3KOZE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (anaerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kozE02
3KOXE 3KOYE 3KP0E 3KP1E 3KOWE 3KOZE
chains in the Genus database with same CATH superfamily
4LFCM 5A2QS 2H5XA 1PJJA 4AKGA 1MJGM 1X37A 4MH0E 2ZAOA 1L2CA 1PJTA 2XEPA 4TUWA 5ITQA 2CE7A 1WIVA 1QZMA 4FWDA 4D81A 4Z6YA 1NJGA 3SBJA 2ZAMA 4FCTA 3J7AS 1WGLA 3BXWA 1ZMUA 2DAGA 1NNJA 3VDUA 2DI0A 2F4VM 2BWBA 5EXTA 5LMNM 1IN5A 4MM3B 3FYCA 1QAOA 4M9SA 5JI3E 1P3QQ 5KO3A 1Z5AA 2Z3XA 2B3TA 2HCBA 1QYRA 1OFIA 2CHQA 1G3IA 1PGYA 2WSFF 2C96A 2FNAA 3FUUA 3J81S 1NHWC 3R8FA 3FTFA 1OAIA 1UFZA 4NSRA 4LF6M 2RGHA 3L29A 1OAOC 2G8LA 4HL4A 2X4AA 3ZH9B 3U61A 2JP7A 1JR3A 3VK8A 3I51A 3TWKA 2JZ0A 2Z4RA 3OTOM 4NXNM 4DUYM 1NO1A 3M0EA 3GPPA 2CV2A 3HWSA 1LV7A 3UJNA 2QQ8A 5ITXA 2UUBM 2RKOA 2Q2EB 3AL0C 5C1BA 1Q02A 2MGWA 2ZBKB 3K2LA 4P17A 2DWNA 4B3MM 3K9PA 3TE6A 2XFSA 2LVNC 2HKJA 4I81A 3UZUA 4PT5A 4MGKE 4DBGB 4M9XA 4JI6M 2XZUA 4QOZC 3VK7A 1SXJA 3AFHA 2E5LM 2RGOA 1IQPA 1IBMM 3GQ5A 1LTMA 4G4RA 3HU3A 2L09A 1XWIA 3HHZA 2D7GA 2DWLA 1C1KA 2R6FA 3GPYA 1N36M 2GQFA 2C5RA 2WSCF 1RU3A 2O25A 3RE8A 3IECA 2YR0A 4MB7A 1NSFA 2ZM6M 2JWSA 1F4IA 2F5QA 2A5YB 4IJEA 3QYEA 1GJSA 2XFTA 1Z5CA 4L16A 2J7OA 3JR4A 4JI4M 4AG5A 4BLCA 3B7QA 4DR2M 3PNYA 2BJWA 4P16A 2OPFA 3GO8A 1OTRA 2H1RA 2LVOC 1XNQM 2L4EA 3LVWA 1GO5A 1GL6A 1XXHB 2OOBA 4OVZB 3FTDA 4JI3M 4S12A 1N34M 3IG5A 1DO0A 1NV9A 1ZAEA 1DGHA 4G6ZA 3HJ8A 1HQYE 2QNJA 3H4JA 3FD9A 2KNZA 2L7IA 2QZ4A 3U6EA 1IN8A 2F5SA 3E9SA 4EIWA 5KPRA 2CRUA 4G4OA 2DHRA 3K1JA 4LJ9A 3KS4A 3TQSA 3GP1A 1IN6A 2K6BA 3HHYA 1NV8A 1DV0A 1Z59A 3FUXA 3VFDA 2R62A 3DA1A 3J2PB 1K3WA 1G59A 1MU5A 2DZNB 4IBBA 3SASA 4AQYM 4DR5M 2X49A 3KP0E 1QANA 1Z5BA 4LG2A 1V33A 3SFZA 4DR1M 1NJFA 3TL4X 3GQ4A 3HHXA 4Q7JA 1VDLA 3GRVA 1DO2A 1AIPC 4CGYB 3W67A 4R71A 1HT1E 4B7GA 1YLAA 3U61B 1GJTA 4DV5M 1TGUA 1R2YA 3IHPA 3AJIB 1E9RA 2VF8A 3B7NA 3F92A 3FRHA 2KZUA 4A3VB 2DENA 2DWZB 4DR6M 2K47A 4LJ5A 4RF1A 4RF0A 4MGYE 4LFBM 4QHTA 5BPVA 3HU2A 4DV0M 4FWHA 1IXSA 2MR9A 2UXBM 3QAUA 3KOWE 5H37D 2HWJA 4CHTB 2ERCA 5KPTA 3GLFE 2XF3A 1IBLM 4OVZA 2Y21A 3GRYA 2CUZA 4WURA 1ZV1A 4I4LA 5EXSA 2DAKA 2V6ZM 2DHYA 2YNMD 3QYBA 4LZJA 1SXJB 1TDHA 2KDLA 2R45A 4GEWA 4B3SM 1VQ1A 4F2LA 3FTEA 2UUCM 3LW5F 2LBCA 3AOEC 2DVWB 4HEOA 1K82A 4LRSA 1XHBA 1YE9A 2KRUA 2O5RA 4NSOB 1HR0M 3RFWA 4I5SA 5EXXA 2JY5A 1HNZM 4Y28F 4MGZE 4NC6A 1QDRA 3GRRA 1OKSA 2DZLA 4LGMA 3L26A 2I7PA 4LFAM 2C99A 3E4RA 3EIEA 2XSZA 1DGGA 3VKHA 4LY6A 2FH0A 3VLFB 2KEBA 2R4EA 2CHVA 3FUWA 1G8PA 4AZFA 1QDTA 4REZA 3T1YM 1KYIA 2HAKA 3GLHA 4LGYA 2FOIC 5EP2A 1WHCA 4JXJA 4X66M 4AW4A 4PD2A 1DGHB 4MGHA 2HHHM 4FW9A 3C3DA 1L8QA 3J80S 2KA6B 2CHGA 4JYAM 3BBZA 3HJQA 4KLNA 1WGNA 2XLJA 4MGIE 5EQTA 3LQRA 2QPAA 4DV2M 2UU9M 4RKUF 3A98B 5DNYA 3KFUG 1ZQ9A 2MH8A 4B7FA 3U6PA 1L2DA 1I94M 2R44A 4QNMA 4PDIA 2D7HA 2VDBB 3LQQA 2LHGA 3A42A 5DFLA 2KXEA 2F5NA 2V1UA 1IN4A 2KHHA 1UM8A 4L6V6 4ANRA 3KXEC 2VIIA 5BR8M 1H6UA 3THGA 4GRIA 3KSJA 1L1TA 1XNRM 5DYIA 2Y0TA 2LH0A 2X8AA 3I04M 4G4NA 3T38A 4QNRA 2QSFX 4IBCA 2WSEF 1HNXM 3NBIA 4L78A 1DGBA 3EIHA 4FWGA 2XSZD 2ZTCA 4XK8F 4GKKM 3CGWA 3K8ZA 5LMUM 1E94E 2QENA 4KODA 3GLGB 1SXJC 3NWLA 3UMMA 1PM5A 2K9DA 3WHKA 4X65M 1OQYA 4B08A 3GPUA 4PCZA 4R3DA 1E32A 3FYDA 4IBIA 4DR7M 2MROB 3FTCA 4IJFA 1QQWA 5KQ8A 1IXSB 1ORYB 2CFOA 5GKNA 4JI8M 3NBXX 2O01F 1JR3D 2W82A 4LJ6A 4BBAA 1ZMVA 3L27A 1EIJA 3D8BA 2AHMA 1A5TA 3MK6A 3E46A 1IM2A 1R2ZA 1T6OA 1G4AE 5C18A 5ITRA 1NY6A 3HU1A 3U6CA 1ZMWA 3HKPA 4M0DA 4IIWA 2JY8A 3KOZE 1MN3A 3ZCBB 1N78A 