TH2 A;  1IXS B;  4LJ7 A;  1J7K A;  2QEN A;  1K3W A;  2VQF M;  1G8P A;  4WW0 A;  3LVV A;  3AV0 A;  5DYI A;  2FOI C;  3KVW A;  2LH0 A;  4JXJ A;  4K0K M;  4LCB A;  3U60 A;  4LJ8 A;  4DV0 M;  2AHM A;  3TL4 X;  4W5W A;  1HT2 E;  5EXS A;  1Z6T A;  5F3W A;  2BJV A;  3TE6 A;  2G8L A;  3I4Y A;  3T15 A;  3VK8 A;  3WHL A;  3D8B A;  2R4E A;  1E94 E;  8CAT A;  5JI2 E;  5ITR A;  2YFQ A;  3KOZ E;  1MX0 A;  5EP2 A;  1XNQ M;  3W0F A;  3FUW A;  3U60 B;  2W82 A;  5IWA M;  3RGS A;  2K47 A;  4RF0 A;  3L26 A;  4GIT A;  5FTK A;  3GLF A;  4G4Q A;  4GC9 A;  4IBD A;  4LJ4 A;  4IBG A;  3SHF A;  2F5Q A;  4MGI E;  4JI8 M;  3LMM A;  1Z5A A;  2CFO A;  3UGJ A;  3T1Y M;  3LQQ A;  3PFI A;  5FTJ A;  2DWL A;  4AKH A;  2QBY B;  1H6U A;  4NOO B;  2UU9 M;  1K82 A;  1KSF X;  5FTL A;  3GQ5 A;  2Y20 A;  2KZS A;  3H4M A;  4YHH M;  2I7P A;  1IN8 A;  1N77 A;  2XZU A;  1IXZ A;  1D2N A;  1L2D A;  2KRU A;  3NWL A;  5FSW A;  5KQD A;  4L16 A;  3SAS A;  4IBF A;  5EQT A;  1XHB A;  3RE8 A;  1HQC A;  3RFW A;  3J2P B;  3GRU A;  4R3D A;  4LY6 A;  5KPZ A;  4FCV A;  4DV5 M;  4KLN A;  3K1J A;  4DR6 M;  2C9C A;  3U6D A;  4GHL A;  1IY0 A;  2NQ8 C;  3FD9 A;  1JR3 D;  4DV2 M;  1L1T A;  4MM3 B;  2DHR A;  3ILK A;  4LZZ A;  4BB9 A;  4DR7 M;  3DOA A;  3KW6 A;  3B9P A;  5EP1 A;  1I4W A;  3HU2 A;  3TWL A;  3AKZ A;  5ITX E;  2R62 A;  2XSZ A;  3A45 A;  4X66 M;  2UXB M;  4LGM A;  1IBL M;  2LNH C;  3KFU G;  3LQR A;  4IBE A;  3U6C A;  4FW9 A;  4G4N A;  2C5R A;  5LMN M;  3SAT A;  4FWD A;  4CIS A;  3FUX A;  2D7E A;  3EIH A;  1NY5 A;  2CHG A;  5EXP A;  4DUY M;  1IN7 A;  4XGI A;  3QWL A;  2ZBK B;  4AZF A;  4PD2 A;  3KOY E;  2XSZ D;  2LXE A;  5ITQ A;  1NJG A;  4OU7 A;  3DFZ A;  4M9Z A;  2Y21 A;  3ZH9 B;  1J09 A;  3UJN A;  3VDU A;  5E6J A;  3GPY A;  3TWM A;  1SXJ A;  3ZCB B;  2C96 A;  2Q2E B;  1J5E M;  1E9S A;  2HHH M;  4LJ9 A;  4DV7 M;  3GLF B;  1IY1 A;  4B7F A;  4NXN M;  2ZAO A;  2DXI A;  4HLQ A;  1DGG A;  4X62 M;  4L15 A;  4GC5 A;  1L2C A;  1NHW C;  2L6O A;  2HKJ A;  2X4A A;  3AFH A;  4EIW A;  2UUB M;  2D7H A;  4FWH A;  2BNK A;  4KHP M;  5DNY A;  3KS8 A;  5C18 A;  5H37 D;  4DR1 M;  3GPP A;  4B7H A;  1OJL A;  2CV1 A;  3KSX A;  1QAN A;  2Z4S A;  1E9R A;  4LFA M;  3HHZ A;  3U6E A;  4II7 A;  4IBB A;  4MGZ E;  5KPR A;  3DZD A;  2L7H A;  3KOW E;  3L27 A;  5KQ8 A;  4PT5 A;  4LF4 