3KOZE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (anaerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kozE02
3KOYE 3KP0E 3KP1E 3KOXE 3KOZE 3KOWE
chains in the Genus database with same CATH superfamily
2DHRA 3EIHA 1TDZA 3L29A 5DFLA 1KSFX 4PD2A 2QBYB 3FUVA 4B3RM 3J27B 2LXEA 3CGWA 1XHBA 3LCUA 1V34A 2O01F 1L2BA 2Y21A 3FYDA 5ITQA 3HU1A 4DR7M 1NV8A 2G3QA 2R45A 2VF8A 3I51A 3QYBA 4LRSA 3SYKA 5ITRA 4JI8M 2DZOB 2F4VM 3JR5A 1OKSA 2Y0TA 1L1TA 4G4QA 4AKIA 3W67A 3GLHE 4MGIE 1OTRA 4FD2A 1TGUA 4D80A 1CUKA 3AKZA 2ZAOA 3KOXE 2F5NA 3JR4A 3J81S 3U5ZA 5FTKA 1HQCA 3K1JA 1JR3A 3J7AS 4GHLA 2LWXA 4LGMA 2CHGA 1QANA 4QHTA 1JQJC 2D7EA 2RRUA 2DAMA 3AL0C 2YNMD 4ANRA 1SXJE 4LF7M 2QSFX 2ERCA 4IBFA 1OQYA 4LFCM 3M7GA 4XGIA 1YSYA 4LCBA 2EUCA 3FUWA 4PCZA 1IQPA 3GLIB 2NQ8C 3AOEC 3KS8A 2BWBA 3C9PA 1G3IA 3GPXA 5C1BA 1LTMA 1Z5CA 5E26A 3U6MA 3THGA 4LJ9A 4IBEA 1XMOM 3RE8A 1Q3BA 1OJLA 1YE9A 2J7NA 3AV0A 4F2LA 4G4RA 2DWNA 5DYIA 1C1KA 2OQ4A 2F5SA 3W0FA 4AG6A 2J7OA 1HT1E 1OAOC 2MROB 1OIPA 2QBYA 4AW4A 1R7RA 4NOOB 2CRUA 2WSCF 4L15A 4M0DA 3FYCA 4LFBM 2OOAA 2EKFA 4Y28F 3PFIA 4I5SA 3M6AA 2JY5A 4DV3M 2DWMA 1QUSA 1BVSA 5H37D 4G4NA 4L6V6 4DR2M 4NSRA 1I4WA 2R44A 4M9ZA 2WSEF 3GLFE 5KPRA 3HHZA 3I01M 1IXSA 1VDLA 4DV0M 1J5EM 3C3EA 2CV0A 3GQ4A 1WGLA 3R9XB 4DR4M 1T43A 4HLQA 2JY8A 2VQFM 3U6EA 3CTWB 4M9XA 4RF0A 3E9SA 3MHVC 2RGOA 2APLA 3NBXX 3SYLA 4CHTB 3R8FA 4DV2M 2CV2A 2R65A 1DGHB 8CATA 5EXXA 1DGGA 3B7ZA 3IECA 1QZMA 3LVVA 2KRUA 1N33M 1J7KA 3H4MA 5F3WA 2LVPC 1VG5A 2BJWA 1NV9A 2VQEM 3FKEA 3B7QA 3J7BA 1R2YA 2DKLA 2FE8A 3Q8GA 1TH2A 1WIVA 1IN7A 4NXNM 2CE7A 2LVOC 3FRHA 4G6ZA 4XK8F 3VDPA 1T6OA 2C9OA 2RGHA 5EJCA 3J80S 3T6PA 4DV7M 1PGYA 3A42A 4NRWA 1DGFA 2FOIC 3B7NA 5EP4A 3BBZA 1PJSA 1IM2A 3E4RA 2BWEA 5BPVA 2HWJA 5ITXA 1HNWM 5EXTA 3LW5F 5IREB 4I8OA 2X8AA 3GLHA 1Z6TA 4II7A 3JAMS 1L2DA 3WHKA 1NNUC 2R4EA 1WHCA 3UJNA 4AI6A 2JZ1A 4OVZB 1HQYE 2O25A 3C58A 2GQFA 3U6DA 2L7HA 4LJ5A 3A45A 1NY6A 1RU3A 2DWZB 1X37A 4KHPM 5IWAM 1GVNA 2KZUA 2XSZD 1G41A 3HHWA 1XC8A 2B3TA 1HJPA 3ZCBB 3GRRA 2F5OA 3HX3A 1GL6A 4K0KM 3AOEA 3IG5A 3U6PA 1V33A 2KXEA 4GH9A 4FW9A 3SASA 3MMPA 5FLXS 2DHYA 4HEOA 2EO2A 3KVWA 1QYRA 2XZFA 3KS4A 1HR0M 3NBIA 4IBJA 4IIWA 1ZMVA 3HJSA 4D82A 5BR8M 1QAQA 2V1CA 2CFOA 1PJJA 1IY2A 4AQYM 1SXJB 1V92A 2WZJA 1ZV1A 5FSWA 3PNYA 3HHYA 1R2ZA 3SFZA 3FTDA 3WHLA 2XEPA 4FVMA 3KOWE 4B7GA 1XXHA 1XB2B 2K9DA 2XFTA 3DA1A 3SARA 3GLFA 2JZ0A 3MJ5A 2F5PA 2V1UA 1EE8A 1I94M 2MJ5B 4R3DA 3B74A 3TE6A 1ORYB 4LG2A 1TR8A 3TQSA 2FS1A 2KEBA 4I81A 2KW0A 5DNYA 2QNJA 4RKUF 1QAOA 2Z3XA 3UK6A 5LMUM 1NJGA 4R7GA 2UUBM 1OAIA 4JI7M 4HL4A 1YLAA 1SG9A 4B3SM 5EP3A 3K8ZA 5FTNA 2CWBA 2MR9A 2AHMA 1DO0A 4OU7A 2DAGA 1NO1A 1NHWC 1Y8GA 1ZMUA 3FTCA 3QAUA 3HHXA 5KO3A 3DOAA 4FWDA 4AZFA 2VF7A 1E94E 1GABA 3FUTA 1LV7A 1MX0A 4Z6YA 2XLJA 4JXJA 5A2QS 2R6FA 1XMQM 1D2NA 1QDTA 2G8LA 1HNXM 3KDSE 2CV1A 3VFDA 1D0KA 5DYGA 1QQWA 1SXJC 1VEGA 2ZTCA 1E32A 3LCVB 2UXDM 1NHGC 1TDHA 3IHPA 4WW0A 1L1ZA 2X4AA 2M5ZA 5ITTA 2JY7A 4LF6M 1N32M 2RKOA 1DO2A 1PM5A 3FTFA 3FTEA 3HU2A 1E9RA 1QUTA 5EQTA 2BNKA 2R0IA 2DAIA 1IY0A 4QNMA 2ZM6M 3U60A 3T1YM 2CHVA 3FE3A 4M9SA 3HU3A 4G4OA 5IZ7D 1ZMWA 3KXEC 4NSOB 1GO5A 3GLGB 2Q2EB 2LTUA 2N35A 3B89A 3GO8A 1K3WA 3SATA 2HL7A 3LMMA 3K9PA 2JP7A 3FUUA 2EKKA 5E6JA 2XZUA 4B3TM 4I4LA 2L7IA 4IJEA 2C9CA 2DI0A 4JI0M 3GLIA 3E46A 3SAUA 2FH0A 3UMMA 3H4JA 4GC9A 3UGJA 3A46A 4IBGA 4B08A 3ZQJA 2H5XA 3GRUA 1IN6A 2KDLA 4LFAM 3B9PA 1DV0A 4LZZA 3TWMA 2QP9X 2ZANA 4MB7A 1WR1B 4AG5A 4YHHM 1XXHB 4GKKM 2DAKA 2ZBKB 5EP1A 4BBAA 