3KOZE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (anaerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kozE02
3KOWE 3KOZE 3KOXE 3KOYE 3KP0E 3KP1E
chains in the Genus database with same CATH superfamily
2UUAM 1Z6TA 4OW0A 1YSYA 2HWJA 1XWIA 2OOBA 2WSEF 3TPZA 3B7ZA 1MX0A 2HCBA 5BPVA 4JI2M 2R0IA 1OFIA 2JA2A 1R6BX 2CHVA 2YR0A 1GL6A 3GLHA 3U5ZA 1Q3CA 4DV6M 2FFJA 2DNAA 3U6EA 3CF0A 1HT2E 4Q7JA 1R4GA 4PDGA 3I01M 3VK8A 1SXJA 3FE3A 1IN5A 3HZJA 3GLFE 2CV1A 2EKKA 2HL7A 2KW0A 2Y0TA 1N36M 3VKHA 2Z4SA 2DAEA 2R6FA 1TH3A 3KW6A 4CJ6A 2R45A 2CWBA 4NOOB 3E21A 3C58A 2DAMA 3AOEC 3BOSA 4NXMM 3LQQA 1CUKA 2DZOB 3U60A 2CE7A 3SYKA 1QUTA 3ZQJA 3LMMA 1N33M 1OIPA 1IM2A 2L4FA 2JNHA 3I4VA 1DV0A 4IJEA 1NJFA 2QBYB 3HU1A 4DR2M 1OAIA 2AHMA 4FVMA 2R44A 2KZUA 4M0DA 3U6SA 2E5LM 4IBDA 2KDLA 2G3QA 1EIJA 3SASA 1VEJA 1Z5CA 4QNRA 5A2QS 3EIEA 3GRRA 2G8LA 2DZNB 1IY2A 5KQ8A 4JI3M 1Q3BA 2LH0A 1E32A 1L8QA 3LQRA 2CRUA 2HHHM 5ITXA 2Y20A 4IBCA 5FLXS 2DXIA 4LGMA 1QAMA 2KZSA 2CP8A 3D8LA 1SXJE 1T6OA 2KRKA 2GQFA 2M60A 2XEPA 4GKKM 3ZCBB 1L2CA 2EKFA 4DR3M 1QANA 3HWSA 2EO2A 3C3DA 3IHPA 3MK6A 3MJ5A 3Q8GA 4B7GA 2ZTDA 5ITUA 4IBEA 2LBCA 1VG5A 4QHTA 1DGFA 3FTCA 4PDIA 1R7RA 2XSZD 1EE8A 1GL7A 3M7GA 4GRIA 3JR5A 2QSFX 4P16A 3GLGB 4GITA 2HAKA 4W5WA 2B3TA 2MJ5B 4JI8M 3K9PA 3UZUA 5GKNA 2Q2EB 2XFTA 4DV2M 1Z59A 2JP7A 1BVSA 2O25A 1N32M 3WHKA 1QAOA 1W5TA 2ZANA 2JZ0A 1JR3A 4MGYE 5ITQA 1DO0A 1VDLA 3MMPA 3U5ZB 2D7GA 4G4RA 4FCVA 1XHBA 3ZH9B 3FYDA 1IXRC 3K8ZA 3KOYE 3ILKA 2ZAOA 1GLNA 4HEOA 3GLFB 2VQEM 4RF1A 4A3VB 3K2LA 4I4LA 4CGYB 2LWXA 3F92A 3K92A 4AG6A 1GJTA 2Y0QA 2R18A 2QHOB 3E4RA 1WHCA 2Y21A 3THGA 2CEAA 3C9PA 4AKIA 4L16A 2J7NA 3FD9A 4NSOB 1A5TA 1GJSA 3L29A 4PT5A 2QP9X 1NSFA 1QAQA 2DWZB 4P17A 2XSZA 5EP3A 2LVOC 3VFDA 5KPRA 1H6UA 3WHLA 1V33A 3GQ3A 3D8BA 5H37D 4AQYM 4NXNM 2UXBM 3I4YA 1JQJC 1WGNA 2LNHC 4CHTB 2JWSA 3B9PA 1K3WA 1ZAEA 3M0EA 3T38A 5FTKA 2F5SA 3SHGB 2HKJA 4CIZA 1P3QQ 4JXJA 3LCUA 2LVAA 4LRTA 2L09A 2XZUA 1IXSB 4X62M 4M9ZA 1IXZA 1QVRA 2NQ8C 1NHGC 2KXEA 1GO5A 3GPUA 3U6OA 2F5QA 1GABA 3HJQA 5FSWA 4RNAA 4DR1M 4LZJA 1AIPC 3B74A 1W5SA 1IBLM 4DV5M 3RGSA 4OX9M 4G3OA 4LF5M 3U6MA 3J2PB 3UJNA 4NRVA 1OTRA 2O01F 1J5EM 3U6PA 3T15A 3HHZA 1XNRM 3AOGA 1MU5A 4I81A 2F5NA 2G5GX 4XK8F 3TWLA 2CUZA 3TL4X 2X4AA 4F1IA 4IBBA 5LMUM 2KEBA 2BJWA 4WURA 2F5PA 2W82A 2FS1A 4FWHA 4XBOA 3HHYA 1QQWA 4Z8XA 1QZMA 1XXHE 3SATA 4L8RC 3H4JA 4X66M 1IBMM 1OAOC 3RGPA 3H4MA 5EP2A 5FTNA 3B7NA 4Z6YA 3U60B 2YFQA 3HU3A 4GIPA 2K6BA 1KYIA 2D7EA 3HJ8A 1L2BA 1IN6A 3SAVA 3AOEA 3QAUA 2M5ZA 1NY5A 4OVZA 2DWLA 3TWMA 3GRYA 4L78A 3LCVB 1E9SA 1TDZA 5KO3A 1K3XA 1PM5A 3KFUG 1E94E 1D0MA 1XB2B 5E26A 1F4IA 3FKEA 1KFVA 4L6V6 4ANRA 2LVPC 2Z3XA 1VQ1A 4LJ5A 4LF8M 2KNAA 4LF6M 2QQ8A 8CATA 2EJSA 3W68A 3PXGA 3SARA 1Q39A 1C7YA 1NV9A 3I51A 4LJ4A 1ZV1A 1YE9A 2K0BX 4B3MM 1XMQM 1I94M 4PCZA 2LXEA 4B3RM 5EXSA 4GKJM 4RKUF 3NWLA 2R46A 4JI0M 4XGIA 1PJSA 2C9OA 3HU2A 3KXEC 3J81S 2DVWB 3SMPA 1G71A 5FTJA 1TTEA 3FUUA 4GEWA 4ZPXA 5JI3E 2VIIA 1PJQA 2ZBKB 2UXDM 3FRIA 1IXSA 1QZEA 3QWLA 4KODA 2DENA 4G4NA 2F4VM 2FE8A 4DR5M 1R2ZA 1PJIA 5ITTA 3C3EA 1WJ7A 2UUCM 4R3DA 4QOZC 1GVNA 3HY5A 3JR4A 4FWGA 3L26A 1UFZA 2OPFA 4LFAM 1DGGA 1PGYA 4QHSA 1N77A 1NNUC 3VLFB 5DYIA 2FH0A 3ZC7B 2L4EA 3CF6E 5F3WA 2BNKA 3KVWA 2H1RA 3SC3A 1D0LA 4M0WA 3SBJA 4GC9A 4QOSA 2KRUA 2JY5A 3GO8A 4WP2A 4MGZE 4LFBM 1Z5AA 1LTMA 5EXPA 2FOIC 4DR6M 1LV7A 4AZFA 2ZM6M 3T6PA 4LRSA 4GHAA 2R4EA 3KS8A 3J7BA 3E46A 2C98A 2EUCA 1GKIA 4DV7M 4S12A 3DOAA 4JN6A 4MM3B 5DYGA 4BLCA 4JV5M 1G4AE 3AKZA 