1AUAA 2KW0A 2DAEA 2QHOB 3GLIB 4LJAA 1GKIA 3HJSA 5EP1A 3B74A 2Z4SA 3KP1E 3GQ3A 2NQ8C 4QHSA 3GRUA 4IBFA 4GKJM 3SAVA 3C9PA 3SARA 1PJQA 2KNVA 4NL4H 2P5TA 1SXJD 3T1HM 2L6OA 1L2BA 5E26A 4NOOB 3U60A 2EO2A 8CATA 1HT2E 2QP9X 2G3QA 2YFQA 3PFIA 5ITTA 1OIPA 1QVRA 4B3TM 2JA2A 2GNOA 3GLHB 2UUAM 1DGFA 3DFZA 4OX9M 2CWBA 2FE8A 4AI6A 3QWLA 3CF6E 1Q3BA 4GITA 1GLNA 1EE8A 4PDGA 1N33M 3HX3A 5DYGA 3A45A 4JI7M 1QAMA 1NY5A 2C9CA 4F1IA 4KT0F 3GPXA 1Q3CA 4LF8M 1J5EM 3KOXE 3PNVA 3GLGA 1JB0F 4DV3M 4JI2M 1XMQM 2CEAA 4UN2B 2ZTDA 4M9ZA 4XGIA 1TF0B 1V34A 2J7NA 3DZDA 4IBJA 1R4GA 3U5ZA 1N77A 2KRKA 2UXCM 3FE3A 1XXHE 1XC8A 3K9OA 4YY3M 2EJSA 4GC5A 5FTNA 3FUTA 1K3XA 2VF7A 4I8OA 3FRIA 5EP3A 1L1ZA 1PRBA 1GL7A 2K0BX 4LZZA 5ITYA 4JV5M 1FNNA 1E9SA 1IY0A 2JXNA 4JI0M 5FSWA 3GLIA 3M6AA 4XBOA 4LF7M 1J7KA 3E21A 4FCVA 3SC3A 2Z7JA 4M0WA 4W5WA 4ITQA 7CATA 2XZFA 4X62M 2M5ZA 4K0KM 3GLFA 2C9OA 1SG9A 3U6LA 1R5LA 1TH4A 1G71A 3AOGA 3Q8XA 1V92A 3SYKA 3DOAA 2VQEM 4HLQA 2I7NA 4LF5M 3R9XB 1Y8GA 3HY5A 3KW6A 1VEGA 5KQDA 3I01M 4FCWA 1JR3E 3L25A 3KVWA 4D80A 1IY2A 2VQFM 3T6PA 5KPZA 4GHLA 5IT9S 1FJGM 5EP4A 2DAIA 4FD2A 2C98A 4BB9A 1IFYA 3SAUA 3J7BA 1HQCA 5ITXE 3B89A 1D2NA 2DXIA 3U6QA 5IZ7D 4D82A 3U60B 2KNAA 2DNAA 2APLA 1QAQA 5E6JA 2BWEA 3H4MA 5IWAM 2CV1A 3CTWB 3RGPA 3SATA 3C3EA 2ZANA 3L28A 3KS8A 1KSFX 3CF0A 3PVSA 1MX0A 1SXJE 2JY6B 2JZ1A 3ILKA 4LJ8A 4OW0A 3SMPA 3T15A 1TDZA 4L15A 4B3RM 4AKIA 1HJPA 1BVSA 2MJ5B 3U6MA 2UXDM 2HL7A 1D0LA 2FS1A 3IG8A 3L2AA 5FTJA 3AV0A 2RRUA 3LCVB 3LMMA 4JI5M 3K92A 3SMSA 2QBYA 1TH3A 3B7ZA 1R7RA 2V1CA 4GH9A 4NXMM 1G41A 3UK6A 2XH9A 2LNHC 1NHGC 4DR4M 4NRWA 2Y20A 3U5ZB 4NRVA 1HNWM 3CF2A 3HHWA 1S3SA 2LHCA 3KDSE 4IBGA 3ZC7B 2D7EA 4LJ7A 1Z6TA 3C58A 1OJLA 1TH2A 1IN7A 3HZJA 2R46A 1IBKM 1IXRC 1D0KA 4ZPXA 3W68A 3ZQJA 2R0IA 1W5SA 1R6BX 2YQZA 2FFJA 4L4UA 1NVMA 4GMQA 3FKEA 3SHGB 1WR1B 3WHLA 2WZJA 2XGNA 2R65A 3I4VA 4Z8XA 1C7YA 2F5PA 1GABA 3W0LB 2Y0QA 1XMOM 5EXPA 3MJ5A 1QZEA 2DWMA 1OFHA 1YSYA 5FLXS 2EA0A 4DUZM 3U6OA 3W0FA 3GLFB 3J27B 4X64M 2JY7A 2DKLA 1TR8A 2KZSA 3UGJA 2DAMA 1IY1A 5F3WA 3Q8GA 4LF9M 3FUVA 2F5OA 2DZOB 1PJIA 2R18A 2JNHA 3VDPA 4DV7M 2LTUA 3BOSA 1QUTA 4JN6A 4II7A 2L4FA 5IREB 5ITUA 3D8LA 4JI1M 4QOSA 2OO9A 4B7HA 3V76A 1WXQA 1JQJC 3JAMS 1VDDA 1VG5A 3MHVC 1J09A 4AKHA 4AG6A 1VEJA 4LCBA 4L8RC 1N75A 4IBDA 1NNUC 1I4WA 3TWLA 3GLGE 2EKFA 4CISA 4KO8A 4G3OA 2L7HA 2Z8YM 2CV0A 1PJSA 5FTKA 3SHFA 4KHPM 1N32M 3A46A 3U6SA 4OU7A 3MMPA 5FTLA 1Q39A 2N35A 1T3TA 3U6DA 5JI2E 1D0MA 2QCUA 3JR5A 3SYLA 3M7GA 5EJCA 4DV1M 1W5TA 4IBKA 5FTMA 1EFUB 4WW0A 5L8RF 3SAWA 1QUSA 3KOYE 1YUBA 3LCUA 2CP8A 3KSXA 1T43A 2L2DA 2LVQD 3B9PA 4GC9A 2BJVA 3LVVA 3GLIE 1TTEA 1XB2B 4RNAA 4G4QA 3AKZA 2R4JA 4FVMA 2LVPC 2OQ4A 4LRTA 3RGSA 4DV4M 1CUKA 3TPZA 4DV6M 4R7GA 4IBEA 1GVNA 2EKKA 2QBYB 2LVAA 2OOAA 4LJ4A 2BNKA 2EUCA 4CJ6A 4LF4M 4GHAA 4DR3M 3AOEA 1WJ7A 1VEKA 3PXGA 2G5GX 4CIZA 3I4YA 4WP2A 3VKGA 1XXHA 3HGIA 1KFVA 4GIPA 3TWMA 2LXEA 2M60A 1IXZA 1OIZA 2JUJA 2LWXA 4YHHM 2J5YA 3GLHE
chains in the Genus database with same CATH topology