3TL4X 1N77A 1IXSB 2LBCA 3U6LA 2XSZA 1N75A 3QWLA 4JN6A 1G4AE 3CF2A 4CIZA 4CISA 3KP1E 2QENA 4LJ6A 1J09A 3MK6A 3SMSA 1L8QA 4JI1M 3KOZE 5GKNA 4WURA 4DBGB 4LJ4A 3OTOM 3SBJA 1KFVA 1GL7A 2CUZA 2MGWA 2KNVA 2Y20A 2D7HA 4G3OA 1A5TA 4IBCA 1PRBA 4IBIA 5LMNM 1QZEA 1IXRC 2D7GA 3C3DA 2FFJA 3A98B 2LVQD 3L26A 1IBKM 1FNNA 3RGSA 1WGNA 2UUCM 4DV4M 2R62A 2V6ZM 5KPZA 4X64M 4X65M 2WSFF 2M60A 3GP1A 4RNAA 1JR3E 2A5YB 4JI5M 4YY3M 1MN3A 4B7HA 4LGYA 4W5WA 2LHCA 3FD9A 2Z4RA 7CATA 1G8PA 4ZPXA 3ILKA 3HKPA 1NJFA 3CF0A 4MH0E 3VK8A 1W5TA 1Q3CA 2EJSA 4DR1M 3CF6E 2CEAA 4X62M 4LF5M 2DVWB 2OO9A 1NNJA 2HHHM 4CJ6A 1TTEA 1ZQ9A 1OIZA 2R18A 3T15A 1FJGM 1JB0F 1MJGM 3AOGA 1Q39A 2K0BX 3ZC7B 2L09A 1YUBA 3VKGA 4FCVA 3HZJA 4BLCA 3SAVA 2UXCM 3L25A 2I7PA 2KNZA 5ITYA 1E9SA 4L4UA 3VLFB 3ZH9B 1IBLM 3GQ5A 3VKHA 3PVSA 4R71A 1L2CA 1Q02A 3K9OA 3KSJA 3W68A 2LVAA 2Z4SA 1PJIA 3DZDA 4QOZC 3T1HM 3K2LA 4QHSA 4DR3M 1XNRM 2O5RA 1GLNA 2JXNA 1WJ7A 1T3TA 4IJFA 1IXZA 3M0EA 1D0MA 4GEWA 1UFZA 2K47A 1AIPC 3F92A 3KOYE 4OVZA 4WP2A 5KQ8A 5ITXE 2DZNB 2J5YA 3GLHB 2EA0A 4P16A 2HCBA 3U6SA 4FCTA 4QOSA 2I7NA 3U61A 2XGNA 2C98A 5EP2A 4FWHA 5ITUA 3TWKA 3GLIE 4NC6A 3D8LA 2Z8YM 2C96A 1IFYA 1IN8A 3FUXA 5JI2E 2DNAA 2LH0A 3LQRA 4QNRA 3V76A 4EIWA 5KQDA 4DV1M 2CHQA 2DXIA 2G5GX 1R5LA 5FTJA 1TH4A 2FNAA 3HY5A 1SXJD 2Y0QA 4MM3B 4P17A 4MGKE 4MGZE 2X49A 4X66M 1H6UA 3SHGB 4AKGA 1VQ1A 2C5RA 4DV6M 4DUZM 1N36M 2JY6B 2YR0A 4MGHA 4FCWA 3K92A 3L2AA 4GITA 1PJQA 1VEKA 1WXQA 4RF1A 4GKJM 2QQ8A 4D81A 3GLFB 1GJTA 3AFHA 1C7YA 3T38A 1R6BX 4LJ7A 2OPFA 3IG8A 2R4JA 1XXHE 4A3VB 2C99A 3HGIA 1P3QQ 4KLNA 4B3MM 1K3XA 1R4GA 5JI3E 4OX9M 2ZAMA 3HJ8A 4REZA 3KP0E 3VK7A 1K82A 4AKHA 4Z8XA 1Z5BA 1ZAEA 4M0WA 1IN4A 3UZUA 4NRVA 2XFSA 4PDIA 3GQ3A 2HKJA 2L6OA 1AUAA 5EXPA 4NL4H 3RFWA 1UM8A 4MGYE 4LF8M 4JI3M 4JI2M 3GRVA 2YFQA 4S12A 4Q7JA 4DR5M 3W0LB 3AJIB 4GHAA 4KO8A 3TWLA 2ZTDA 1KYIA 3U61B 3GPPA 1N78A 5FTLA 2DENA 2UUAM 4LJ8A 4NXMM 1NVMA 2LHGA 3DFZA 3PXGA 1XNQM 4L78A 3EIEA 5KPTA 2VDBB 3U6OA 4GIPA 1DGHA 2L4EA 4F1IA 1OFIA 3LVWA 2BJVA 2GNOA 1G59A 2KA6B 3E21A 4KODA 3U60B 2DWLA 1Z59A 2JNHA 2JUJA 2L2DA 3GLGA 4PDGA 4ITQA 3KW6A 1F4IA 3Q8XA 5IT9S 1EFUB 3U6CA 4DUYM 4LZJA 4BB9A 2XF3A 4DV5M 3I04M 1IY1A 2K6BA 4L16A 2QPAA 3GPUA 3SAWA 3SC3A 1TF0B 2F5QA 2VIIA 4B7FA 1EIJA 2W82A 2XH9A 2YQZA 2OOBA 1TH3A 5FTMA 2DAEA 3GPYA 2JA2A 4FWGA 3KFUG 3VDUA 4LF4M 2LNHC 1IN5A 1DGBA 3I4VA 4LRTA 2KHHA 2Z7JA 5EXSA 4LJAA 1S3SA 1G71A 1Z5AA 2QHOB 3PNVA 4JV5M 3HJQA 4KT0F 2HAKA 4GRIA 1MU5A 3NWLA 1QAMA 2MH8A 1GKIA 4LF9M 4JYAM 3FRIA 2H1RA 3BXWA 1XWIA 3SMPA 4GMQA 1JR3D 4IBKA 4TUWA 4IBDA 3LQQA 2QZ4A 3SHFA 3TPZA 3U6QA 2DZLA 3BOSA 4PT5A 2KRKA 1D0LA 2E5LM 2P5TA 3KSXA 2R46A 1W5SA 2KZSA 4OW0A 2UU9M 2JWSA 3L28A 1VDDA 4IBBA 5C18A 3RGPA 4L8RC 3GLGE 3HWSA 1NSFA 3L27A 1OFHA 3D8BA 4XBOA 3I4YA 1PJTA 1HT2E 1SXJA 1GJSA 2CP8A 3QYEA 3U5ZB 1QVRA 4DR6M 2LVNC 2KNAA 2UXBM 3J2PB 1NY5A 1IBMM 2L4FA 1HNZM 1VEJA 3GRYA 1N34M 5L8RF 4LY6A 4GC5A 1QDRA 2QCUA 4JI4M 4CGYB 4JI6M 4UN2B
chains in the Genus database with same CATH topology