3M6AA 3SYLA 3HHXA 1DGHA 3SAWA 4DR4M 1V34A 4KHPM 4YY3M 1MN3A 1JB0F 4MGKE 5LMNM 4DR7M 5IT9S 2K9DA 3U6CA 4FW9A 2A5YB 4LF7M 4RF0A 3GLIE 1WR1B 2APLA 1IBKM 1ZMWA 2QBYA 5EXTA 2DAGA 3GLFA 2VF7A 3CGWA 2BJVA 1TF0B 4LCBA 3SHFA 2JY8A 4AI6A 2KNVA 4AW4A 3HX3A 5C1BA 1SG9A 2OQ4A 4FD2A 4IBFA 2WZJA 4IJFA 3GLGE 4GC5A 1NY6A 1ZMVA 4NC6A 1V92A 3VDUA 1IY0A 1HQCA 2ERCA 4B08A 4D80A 2LTUA 4X64M 4X65M 1SXJC 1E9RA 2XF3A 4DUYM 3GRUA 4DV3M 2L6OA 2QCUA 2BWEA 3KP0E 4GH9A 3L28A 2VQFM 4PD2A 2FNAA 4ITQA 1G3IA 3U61A 3W67A 4GMQA 2OO9A 3IG5A 1OFHA 1N78A 1DO2A 1VEGA 4NSRA 3R9XB 3T1YM 3FRHA 4FWDA 1Y8GA 1YUBA 1G41A 3KP1E 2R4JA 2JY7A 4REZA 5KPTA 1IQPA 2QPAA 3BXWA 2QNJA 1UM8A 2LHCA 1T3TA 1JR3E 4G6ZA 1HNXM 3K1JA 5ITRA 2CV2A 5E6JA 2EA0A 3A98B 3FUTA 3J27B 3E9SA 3KSXA 1ORYB 2R62A 4I5SA 3TQSA 3W0LB 2C5RA 1HQYE 1TR8A 4F2LA 4JI1M 2DKLA 2GNOA 4KO8A 3PVSA 2V1CA 5IWAM 2UXCM 4AKHA 3GLGA 1TGUA 3FTDA 2F5OA 1OJLA 1YLAA 1AUAA 3CF2A 4JYAM 1IFYA 3AFHA 2RRUA 3JAMS 3VK7A 1FJGM 1G59A 3FUXA 1WGLA 3HJSA 1QUSA 2J7OA 3EIHA 3FTEA 3DFZA 3VKGA 1OIZA 2RGOA 4DBGB 2J5YA 1NVMA 3CTWB 3UGJA 4JI4M 2JXNA 2XGNA 1MJGM 1L1TA 3KSJA 3FTFA 5ITYA 4D81A 3NBXX 3A46A 3U61B 3SFZA 3QYEA 3B7QA 5ITXE 2OOAA 3GLHB 2D7HA 4KLNA 1NNJA 3B89A 2QZ4A 3K9OA 5IZ7D 4L4UA 1VDDA 4IBIA 1I4WA 2JY6B 1SXJB 2ZTCA 4OVZB 1XXHA 2L7HA 2DWMA 1HNWM 2DAIA 4LJ6A 2C9CA 5DNYA 4GHLA 1XMOM 1R5LA 2V1UA 4DV4M 4LY6A 3R8FA 1QDTA 2LHGA 5EJCA 1PJJA 4LG2A 2JZ1A 4LF4M 2X8AA 4TUWA 2CFOA 1WXQA 4FCWA 1N75A 4LJ8A 1Z5BA 4DUZM 3FUWA 1IN7A 2MR9A 5EXXA 4B7FA 1OQYA 2KNZA 2O5RA 3J80S 2RGHA 4QNMA 2YNMD 2N35A 4LFCM 1HR0M 1OKSA 1IN8A 1NJGA 3U6DA 3U6LA 5FTLA 3GLIB 3AJIB 1Q02A 2VDBB 1C1KA 5DFLA 4LJAA 3LVWA 5EP4A 3L25A 3UMMA 3A45A 4HL4A 3T1HM 1WIVA 2L7IA 1KSFX 3FYCA 4L15A 2DZLA 5EP1A 4MGHA 2KHHA 4YHHM 5KPZA 3HGIA 2DHYA 3L27A 1ZQ9A 1QDRA 2XH9A 2K47A 3VDPA 4G4OA 4B3TM 4WW0A 2X49A 2XLJA 4LJ9A 1TH2A 2XZFA 4IIWA 4LJ7A 3RE8A 1PRBA 2RKOA 4M9SA 5IREB 4NRWA 1XNQM 2KA6B 2WSFF 3UK6A 3GRVA 3Q8XA 3HKPA 4B7HA 3RFWA 2I7PA 4I8OA 5EQTA 1HT1E 1ZMUA 1X37A 4BB9A 3GP1A 3GPYA 1FNNA 1K82A 4AG5A 2CV0A 4IBKA 4LZZA 3GLHE 1N34M 1DGHB 1D2NA 1QYRA 2JUJA 2Z7JA 3KOWE 4B3SM 2MGWA 1NO1A 1VEKA 1SXJD 3LW5F 1D0KA 3IECA 4EIWA 2BWBA 3SMSA 5BR8M 4R71A 1HNZM 4IBJA 2C96A 3QYBA 2CHQA 2LVNC 5FTMA 3TE6A 4KT0F 3HHWA 1NHWC 1XXHB 1RU3A 1S3SA 2P5TA 1L2DA 3U6QA 4JI6M 1TH4A 2Z8YM 3GQ5A 3L2AA 1IN4A 3SAUA 1R2YA 2L2DA 3BBZA 2ZAMA 2DWNA 3KDSE 3FUVA 3GPPA 3W0FA 2Z4RA 2I7NA 3PNVA 4NL4H 3IG8A 1J7KA 4G4QA 3AV0A 4R7GA 3DZDA 3OTOM 4AKGA 2MH8A 3KS4A 4UN2B 5KQDA 2C99A 2LVQD 2V6ZM 4Y28F 3NBIA 4M9XA 1PJTA 3PNYA 3TWKA 4BBAA 4FCTA 4K0KM 2R65A 2H5XA 1L1ZA 2DHRA 1JR3D 3KOZE 4OU7A 4II7A 4JI5M 3PFIA 4D82A 1NV8A 2UU9M 1EFUB 3A42A 4LF9M 1T43A 3GLIA 3MHVC 1G8PA 2DI0A 4DV1M 4HLQA 5L8RF 1J09A 2MROB 2WSCF 3GPXA 2XFSA 2DAKA 2UUBM 4IBGA 4MH0E 3DA1A 3I04M 3LVVA 2YQZA 4MB7A 7CATA 3KOXE 3AL0C 3GQ4A 4LGYA 4DV0M 2CHGA 5JI2E 4JI7M 3J7AS 1HJPA 1DGBA 4CISA 1TDHA 1IY1A 3V76A 5C18A 2QENA 2VF8A 4MGIE 1XC8A
chains in the Genus database with same CATH topology