4LFCM 5A2QS 1PJJA 4AKGA 1X37A 4MH0E 2ZAOA 1L2CA 2XEPA 4TUWA 5ITQA 2CE7A 1QZMA 4FWDA 4D81A 4Z6YA 1NJGA 3SBJA 2ZAMA 4FCTA 3J7AS 1NNJA 3VDUA 2F4VM 5EXTA 5LMNM 1IN5A 4MM3B 3FYCA 1QAOA 4M9SA 5JI3E 5KO3A 1Z5AA 2Z3XA 2HCBA 1QYRA 1OFIA 2CHQA 1G3IA 2C96A 2FNAA 3FUUA 3J81S 1NHWC 3R8FA 3FTFA 4LF6M 4NSRA 2RGHA 3L29A 4HL4A 2G8LA 2X4AA 3ZH9B 3U61A 1JR3A 3VK8A 3I51A 3TWKA 2Z4RA 3OTOM 4NXNM 4DUYM 2CV2A 3M0EA 3GPPA 3HWSA 1LV7A 3UJNA 5ITXA 2UUBM 2RKOA 2Q2EB 3AL0C 5C1BA 4B3MM 2ZBKB 3K2LA 3TE6A 2XFSA 4I81A 2HKJA 3UZUA 4PT5A 4MGKE 4JI6M 4M9XA 2XZUA 4QOZC 3VK7A 1SXJA 3AFHA 2E5LM 2RGOA 1IQPA 1IBMM 3GQ5A 4G4RA 3HU3A 2L09A 1XWIA 3HHZA 2D7GA 2DWLA 1C1KA 3GPYA 1N36M 2C5RA 3RE8A 2YR0A 4MB7A 1NSFA 2ZM6M 2F5QA 2A5YB 4IJEA 2XFTA 1Z5CA 4L16A 2J7OA 3JR4A 4JI4M 4AG5A 4BLCA 4DR2M 3PNYA 2BJWA 4P16A 2OPFA 3GO8A 2H1RA 1XNQM 3LVWA 1GL6A 1XXHB 4OVZB 3FTDA 4JI3M 4S12A 1N34M 3IG5A 1DO0A 1ZAEA 1DGHA 4G6ZA 3HJ8A 1HQYE 3FD9A 2L7IA 2QZ4A 3U6EA 1IN8A 2F5SA 3E9SA 4EIWA 5KPRA 4G4OA 2DHRA 3K1JA 4LJ9A 3KS4A 3TQSA 3GP1A 1IN6A 3HHYA 1Z59A 3FUXA 3VFDA 2R62A 3DA1A 3J2PB 1K3WA 1G59A 1MU5A 2DZNB 4IBBA 3SASA 4AQYM 4DR5M 2X49A 3KP0E 1QANA 1Z5BA 4LG2A 3SFZA 4DR1M 1NJFA 3TL4X 3GQ4A 3HHXA 3GRVA 1DO2A 4CGYB 1HT1E 4B7GA 3U61B 4DV5M 1TGUA 3AJIB 1E9RA 2KZUA 4A3VB 2DWZB 4DR6M 2K47A 4LJ5A 4RF1A 4RF0A 4MGYE 4LFBM 4QHTA 5BPVA 3HU2A 4DV0M 4FWHA 2UXBM 3QAUA 3KOWE 5H37D 4CHTB 2ERCA 5KPTA 2XF3A 1IBLM 4OVZA 2Y21A 3GRYA 2CUZA 4WURA 4I4LA 5EXSA 2V6ZM 2YNMD 4LZJA 1SXJB 1TDHA 2R45A 4B3SM 3FTEA 2UUCM 3AOEC 2DVWB 1K82A 4LRSA 1XHBA 1YE9A 2KRUA 2O5RA 4NSOB 1HR0M 3RFWA 4I5SA 5EXXA 1HNZM 4MGZE 3GRRA 4LGMA 3L26A 2I7PA 4LFAM 2C99A 3E4RA 3EIEA 2XSZA 1DGGA 3VKHA 4LY6A 3VLFB 2KEBA 2R4EA 2CHVA 3FUWA 1G8PA 4AZFA 4REZA 3T1YM 1KYIA 3GLHA 4LGYA 2FOIC 5EP2A 4JXJA 4X66M 4AW4A 4PD2A 1DGHB 4MGHA 2HHHM 4FW9A 1L8QA 3J80S 2KA6B 2CHGA 4JYAM 3HJQA 4KLNA 2XLJA 4MGIE 5EQTA 3LQRA 2QPAA 4DV2M 2UU9M 3A98B 5DNYA 3KFUG 1ZQ9A 4B7FA 3U6PA 1L2DA 1I94M 4QNMA 4PDIA 2D7HA 3LQQA 3A42A 2F5NA 2KXEA 2V1UA 1IN4A 1UM8A 3KXEC 2VIIA 5BR8M 1H6UA 3THGA 4GRIA 3KSJA 1L1TA 1XNRM 5DYIA 2Y0TA 2LH0A 2X8AA 4G4NA 3T38A 4QNRA 4IBCA 1HNXM 3NBIA 4L78A 1DGBA 3EIHA 4FWGA 2XSZD 4GKKM 3K8ZA 5LMUM 1E94E 2QENA 4KODA 3GLGB 1SXJC 3NWLA 3UMMA 1PM5A 3WHKA 4X65M 4LF4M 4B08A 3GPUA 4PCZA 4R3DA 1E32A 3FYDA 4IBIA 4DR7M 3FTCA 4IJFA 1QQWA 5KQ8A 1IXSB 1ORYB 2CFOA 5GKNA 4JI8M 1JR3D 2W82A 4LJ6A 4BBAA 3L27A 3D8BA 2AHMA 3MK6A 1IM2A 1R2ZA 1G4AE 5C18A 5ITRA 1NY6A 3HU1A 3U6CA 3HKPA 4M0DA 4IIWA 3KOZE 3ZCBB 1N78A 2KW0A 3GLIB 4LJAA 1GKIA 3HJSA 5EP1A 2Z4SA 3KP1E 3GQ3A 2NQ8C 4QHSA 3GRUA 4IBFA 4GKJM 3SARA 4NL4H 2P5TA 1SXJD 3T1HM 2L6OA 1L2BA 5E26A 4NOOB 3U60A 2EO2A 8CATA 1HT2E 2QP9X 2YFQA 3PFIA 5ITTA 1QVRA 4B3TM 2JA2A 3GLHB 2UUAM 1DGFA 3DFZA 4OX9M 2FE8A 4AI6A 3QWLA 3CF6E 1Q3BA 4GITA 1GLNA 1EE8A 4PDGA 1N33M 5DYGA 3A45A 4JI7M 1QAMA 1NY5A 2C9CA 3GPXA 1Q3CA 4LF8M 1J5EM 3KOXE 3PNVA 3GLGA 4DV3M 4JI2M 1XMQM 2CEAA 4M9ZA 4XGIA 3DZDA 2J7NA 4IBJA 3U5ZA 1N77A 2KRKA 2UXCM 1XC8A 4YY3M 4GC5A 5FTNA 3FUTA 1K3XA 4I8OA 5EP3A 1L1ZA 1GL7A 4LZZA 5ITYA 4JV5M 1FNNA 1E9SA 1IY0A 4JI0M 5FSWA 3GLIA 4LF7M 3M6AA 4XBOA 1J7KA 4FCVA 3SC3A 2Z7JA 4M0WA 4W5WA 4ITQA 7CATA 2XZFA 4X62M 2M5ZA 4K0KM 3GLFA 2C9OA 3U6LA 1TH4A 3AOGA 3Q8XA 3SYKA 3DOAA 2VQEM 4HLQA 2I7NA 4LF5M 3R9XB 3KW6A 5KQDA 4FCWA 3L25A 3KVWA 4D80A 1IY2A 2VQFM 5KPZA 4GHLA 5IT9S 1FJGM 5EP4A 4FD2A 2C98A 4BB9A 3SAUA 3J7BA 1HQCA 5ITXE 1D2NA 2DXIA 3U6QA 5IZ7D 4D82A 3U60B 1QAQA 5E6JA 3H4MA 5IWAM 2CV1A 3CTWB 3RGPA 3SATA 2ZANA 3L28A 3KS8A 1KSFX 3CF0A 3PVSA 1MX0A 1SXJE 3ILKA 4LJ8A 4OW0A 1TDZA 3SMPA 3T15A 1R2YA 4B3RM 4L15A 4AKIA 3U6MA 2UXDM 2HL7A 5FTJA 3IG8A 3L2AA 3AV0A 3LMMA 4JI5M 3K92A 3SMSA 2QBYA 1TH3A 1R7RA 2V1CA 4GH9A 4NXMM 1G41A 3UK6A 2XH9A 2LNHC 1NHGC 4DR4M 4NRWA 2Y20A 3U5ZB 1HNWM 3HHWA 3CF2A 1S3SA 3KDSE 4IBGA 3ZC7B 2D7EA 4LJ7A 1Z6TA 3C58A 1OJLA 1TH2A 1IN7A 1IBKM 2R46A 1IXRC 4ZPXA 1W5SA 1R6BX 2YQZA 2FFJA 4L4UA 1NVMA 4GMQA 3FKEA 3SHGB 3WHLA 3SAVA 2XGNA 3I4VA 2R65A 4Z8XA 2F5PA 3W0LB 2Y0QA 