2DHRA 3EIHA 1TDZA 3L29A 1KSFX 4PD2A 2QBYB 3FUVA 4B3RM 3J27B 2LXEA 1XHBA 1L2BA 2Y21A 3FYDA 5ITQA 3HU1A 4DR7M 3I51A 2R45A 4LRSA 3SYKA 5ITRA 4JI8M 2DZOB 2F4VM 3JR5A 2Y0TA 1L1TA 4AKIA 4G4QA 4MGIE 4FD2A 1TGUA 4D80A 3AKZA 2F5NA 2ZAOA 3KOXE 3JR4A 3J81S 3U5ZA 5FTKA 1HQCA 3K1JA 1JR3A 3J7AS 4GHLA 2LWXA 4LGMA 2CHGA 1QANA 4QHTA 1JQJC 2D7EA 3AL0C 2YNMD 1SXJE 4LF7M 4IBFA 2ERCA 4LFCM 3M7GA 4XGIA 1YSYA 4LCBA 2EUCA 3FUWA 4PCZA 1IQPA 3GLIB 2NQ8C 3AOEC 3KS8A 3GPXA 1G3IA 5C1BA 1Z5CA 5E26A 3U6MA 3THGA 4LJ9A 4IBEA 1XMOM 3RE8A 1Q3BA 1OJLA 1YE9A 2J7NA 3AV0A 4G4RA 2DWNA 5DYIA 1C1KA 2OQ4A 2F5SA 3W0FA 4AG6A 2J7OA 1HT1E 2QBYA 4AW4A 1R7RA 4NOOB 4L15A 4M0DA 3FYCA 4LFBM 3PFIA 4I5SA 3M6AA 4DV3M 2DWMA 4G4NA 5H37D 4DR2M 4NSRA 1I4WA 4M9ZA 5KPRA 3HHZA 4DV0M 1J5EM 2CV0A 3GQ4A 3R9XB 4DR4M 4HLQA 2VQFM 3U6EA 3CTWB 4M9XA 4RF0A 3E9SA 3MHVC 2RGOA 3SYLA 4CHTB 3R8FA 4DV2M 2CV2A 2R65A 1DGHB 8CATA 5EXXA 1DGGA 1QZMA 3LVVA 2KRUA 1N33M 1J7KA 3H4MA 5F3WA 2BJWA 2VQEM 3FKEA 3J7BA 1R2YA 2FE8A 1TH2A 1IN7A 4NXNM 2CE7A 4G6ZA 3VDPA 2C9OA 5EJCA 2RGHA 3J80S 4DV7M 3A42A 4NRWA 1DGFA 2FOIC 5EP4A 1IM2A 3E4RA 5BPVA 5ITXA 1HNWM 5EXTA 5IREB 4I8OA 2X8AA 3GLHA 1Z6TA 4II7A 3JAMS 1L2DA 3WHKA 1NNUC 2R4EA 3UJNA 4AI6A 4OVZB 1HQYE 3C58A 3U6DA 2L7HA 4LJ5A 3A45A 1NY6A 2DWZB 1X37A 4KHPM 5IWAM 1GVNA 2KZUA 2XSZD 1G41A 3HHWA 1XC8A 3ZCBB 3GRRA 2F5OA 4K0KM 1GL6A 3AOEA 3IG5A 3U6PA 2KXEA 4GH9A 4FW9A 3SASA 5FLXS 2EO2A 3KVWA 1QYRA 2XZFA 3KS4A 1HR0M 3NBIA 4IBJA 4IIWA 3HJSA 4D82A 5BR8M 1QAQA 2V1CA 2CFOA 1PJJA 1IY2A 4AQYM 1SXJB 5FSWA 3PNYA 3HHYA 1R2ZA 3SFZA 3FTDA 3WHLA 2XEPA 4FVMA 3KOWE 4B7GA 1XXHA 3DA1A 2XFTA 3SARA 3GLFA 3MJ5A 2F5PA 2V1UA 1EE8A 1I94M 3TE6A 4R3DA 1ORYB 4LG2A 3TQSA 2KEBA 4I81A 2KW0A 5DNYA 1QAOA 2Z3XA 3UK6A 5LMUM 1NJGA 4R7GA 2UUBM 4JI7M 4HL4A 4B3SM 5EP3A 3K8ZA 5FTNA 2AHMA 1DO0A 4OU7A 1NHWC 3QAUA 3FTCA 5KO3A 3HHXA 3DOAA 4FWDA 4AZFA 1E94E 3FUTA 1LV7A 1MX0A 4Z6YA 2XLJA 4JXJA 5A2QS 1XMQM 1D2NA 2CV1A 2G8LA 1HNXM 3KDSE 3VFDA 5DYGA 1QQWA 1SXJC 1E32A 2UXDM 1NHGC 1TDHA 4WW0A 1L1ZA 2X4AA 2M5ZA 5ITTA 4LF6M 1N32M 2RKOA 1DO2A 1PM5A 3FTFA 3FTEA 3HU2A 1E9RA 5EQTA 2BNKA 1IY0A 4QNMA 2ZM6M 3U60A 3T1YM 2CHVA 4M9SA 3HU3A 4G4OA 5IZ7D 3KXEC 4NSOB 3GLGB 2Q2EB 1K3WA 3GO8A 3SATA 2HL7A 3LMMA 5E6JA 3FUUA 2XZUA 4B3TM 4I4LA 2L7IA 4IJEA 2C9CA 4JI0M 3GLIA 3SAUA 3UMMA 4GC9A 3UGJA 3A46A 4IBGA 4B08A 3GRUA 1IN6A 4LFAM 3B9PA 4LZZA 3TWMA 2QP9X 2ZANA 4MB7A 4AG5A 4YHHM 1XXHB 4GKKM 2ZBKB 5EP1A 4BBAA 3TL4X 1N77A 1IXSB 3U6LA 2XSZA 1N75A 3QWLA 4JN6A 1G4AE 3CF2A 4CISA 3KP1E 2QENA 4LJ6A 1J09A 3MK6A 3SMSA 1L8QA 4JI1M 3KOZE 5GKNA 4WURA 3SBJA 4LJ4A 3OTOM 1KFVA 4LF4M 1GL7A 2CUZA 2Y20A 2D7HA 4IBCA 4IBIA 5LMNM 1IXRC 2D7GA 2FFJA 3A98B 3L26A 1IBKM 1FNNA 3RGSA 2UUCM 4DV4M 2R62A 2V6ZM 5KPZA 4X64M 4X65M 2M60A 3GP1A 4RNAA 2A5YB 4JI5M 4YY3M 4B7HA 4LGYA 4W5WA 3FD9A 2Z4RA 7CATA 1G8PA 4ZPXA 3ILKA 3HKPA 1NJFA 3CF0A 4MH0E 3VK8A 1W5TA 1Q3CA 4DR1M 3CF6E 2CEAA 4X62M 4LF5M 2DVWB 1NNJA 2HHHM 1ZQ9A 2R18A 3T15A 1FJGM 3AOGA 3ZC7B 1Q39A 2L09A 1YUBA 3VKGA 4FCVA 4BLCA 3SAVA 2UXCM 3L25A 2I7PA 5ITYA 3VLFB 1E9SA 4L4UA 3ZH9B 1IBLM 3VKHA 3GQ5A 3PVSA 1L2CA 3KSJA 2Z4SA 1PJIA 3DZDA 4QOZC 3T1HM 3K2LA 4QHSA 4DR3M 1XNRM 2O5RA 1GLNA 1T3TA 4IJFA 1IXZA 3M0EA 2K47A 3KOYE 5ITXE 4OVZA 5KQ8A 2DZNB 3GLHB 2EA0A 4P16A 2HCBA 3U6SA 4FCTA 4QOSA 2I7NA 3U61A 2XGNA 2C98A 5EP2A 4FWHA 5ITUA 3TWKA 3D8LA 2C96A 1IN8A 3FUXA 5JI2E 3LQRA 2LH0A 4QNRA 4EIWA 5KQDA 4DV1M 2CHQA 2DXIA 2G5GX 5FTJA 1TH4A 2FNAA 1SXJD 2Y0QA 4MM3B 4MGKE 4MGZE 2X49A 4X66M 1H6UA 3SHGB 4AKGA 2C5RA 4DV6M 4DUZM 1N36M 2YR0A 4MGHA 4FCWA 3K92A 3L2AA 4GITA 4RF1A 1WXQA 4GKJM 4D81A 3GLFB 3AFHA 3T38A 1R6BX 4LJ7A 2OPFA 3IG8A 2R4JA 4A3VB 2C99A 3HGIA 4KLNA 4B3MM 1K3XA 5JI3E 4OX9M 2ZAMA 3HJ8A 4REZA 3KP0E 3VK7A 1K82A 4AKHA 4Z8XA 1Z5BA 1ZAEA 4M0WA 1IN4A 3UZUA 4NRVA 2XFSA 4PDIA 3GQ3A 2HKJA 2L6OA 5EXPA 4NL4H 3RFWA 1UM8A 4MGYE 4LF8M 4JI3M 4JI2M 3GRVA 2YFQA 4S12A 4DR5M 3W0LB 3AJIB 4GHAA 4KO8A 3TWLA 1KYIA 3U61B 3GPPA 1N78A 5FTLA 2UUAM 4LJ8A 4NXMM 1NVMA 3DFZA 3PXGA 1XNQM 