2UUAM 1Z6TA 4OW0A 1YSYA 1XWIA 3TPZA 1MX0A 2HCBA 5BPVA 4JI2M 1OFIA 2JA2A 1R6BX 2CHVA 2YR0A 1GL6A 3GLHA 3U5ZA 1Q3CA 4DV6M 2FFJA 3U6EA 3CF0A 1HT2E 4PDGA 3VK8A 1SXJA 1IN5A 2CV1A 2HL7A 2KW0A 2Y0TA 1N36M 3VKHA 2Z4SA 1TH3A 3KW6A 2R45A 4NOOB 3C58A 3AOEC 3BOSA 4NXMM 3LQQA 2DZOB 3U60A 2CE7A 3SYKA 3LMMA 1N33M 1IM2A 3I4VA 4IJEA 1NJFA 2QBYB 3HU1A 4DR2M 4FVMA 2AHMA 2KZUA 4M0DA 3U6SA 2E5LM 4IBDA 3SASA 1Z5CA 4QNRA 5A2QS 3EIEA 3GRRA 2G8LA 2DZNB 1IY2A 5KQ8A 4JI3M 1Q3BA 2LH0A 1E32A 1L8QA 3LQRA 2HHHM 5ITXA 2Y20A 4IBCA 5FLXS 2DXIA 4LGMA 1QAMA 2KZSA 3D8LA 1SXJE 2KRKA 2M60A 2XEPA 4GKKM 3ZCBB 1L2CA 4DR3M 1QANA 3HWSA 2EO2A 3MK6A 4B7GA 3MJ5A 5ITUA 4IBEA 4QHTA 1DGFA 3FTCA 4PDIA 1R7RA 2XSZD 1EE8A 1GL7A 3M7GA 4GRIA 3JR5A 4P16A 3GLGB 4GITA 4W5WA 4JI8M 3UZUA 5GKNA 2Q2EB 2XFTA 4DV2M 1Z59A 1N32M 3WHKA 1QAOA 1W5TA 2ZANA 1JR3A 4MGYE 5ITQA 1DO0A 3U5ZB 2D7GA 4G4RA 4FCVA 1XHBA 3ZH9B 3FYDA 1IXRC 3K8ZA 3KOYE 3ILKA 2ZAOA 1GLNA 3GLFB 2VQEM 4RF1A 4A3VB 3K2LA 4I4LA 4CGYB 2LWXA 3K92A 4AG6A 2Y0QA 2R18A 3E4RA 2Y21A 3THGA 2CEAA 4AKIA 4L16A 2J7NA 3FD9A 4NSOB 3L29A 4PT5A 2QP9X 1NSFA 1QAQA 2DWZB 2XSZA 5EP3A 3VFDA 5KPRA 1H6UA 3WHLA 3GQ3A 3D8BA 5H37D 4AQYM 4NXNM 3I4YA 1JQJC 2LNHC 4CHTB 3B9PA 1K3WA 1ZAEA 3M0EA 3T38A 5FTKA 2F5SA 3SHGB 2HKJA 4JXJA 4LRTA 2L09A 2XZUA 1IXSB 4X62M 4M9ZA 1IXZA 1QVRA 2NQ8C 1NHGC 2KXEA 3GPUA 3U6OA 2F5QA 3HJQA 5FSWA 4RNAA 4DR1M 4LZJA 1IBLM 1W5SA 4DV5M 3RGSA 4OX9M 4LF5M 3U6MA 3J2PB 3UJNA 4NRVA 1J5EM 3U6PA 3T15A 3HHZA 1XNRM 3AOGA 1MU5A 4I81A 2F5NA 2G5GX 3TWLA 2CUZA 3TL4X 2X4AA 5LMUM 4IBBA 2KEBA 2BJWA 4WURA 2F5PA 2W82A 4FWHA 4XBOA 3HHYA 1QQWA 4Z8XA 1QZMA 3SATA 4L8RC 4X66M 1IBMM 3RGPA 3H4MA 5EP2A 5FTNA 4Z6YA 3U60B 2YFQA 3HU3A 4GIPA 1KYIA 2D7EA 3HJ8A 1L2BA 1IN6A 3SAVA 3AOEA 3QAUA 2M5ZA 1NY5A 4OVZA 2DWLA 3TWMA 3GRYA 4L78A 1E9SA 1TDZA 5KO3A 1K3XA 1PM5A 3KFUG 1E94E 5E26A 3FKEA 1KFVA 2Z3XA 4LJ5A 4LF8M 4LF6M 8CATA 3PXGA 3SARA 1Q39A 4LJ4A 3I51A 1YE9A 4B3MM 1XMQM 1I94M 4PCZA 2LXEA 4B3RM 5EXSA 4GKJM 3NWLA 2R46A 4JI0M 4XGIA 2C9OA 3HU2A 3KXEC 3J81S 2DVWB 3SMPA 5FTJA 3FUUA 4ZPXA 5JI3E 2VIIA 2ZBKB 2UXDM 3QWLA 4KODA 4G4NA 2F4VM 2FE8A 4DR5M 1R2ZA 1PJIA 5ITTA 2UUCM 4R3DA 4QOZC 1GVNA 3JR4A 2OPFA 4FWGA 3L26A 4LFAM 1DGGA 4QHSA 1N77A 1NNUC 3VLFB 5DYIA 3ZC7B 3CF6E 5F3WA 2BNKA 3KVWA 2H1RA 3SC3A 3SBJA 4M0WA 4GC9A 4QOSA 2KRUA 3GO8A 4MGZE 4LFBM 1Z5AA 5EXPA 4DR6M 2FOIC 1LV7A 4AZFA 2ZM6M 4LRSA 4GHAA 2R4EA 3KS8A 3J7BA 2C98A 2EUCA 1GKIA 4DV7M 4S12A 3DOAA 4JN6A 4MM3B 5DYGA 4BLCA 4JV5M 1G4AE 3AKZA 3M6AA 3SYLA 3HHXA 1DGHA 3SAWA 4DR4M 4KHPM 4YY3M 5IT9S 4MGKE 5LMNM 4DR7M 3U6CA 4FW9A 2A5YB 4LF7M 4RF0A 1IBKM 2QBYA 5EXTA 3GLFA 2BJVA 4LCBA 3SHFA 4AI6A 4AW4A 5C1BA 2OQ4A 4FD2A 4IBFA 4IJFA 4GC5A 1NY6A 2UXBM 3VDUA 4X64M 1IY0A 1HQCA 2ERCA 4B08A 4D80A 4X65M 1SXJC 1E9RA 2XF3A 4DUYM 3GRUA 4DV3M 2L6OA 2QCUA 3KP0E 4GH9A 3L28A 2VQFM 4PD2A 2FNAA 4ITQA 1G3IA 3U61A 4GMQA 3IG5A 1OFHA 1N78A 1DO2A 4NSRA 3R9XB 3T1YM 4FWDA 1YUBA 1G41A 3KP1E 2R4JA 4REZA 5KPTA 1IQPA 2QPAA 1UM8A 1T3TA 4G6ZA 3K1JA 5ITRA 2CV2A 5E6JA 2EA0A 3A98B 3FUTA 3J27B 3E9SA 3KSXA 1ORYB 2R62A 4I5SA 3TQSA 3W0LB 2C5RA 1HQYE 4JI1M 4AKHA 4KO8A 3PVSA 2V1CA 5IWAM 2UXCM 3GLGA 1TGUA 3FTDA 2F5OA 1OJLA 3CF2A 4JYAM 3AFHA 3JAMS 3VK7A 1FJGM 1G59A 3FUXA 3HJSA 2J7OA 3EIHA 3FTEA 3DFZA 3VKGA 2RGOA 1NVMA 3CTWB 3UGJA 4JI4M 2XGNA 1L1TA 3KSJA 3FTFA 5ITYA 4D81A 3A46A 3U61B 3SFZA 5ITXE 3GLHB 2D7HA 4KLNA 1NNJA 2QZ4A 5IZ7D 4L4UA 1VDDA 4IBIA 1I4WA 1SXJB 2DWMA 4OVZB 1XXHA 2L7HA 1HNWM 4LJ6A 2C9CA 5DNYA 4GHLA 1XMOM 2V1UA 4DV4M 4LY6A 3R8FA 5EJCA 1PJJA 4LG2A 4LF4M 2X8AA 4TUWA 2CFOA 1WXQA 4FCWA 1N75A 4LJ8A 1Z5BA 4DUZM 3FUWA 1IN7A 5EXXA 4B7FA 2O5RA 3J80S 2RGHA 4QNMA 2YNMD 4LFCM 1HR0M 1IN8A 1NJGA 3U6DA 3U6LA 5FTLA 3GLIB 3AJIB 1C1KA 4LJAA 3LVWA 5EP4A 3L25A 3UMMA 3A45A 4HL4A 3T1HM 2L7IA 1KSFX 3FYCA 4L15A 5EP1A 4MGHA 4YHHM 5KPZA 3HGIA 3L27A 1ZQ9A 2XH9A 3VDPA 2K47A 4G4OA 4B3TM 4WW0A 2X49A 2XLJA 4LJ9A 1TH2A 2XZFA 4IIWA 4LJ7A 3RE8A 2RKOA 4M9SA 5IREB 4NRWA 1XNQM 2KA6B 3UK6A 3GRVA 3Q8XA 3HKPA 4B7HA 3RFWA 