1XMOM 5EXPA 3MJ5A 2DWMA 1OFHA 1YSYA 5FLXS 2EA0A 4DUZM 3U6OA 3W0FA 3GLFB 4X64M 2KZSA 3UGJA 1IY1A 5F3WA 4LF9M 3FUVA 2F5OA 2DZOB 1PJIA 2R18A 3VDPA 4DV7M 3BOSA 4JI1M 4JN6A 4II7A 5IREB 5ITUA 3D8LA 4QOSA 4B7HA 1WXQA 1JQJC 3JAMS 1VDDA 4AKHA 3MHVC 1J09A 4AG6A 4LCBA 4L8RC 1N75A 4IBDA 1NNUC 1I4WA 3TWLA 4CISA 4KO8A 2L7HA 2CV0A 4KHPM 5FTKA 3SHFA 1N32M 3A46A 3U6SA 4OU7A 5FTLA 1Q39A 1T3TA 3U6DA 5JI2E 2QCUA 3JR5A 3SYLA 3M7GA 5EJCA 4DV1M 1W5TA 4IBKA 5FTMA 4WW0A 3SAWA 3KOYE 1YUBA 3KSXA 4GC9A 3B9PA 2BJVA 3LVVA 4RNAA 2DWNA 4G4QA 3AKZA 2R4JA 4FVMA 2OQ4A 4LRTA 3RGSA 4DV4M 3TPZA 4DV6M 4R7GA 4IBEA 1GVNA 2QBYB 4GHAA 4LJ4A 2BNKA 2EUCA 4DR3M 3AOEA 3PXGA 3VKGA 2G5GX 3I4YA 1XXHA 3HGIA 1KFVA 4GIPA 3TWMA 2LXEA 2M60A 1IXZA 4YHHM 2LWXA 3J27B 4NRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOX E;  3KOY E;  3KP0 E;  3KP1 E;  3KOW E;  3KOZ E; 
#chains in the Genus database with same CATH topology
 4LFC M;  5A2Q S;  2H5X A;  1PJJ A;  4AKG A;  1MJG M;  1X37 A;  4MH0 E;  2ZAO A;  1L2C A;  1PJT A;  2XEP A;  4TUW A;  5ITQ A;  2CE7 A;  1WIV A;  1QZM A;  4FWD A;  4D81 A;  4Z6Y A;  1NJG A;  3SBJ A;  2ZAM A;  4FCT A;  3J7A S;  1WGL A;  3BXW A;  1ZMU A;  2DAG A;  1NNJ A;  3VDU A;  2DI0 A;  2F4V M;  2BWB A;  5EXT A;  5LMN M;  1IN5 A;  4MM3 B;  3FYC A;  1QAO A;  4M9S A;  5JI3 E;  1P3Q Q;  5KO3 A;  1Z5A A;  2Z3X A;  2B3T A;  2HCB A;  1QYR A;  1OFI A;  2CHQ A;  1G3I A;  1PGY A;  2WSF F;  2C96 A;  2FNA A;  3FUU A;  3J81 S;  1NHW C;  3R8F A;  3FTF A;  1OAI A;  1UFZ A;  4NSR A;  4LF6 M;  2RGH A;  3L29 A;  1OAO C;  2G8L A;  4HL4 A;  2X4A A;  3ZH9 B;  3U61 A;  2JP7 A;  1JR3 A;  3VK8 A;  3I51 A;  3TWK A;  2JZ0 A;  2Z4R A;  3OTO M;  4NXN M;  4DUY M;  1NO1 A;  3M0E A;  3GPP A;  2CV2 A;  3HWS A;  1LV7 A;  3UJN A;  2QQ8 A;  5ITX A;  2UUB M;  2RKO A;  2Q2E B;  3AL0 C;  5C1B A;  1Q02 A;  2MGW A;  2ZBK B;  3K2L A;  4P17 A;  2DWN A;  4B3M M;  3K9P A;  3TE6 A;  2XFS A;  2LVN C;  2HKJ A;  4I81 A;  3UZU A;  4PT5 A;  4MGK E;  4DBG B;  4M9X A;  4JI6 M;  2XZU A;  4QOZ C;  3VK7 A;  1SXJ A;  3AFH A;  2E5L M;  2RGO A;  1IQP A;  1IBM M;  3GQ5 A;  1LTM A;  4G4R A;  3HU3 A;  2L09 A;  1XWI A;  3HHZ A;  2D7G A;  2DWL A;  1C1K A;  2R6F A;  3GPY A;  1N36 M;  2GQF A;  2C5R A;  2WSC F;  1RU3 A;  2O25 A;  3RE8 A;  3IEC A;  2YR0 A;  4MB7 A;  1NSF A;  2ZM6 M;  2JWS A;  1F4I A;  2F5Q A;  2A5Y B;  4IJE A;  3QYE A;  1GJS A;  2XFT A;  1Z5C A;  4L16 A;  2J7O A;  3JR4 A;  4JI4 M;  4AG5 A;  4BLC A;  3B7Q A;  4DR2 M;  3PNY A;  2BJW A;  4P16 A;  2OPF A;  3GO8 A;  1OTR A;  2H1R A;  2LVO C;  1XNQ M;  2L4E A;  3LVW A;  1GO5 A;  1GL6 A;  1XXH B;  2OOB A;  4OVZ B;  3FTD A;  4JI3 M;  4S12 A;  1N34 M;  3IG5 A;  1DO0 A;  1NV9 A;  1ZAE A;  1DGH A;  4G6Z A;  3HJ8 A;  1HQY E;  2QNJ A;  3H4J A;  3FD9 A;  2KNZ A;  2L7I A;  2QZ4 A;  3U6E A;  1IN8 A;  2F5S A;  3E9S A;  4EIW A;  5KPR A;  2CRU A;  4G4O A;  2DHR A;  3K1J A;  4LJ9 A;  3KS4 A;  3TQS A;  3GP1 A;  1IN6 A;  2K6B A;  3HHY A;  1NV8 A;  1DV0 A;  1Z59 A;  3FUX A;  3VFD A;  2R62 A;  3DA1 A;  3J2P B;  1K3W A;  1G59 A;  1MU5 A;  2DZN B;  4IBB A;  3SAS A;  4AQY M;  4DR5 M;  2X49 A;  3KP0 E;  1QAN A;  1Z5B A;  4LG2 A;  1V33 A;  3SFZ A;  4DR1 M;  1NJF A;  3TL4 X;  3GQ4 A;  3HHX A;  4Q7J A;  1VDL A;  3GRV A;  1DO2 A;  1AIP C;  4CGY B;  3W67 A;  4R71 A;  1HT1 E;  4B7G A;  1YLA A;  3U61 B;  1GJT A;  4DV5 M;  1TGU A;  1R2Y A;  3IHP A;  3AJI B;  1E9R A;  2VF8 A;  3B7N A;  3F92 A;  3FRH A;  2KZU A;  4A3V B;  2DEN A;  2DWZ B;  4DR6 M;  2K47 