4L78A 3EIEA 5KPTA 3U6OA 4GIPA 1DGHA 1OFIA 3LVWA 2BJVA 1G59A 2KA6B 4KODA 3U60B 2DWLA 1Z59A 3GLGA 4PDGA 4ITQA 3KW6A 3Q8XA 5IT9S 3U6CA 4DUYM 4LZJA 4BB9A 2XF3A 4DV5M 1IY1A 4L16A 2QPAA 3GPUA 3SAWA 3SC3A 2F5QA 2VIIA 4B7FA 2W82A 2XH9A 2YQZA 1TH3A 5FTMA 3GPYA 2JA2A 4FWGA 3KFUG 3VDUA 2LNHC 1IN5A 1DGBA 3I4VA 4LRTA 2Z7JA 5EXSA 4LJAA 1S3SA 1Z5AA 3PNVA 4JV5M 3HJQA 4GRIA 1MU5A 3NWLA 1QAMA 1GKIA 4LF9M 4JYAM 2H1RA 1XWIA 3SMPA 4GMQA 1JR3D 4IBKA 4TUWA 4IBDA 3LQQA 2QZ4A 3SHFA 3TPZA 3U6QA 3BOSA 4PT5A 2KRKA 2E5LM 2P5TA 3KSXA 1W5SA 2KZSA 2R46A 4OW0A 2UU9M 3L28A 1VDDA 4IBBA 5C18A 3RGPA 4L8RC 3HWSA 1NSFA 3L27A 1OFHA 3D8BA 4XBOA 3I4YA 1HT2E 1SXJA 3U5ZB 1QVRA 4DR6M 2UXBM 3J2PB 1NY5A 1IBMM 1HNZM 3GRYA 1N34M 4LY6A 4GC5A 2QCUA 4JI4M 4CGYB 4JI6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOY E;  3KP0 E;  3KP1 E;  3KOX E;  3KOZ E;  3KOW E; 
#chains in the Genus database with same CATH topology
 2DHR A;  3EIH A;  1TDZ A;  3L29 A;  5DFL A;  1KSF X;  4PD2 A;  2QBY B;  3FUV A;  4B3R M;  3J27 B;  2LXE A;  3CGW A;  1XHB A;  3LCU A;  1V34 A;  2O01 F;  1L2B A;  2Y21 A;  3FYD A;  5ITQ A;  3HU1 A;  4DR7 M;  1NV8 A;  2G3Q A;  2R45 A;  2VF8 A;  3I51 A;  3QYB A;  4LRS A;  3SYK A;  5ITR A;  4JI8 M;  2DZO B;  2F4V M;  3JR5 A;  1OKS A;  2Y0T A;  1L1T A;  4G4Q A;  4AKI A;  3W67 A;  3GLH E;  4MGI E;  1OTR A;  4FD2 A;  1TGU A;  4D80 A;  1CUK A;  3AKZ A;  2ZAO A;  3KOX E;  2F5N A;  3JR4 A;  3J81 S;  3U5Z A;  5FTK A;  1HQC A;  3K1J A;  1JR3 A;  3J7A S;  4GHL A;  2LWX A;  4LGM A;  2CHG A;  1QAN A;  4QHT A;  1JQJ C;  2D7E A;  2RRU A;  2DAM A;  3AL0 C;  2YNM D;  4ANR A;  1SXJ E;  4LF7 M;  2QSF X;  2ERC A;  4IBF A;  1OQY A;  4LFC M;  3M7G A;  4XGI A;  1YSY A;  4LCB A;  2EUC A;  3FUW A;  4PCZ A;  1IQP A;  3GLI B;  2NQ8 C;  3AOE C;  3KS8 A;  2BWB A;  3C9P A;  1G3I A;  3GPX A;  5C1B A;  1LTM A;  1Z5C A;  5E26 A;  3U6M A;  3THG A;  4LJ9 A;  4IBE A;  1XMO M;  3RE8 A;  1Q3B A;  1OJL A;  1YE9 A;  2J7N A;  3AV0 A;  4F2L A;  4G4R A;  2DWN A;  5DYI A;  1C1K A;  2OQ4 A;  2F5S A;  3W0F A;  4AG6 A;  2J7O A;  1HT1 E;  1OAO C;  2MRO B;  1OIP A;  2QBY A;  4AW4 A;  1R7R A;  4NOO B;  2CRU A;  2WSC F;  4L15 A;  4M0D A;  3FYC A;  4LFB M;  2OOA A;  2EKF A;  4Y28 F;  3PFI A;  4I5S A;  3M6A A;  2JY5 A;  4DV3 M;  2DWM A;  1QUS A;  1BVS A;  5H37 D;  4G4N A;  4L6V 6;  4DR2 M;  4NSR A;  1I4W A;  2R44 A;  4M9Z A;  2WSE F;  3GLF E;  5KPR A;  3HHZ A;  3I01 M;  1IXS A;  1VDL A;  4DV0 M;  1J5E M;  3C3E A;  2CV0 A;  3GQ4 A;  1WGL A;  3R9X B;  4DR4 M;  1T43 A;  4HLQ A;  2JY8 A;  2VQF M;  3U6E A;  3CTW B;  4M9X A;  4RF0 A;  3E9S A;  3MHV C;  2RGO A;  2APL A;  3NBX X;  3SYL A;  4CHT B;  3R8F A;  4DV2 M;  2CV2 A;  2R65 A;  1DGH B;  8CAT A;  5EXX A;  1DGG A;  3B7Z A;  3IEC A;  1QZM A;  3LVV A;  2KRU A;  1N33 M;  1J7K A;  3H4M A;  5F3W A;  2LVP C;  1VG5 A;  2BJW A;  1NV9 A;  2VQE M;  3FKE A;  3B7Q A;  3J7B A;  1R2Y A;  2DKL A;  2FE8 A;  3Q8G A;  1TH2 A;  1WIV A;  1IN7 A;  4NXN M;  2CE7 A;  2LVO C;  3FRH A;  4G6Z A;  4XK8 F;  3VDP A;  1T6O A;  2C9O A;  2RGH A;  5EJC A;  3J80 S;  3T6P A;  4DV7 M;  1PGY A;  3A42 A;  4NRW A;  1DGF A;  2FOI C;  3B7N A;  5EP4 A;  3BBZ A;  1PJS A;  1IM2 A;  3E4R A;  2BWE A;  5BPV A;  2HWJ A;  5ITX A;  1HNW M;  5EXT A;  3LW5 F;  5IRE B;  4I8O A;  2X8A A;  3GLH A;  1Z6T A;  4II7 A;  3JAM S;  1L2D A;  3WHK A;  1NNU C;  2R4E A;  1WHC A;  3UJN A;  4AI6 A;  2JZ1 A;  4OVZ B;  1HQY E;  2O25 A;  3C58 A;  2GQF A;  3U6D A;  2L7H A;  4LJ5 A;  3A45 A;  1NY6 