2I7PA 4I8OA 5EQTA 1HT1E 4BB9A 1X37A 3GPYA 3GP1A 1HNXM 1FNNA 1K82A 4AG5A 2CV0A 4IBKA 4LZZA 1N34M 1DGHB 1D2NA 1QYRA 4B3SM 2Z7JA 3KOWE 4DV0M 1SXJD 5BR8M 4EIWA 3SMSA 1HNZM 4IBJA 2C96A 3TE6A 2CHQA 5FTMA 3HHWA 1NHWC 1XXHB 2P5TA 1S3SA 1L2DA 3U6QA 4JI6M 1TH4A 3GQ5A 3L2AA 1IN4A 3SAUA 1R2YA 2ZAMA 2DWNA 3KDSE 3FUVA 3GPPA 3W0FA 2Z4RA 2I7NA 3PNVA 4NL4H 3IG8A 1J7KA 4G4QA 3AV0A 4R7GA 3DZDA 3OTOM 4AKGA 3KS4A 5KQDA 2C99A 2V6ZM 3NBIA 4M9XA 3PNYA 3TWKA 4BBAA 4FCTA 4K0KM 2R65A 1L1ZA 2DHRA 1JR3D 3KOZE 4OU7A 4II7A 4JI5M 3PFIA 4D82A 2UU9M 3A42A 4LF9M 3GLIA 3MHVC 1G8PA 4DV1M 4HLQA 1J09A 3GPXA 2XFSA 2UUBM 4IBGA 4MH0E 3DA1A 3LVVA 2YQZA 4MB7A 7CATA 3KOXE 3AL0C 3GQ4A 4LGYA 2CHGA 5JI2E 4JI7M 3J7AS 1DGBA 4CISA 1TDHA 1IY1A 5C18A 2QENA 4MGIE 1XC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOW E;  3KOZ E;  3KOX E;  3KOY E;  3KP0 E;  3KP1 E; 
#chains in the Genus database with same CATH topology
 2UUA M;  1Z6T A;  4OW0 A;  1YSY A;  2HWJ A;  1XWI A;  2OOB A;  2WSE F;  3TPZ A;  3B7Z A;  1MX0 A;  2HCB A;  5BPV A;  4JI2 M;  2R0I A;  1OFI A;  2JA2 A;  1R6B X;  2CHV A;  2YR0 A;  1GL6 A;  3GLH A;  3U5Z A;  1Q3C A;  4DV6 M;  2FFJ A;  2DNA A;  3U6E A;  3CF0 A;  1HT2 E;  4Q7J A;  1R4G A;  4PDG A;  3I01 M;  3VK8 A;  1SXJ A;  3FE3 A;  1IN5 A;  3HZJ A;  3GLF E;  2CV1 A;  2EKK A;  2HL7 A;  2KW0 A;  2Y0T A;  1N36 M;  3VKH A;  2Z4S A;  2DAE A;  2R6F A;  1TH3 A;  3KW6 A;  4CJ6 A;  2R45 A;  2CWB A;  4NOO B;  3E21 A;  3C58 A;  2DAM A;  3AOE C;  3BOS A;  4NXM M;  3LQQ A;  1CUK A;  2DZO B;  3U60 A;  2CE7 A;  3SYK A;  1QUT A;  3ZQJ A;  3LMM A;  1N33 M;  1OIP A;  1IM2 A;  2L4F A;  2JNH A;  3I4V A;  1DV0 A;  4IJE A;  1NJF A;  2QBY B;  3HU1 A;  4DR2 M;  1OAI A;  2AHM A;  4FVM A;  2R44 A;  2KZU A;  4M0D A;  3U6S A;  2E5L M;  4IBD A;  2KDL A;  2G3Q A;  1EIJ A;  3SAS A;  1VEJ A;  1Z5C A;  4QNR A;  5A2Q S;  3EIE A;  3GRR A;  2G8L A;  2DZN B;  1IY2 A;  5KQ8 A;  4JI3 M;  1Q3B A;  2LH0 A;  1E32 A;  1L8Q A;  3LQR A;  2CRU A;  2HHH M;  5ITX A;  2Y20 A;  4IBC A;  5FLX S;  2DXI A;  4LGM A;  1QAM A;  2KZS A;  2CP8 A;  3D8L A;  1SXJ E;  1T6O A;  2KRK A;  2GQF A;  2M60 A;  2XEP A;  4GKK M;  3ZCB B;  1L2C A;  2EKF A;  4DR3 M;  1QAN A;  3HWS A;  2EO2 A;  3C3D A;  3IHP A;  3MK6 A;  3MJ5 A;  3Q8G A;  4B7G A;  2ZTD A;  5ITU A;  4IBE A;  2LBC A;  1VG5 A;  4QHT A;  1DGF A;  3FTC A;  4PDI A;  1R7R A;  2XSZ D;  1EE8 A;  1GL7 A;  3M7G A;  4GRI A;  3JR5 A;  2QSF X;  4P16 A;  3GLG B;  4GIT A;  2HAK A;  4W5W A;  2B3T A;  2MJ5 B;  4JI8 M;  3K9P A;  3UZU A;  5GKN A;  2Q2E B;  2XFT A;  4DV2 M;  1Z59 A;  2JP7 A;  1BVS A;  2O25 A;  1N32 M;  3WHK A;  1QAO A;  1W5T A;  2ZAN A;  2JZ0 A;  1JR3 A;  4MGY E;  5ITQ A;  1DO0 A;  1VDL A;  3MMP A;  3U5Z B;  2D7G A;  4G4R A;  4FCV A;  1XHB A;  3ZH9 B;  3FYD A;  1IXR C;  3K8Z A;  3KOY E;  3ILK A;  2ZAO A;  1GLN A;  4HEO A;  3GLF B;  2VQE M;  4RF1 A;  4A3V B;  3K2L A;  4I4L A;  4CGY B;  2LWX A;  3F92 A;  3K92 A;  4AG6 A;  1GJT A;  2Y0Q A;  2R18 A;  2QHO B;  3E4R A;  1WHC A;  2Y21 A;  3THG A;  2CEA A;  3C9P A;  4AKI A;  4L16 A;  2J7N A;  3FD9 A;  4NSO B;  1A5T A;  1GJS A;  3L29 A;  4PT5 A;  2QP9 X;  1NSF A;  1QAQ A;  2DWZ B;  4P17 A;  2XSZ A;  5EP3 A;  2LVO C;  3VFD A;  5KPR A;  1H6U A;  3WHL A;  1V33 A;  3GQ3 A;  3D8B A;  5H37 D;  4AQY M;  4NXN M;  2UXB M;  3I4Y A;  1JQJ C;  1WGN A;  2LNH C;  4CHT B;  2JWS A;  3B9P A;  1K3W A;  1ZAE A;  3M0E A;  3T38 A;  5FTK A;  2F5S A;  3SHG B;  2HKJ A;  4CIZ A;  1P3Q Q;  4JXJ A;  3LCU A;  2LVA