A;  4LJ5 A;  4RF1 A;  4RF0 A;  4MGY E;  4LFB M;  4QHT A;  5BPV A;  3HU2 A;  4DV0 M;  4FWH A;  1IXS A;  2MR9 A;  2UXB M;  3QAU A;  3KOW E;  5H37 D;  2HWJ A;  4CHT B;  2ERC A;  5KPT A;  3GLF E;  2XF3 A;  1IBL M;  4OVZ A;  2Y21 A;  3GRY A;  2CUZ A;  4WUR A;  1ZV1 A;  4I4L A;  5EXS A;  2DAK A;  2V6Z M;  2DHY A;  2YNM D;  3QYB A;  4LZJ A;  1SXJ B;  1TDH A;  2KDL A;  2R45 A;  4GEW A;  4B3S M;  1VQ1 A;  4F2L A;  3FTE A;  2UUC M;  3LW5 F;  2LBC A;  3AOE C;  2DVW B;  4HEO A;  1K82 A;  4LRS A;  1XHB A;  1YE9 A;  2KRU A;  2O5R A;  4NSO B;  1HR0 M;  3RFW A;  4I5S A;  5EXX A;  2JY5 A;  1HNZ M;  4Y28 F;  4MGZ E;  4NC6 A;  1QDR A;  3GRR A;  1OKS A;  2DZL A;  4LGM A;  3L26 A;  2I7P A;  4LFA M;  2C99 A;  3E4R A;  3EIE A;  2XSZ A;  1DGG A;  3VKH A;  4LY6 A;  2FH0 A;  3VLF B;  2KEB A;  2R4E A;  2CHV A;  3FUW A;  1G8P A;  4AZF A;  1QDT A;  4REZ A;  3T1Y M;  1KYI A;  2HAK A;  3GLH A;  4LGY A;  2FOI C;  5EP2 A;  1WHC A;  4JXJ A;  4X66 M;  4AW4 A;  4PD2 A;  1DGH B;  4MGH A;  2HHH M;  4FW9 A;  3C3D A;  1L8Q A;  3J80 S;  2KA6 B;  2CHG A;  4JYA M;  3BBZ A;  3HJQ A;  4KLN A;  1WGN A;  2XLJ A;  4MGI E;  5EQT A;  3LQR A;  2QPA A;  4DV2 M;  2UU9 M;  4RKU F;  3A98 B;  5DNY A;  3KFU G;  1ZQ9 A;  2MH8 A;  4B7F A;  3U6P A;  1L2D A;  1I94 M;  2R44 A;  4QNM A;  4PDI A;  2D7H A;  2VDB B;  3LQQ A;  2LHG A;  3A42 A;  5DFL A;  2KXE A;  2F5N A;  2V1U A;  1IN4 A;  2KHH A;  1UM8 A;  4L6V 6;  4ANR A;  3KXE C;  2VII A;  5BR8 M;  1H6U A;  3THG A;  4GRI A;  3KSJ A;  1L1T A;  1XNR M;  5DYI A;  2Y0T A;  2LH0 A;  2X8A A;  3I04 M;  4G4N A;  3T38 A;  4QNR A;  2QSF X;  4IBC A;  2WSE F;  1HNX M;  3NBI A;  4L78 A;  1DGB A;  3EIH A;  4FWG A;  2XSZ D;  2ZTC A;  4XK8 F;  4GKK M;  3CGW A;  3K8Z A;  5LMU M;  1E94 E;  2QEN A;  4KOD A;  3GLG B;  1SXJ C;  3NWL A;  3UMM A;  1PM5 A;  2K9D A;  3WHK A;  4X65 M;  1OQY A;  4B08 A;  3GPU A;  4PCZ A;  4R3D A;  1E32 A;  3FYD A;  4IBI A;  4DR7 M;  2MRO B;  3FTC A;  4IJF A;  1QQW A;  5KQ8 A;  1IXS B;  1ORY B;  2CFO A;  5GKN A;  4JI8 M;  3NBX X;  2O01 F;  1JR3 D;  2W82 A;  4LJ6 A;  4BBA A;  1ZMV A;  3L27 A;  1EIJ A;  3D8B A;  2AHM A;  1A5T A;  3MK6 A;  3E46 A;  1IM2 A;  1R2Z A;  1T6O A;  1G4A E;  5C18 A;  5ITR A;  1NY6 A;  3HU1 A;  3U6C A;  1ZMW A;  3HKP A;  4M0D A;  4IIW A;  2JY8 A;  3KOZ E;  1MN3 A;  3ZCB B;  1N78 A;  1AUA A;  2KW0 A;  2DAE A;  2QHO B;  3GLI B;  4LJA A;  1GKI A;  3HJS A;  5EP1 A;  3B74 A;  2Z4S A;  3KP1 E;  3GQ3 A;  2NQ8 C;  4QHS A;  3GRU A;  4IBF A;  4GKJ M;  3SAV A;  3C9P A;  3SAR A;  1PJQ A;  2KNV A;  4NL4 H;  2P5T A;  1SXJ D;  3T1H M;  2L6O A;  1L2B A;  5E26 A;  4NOO B;  3U60 A;  2EO2 A;  8CAT A;  1HT2 E;  2QP9 X;  2G3Q A;  2YFQ A;  3PFI A;  5ITT A;  1OIP A;  1QVR A;  4B3T M;  2JA2 A;  2GNO A;  3GLH B;  2UUA M;  1DGF A;  3DFZ A;  4OX9 M;  2CWB A;  2FE8 A;  4AI6 A;  3QWL A;  3CF6 E;  1Q3B A;  4GIT A;  1GLN A;  1EE8 A;  4PDG A;  1N33 M;  3HX3 A;  5DYG A;  3A45 A;  4JI7 M;  1QAM A;  1NY5 A;  2C9C A;  4F1I A;  4KT0 F;  3GPX A;  1Q3C A;  4LF8 M;  1J5E M;  3KOX E;  3PNV A;  3GLG A;  1JB0 F;  4DV3 M;  4JI2 M;  1XMQ M;  2CEA A;  4UN2 B;  2ZTD A;  4M9Z A;  4XGI A;  1TF0 B;  1V34 A;  2J7N A;  3DZD A;  4IBJ A;  1R4G A;  3U5Z A;  1N77 A;  2KRK A;  2UXC M;  3FE3 A;  1XXH E;  1XC8 A;  3K9O A;  4YY3 M;  2EJS A;  4GC5 A;  5FTN A;  3FUT A;  1K3X A;  2VF7 A;  4I8O A;  3FRI A;  5EP3 A;  1L1Z A;  1PRB A;  1GL7 A;  2K0B X;  4LZZ A;  5ITY A;  4JV5 M;  1FNN A;  1E9S A;  1IY0 A;  2JXN A;  4JI0 M;  5FSW A;  3GLI