A;  1RU3 A;  2DWZ B;  1X37 A;  4KHP M;  5IWA M;  1GVN A;  2KZU A;  2XSZ D;  1G41 A;  3HHW A;  1XC8 A;  2B3T A;  1HJP A;  3ZCB B;  3GRR A;  2F5O A;  3HX3 A;  1GL6 A;  4K0K M;  3AOE A;  3IG5 A;  3U6P A;  1V33 A;  2KXE A;  4GH9 A;  4FW9 A;  3SAS A;  3MMP A;  5FLX S;  2DHY A;  4HEO A;  2EO2 A;  3KVW A;  1QYR A;  2XZF A;  3KS4 A;  1HR0 M;  3NBI A;  4IBJ A;  4IIW A;  1ZMV A;  3HJS A;  4D82 A;  5BR8 M;  1QAQ A;  2V1C A;  2CFO A;  1PJJ A;  1IY2 A;  4AQY M;  1SXJ B;  1V92 A;  2WZJ A;  1ZV1 A;  5FSW A;  3PNY A;  3HHY A;  1R2Z A;  3SFZ A;  3FTD A;  3WHL A;  2XEP A;  4FVM A;  3KOW E;  4B7G A;  1XXH A;  1XB2 B;  2K9D A;  2XFT A;  3DA1 A;  3SAR A;  3GLF A;  2JZ0 A;  3MJ5 A;  2F5P A;  2V1U A;  1EE8 A;  1I94 M;  2MJ5 B;  4R3D A;  3B74 A;  3TE6 A;  1ORY B;  4LG2 A;  1TR8 A;  3TQS A;  2FS1 A;  2KEB A;  4I81 A;  2KW0 A;  5DNY A;  2QNJ A;  4RKU F;  1QAO A;  2Z3X A;  3UK6 A;  5LMU M;  1NJG A;  4R7G A;  2UUB M;  1OAI A;  4JI7 M;  4HL4 A;  1YLA A;  1SG9 A;  4B3S M;  5EP3 A;  3K8Z A;  5FTN A;  2CWB A;  2MR9 A;  2AHM A;  1DO0 A;  4OU7 A;  2DAG A;  1NO1 A;  1NHW C;  1Y8G A;  1ZMU A;  3FTC A;  3QAU A;  3HHX A;  5KO3 A;  3DOA A;  4FWD A;  4AZF A;  2VF7 A;  1E94 E;  1GAB A;  3FUT A;  1LV7 A;  1MX0 A;  4Z6Y A;  2XLJ A;  4JXJ A;  5A2Q S;  2R6F A;  1XMQ M;  1D2N A;  1QDT A;  2G8L A;  1HNX M;  3KDS E;  2CV1 A;  3VFD A;  1D0K A;  5DYG A;  1QQW A;  1SXJ C;  1VEG A;  2ZTC A;  1E32 A;  3LCV B;  2UXD M;  1NHG C;  1TDH A;  3IHP A;  4WW0 A;  1L1Z A;  2X4A A;  2M5Z A;  5ITT A;  2JY7 A;  4LF6 M;  1N32 M;  2RKO A;  1DO2 A;  1PM5 A;  3FTF A;  3FTE A;  3HU2 A;  1E9R A;  1QUT A;  5EQT A;  2BNK A;  2R0I A;  2DAI A;  1IY0 A;  4QNM A;  2ZM6 M;  3U60 A;  3T1Y M;  2CHV A;  3FE3 A;  4M9S A;  3HU3 A;  4G4O A;  5IZ7 D;  1ZMW A;  3KXE C;  4NSO B;  1GO5 A;  3GLG B;  2Q2E B;  2LTU A;  2N35 A;  3B89 A;  3GO8 A;  1K3W A;  3SAT A;  2HL7 A;  3LMM A;  3K9P A;  2JP7 A;  3FUU A;  2EKK A;  5E6J A;  2XZU A;  4B3T M;  4I4L A;  2L7I A;  4IJE A;  2C9C A;  2DI0 A;  4JI0 M;  3GLI A;  3E46 A;  3SAU A;  2FH0 A;  3UMM A;  3H4J A;  4GC9 A;  3UGJ A;  3A46 A;  4IBG A;  4B08 A;  3ZQJ A;  2H5X A;  3GRU A;  1IN6 A;  2KDL A;  4LFA M;  3B9P A;  1DV0 A;  4LZZ A;  3TWM A;  2QP9 X;  2ZAN A;  4MB7 A;  1WR1 B;  4AG5 A;  4YHH M;  1XXH B;  4GKK M;  2DAK A;  2ZBK B;  5EP1 A;  4BBA A;  3TL4 X;  1N77 A;  1IXS B;  2LBC A;  3U6L A;  2XSZ A;  1N75 A;  3QWL A;  4JN6 A;  1G4A E;  3CF2 A;  4CIZ A;  4CIS A;  3KP1 E;  2QEN A;  4LJ6 A;  1J09 A;  3MK6 A;  3SMS A;  1L8Q A;  4JI1 M;  3KOZ E;  5GKN A;  4WUR A;  4DBG B;  4LJ4 A;  3OTO M;  3SBJ A;  1KFV A;  1GL7 A;  2CUZ A;  2MGW A;  2KNV A;  2Y20 A;  2D7H A;  4G3O A;  1A5T A;  4IBC A;  1PRB A;  4IBI A;  5LMN M;  1QZE A;  1IXR C;  2D7G A;  3C3D A;  2FFJ A;  3A98 B;  2LVQ D;  3L26 A;  1IBK M;  1FNN A;  3RGS A;  1WGN A;  2UUC M;  4DV4 M;  2R62 A;  2V6Z M;  5KPZ A;  4X64 M;  4X65 M;  2WSF F;  2M60 A;  3GP1 A;  4RNA A;  1JR3 E;  2A5Y B;  4JI5 M;  4YY3 M;  1MN3 A;  4B7H A;  4LGY A;  4W5W A;  2LHC A;  3FD9 A;  2Z4R A;  7CAT A;  1G8P A;  4ZPX A;  3ILK A;  3HKP A;  1NJF A;  3CF0 A;  4MH0 E;  3VK8 A;  1W5T A;  1Q3C A;  2EJS A;  4DR1 M;  3CF6 E;  2CEA A;  4X62 M;  4LF5 M;  2DVW B;  2OO9 A;  1NNJ A;  2HHH M;  4CJ6 A;  1TTE A;  1ZQ9 A;  1OIZ A;  2R18 A;  3T15 A;  1FJG M;  1JB0 F;  1MJG M;  3AOG A;  1Q39 A;  2K0B X;  3ZC7 B;  2L09 A;  1YUB A;  3VKG A;  4FCV A;  3HZJ A;  4BLC A;  3SAV A;  2UXC M;  3L25 A;  2I7P A;  2KNZ A;  5ITY A;  1E9S A;  4L4U A;  3VLF