A;  4LRT A;  2L09 A;  2XZU A;  1IXS B;  4X62 M;  4M9Z A;  1IXZ A;  1QVR A;  2NQ8 C;  1NHG C;  2KXE A;  1GO5 A;  3GPU A;  3U6O A;  2F5Q A;  1GAB A;  3HJQ A;  5FSW A;  4RNA A;  4DR1 M;  4LZJ A;  1AIP C;  3B74 A;  1W5S A;  1IBL M;  4DV5 M;  3RGS A;  4OX9 M;  4G3O A;  4LF5 M;  3U6M A;  3J2P B;  3UJN A;  4NRV A;  1OTR A;  2O01 F;  1J5E M;  3U6P A;  3T15 A;  3HHZ A;  1XNR M;  3AOG A;  1MU5 A;  4I81 A;  2F5N A;  2G5G X;  4XK8 F;  3TWL A;  2CUZ A;  3TL4 X;  2X4A A;  4F1I A;  4IBB A;  5LMU M;  2KEB A;  2BJW A;  4WUR A;  2F5P A;  2W82 A;  2FS1 A;  4FWH A;  4XBO A;  3HHY A;  1QQW A;  4Z8X A;  1QZM A;  1XXH E;  3SAT A;  4L8R C;  3H4J A;  4X66 M;  1IBM M;  1OAO C;  3RGP A;  3H4M A;  5EP2 A;  5FTN A;  3B7N A;  4Z6Y A;  3U60 B;  2YFQ A;  3HU3 A;  4GIP A;  2K6B A;  1KYI A;  2D7E A;  3HJ8 A;  1L2B A;  1IN6 A;  3SAV A;  3AOE A;  3QAU A;  2M5Z A;  1NY5 A;  4OVZ A;  2DWL A;  3TWM A;  3GRY A;  4L78 A;  3LCV B;  1E9S A;  1TDZ A;  5KO3 A;  1K3X A;  1PM5 A;  3KFU G;  1E94 E;  1D0M A;  1XB2 B;  5E26 A;  1F4I A;  3FKE A;  1KFV A;  4L6V 6;  4ANR A;  2LVP C;  2Z3X A;  1VQ1 A;  4LJ5 A;  4LF8 M;  2KNA A;  4LF6 M;  2QQ8 A;  8CAT A;  2EJS A;  3W68 A;  3PXG A;  3SAR A;  1Q39 A;  1C7Y A;  1NV9 A;  3I51 A;  4LJ4 A;  1ZV1 A;  1YE9 A;  2K0B X;  4B3M M;  1XMQ M;  1I94 M;  4PCZ A;  2LXE A;  4B3R M;  5EXS A;  4GKJ M;  4RKU F;  3NWL A;  2R46 A;  4JI0 M;  4XGI A;  1PJS A;  2C9O A;  3HU2 A;  3KXE C;  3J81 S;  2DVW B;  3SMP A;  1G71 A;  5FTJ A;  1TTE A;  3FUU A;  4GEW A;  4ZPX A;  5JI3 E;  2VII A;  1PJQ A;  2ZBK B;  2UXD M;  3FRI A;  1IXS A;  1QZE A;  3QWL A;  4KOD A;  2DEN A;  4G4N A;  2F4V M;  2FE8 A;  4DR5 M;  1R2Z A;  1PJI A;  5ITT A;  3C3E A;  1WJ7 A;  2UUC M;  4R3D A;  4QOZ C;  1GVN A;  3HY5 A;  3JR4 A;  4FWG A;  3L26 A;  1UFZ A;  2OPF A;  4LFA M;  1DGG A;  1PGY A;  4QHS A;  1N77 A;  1NNU C;  3VLF B;  5DYI A;  2FH0 A;  3ZC7 B;  2L4E A;  3CF6 E;  5F3W A;  2BNK A;  3KVW A;  2H1R A;  3SC3 A;  1D0L A;  4M0W A;  3SBJ A;  4GC9 A;  4QOS A;  2KRU A;  2JY5 A;  3GO8 A;  4WP2 A;  4MGZ E;  4LFB M;  1Z5A A;  1LTM A;  5EXP A;  2FOI C;  4DR6 M;  1LV7 A;  4AZF A;  2ZM6 M;  3T6P A;  4LRS A;  4GHA A;  2R4E A;  3KS8 A;  3J7B A;  3E46 A;  2C98 A;  2EUC A;  1GKI A;  4DV7 M;  4S12 A;  3DOA A;  4JN6 A;  4MM3 B;  5DYG A;  4BLC A;  4JV5 M;  1G4A E;  3AKZ A;  3M6A A;  3SYL A;  3HHX A;  1DGH A;  3SAW A;  4DR4 M;  1V34 A;  4KHP M;  4YY3 M;  1MN3 A;  1JB0 F;  4MGK E;  5LMN M;  4DR7 M;  5IT9 S;  2K9D A;  3U6C A;  4FW9 A;  2A5Y B;  4LF7 M;  4RF0 A;  3GLI E;  1WR1 B;  2APL A;  1IBK M;  1ZMW A;  2QBY A;  5EXT A;  2DAG A;  3GLF A;  2VF7 A;  3CGW A;  2BJV A;  1TF0 B;  4LCB A;  3SHF A;  2JY8 A;  4AI6 A;  2KNV A;  4AW4 A;  3HX3 A;  5C1B A;  1SG9 A;  2OQ4 A;  4FD2 A;  4IBF A;  2WZJ A;  4IJF A;  3GLG E;  4GC5 A;  1NY6 A;  1ZMV A;  4NC6 A;  1V92 A;  3VDU A;  1IY0 A;  1HQC A;  2ERC A;  4B08 A;  4D80 A;  2LTU A;  4X64 M;  4X65 M;  1SXJ C;  1E9R A;  2XF3 A;  4DUY M;  3GRU A;  4DV3 M;  2L6O A;  2QCU A;  2BWE A;  3KP0 E;  4GH9 A;  3L28 A;  2VQF M;  4PD2 A;  2FNA A;  4ITQ A;  1G3I A;  3U61 A;  3W67 A;  4GMQ A;  2OO9 A;  3IG5 A;  1OFH A;  1N78 A;  1DO2 A;  1VEG A;  4NSR A;  3R9X B;  3T1Y M;  3FRH A;  4FWD A;  1Y8G A;  1YUB A;  1G41 A;  3KP1 E;  2R4J A;  2JY7 A;  4REZ A;  5KPT A;  1IQP A;  2QPA A;  3BXW A;  2QNJ A;  1UM8 A;  2LHC A;  1T3T A;  1JR3 E;  4G6Z A;  1HNX M;  3K1J A;  5ITR A;  2CV2 A;  5E6J A;  2EA0 A;  3A98 B;  3FUT A;  3J27 B;  3E9S A;  3KSX A;  1ORY B;  2R62 