A;  3M6A A;  4XBO A;  4LF7 M;  1J7K A;  3E21 A;  4FCV A;  3SC3 A;  2Z7J A;  4M0W A;  4W5W A;  4ITQ A;  7CAT A;  2XZF A;  4X62 M;  2M5Z A;  4K0K M;  3GLF A;  2C9O A;  1SG9 A;  3U6L A;  1R5L A;  1TH4 A;  1G71 A;  3AOG A;  3Q8X A;  1V92 A;  3SYK A;  3DOA A;  2VQE M;  4HLQ A;  2I7N A;  4LF5 M;  3R9X B;  1Y8G A;  3HY5 A;  3KW6 A;  1VEG A;  5KQD A;  3I01 M;  4FCW A;  1JR3 E;  3L25 A;  3KVW A;  4D80 A;  1IY2 A;  2VQF M;  3T6P A;  5KPZ A;  4GHL A;  5IT9 S;  1FJG M;  5EP4 A;  2DAI A;  4FD2 A;  2C98 A;  4BB9 A;  1IFY A;  3SAU A;  3J7B A;  1HQC A;  5ITX E;  3B89 A;  1D2N A;  2DXI A;  3U6Q A;  5IZ7 D;  4D82 A;  3U60 B;  2KNA A;  2DNA A;  2APL A;  1QAQ A;  5E6J A;  2BWE A;  3H4M A;  5IWA M;  2CV1 A;  3CTW B;  3RGP A;  3SAT A;  3C3E A;  2ZAN A;  3L28 A;  3KS8 A;  1KSF X;  3CF0 A;  3PVS A;  1MX0 A;  1SXJ E;  2JY6 B;  2JZ1 A;  3ILK A;  4LJ8 A;  4OW0 A;  3SMP A;  3T15 A;  1TDZ A;  4L15 A;  4B3R M;  4AKI A;  1HJP A;  1BVS A;  2MJ5 B;  3U6M A;  2UXD M;  2HL7 A;  1D0L A;  2FS1 A;  3IG8 A;  3L2A A;  5FTJ A;  3AV0 A;  2RRU A;  3LCV B;  3LMM A;  4JI5 M;  3K92 A;  3SMS A;  2QBY A;  1TH3 A;  3B7Z A;  1R7R A;  2V1C A;  4GH9 A;  4NXM M;  1G41 A;  3UK6 A;  2XH9 A;  2LNH C;  1NHG C;  4DR4 M;  4NRW A;  2Y20 A;  3U5Z B;  4NRV A;  1HNW M;  3CF2 A;  3HHW A;  1S3S A;  2LHC A;  3KDS E;  4IBG A;  3ZC7 B;  2D7E A;  4LJ7 A;  1Z6T A;  3C58 A;  1OJL A;  1TH2 A;  1IN7 A;  3HZJ A;  2R46 A;  1IBK M;  1IXR C;  1D0K A;  4ZPX A;  3W68 A;  3ZQJ A;  2R0I A;  1W5S A;  1R6B X;  2YQZ A;  2FFJ A;  4L4U A;  1NVM A;  4GMQ A;  3FKE A;  3SHG B;  1WR1 B;  3WHL A;  2WZJ A;  2XGN A;  2R65 A;  3I4V A;  4Z8X A;  1C7Y A;  2F5P A;  1GAB A;  3W0L B;  2Y0Q A;  1XMO M;  5EXP A;  3MJ5 A;  1QZE A;  2DWM A;  1OFH A;  1YSY A;  5FLX S;  2EA0 A;  4DUZ M;  3U6O A;  3W0F A;  3GLF B;  3J27 B;  4X64 M;  2JY7 A;  2DKL A;  1TR8 A;  2KZS A;  3UGJ A;  2DAM A;  1IY1 A;  5F3W A;  3Q8G A;  4LF9 M;  3FUV A;  2F5O A;  2DZO B;  1PJI A;  2R18 A;  2JNH A;  3VDP A;  4DV7 M;  2LTU A;  3BOS A;  1QUT A;  4JN6 A;  4II7 A;  2L4F A;  5IRE B;  5ITU A;  3D8L A;  4JI1 M;  4QOS A;  2OO9 A;  4B7H A;  3V76 A;  1WXQ A;  1JQJ C;  3JAM S;  1VDD A;  1VG5 A;  3MHV C;  1J09 A;  4AKH A;  4AG6 A;  1VEJ A;  4LCB A;  4L8R C;  1N75 A;  4IBD A;  1NNU C;  1I4W A;  3TWL A;  3GLG E;  2EKF A;  4CIS A;  4KO8 A;  4G3O A;  2L7H A;  2Z8Y M;  2CV0 A;  1PJS A;  5FTK A;  3SHF A;  4KHP M;  1N32 M;  3A46 A;  3U6S A;  4OU7 A;  3MMP A;  5FTL A;  1Q39 A;  2N35 A;  1T3T A;  3U6D A;  5JI2 E;  1D0M A;  2QCU A;  3JR5 A;  3SYL A;  3M7G A;  5EJC A;  4DV1 M;  1W5T A;  4IBK A;  5FTM A;  1EFU B;  4WW0 A;  5L8R F;  3SAW A;  1QUS A;  3KOY E;  1YUB A;  3LCU A;  2CP8 A;  3KSX A;  1T43 A;  2L2D A;  2LVQ D;  3B9P A;  4GC9 A;  2BJV A;  3LVV A;  3GLI E;  1TTE A;  1XB2 B;  4RNA A;  4G4Q A;  3AKZ A;  2R4J A;  4FVM A;  2LVP C;  2OQ4 A;  4LRT A;  3RGS A;  4DV4 M;  1CUK A;  3TPZ A;  4DV6 M;  4R7G A;  4IBE A;  1GVN A;  2EKK A;  2QBY B;  2LVA A;  2OOA A;  4LJ4 A;  2BNK A;  2EUC A;  4CJ6 A;  4LF4 M;  4GHA A;  4DR3 M;  3AOE A;  1WJ7 A;  1VEK A;  3PXG A;  2G5G X;  4CIZ A;  3I4Y A;  4WP2 A;  3VKG A;  1XXH A;  3HGI A;  1KFV A;  4GIP A;  3TWM A;  2LXE A;  2M60 A;  1IXZ A;  1OIZ A;  2JUJ A;  2LWX A;  4YHH M;  2J5Y A;  3GLH E; 
#chains in the Genus database with same CATH homology