M;  1TH4 A;  2KW0 A;  4LF9 M;  1PJI A;  3FUT A;  4NSR A;  1ZQ9 A;  3L28 A;  3WHK A;  2YR0 A;  4OW0 A;  1QAO A;  5EP3 A;  3HJ8 A;  1JR3 A;  3GO8 A;  5ITY A;  2XZF A;  2RGH A;  3J81 S;  3E9S A;  1JQJ C;  4A3V B;  1L2B A;  4OVZ B;  2V1C A;  3UK6 A;  1NSF A;  3RGP A;  3SAV A;  2C9O A;  3I4V A;  4D81 A;  1DO0 A;  4IBK A;  3GLI B;  2KZU A;  5KO3 A;  2X49 A;  4IBC A;  2EO2 A;  3HHY A;  1FJG M;  4YY3 M;  3J7B A;  1GKI A;  2KA6 B;  4IBJ A;  1VDD A;  4AQY M;  2A5Y B;  2O5R A;  3GLH B;  2XLJ A;  3QAU A;  1G3I A;  2OPF A;  5IT9 S;  2R4J A;  1IBM M;  1IXR C;  4Z8X A;  4LJ6 A;  4JI1 M;  2UXC M;  3MHV C;  1R6B X;  1E32 A;  2C98 A;  3GLG A;  1DGB A;  2C99 A;  4M0D A;  3SC3 A;  4IBI A;  2L09 A;  5ITU A;  2EA0 A;  4DUZ M;  3U6P A;  3TPZ A;  3D8L A;  5EJC A;  2QZ4 A;  2VII A;  1SXJ D;  2KRK A;  2DWM A;  1YUB A;  4P16 A;  5EP4 A;  2DWN A;  1XXH B;  1KYI A;  2UUA M;  2Z4R A;  3W0L B;  2F5O A;  1SXJ E;  4L78 A;  4AG6 A;  4WUR A;  3KP1 E;  3HJQ A;  3HU3 A;  4MGK E;  3A46 A;  2DZN B;  3HHX A;  3U6L A;  2ZM6 M;  1SXJ C;  2Y0Q A;  3FYC A;  5A2Q S;  1IN6 A;  3FKE A;  5BR8 M;  4GMQ A;  1FNN A;  2XFT A;  3R8F A;  2FFJ A;  2V6Z M;  3AL0 C;  4IIW A;  1Q3C A;  4JN6 A;  4I4L A;  4PCZ A;  1XMO M;  1L8Q A;  4QHT A;  3VFD A;  3AJI B;  1HQY E;  3U6O A;  1R2Z A;  1TGU A;  3VKG A;  1HR0 M;  4LFC M;  1GL6 A;  2D7G A;  2JA2 A;  3PVS A;  4LJA A;  3T38 A;  3C58 A;  4LF5 M;  1YE9 A;  4L8R C;  4OX9 M;  3JR4 A;  2Z3X A;  2YNM D;  3NBI A;  4B3M M;  4I5S A;  3R9X B;  4HL4 A;  3UZU A;  3SBJ A;  1IN4 A;  1DGH B;  3J7A S;  3CF2 A;  3FTF A;  3MJ5 A;  2I7N A;  4QNM A;  2UUC M;  1KFV A;  4M9S A;  4LG2 A;  1C1K A;  3GLH A;  3M7G A;  2H1R A;  3DA1 A;  2E5L M;  4FCW A;  4M0W A;  4MGH A;  3HKP A;  3SFZ A;  4GH9 A;  3KP0 E;  3SYK A;  1S3S A;  1UM8 A;  3J80 S;  1XMQ M;  2R65 A;  1IBK M;  1T3T A;  2XF3 A;  3AOG A;  3AOE A;  2F5P A;  2DZO B;  1IN5 A;  3THG A;  2CV2 A;  1PJJ A;  4JI7 M;  1NHG C;  3IG5 A;  3Q8X A;  3TWK A;  4FVM A;  2J7O A;  2R45 A;  3FUU A;  3EIE A;  3HHW A;  1QYR A;  2RKO A;  4DR3 M;  4IJF A;  3PNV A;  3A42 A;  1N36 M;  1N75 A;  2KXE A;  5FTM A;  1N34 M;  1IY2 A;  3PXG A;  4MGY E;  3U5Z A;  4KO8 A;  5FTN A;  1NNJ A;  4X64 M;  4FCT A;  2XH9 A;  2CEA A;  3U6S A;  3U6M A;  4LF7 M;  3SHG B;  3AOE C;  5IRE B;  4LRT A;  3HU1 A;  2ZAN A;  3KDS