A;  4I5S A;  3TQS A;  3W0L B;  2C5R A;  1HQY E;  1TR8 A;  4F2L A;  4JI1 M;  2DKL A;  2GNO A;  4KO8 A;  3PVS A;  2V1C A;  5IWA M;  2UXC M;  4AKH A;  3GLG A;  1TGU A;  3FTD A;  2F5O A;  1OJL A;  1YLA A;  1AUA A;  3CF2 A;  4JYA M;  1IFY A;  3AFH A;  2RRU A;  3JAM S;  3VK7 A;  1FJG M;  1G59 A;  3FUX A;  1WGL A;  3HJS A;  1QUS A;  2J7O A;  3EIH A;  3FTE A;  3DFZ A;  3VKG A;  1OIZ A;  2RGO A;  4DBG B;  2J5Y A;  1NVM A;  3CTW B;  3UGJ A;  4JI4 M;  2JXN A;  2XGN A;  1MJG M;  1L1T A;  3KSJ A;  3FTF A;  5ITY A;  4D81 A;  3NBX X;  3A46 A;  3U61 B;  3SFZ A;  3QYE A;  3B7Q A;  5ITX E;  2OOA A;  3GLH B;  2D7H A;  4KLN A;  1NNJ A;  3B89 A;  2QZ4 A;  3K9O A;  5IZ7 D;  4L4U A;  1VDD A;  4IBI A;  1I4W A;  2JY6 B;  1SXJ B;  2ZTC A;  4OVZ B;  1XXH A;  2L7H A;  2DWM A;  1HNW M;  2DAI A;  4LJ6 A;  2C9C A;  5DNY A;  4GHL A;  1XMO M;  1R5L A;  2V1U A;  4DV4 M;  4LY6 A;  3R8F A;  1QDT A;  2LHG A;  5EJC A;  1PJJ A;  4LG2 A;  2JZ1 A;  4LF4 M;  2X8A A;  4TUW A;  2CFO A;  1WXQ A;  4FCW A;  1N75 A;  4LJ8 A;  1Z5B A;  4DUZ M;  3FUW A;  1IN7 A;  2MR9 A;  5EXX A;  4B7F A;  1OQY A;  2KNZ A;  2O5R A;  3J80 S;  2RGH A;  4QNM A;  2YNM D;  2N35 A;  4LFC M;  1HR0 M;  1OKS A;  1IN8 A;  1NJG A;  3U6D A;  3U6L A;  5FTL A;  3GLI B;  3AJI B;  1Q02 A;  2VDB B;  1C1K A;  5DFL A;  4LJA A;  3LVW A;  5EP4 A;  3L25 A;  3UMM A;  3A45 A;  4HL4 A;  3T1H M;  1WIV A;  2L7I A;  1KSF X;  3FYC A;  4L15 A;  2DZL A;  5EP1 A;  4MGH A;  2KHH A;  4YHH M;  5KPZ A;  3HGI A;  2DHY A;  3L27 A;  1ZQ9 A;  1QDR A;  2XH9 A;  2K47 A;  3VDP A;  4G4O A;  4B3T M;  4WW0 A;  2X49 A;  2XLJ A;  4LJ9 A;  1TH2 A;  2XZF A;  4IIW A;  4LJ7 A;  3RE8 A;  1PRB A;  2RKO A;  4M9S A;  5IRE B;  4NRW A;  1XNQ M;  2KA6 B;  2WSF F;  3UK6 A;  3GRV A;  3Q8X A;  3HKP A;  4B7H A;  3RFW A;  2I7P A;  4I8O A;  5EQT A;  1HT1 E;  1ZMU A;  1X37 A;  4BB9 A;  3GP1 A;  3GPY A;  1FNN A;  1K82 A;  4AG5 A;  2CV0 A;  4IBK A;  4LZZ A;  3GLH E;  1N34 M;  1DGH B;  1D2N A;  1QYR A;  2JUJ A;  2Z7J A;  3KOW E;  4B3S M;  2MGW A;  1NO1 A;  1VEK A;  1SXJ D;  3LW5 F;  1D0K A;  3IEC A;  4EIW A;  2BWB A;  3SMS A;  5BR8 M;  4R71 A;  1HNZ M;  4IBJ A;  2C96 A;  3QYB A;  2CHQ A;  2LVN C;  5FTM A;  3TE6 A;  4KT0 F;  3HHW A;  1NHW C;  1XXH B;  1RU3 A;  1S3S A;  2P5T A;  1L2D A;  3U6Q A;  4JI6 M;  1TH4 A;  2Z8Y M;  3GQ5 A;  3L2A A;  1IN4 A;  3SAU A;  1R2Y A;  2L2D A;  3BBZ A;  2ZAM A;  2DWN A;  3KDS E;  3FUV A;  3GPP A;  3W0F A;  2Z4R A;  2I7N A;  3PNV A;  4NL4 H;  3IG8 A;  1J7K A;  4G4Q A;  3AV0 A;  4R7G A;  3DZD A;  3OTO M;  4AKG A;  2MH8 A;  3KS4 A;  4UN2 B;  5KQD A;  2C99 A;  2LVQ D;  2V6Z M;  4Y28 F;  3NBI A;  4M9X A;  1PJT A;  3PNY A;  3TWK A;  4BBA A;  4FCT A;  4K0K M;  2R65 A;  2H5X A;  1L1Z A;  2DHR A;  1JR3 D;  3KOZ E;  4OU7 A;  4II7 A;  4JI5 M;  3PFI A;  4D82 A;  1NV8 A;  2UU9 M;  1EFU B;  3A42 A;  4LF9 M;  1T43 A;  3GLI A;  3MHV C;  1G8P A;  2DI0 A;  4DV1 M;  4HLQ A;  5L8R F;  1J09 A;  2MRO B;  2WSC F;  3GPX A;  2XFS A;  2DAK A;  2UUB M;  4IBG A;  4MH0 E;  3DA1 A;  3I04 M;  3LVV A;  2YQZ A;  4MB7 A;  7CAT A;  3KOX E;  3AL0 C;  3GQ4 A;  4LGY A;  4DV0 M;  2CHG A;  5JI2 E;  4JI7 M;  3J7A S;  1HJP A;  1DGB A;  4CIS A;  1TDH A;  1IY1 A;  3V76 A;  5C18 A;  2QEN A;  2VF8 A;  4MGI E;  1XC8 A; 
#chains in the Genus database with same CATH homology