 4LFC M;  5A2Q S;  1PJJ A;  4AKG A;  1X37 A;  4MH0 E;  2ZAO A;  1L2C A;  2XEP A;  4TUW A;  5ITQ A;  2CE7 A;  1QZM A;  4FWD A;  4D81 A;  4Z6Y A;  1NJG A;  3SBJ A;  2ZAM A;  4FCT A;  3J7A S;  1NNJ A;  3VDU A;  2F4V M;  5EXT A;  5LMN M;  1IN5 A;  4MM3 B;  3FYC A;  1QAO A;  4M9S A;  5JI3 E;  5KO3 A;  1Z5A A;  2Z3X A;  2HCB A;  1QYR A;  1OFI A;  2CHQ A;  1G3I A;  2C96 A;  2FNA A;  3FUU A;  3J81 S;  1NHW C;  3R8F A;  3FTF A;  4LF6 M;  4NSR A;  2RGH A;  3L29 A;  4HL4 A;  2G8L A;  2X4A A;  3ZH9 B;  3U61 A;  1JR3 A;  3VK8 A;  3I51 A;  3TWK A;  2Z4R A;  3OTO M;  4NXN M;  4DUY M;  2CV2 A;  3M0E A;  3GPP A;  3HWS A;  1LV7 A;  3UJN A;  5ITX A;  2UUB M;  2RKO A;  2Q2E B;  3AL0 C;  5C1B A;  4B3M M;  2ZBK B;  3K2L A;  3TE6 A;  2XFS A;  4I81 A;  2HKJ A;  3UZU A;  4PT5 A;  4MGK E;  4JI6 M;  4M9X A;  2XZU A;  4QOZ C;  3VK7 A;  1SXJ A;  3AFH A;  2E5L M;  2RGO A;  1IQP A;  1IBM M;  3GQ5 A;  4G4R A;  3HU3 A;  2L09 A;  1XWI A;  3HHZ A;  2D7G A;  2DWL A;  1C1K A;  3GPY A;  1N36 M;  2C5R A;  3RE8 A;  2YR0 A;  4MB7 A;  1NSF A;  2ZM6 M;  2F5Q A;  2A5Y B;  4IJE A;  2XFT A;  1Z5C A;  4L16 A;  2J7O A;  3JR4 A;  4JI4 M;  4AG5 A;  4BLC A;  4DR2 M;  3PNY A;  2BJW A;  4P16 A;  2OPF A;  3GO8 A;  2H1R A;  1XNQ M;  3LVW A;  1GL6 A;  1XXH B;  4OVZ B;  3FTD A;  4JI3 M;  4S12 A;  1N34 M;  3IG5 A;  1DO0 A;  1ZAE A;  1DGH A;  4G6Z A;  3HJ8 A;  1HQY E;  3FD9 A;  2L7I A;  2QZ4 A;  3U6E A;  1IN8 A;  2F5S A;  3E9S A;  4EIW A;  5KPR A;  4G4O A;  2DHR A;  3K1J A;  4LJ9 A;  3KS4 A;  3TQS A;  3GP1 A;  1IN6 A;  3HHY A;  1Z59 A;  3FUX A;  3VFD A;  2R62 A;  3DA1 A;  3J2P B;  1K3W A;  1G59 A;  1MU5 A;  2DZN B;  4IBB A;  3SAS A;  4AQY M;  4DR5 M;  2X49 A;  3KP0 E;  1QAN A;  1Z5B A;  4LG2 A;  3SFZ A;  4DR1 M;  1NJF A;  3TL4 X;  3GQ4 A;  3HHX A;  3GRV A;  1DO2 A;  4CGY B;  1HT1 E;  4B7G A;  3U61 B;  4DV5 M;  1TGU A;  3AJI B;  1E9R A;  2KZU A;  4A3V B;  2DWZ B;  4DR6 M;  2K47 A;  4LJ5 A;  4RF1 A;  4RF0 A;  4MGY E;  4LFB M;  4QHT A;  5BPV A;  3HU2 A;  4DV0 M;  4FWH A;  2UXB M;  3QAU A;  3KOW E;  5H37 D;  4CHT B;  2ERC A;  5KPT A;  2XF3 A;  1IBL M;  4OVZ A;  2Y21 A;  3GRY A;  2CUZ A;  4WUR A;  4I4L A;  5EXS A;  2V6Z M;  2YNM D;  4LZJ A;  1SXJ B;  1TDH A;  2R45 A;  4B3S M;  3FTE A;  2UUC M;  3AOE C;  2DVW B;  1K82 A;  4LRS A;  1XHB A;  1YE9 A;  2KRU A;  2O5R A;  4NSO B;  1HR0 M;  3RFW A;  4I5S A;  5EXX A;  1HNZ M;  4MGZ E;  3GRR A;  4LGM A;  3L26 A;  2I7P A;  4LFA M;  2C99 A;  3E4R A;  3EIE A;  2XSZ A;  1DGG A;  3VKH A;  4LY6 A;  3VLF B;  2KEB A;  2R4E A;  2CHV A;  3FUW A;  1G8P A;  4AZF A;  4REZ A;  3T1Y M;  1KYI A;  3GLH A;  4LGY A;  2FOI C;  5EP2 A;  4JXJ A;  4X66 M;  4AW4 A;  4PD2 A;  1DGH B;  4MGH A;  2HHH M;  4FW9 A;  1L8Q A;  3J80 S;  2KA6 B;  2CHG A;  4JYA M;  3HJQ A;  4KLN A;  2XLJ A;  4MGI E;  5EQT A;  3LQR A;  2QPA A;  4DV2 M;  2UU9 M;  3A98 B;  5DNY A;  3KFU G;  1ZQ9 A;  4B7F A;  3U6P A;  1L2D A;  1I94 M;  4QNM A;  4PDI A;  2D7H A;  3LQQ A;  3A42 A;  2F5N A;  2KXE A;  2V1U A;  1IN4 A;  1UM8 A;  3KXE C;  2VII A;  5BR8 M;  1H6U A;  3THG A;  4GRI A;  3KSJ A;  1L1T A;  1XNR M;  5DYI A;  2Y0T A;  2LH0 A;  2X8A A;  4G4N A;  3T38 A;  4QNR A;  4IBC A;  1HNX M;  3NBI A;  4L78 A;  1DGB A;  3EIH A;  4FWG A;  2XSZ D;  4GKK M;  3K8Z A;  5LMU M;  1E94 E;  2QEN A;  4KOD A;  3GLG B;  1SXJ C;  3NWL A;  3UMM A;  1PM5 A;  3WHK A;  4X65 M;  4LF4 M;  4B08 A;  3GPU A;  4PCZ A;  4R3D A;  1E32 A;  3FYD A;  4IBI A;  4DR7 M;  3FTC A;  4IJF A;  1QQW A;  5KQ8 A;  1IXS B;  1ORY B;  2CFO A;  5GKN A;  4JI8 M;  1JR3 D;  2W82 A;  4LJ6 A;  4BBA A;  3L27 A;  3D8B A;  2AHM A;  3MK6 A;  1IM2 A;  1R2Z A;  1G4A E;  5C18 A;  5ITR A;  