E;  1PM5 A;  3K2L A;  4CGY B;  3IG8 A;  2DVW B;  4TUW A;  1QAM A;  3L2A A;  1QQW A;  2J7N A;  3I51 A;  1GL7 A;  4OVZ A;  4NXM M;  4NL4 H;  4GHA A;  2CUZ A;  1Q3B A;  2CV0 A;  4D80 A;  2X8A A;  4JI4 M;  3U61 A;  3UMM A;  3FUV A;  4LF6 M;  5E26 A;  1TH3 A;  2HL7 A;  4GRI A;  1IQP A;  5EXT A;  3U5Z B;  3VLF B;  4FD2 A;  2UXD M;  5LMU M;  3L29 A;  1EE8 A;  2L7I A;  5IZ7 D;  3HJS A;  4I81 A;  3GLI A;  4JI3 M;  4DR4 M;  4JI6 M;  3JAM S;  4ITQ A;  1L1Z A;  4IJE A;  1W5S A;  2XGN A;  4DR2 M;  1XNR M;  4QOS A;  4BBA A;  5C1B A;  4DR5 M;  4QNR A;  2RGO A;  3GQ3 A;  2FNA A;  3HWS A;  4RF1 A;  3KSJ A;  1IM2 A;  4BLC A;  3U6Q A;  2BJW A;  2LWX A;  3T1H M;  4PDG A;  5KPT A;  1DO2 A;  3CF6 E;  4GKJ M;  1K3X A;  3VK7 A;  5BPV A;  4MB7 A;  3KOX E;  2HCB A;  4AG5 A;  4GIP A;  2ZAM A;  4REZ A;  2G5G X;  2P5T A;  1QZM A;  2QPA A;  2YQZ A;  3KXE C;  3K92 A;  5ITX A;  3FTC A;  7CAT A;  5JI3 E;  3GPX A;  5ITT A;  3U61 B;  2R46 A;  4B7G A;  1DGH A;  3ZC7 B;  3GRY A;  4AKI A;  4GKK M;  4D82 A;  4JYA M;  4LGY A;  4PDI A;  4DV3 M;  2M5Z A;  4NRW A;  2F5S A;  1TDZ A;  3TQS A;  3VDP A;  1ORY B;  1R2Y A;  4DV1 M;  3JR5 A;  2CHQ A;  4JI0 M;  3GPU A;  2R18 A;  3CTW B;  4LF8 M;  1GVN A;  3L25 A;  1WXQ A;  1X37 A;  4DV4 M;  4NSO B;  3CF0 A;  4RNA A;  1G41 A;  3A98 B;  4LJ5 A;  4KOD A;  1G59 A;  1G4A E;  4DV6 M;  2CHV A;  4M9X A;  3GQ4 A;  4S12 A;  1OFI A;  4JI5 M;  4R7G A;  2QBY A;  2Z7J A;  1NVM A;  1Z5B A;  1DGF A;  3GP1 A;  1MU5 A;  3E4R A;  3J27 B;  3KS4 A;  3PNY A;  1YSY A;  4XBO A;  4G4O A;  3VKH A;  4ZPX A;  3SYL A;  1NJF A;  5EXX A;  4LRS A;  3BOS A;  4AKG A;  3SMS A;  3SAU A;  3SMP A;  4AI6 A;  3SAW A;  1Q39 A;  4G4R A;  3MK6 A;  1XXH A;  4B3T M;  2KEB A;  3HGI A;  1QAQ A;  2DWZ B;  4NRV A;  4AW4 A;  4JV5 M;  1HNZ M;  3OTO M;  1XWI A;  1HNW M;  4FWG A;  3GLG B;  2M60 A;  4JI2 M;  2QCU A;  4G6Z A;  4B3R M;  1ZAE A;  1GLN A;  4LZJ A;  3K8Z A;  3M0E A;  2ERC A;  4Z6Y A;  4MH0 E;  1QVR A;  3SAR A;  1SXJ B;  3GRV A;  5DYG A;  3LVW A;  2FE8 A;  3FTD A;  2F4V M;  4LFB M;  1R7R A;  5GKN A;  1W5T A;  2OQ4 A;  4L4U A;  2Y0T A;  1LV7 A;  4I8O A;  1Z59 A;  1HNX M;  1OFH A;  2XFS A;  4B3S M;  3M6A A;  4X65 M;  2EUC A;  2XEP A;  4B08 A;  1NNU C;  1N78 A;  2V1U A;  1TDH A;  1N32 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...