B;  3ZH9 B;  1IBL M;  3GQ5 A;  3VKH A;  3PVS A;  4R71 A;  1L2C A;  1Q02 A;  3K9O A;  3KSJ A;  3W68 A;  2LVA A;  2Z4S A;  1PJI A;  3DZD A;  4QOZ C;  3T1H M;  3K2L A;  4QHS A;  4DR3 M;  1XNR M;  2O5R A;  1GLN A;  2JXN A;  1WJ7 A;  1T3T A;  4IJF A;  1IXZ A;  3M0E A;  1D0M A;  4GEW A;  1UFZ A;  2K47 A;  1AIP C;  3F92 A;  3KOY E;  4OVZ A;  4WP2 A;  5KQ8 A;  5ITX E;  2DZN B;  2J5Y A;  3GLH B;  2EA0 A;  4P16 A;  2HCB A;  3U6S A;  4FCT A;  4QOS A;  2I7N A;  3U61 A;  2XGN A;  2C98 A;  5EP2 A;  4FWH A;  5ITU A;  3TWK A;  3GLI E;  4NC6 A;  3D8L A;  2Z8Y M;  2C96 A;  1IFY A;  1IN8 A;  3FUX A;  5JI2 E;  2DNA A;  2LH0 A;  3LQR A;  4QNR A;  3V76 A;  4EIW A;  5KQD A;  4DV1 M;  2CHQ A;  2DXI A;  2G5G X;  1R5L A;  5FTJ A;  1TH4 A;  2FNA A;  3HY5 A;  1SXJ D;  2Y0Q A;  4MM3 B;  4P17 A;  4MGK E;  4MGZ E;  2X49 A;  4X66 M;  1H6U A;  3SHG B;  4AKG A;  1VQ1 A;  2C5R A;  4DV6 M;  4DUZ M;  1N36 M;  2JY6 B;  2YR0 A;  4MGH A;  4FCW A;  3K92 A;  3L2A A;  4GIT A;  1PJQ A;  1VEK A;  1WXQ A;  4RF1 A;  4GKJ M;  2QQ8 A;  4D81 A;  3GLF B;  1GJT A;  3AFH A;  1C7Y A;  3T38 A;  1R6B X;  4LJ7 A;  2OPF A;  3IG8 A;  2R4J A;  1XXH E;  4A3V B;  2C99 A;  3HGI A;  1P3Q Q;  4KLN A;  4B3M M;  1K3X A;  1R4G A;  5JI3 E;  4OX9 M;  2ZAM A;  3HJ8 A;  4REZ A;  3KP0 E;  3VK7 A;  1K82 A;  4AKH A;  4Z8X A;  1Z5B A;  1ZAE A;  4M0W A;  1IN4 A;  3UZU A;  4NRV A;  2XFS A;  4PDI A;  3GQ3 A;  2HKJ A;  2L6O A;  1AUA A;  5EXP A;  4NL4 H;  3RFW A;  1UM8 A;  4MGY E;  4LF8 M;  4JI3 M;  4JI2 M;  3GRV A;  2YFQ A;  4S12 A;  4Q7J A;  4DR5 M;  3W0L B;  3AJI B;  4GHA A;  4KO8 A;  3TWL A;  2ZTD A;  1KYI A;  3U61 B;  3GPP A;  1N78 A;  5FTL A;  2DEN A;  2UUA M;  4LJ8 A;  4NXM M;  1NVM A;  2LHG A;  3DFZ A;  3PXG A;  1XNQ M;  4L78 A;  3EIE A;  5KPT A;  2VDB B;  3U6O A;  4GIP A;  1DGH A;  2L4E A;  4F1I A;  1OFI A;  3LVW A;  2BJV A;  2GNO A;  1G59 A;  2KA6 B;  3E21 A;  4KOD A;  3U60 B;  2DWL A;  1Z59 A;  2JNH A;  2JUJ A;  2L2D A;  3GLG A;  4PDG A;  4ITQ A;  3KW6 A;  1F4I A;  3Q8X A;  5IT9 S;  1EFU B;  3U6C A;  4DUY M;  4LZJ A;  4BB9 A;  2XF3 A;  4DV5 M;  3I04 M;  1IY1 A;  2K6B A;  4L16 A;  2QPA A;  3GPU A;  3SAW A;  3SC3 A;  1TF0 B;  2F5Q A;  2VII A;  4B7F A;  1EIJ A;  2W82 A;  2XH9 A;  2YQZ A;  2OOB A;  1TH3 A;  5FTM A;  2DAE A;  3GPY A;  2JA2 A;  4FWG A;  3KFU G;  3VDU A;  4LF4 M;  2LNH C;  1IN5 A;  1DGB A;  3I4V A;  4LRT A;  2KHH A;  2Z7J A;  5EXS A;  4LJA A;  1S3S A;  1G71 A;  1Z5A A;  2QHO B;  3PNV A;  4JV5 M;  3HJQ A;  4KT0 F;  2HAK A;  4GRI A;  1MU5 A;  3NWL A;  1QAM A;  2MH8 A;  1GKI A;  4LF9 M;  4JYA M;  3FRI A;  2H1R A;  3BXW A;  1XWI A;  3SMP A;  4GMQ A;  1JR3 D;  4IBK A;  4TUW A;  4IBD A;  3LQQ A;  2QZ4 A;  3SHF A;  3TPZ A;  3U6Q A;  2DZL A;  3BOS A;  4PT5 A;  2KRK A;  1D0L A;  2E5L M;  2P5T A;  3KSX A;  2R46 A;  1W5S A;  2KZS A;  4OW0 A;  2UU9 M;  2JWS A;  3L28 A;  1VDD A;  4IBB A;  5C18 A;  3RGP A;  4L8R C;  3GLG E;  3HWS A;  1NSF A;  3L27 A;  1OFH A;  3D8B A;  4XBO A;  3I4Y A;  1PJT A;  1HT2 E;  1SXJ A;  1GJS A;  2CP8 A;  3QYE A;  3U5Z B;  1QVR A;  4DR6 M;  2LVN C;  2KNA A;  2UXB M;  3J2P B;  1NY5 A;  1IBM M;  2L4F A;  1HNZ M;  1VEJ A;  3GRY A;  1N34 M;  5L8R F;  4LY6 A;  4GC5 A;  1QDR A;  2QCU A;  4JI4 M;  4CGY B;  4JI6 M;  4UN2 B; 
#chains in the Genus database with same CATH homology