1NY6 A;  3HU1 A;  3U6C A;  3HKP A;  4M0D A;  4IIW A;  3KOZ E;  3ZCB B;  1N78 A;  2KW0 A;  3GLI B;  4LJA A;  1GKI A;  3HJS A;  5EP1 A;  2Z4S A;  3KP1 E;  3GQ3 A;  2NQ8 C;  4QHS A;  3GRU A;  4IBF A;  4GKJ M;  3SAR A;  4NL4 H;  2P5T A;  1SXJ D;  3T1H M;  2L6O A;  1L2B A;  5E26 A;  4NOO B;  3U60 A;  2EO2 A;  8CAT A;  1HT2 E;  2QP9 X;  2YFQ A;  3PFI A;  5ITT A;  1QVR A;  4B3T M;  2JA2 A;  3GLH B;  2UUA M;  1DGF A;  3DFZ A;  4OX9 M;  2FE8 A;  4AI6 A;  3QWL A;  3CF6 E;  1Q3B A;  4GIT A;  1GLN A;  1EE8 A;  4PDG A;  1N33 M;  5DYG A;  3A45 A;  4JI7 M;  1QAM A;  1NY5 A;  2C9C A;  3GPX A;  1Q3C A;  4LF8 M;  1J5E M;  3KOX E;  3PNV A;  3GLG A;  4DV3 M;  4JI2 M;  1XMQ M;  2CEA A;  4M9Z A;  4XGI A;  3DZD A;  2J7N A;  4IBJ A;  3U5Z A;  1N77 A;  2KRK A;  2UXC M;  1XC8 A;  4YY3 M;  4GC5 A;  5FTN A;  3FUT A;  1K3X A;  4I8O A;  5EP3 A;  1L1Z A;  1GL7 A;  4LZZ A;  5ITY A;  4JV5 M;  1FNN A;  1E9S A;  1IY0 A;  4JI0 M;  5FSW A;  3GLI A;  4LF7 M;  3M6A A;  4XBO A;  1J7K A;  4FCV A;  3SC3 A;  2Z7J A;  4M0W A;  4W5W A;  4ITQ A;  7CAT A;  2XZF A;  4X62 M;  2M5Z A;  4K0K M;  3GLF A;  2C9O A;  3U6L A;  1TH4 A;  3AOG A;  3Q8X A;  3SYK A;  3DOA A;  2VQE M;  4HLQ A;  2I7N A;  4LF5 M;  3R9X B;  3KW6 A;  5KQD A;  4FCW A;  3L25 A;  3KVW A;  4D80 A;  1IY2 A;  2VQF M;  5KPZ A;  4GHL A;  5IT9 S;  1FJG M;  5EP4 A;  4FD2 A;  2C98 A;  4BB9 A;  3SAU A;  3J7B A;  1HQC A;  5ITX E;  1D2N A;  2DXI A;  3U6Q A;  5IZ7 D;  4D82 A;  3U60 B;  1QAQ A;  5E6J A;  3H4M A;  5IWA M;  2CV1 A;  3CTW B;  3RGP A;  3SAT A;  2ZAN A;  3L28 A;  3KS8 A;  1KSF X;  3CF0 A;  3PVS A;  1MX0 A;  1SXJ E;  3ILK A;  4LJ8 A;  4OW0 A;  1TDZ A;  3SMP A;  3T15 A;  1R2Y A;  4B3R M;  4L15 A;  4AKI A;  3U6M A;  2UXD M;  2HL7 A;  5FTJ A;  3IG8 A;  3L2A A;  3AV0 A;  3LMM A;  4JI5 M;  3K92 A;  3SMS A;  2QBY A;  1TH3 A;  1R7R A;  2V1C A;  4GH9 A;  4NXM M;  1G41 A;  3UK6 A;  2XH9 A;  2LNH C;  1NHG C;  4DR4 M;  4NRW A;  2Y20 A;  3U5Z B;  1HNW M;  3HHW A;  3CF2 A;  1S3S A;  3KDS E;  4IBG A;  3ZC7 B;  2D7E A;  4LJ7 A;  1Z6T A;  3C58 A;  1OJL A;  1TH2 A;  1IN7 A;  1IBK M;  2R46 A;  1IXR C;  4ZPX A;  1W5S A;  1R6B X;  2YQZ A;  2FFJ A;  4L4U A;  1NVM A;  4GMQ A;  3FKE A;  3SHG B;  3WHL A;  3SAV A;  2XGN A;  3I4V A;  2R65 A;  4Z8X A;  2F5P A;  3W0L B;  2Y0Q A;  1XMO M;  5EXP A;  3MJ5 A;  2DWM A;  1OFH A;  1YSY A;  5FLX S;  2EA0 A;  4DUZ M;  3U6O A;  3W0F A;  3GLF B;  4X64 M;  2KZS A;  3UGJ A;  1IY1 A;  5F3W A;  4LF9 M;  3FUV A;  2F5O A;  2DZO B;  1PJI A;  2R18 A;  3VDP A;  4DV7 M;  3BOS A;  4JI1 M;  4JN6 A;  4II7 A;  5IRE B;  5ITU A;  3D8L A;  4QOS A;  4B7H A;  1WXQ A;  1JQJ C;  3JAM S;  1VDD A;  4AKH A;  3MHV C;  1J09 A;  4AG6 A;  4LCB A;  4L8R C;  1N75 A;  4IBD A;  1NNU C;  1I4W A;  3TWL A;  4CIS A;  4KO8 A;  2L7H A;  2CV0 A;  4KHP M;  5FTK A;  3SHF A;  1N32 M;  3A46 A;  3U6S A;  4OU7 A;  5FTL A;  1Q39 A;  1T3T A;  3U6D A;  5JI2 E;  2QCU A;  3JR5 A;  3SYL A;  3M7G A;  5EJC A;  4DV1 M;  1W5T A;  4IBK A;  5FTM A;  4WW0 A;  3SAW A;  3KOY E;  1YUB A;  3KSX A;  4GC9 A;  3B9P A;  2BJV A;  3LVV A;  4RNA A;  2DWN A;  4G4Q A;  3AKZ A;  2R4J A;  4FVM A;  2OQ4 A;  4LRT A;  3RGS A;  4DV4 M;  3TPZ A;  4DV6 M;  4R7G A;  4IBE A;  1GVN A;  2QBY B;  4GHA A;  4LJ4 A;  2BNK A;  2EUC A;  4DR3 M;  3AOE A;  3PXG A;  3VKG A;  2G5G X;  3I4Y A;  1XXH A;  3HGI A;  1KFV A;  4GIP A;  3TWM A;  2LXE A;  2M60 A;  1IXZ A;  4YHH M;  2LWX A;  3J27 B;  4NRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...