 2UUA M;  1Z6T A;  4OW0 A;  1YSY A;  1XWI A;  3TPZ A;  1MX0 A;  2HCB A;  5BPV A;  4JI2 M;  1OFI A;  2JA2 A;  1R6B X;  2CHV A;  2YR0 A;  1GL6 A;  3GLH A;  3U5Z A;  1Q3C A;  4DV6 M;  2FFJ A;  3U6E A;  3CF0 A;  1HT2 E;  4PDG A;  3VK8 A;  1SXJ A;  1IN5 A;  2CV1 A;  2HL7 A;  2KW0 A;  2Y0T A;  1N36 M;  3VKH A;  2Z4S A;  1TH3 A;  3KW6 A;  2R45 A;  4NOO B;  3C58 A;  3AOE C;  3BOS A;  4NXM M;  3LQQ A;  2DZO B;  3U60 A;  2CE7 A;  3SYK A;  3LMM A;  1N33 M;  1IM2 A;  3I4V A;  4IJE A;  1NJF A;  2QBY B;  3HU1 A;  4DR2 M;  4FVM A;  2AHM A;  2KZU A;  4M0D A;  3U6S A;  2E5L M;  4IBD A;  3SAS A;  1Z5C A;  4QNR A;  5A2Q S;  3EIE A;  3GRR A;  2G8L A;  2DZN B;  1IY2 A;  5KQ8 A;  4JI3 M;  1Q3B A;  2LH0 A;  1E32 A;  1L8Q A;  3LQR A;  2HHH M;  5ITX A;  2Y20 A;  4IBC A;  5FLX S;  2DXI A;  4LGM A;  1QAM A;  2KZS A;  3D8L A;  1SXJ E;  2KRK A;  2M60 A;  2XEP A;  4GKK M;  3ZCB B;  1L2C A;  4DR3 M;  1QAN A;  3HWS A;  2EO2 A;  3MK6 A;  4B7G A;  3MJ5 A;  5ITU A;  4IBE A;  4QHT A;  1DGF A;  3FTC A;  4PDI A;  1R7R A;  2XSZ D;  1EE8 A;  1GL7 A;  3M7G A;  4GRI A;  3JR5 A;  4P16 A;  3GLG B;  4GIT A;  4W5W A;  4JI8 M;  3UZU A;  5GKN A;  2Q2E B;  2XFT A;  4DV2 M;  1Z59 A;  1N32 M;  3WHK A;  1QAO A;  1W5T A;  2ZAN A;  1JR3 A;  4MGY E;  5ITQ A;  1DO0 A;  3U5Z B;  2D7G A;  4G4R A;  4FCV A;  1XHB A;  3ZH9 B;  3FYD A;  1IXR C;  3K8Z A;  3KOY E;  3ILK A;  2ZAO A;  1GLN A;  3GLF B;  2VQE M;  4RF1 A;  4A3V B;  3K2L A;  4I4L A;  4CGY B;  2LWX A;  3K92 A;  4AG6 A;  2Y0Q A;  2R18 A;  3E4R A;  2Y21 A;  3THG A;  2CEA A;  4AKI A;  4L16 A;  2J7N A;  3FD9 A;  4NSO B;  3L29 A;  4PT5 A;  2QP9 X;  1NSF A;  1QAQ A;  2DWZ B;  2XSZ A;  5EP3 A;  3VFD A;  5KPR A;  1H6U A;  3WHL A;  3GQ3 A;  3D8B A;  5H37 D;  4AQY M;  4NXN M;  3I4Y A;  1JQJ C;  2LNH C;  4CHT B;  3B9P A;  1K3W A;  1ZAE A;  3M0E A;  3T38 A;  5FTK A;  2F5S A;  3SHG B;  2HKJ A;  4JXJ A;  4LRT A;  2L09 A;  2XZU A;  1IXS B;  4X62 M;  4M9Z A;  1IXZ A;  1QVR A;  2NQ8 C;  1NHG C;  2KXE A;  3GPU A;  3U6O A;  2F5Q A;  3HJQ A;  5FSW A;  4RNA A;  4DR1 M;  4LZJ A;  1IBL M;  1W5S A;  4DV5 M;  3RGS A;  4OX9 M;  4LF5 M;  3U6M A;  3J2P B;  3UJN A;  4NRV A;  1J5E M;  3U6P A;  3T15 A;  3HHZ A;  1XNR M;  3AOG A;  1MU5 A;  4I81 A;  2F5N A;  2G5G X;  3TWL A;  2CUZ A;  3TL4 X;  2X4A A;  5LMU M;  4IBB A;  2KEB A;  2BJW A;  4WUR A;  2F5P A;  2W82 A;  4FWH A;  4XBO A;  3HHY A;  1QQW A;  4Z8X A;  1QZM A;  3SAT A;  4L8R C;  4X66 M;  1IBM M;  3RGP A;  3H4M A;  5EP2 A;  5FTN A;  4Z6Y A;  3U60 B;  2YFQ A;  3HU3 A;  4GIP A;  1KYI A;  2D7E A;  3HJ8 A;  1L2B A;  1IN6 A;  3SAV A;  3AOE A;  3QAU A;  2M5Z A;  1NY5 A;  4OVZ A;  2DWL A;  3TWM A;  3GRY A;  4L78 A;  1E9S A;  1TDZ A;  5KO3 A;  1K3X A;  1PM5 A;  3KFU G;  1E94 E;  5E26 A;  3FKE A;  1KFV A;  2Z3X A;  4LJ5 A;  4LF8 M;  4LF6 M;  8CAT A;  3PXG A;  3SAR A;  1Q39 A;  4LJ4 A;  3I51 A;  1YE9 A;  4B3M M;  1XMQ M;  1I94 M;  4PCZ A;  2LXE A;  4B3R M;  5EXS A;  4GKJ M;  3NWL A;  2R46 A;  4JI0 M;  4XGI A;  2C9O A;  3HU2 A;  3KXE C;  3J81 S;  2DVW B;  3SMP A;  5FTJ A;  3FUU A;  4ZPX A;  5JI3 E;  2VII A;  2ZBK B;  2UXD M;  3QWL A;  4KOD A;  4G4N A;  2F4V M;  2FE8 A;  4DR5 M;  1R2Z A;  1PJI A;  5ITT A;  2UUC M;  4R3D A;  4QOZ C;  1GVN A;  3JR4 A;  2OPF A;  4FWG A;  3L26 A;  4LFA M;  1DGG A;  4QHS A;  1N77 A;  1NNU C;  3VLF B;  5DYI A;  3ZC7 B;  3CF6 E;  5F3W A;  2BNK A;  3KVW A;  2H1R A;  3SC3 A;  3SBJ A;  4M0W A;  4GC9 A;  4QOS A;  2KRU A;  3GO8 A;  4MGZ E;  4LFB M;  1Z5A A;  5EXP A;  4DR6 M;  2FOI C;  1LV7 A;  4AZF A;  2ZM6 M;  4LRS A;  4GHA A;  2R4E A;  3KS8 A;  3J7B A;  2C98 A;  2EUC A;  1GKI A;  4DV7 M;  4S12 A;  3DOA A;  4JN6 A;  