 2DHR A;  3EIH A;  1TDZ A;  3L29 A;  1KSF X;  4PD2 A;  2QBY B;  3FUV A;  4B3R M;  3J27 B;  2LXE A;  1XHB A;  1L2B A;  2Y21 A;  3FYD A;  5ITQ A;  3HU1 A;  4DR7 M;  3I51 A;  2R45 A;  4LRS A;  3SYK A;  5ITR A;  4JI8 M;  2DZO B;  2F4V M;  3JR5 A;  2Y0T A;  1L1T A;  4AKI A;  4G4Q A;  4MGI E;  4FD2 A;  1TGU A;  4D80 A;  3AKZ A;  2F5N A;  2ZAO A;  3KOX E;  3JR4 A;  3J81 S;  3U5Z A;  5FTK A;  1HQC A;  3K1J A;  1JR3 A;  3J7A S;  4GHL A;  2LWX A;  4LGM A;  2CHG A;  1QAN A;  4QHT A;  1JQJ C;  2D7E A;  3AL0 C;  2YNM D;  1SXJ E;  4LF7 M;  4IBF A;  2ERC A;  4LFC M;  3M7G A;  4XGI A;  1YSY A;  4LCB A;  2EUC A;  3FUW A;  4PCZ A;  1IQP A;  3GLI B;  2NQ8 C;  3AOE C;  3KS8 A;  3GPX A;  1G3I A;  5C1B A;  1Z5C A;  5E26 A;  3U6M A;  3THG A;  4LJ9 A;  4IBE A;  1XMO M;  3RE8 A;  1Q3B A;  1OJL A;  1YE9 A;  2J7N A;  3AV0 A;  4G4R A;  2DWN A;  5DYI A;  1C1K A;  2OQ4 A;  2F5S A;  3W0F A;  4AG6 A;  2J7O A;  1HT1 E;  2QBY A;  4AW4 A;  1R7R A;  4NOO B;  4L15 A;  4M0D A;  3FYC A;  4LFB M;  3PFI A;  4I5S A;  3M6A A;  4DV3 M;  2DWM A;  4G4N A;  5H37 D;  4DR2 M;  4NSR A;  1I4W A;  4M9Z A;  5KPR A;  3HHZ A;  4DV0 M;  1J5E M;  2CV0 A;  3GQ4 A;  3R9X B;  4DR4 M;  4HLQ A;  2VQF M;  3U6E A;  3CTW B;  4M9X A;  4RF0 A;  3E9S A;  3MHV C;  2RGO A;  3SYL A;  4CHT B;  3R8F A;  4DV2 M;  2CV2 A;  2R65 A;  1DGH B;  8CAT A;  5EXX A;  1DGG A;  1QZM A;  3LVV A;  2KRU A;  1N33 M;  1J7K A;  3H4M A;  5F3W A;  2BJW A;  2VQE M;  3FKE A;  3J7B A;  1R2Y A;  2FE8 A;  1TH2 A;  1IN7 A;  4NXN M;  2CE7 A;  4G6Z A;  3VDP A;  2C9O A;  5EJC A;  2RGH A;  3J80 S;  4DV7 M;  3A42 A;  4NRW A;  1DGF A;  2FOI C;  5EP4 A;  1IM2 A;  3E4R A;  5BPV A;  5ITX A;  1HNW M;  5EXT A;  5IRE B;  4I8O A;  2X8A A;  3GLH A;  1Z6T A;  4II7 A;  3JAM S;  1L2D A;  3WHK A;  1NNU C;  2R4E A;  3UJN A;  4AI6 A;  4OVZ B;  1HQY E;  3C58 A;  3U6D A;  2L7H A;  4LJ5 A;  3A45 A;  1NY6 A;  2DWZ B;  1X37 A;  4KHP M;  5IWA M;  1GVN A;  2KZU A;  2XSZ D;  1G41 A;  3HHW A;  1XC8 A;  3ZCB B;  3GRR A;  2F5O A;  4K0K M;  1GL6 A;  3AOE A;  3IG5 A;  3U6P A;  2KXE A;  4GH9 A;  4FW9 A;  3SAS A;  5FLX S;  2EO2 A;  3KVW A;  1QYR A;  2XZF A;  3KS4 A;  1HR0 M;  3NBI A;  4IBJ A;  4IIW A;  3HJS A;  4D82 A;  5BR8 M;  1QAQ A;  2V1C A;  2CFO A;  1PJJ A;  1IY2 A;  4AQY M;  1SXJ B;  5FSW A;  3PNY A;  3HHY A;  1R2Z A;  3SFZ A;  3FTD A;  3WHL A;  2XEP A;  4FVM A;  3KOW E;  4B7G A;  1XXH A;  3DA1 A;  2XFT A;  3SAR A;  3GLF A;  3MJ5 A;  2F5P A;  2V1U A;  1EE8 A;  1I94 M;  3TE6 A;  4R3D A;  1ORY B;  4LG2 A;  3TQS A;  2KEB A;  4I81 A;  2KW0 A;  5DNY A;  1QAO A;  2Z3X A;  3UK6 A;  5LMU M;  1NJG A;  4R7G A;  2UUB M;  4JI7 M;  4HL4 A;  4B3S M;  5EP3 A;  3K8Z A;  5FTN A;  2AHM A;  1DO0 A;  4OU7 A;  1NHW C;  3QAU A;  3FTC A;  5KO3 A;  3HHX A;  3DOA A;  4FWD A;  4AZF A;  1E94 E;  3FUT A;  1LV7 A;  1MX0 A;  4Z6Y A;  2XLJ A;  4JXJ A;  5A2Q S;  1XMQ M;  1D2N A;  2CV1 A;  2G8L A;  1HNX M;  3KDS E;  3VFD A;  5DYG A;  1QQW A;  1SXJ C;  1E32 A;  2UXD M;  1NHG C;  1TDH A;  4WW0 A;  1L1Z A;  2X4A A;  2M5Z A;  5ITT A;  4LF6 M;  1N32 M;  2RKO A;  1DO2 A;  1PM5 A;  3FTF A;  3FTE A;  3HU2 A;  1E9R A;  5EQT A;  2BNK A;  1IY0 A;  4QNM A;  2ZM6 M;  3U60 A;  3T1Y M;  2CHV A;  4M9S A;  3HU3 A;  4G4O A;  5IZ7 D;  3KXE C;  4NSO B;  3GLG B;  2Q2E B;  1K3W A;  3GO8 A;  3SAT A;  2HL7 A;  3LMM A;  5E6J A;  3FUU A;  2XZU A;  4B3T M;  4I4L A;  2L7I A;  4IJE A;  2C9C A;  4JI0 M;  3GLI A;  3SAU A;  3UMM A;  4GC9 A;  3UGJ A;  3A46 A;  4IBG A;  4B08 A;  3GRU A;  1IN6 A;  4LFA M;  3B9P A;  4LZZ A;  3TWM A;  2QP9 X;  2ZAN A;  4MB7 A;  4AG5 A;  4YHH M;  1XXH B;  4GKK M;  2ZBK B;  5EP1 A;  4BBA A;  3TL4 X;  1N77 A;  