4MM3 B;  5DYG A;  4BLC A;  4JV5 M;  1G4A E;  3AKZ A;  3M6A A;  3SYL A;  3HHX A;  1DGH A;  3SAW A;  4DR4 M;  4KHP M;  4YY3 M;  5IT9 S;  4MGK E;  5LMN M;  4DR7 M;  3U6C A;  4FW9 A;  2A5Y B;  4LF7 M;  4RF0 A;  1IBK M;  2QBY A;  5EXT A;  3GLF A;  2BJV A;  4LCB A;  3SHF A;  4AI6 A;  4AW4 A;  5C1B A;  2OQ4 A;  4FD2 A;  4IBF A;  4IJF A;  4GC5 A;  1NY6 A;  2UXB M;  3VDU A;  4X64 M;  1IY0 A;  1HQC A;  2ERC A;  4B08 A;  4D80 A;  4X65 M;  1SXJ C;  1E9R A;  2XF3 A;  4DUY M;  3GRU A;  4DV3 M;  2L6O A;  2QCU A;  3KP0 E;  4GH9 A;  3L28 A;  2VQF M;  4PD2 A;  2FNA A;  4ITQ A;  1G3I A;  3U61 A;  4GMQ A;  3IG5 A;  1OFH A;  1N78 A;  1DO2 A;  4NSR A;  3R9X B;  3T1Y M;  4FWD A;  1YUB A;  1G41 A;  3KP1 E;  2R4J A;  4REZ A;  5KPT A;  1IQP A;  2QPA A;  1UM8 A;  1T3T A;  4G6Z A;  3K1J A;  5ITR A;  2CV2 A;  5E6J A;  2EA0 A;  3A98 B;  3FUT A;  3J27 B;  3E9S A;  3KSX A;  1ORY B;  2R62 A;  4I5S A;  3TQS A;  3W0L B;  2C5R A;  1HQY E;  4JI1 M;  4AKH A;  4KO8 A;  3PVS A;  2V1C A;  5IWA M;  2UXC M;  3GLG A;  1TGU A;  3FTD A;  2F5O A;  1OJL A;  3CF2 A;  4JYA M;  3AFH A;  3JAM S;  3VK7 A;  1FJG M;  1G59 A;  3FUX A;  3HJS A;  2J7O A;  3EIH A;  3FTE A;  3DFZ A;  3VKG A;  2RGO A;  1NVM A;  3CTW B;  3UGJ A;  4JI4 M;  2XGN A;  1L1T A;  3KSJ A;  3FTF A;  5ITY A;  4D81 A;  3A46 A;  3U61 B;  3SFZ A;  5ITX E;  3GLH B;  2D7H A;  4KLN A;  1NNJ A;  2QZ4 A;  5IZ7 D;  4L4U A;  1VDD A;  4IBI A;  1I4W A;  1SXJ B;  2DWM A;  4OVZ B;  1XXH A;  2L7H A;  1HNW M;  4LJ6 A;  2C9C A;  5DNY A;  4GHL A;  1XMO M;  2V1U A;  4DV4 M;  4LY6 A;  3R8F A;  5EJC A;  1PJJ A;  4LG2 A;  4LF4 M;  2X8A A;  4TUW A;  2CFO A;  1WXQ A;  4FCW A;  1N75 A;  4LJ8 A;  1Z5B A;  4DUZ M;  3FUW A;  1IN7 A;  5EXX A;  4B7F A;  2O5R A;  3J80 S;  2RGH A;  4QNM A;  2YNM D;  4LFC M;  1HR0 M;  1IN8 A;  1NJG A;  3U6D A;  3U6L A;  5FTL A;  3GLI B;  3AJI B;  1C1K A;  4LJA A;  3LVW A;  5EP4 A;  3L25 A;  3UMM A;  3A45 A;  4HL4 A;  3T1H M;  2L7I A;  1KSF X;  3FYC A;  4L15 A;  5EP1 A;  4MGH A;  4YHH M;  5KPZ A;  3HGI A;  3L27 A;  1ZQ9 A;  2XH9 A;  3VDP A;  2K47 A;  4G4O A;  4B3T M;  4WW0 A;  2X49 A;  2XLJ A;  4LJ9 A;  1TH2 A;  2XZF A;  4IIW A;  4LJ7 A;  3RE8 A;  2RKO A;  4M9S A;  5IRE B;  4NRW A;  1XNQ M;  2KA6 B;  3UK6 A;  3GRV A;  3Q8X A;  3HKP A;  4B7H A;  3RFW A;  2I7P A;  4I8O A;  5EQT A;  1HT1 E;  4BB9 A;  1X37 A;  3GPY A;  3GP1 A;  1HNX M;  1FNN A;  1K82 A;  4AG5 A;  2CV0 A;  4IBK A;  4LZZ A;  1N34 M;  1DGH B;  1D2N A;  1QYR A;  4B3S M;  2Z7J A;  3KOW E;  4DV0 M;  1SXJ D;  5BR8 M;  4EIW A;  3SMS A;  1HNZ M;  4IBJ A;  2C96 A;  3TE6 A;  2CHQ A;  5FTM A;  3HHW A;  1NHW C;  1XXH B;  2P5T A;  1S3S A;  1L2D A;  3U6Q A;  4JI6 M;  1TH4 A;  3GQ5 A;  3L2A A;  1IN4 A;  3SAU A;  1R2Y A;  2ZAM A;  2DWN A;  3KDS E;  3FUV A;  3GPP A;  3W0F A;  2Z4R A;  2I7N A;  3PNV A;  4NL4 H;  3IG8 A;  1J7K A;  4G4Q A;  3AV0 A;  4R7G A;  3DZD A;  3OTO M;  4AKG A;  3KS4 A;  5KQD A;  2C99 A;  2V6Z M;  3NBI A;  4M9X A;  3PNY A;  3TWK A;  4BBA A;  4FCT A;  4K0K M;  2R65 A;  1L1Z A;  2DHR A;  1JR3 D;  3KOZ E;  4OU7 A;  4II7 A;  4JI5 M;  3PFI A;  4D82 A;  2UU9 M;  3A42 A;  4LF9 M;  3GLI A;  3MHV C;  1G8P A;  4DV1 M;  4HLQ A;  1J09 A;  3GPX A;  2XFS A;  2UUB M;  4IBG A;  4MH0 E;  3DA1 A;  3LVV A;  2YQZ A;  4MB7 A;  7CAT A;  3KOX E;  3AL0 C;  3GQ4 A;  4LGY A;  2CHG A;  5JI2 E;  4JI7 M;  3J7A S;  1DGB A;  4CIS A;  1TDH A;  1IY1 A;  5C18 A;  2QEN A;  4MGI E;  1XC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...