1IXS B;  3U6L A;  2XSZ A;  1N75 A;  3QWL A;  4JN6 A;  1G4A E;  3CF2 A;  4CIS A;  3KP1 E;  2QEN A;  4LJ6 A;  1J09 A;  3MK6 A;  3SMS A;  1L8Q A;  4JI1 M;  3KOZ E;  5GKN A;  4WUR A;  3SBJ A;  4LJ4 A;  3OTO M;  1KFV A;  4LF4 M;  1GL7 A;  2CUZ A;  2Y20 A;  2D7H A;  4IBC A;  4IBI A;  5LMN M;  1IXR C;  2D7G A;  2FFJ A;  3A98 B;  3L26 A;  1IBK M;  1FNN A;  3RGS A;  2UUC M;  4DV4 M;  2R62 A;  2V6Z M;  5KPZ A;  4X64 M;  4X65 M;  2M60 A;  3GP1 A;  4RNA A;  2A5Y B;  4JI5 M;  4YY3 M;  4B7H A;  4LGY A;  4W5W A;  3FD9 A;  2Z4R A;  7CAT A;  1G8P A;  4ZPX A;  3ILK A;  3HKP A;  1NJF A;  3CF0 A;  4MH0 E;  3VK8 A;  1W5T A;  1Q3C A;  4DR1 M;  3CF6 E;  2CEA A;  4X62 M;  4LF5 M;  2DVW B;  1NNJ A;  2HHH M;  1ZQ9 A;  2R18 A;  3T15 A;  1FJG M;  3AOG A;  3ZC7 B;  1Q39 A;  2L09 A;  1YUB A;  3VKG A;  4FCV A;  4BLC A;  3SAV A;  2UXC M;  3L25 A;  2I7P A;  5ITY A;  3VLF B;  1E9S A;  4L4U A;  3ZH9 B;  1IBL M;  3VKH A;  3GQ5 A;  3PVS A;  1L2C A;  3KSJ A;  2Z4S A;  1PJI A;  3DZD A;  4QOZ C;  3T1H M;  3K2L A;  4QHS A;  4DR3 M;  1XNR M;  2O5R A;  1GLN A;  1T3T A;  4IJF A;  1IXZ A;  3M0E A;  2K47 A;  3KOY E;  5ITX E;  4OVZ A;  5KQ8 A;  2DZN B;  3GLH B;  2EA0 A;  4P16 A;  2HCB A;  3U6S A;  4FCT A;  4QOS A;  2I7N A;  3U61 A;  2XGN A;  2C98 A;  5EP2 A;  4FWH A;  5ITU A;  3TWK A;  3D8L A;  2C96 A;  1IN8 A;  3FUX A;  5JI2 E;  3LQR A;  2LH0 A;  4QNR A;  4EIW A;  5KQD A;  4DV1 M;  2CHQ A;  2DXI A;  2G5G X;  5FTJ A;  1TH4 A;  2FNA A;  1SXJ D;  2Y0Q A;  4MM3 B;  4MGK E;  4MGZ E;  2X49 A;  4X66 M;  1H6U A;  3SHG B;  4AKG A;  2C5R A;  4DV6 M;  4DUZ M;  1N36 M;  2YR0 A;  4MGH A;  4FCW A;  3K92 A;  3L2A A;  4GIT A;  4RF1 A;  1WXQ A;  4GKJ M;  4D81 A;  3GLF B;  3AFH A;  3T38 A;  1R6B X;  4LJ7 A;  2OPF A;  3IG8 A;  2R4J A;  4A3V B;  2C99 A;  3HGI A;  4KLN A;  4B3M M;  1K3X A;  5JI3 E;  4OX9 M;  2ZAM A;  3HJ8 A;  4REZ A;  3KP0 E;  3VK7 A;  1K82 A;  4AKH A;  4Z8X A;  1Z5B A;  1ZAE A;  4M0W A;  1IN4 A;  3UZU A;  4NRV A;  2XFS A;  4PDI A;  3GQ3 A;  2HKJ A;  2L6O A;  5EXP A;  4NL4 H;  3RFW A;  1UM8 A;  4MGY E;  4LF8 M;  4JI3 M;  4JI2 M;  3GRV A;  2YFQ A;  4S12 A;  4DR5 M;  3W0L B;  3AJI B;  4GHA A;  4KO8 A;  3TWL A;  1KYI A;  3U61 B;  3GPP A;  1N78 A;  5FTL A;  2UUA M;  4LJ8 A;  4NXM M;  1NVM A;  3DFZ A;  3PXG A;  1XNQ M;  4L78 A;  3EIE A;  5KPT A;  3U6O A;  4GIP A;  1DGH A;  1OFI A;  3LVW A;  2BJV A;  1G59 A;  2KA6 B;  4KOD A;  3U60 B;  2DWL A;  1Z59 A;  3GLG A;  4PDG A;  4ITQ A;  3KW6 A;  3Q8X A;  5IT9 S;  3U6C A;  4DUY M;  4LZJ A;  4BB9 A;  2XF3 A;  4DV5 M;  1IY1 A;  4L16 A;  2QPA A;  3GPU A;  3SAW A;  3SC3 A;  2F5Q A;  2VII A;  4B7F A;  2W82 A;  2XH9 A;  2YQZ A;  1TH3 A;  5FTM A;  3GPY A;  2JA2 A;  4FWG A;  3KFU G;  3VDU A;  2LNH C;  1IN5 A;  1DGB A;  3I4V A;  4LRT A;  2Z7J A;  5EXS A;  4LJA A;  1S3S A;  1Z5A A;  3PNV A;  4JV5 M;  3HJQ A;  4GRI A;  1MU5 A;  3NWL A;  1QAM A;  1GKI A;  4LF9 M;  4JYA M;  2H1R A;  1XWI A;  3SMP A;  4GMQ A;  1JR3 D;  4IBK A;  4TUW A;  4IBD A;  3LQQ A;  2QZ4 A;  3SHF A;  3TPZ A;  3U6Q A;  3BOS A;  4PT5 A;  2KRK A;  2E5L M;  2P5T A;  3KSX A;  1W5S A;  2KZS A;  2R46 A;  4OW0 A;  2UU9 M;  3L28 A;  1VDD A;  4IBB A;  5C18 A;  3RGP A;  4L8R C;  3HWS A;  1NSF A;  3L27 A;  1OFH A;  3D8B A;  4XBO A;  3I4Y A;  1HT2 E;  1SXJ A;  3U5Z B;  1QVR A;  4DR6 M;  2UXB M;  3J2P B;  1NY5 A;  1IBM M;  1HNZ M;  3GRY A;  1N34 M;  4LY6 A;  4GC5 A;  2QCU A;  4JI4 M;  4CGY B;  4JI6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...