3KOZE

Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (anaerobic)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
110
structure length
110
Chain Sequence
DDFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 43
structure length 110
sequence length 110
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kozE02
3KOYE 3KP1E 3KOWE 3KOZE 3KOXE 3KP0E
chains in the Genus database with same CATH superfamily
4F1IA 4Z6YA 2MJ5B 2YR0A 4GH9A 5IT9S 3GPXA 4JV5M 2XF3A 4M0DA 1E9RA 3HZJA 3I04M 1HT2E 4FWHA 5H37D 2HL7A 2DWZB 3E46A 4MGKE 3QWLA 1EFUB 1XMQM 1EE8A 2D7GA 2R45A 3M7GA 4DV4M 3HY5A 2K9DA 1WHCA 3T38A 1H6UA 1GJTA 1VDLA 1L1ZA 2UXBM 2ZAMA 4YHHM 2CHQA 4XK8F 4L8RC 1D0KA 4LCBA 1TDHA 3TWLA 3A45A 1MU5A 4B3RM 3C3EA 3HU1A 4X64M 4JI3M 2KNAA 1IN6A 1Q02A 1N33M 1HQYE 4LJ8A 3GLFA 1G4AE 1Z5BA 1FJGM 3AL0C 3LQRA 4FCVA 1D0MA 2G8LA 4NXNM 3GLFE 4DV1M 5F3WA 1S3SA 4DR6M 1NY5A 4OVZA 5FLXS 3DFZA 1DGFA 1PJSA 3GRVA 3RGPA 2JY5A 3LVWA 3JR4A 1QDTA 3L26A 1PJIA 4NC6A 2LNHC 1NO1A 3BOSA 4I5SA 5EP2A 2LVAA 1XB2B 3KW6A 2F5QA 1TDZA 2OOBA 1QAQA 1DO0A 1TH2A 2O01F 2E5LM 1IN7A 4PD2A 2AHMA 2MH8A 3FYCA 1VDDA 1T43A 2MGWA 3U6EA 4FD2A 3T1YM 3GLHA 4CHTB 1SXJE 3TL4X 2DNAA 3D8LA 3M6AA 1V33A 3GLHE 4HEOA 1IXSA 4QNRA 1L2CA 3K9OA 4DV2M 4DR4M 2DZOB 2B3TA 1IY0A 1JB0F 2QZ4A 4RF0A 3GPYA 3AV0A 3LCUA 3GQ4A 1G3IA 3FE3A 2XFSA 1EIJA 1X37A 2FOIC 4BLCA 4IBEA 4QNMA 1K82A 1ZMUA 3UMMA 4HL4A 3QYEA 3GPPA 4FW9A 2JWSA 1Z5CA 2RGOA 5ITQA 1T6OA 2GNOA 1KSFX 2WSFF 1KYIA 1PRBA 1WGLA 2KXEA 1XXHA 2ZAOA 3D8BA 2R44A 5KQ8A 4DR3M 4L4UA 3U6CA 1D2NA 3HKPA 4D82A 2ZTCA 5FTNA 1XXHE 3R9XB 4WW0A 3B9PA 3AOGA 3U60B 1QAOA 2EJSA 1GVNA 4GRIA 3U61A 1F4IA 1QZMA 3AOEC 5EXSA 2X49A 2ZANA 1NJGA 2Z4SA 3H4JA 5JI3E 2DI0A 1QVRA 4MGIE 4OX9M 1VQ1A 4PDGA 1PJQA 3SC3A 4LFCM 2DVWB 2K6BA 3RFWA 1ZAEA 1IY2A 1OKSA 1P3QQ 3VK7A 1WIVA 4NOOB 2Z8YM 3ZH9B 4AZFA 4NSOB 3MMPA 1ZQ9A 4DV3M 2LHGA 2Y0QA 4AI6A 3GLFB 1N75A 4LRSA 3SATA 3J2PB 4GITA 3DZDA 4G4RA 1R4GA 4RKUF 3KVWA 3IHPA 2V6ZM 4GC5A 3JR5A 1HT1E 4OVZB 2Z4RA 2L2DA 3U6PA 5KQDA 3UJNA 1WR1B 3EIEA 1TGUA 4B3SM 1V34A 2XGNA 1Q3BA 1TTEA 2DAIA 3C3DA 3HHYA 4AW4A 4CIZA 3HJQA 1XMOM 4AKGA 3VKGA 2FE8A 2L7IA 3B7NA 2H5XA 2FFJA 1SG9A 3VLFB 4AKIA 2QSFX 3FUTA 2DAGA 5LMNM 2F5PA 4Q7JA 1SXJB 2F4VM 2CRUA 5IZ7D 4D81A 1IXZA 4GMQA 4XBOA 3GLHB 4UN2B 5JI2E 3NWLA 3KOXE 1NY6A 5ITXA 1IXSB 1R6BX 4IBBA 3WHKA 2EKFA 4ZPXA 2KHHA 2ZBKB 5ITXE 3HU2A 2KRUA 4LJAA 3UZUA 2M60A 1QAMA 3J7BA 2R4EA 3K92A 4L16A 2C9OA 3MK6A 4LJ5A 4D80A 1K3WA 3L2AA 2EUCA 3CTWB 3E4RA 3U5ZA 4LJ4A 2LVNC 3B89A 3J81S 4BB9A 3J27B 2QENA 4IBJA 3KFUG 1GABA 3KSXA 1PJTA 4IBDA 2L09A 3MHVC 3U60A 3T1HM 2OO9A 2EA0A 2KNVA 4I81A 2X4AA 1XXHB 1QDRA 1I94M 3AFHA 2BWBA 1JR3A 1HNZM 2R4JA 2JA2A 4Y28F 1BVSA 5FTLA 1JR3E 3U61B 3T6PA 3CF0A 3FTEA 3IG8A 4A3VB 2R65A 4LJ9A 4YY3M 2UXDM 4QOSA 2JNHA 4LFAM 2FNAA 3FUXA 3SMPA 1CUKA 3TWMA 2MR9A 3EIHA 1N36M 4DR2M 2WSCF 1KFVA 2QQ8A 4DV0M 1IN4A 3GQ3A 4IJEA 5BPVA 1GL6A 3GRUA 5GKNA 2C5RA 3VKHA 1QYRA 1R2ZA 3PVSA 1I4WA 2HCBA 5DYGA 3ZCBB 4AQYM 3KOZE 1TH3A 3JAMS 2C98A 4GIPA 3FTCA 4KLNA 1FNNA 4G6ZA 3TE6A 5EXTA 1N34M 2D7HA 2L4EA 1HR0M 2HHHM 4JI8M 2ZM6M 1Z5AA 4G4OA 4DR1M 4AG5A 4JI5M 2Z7JA 5LMUM 4LY6A 4JI4M 4B3TM 2K0BX 1SXJA 4WP2A 4DV6M 4NL4H 3LVVA 3SBJA 1E94E 8CATA 2CUZA 3GQ5A 2UUBM 1E32A 3SASA 2BWEA 2LVOC 1N32M 3J7AS 5FTJA 1IN8A 2YFQA 4PDIA 3FYDA 2C9CA 2CE7A 5DNYA 1DGHB 5EQTA 3HX3A 3IECA 1QUTA 1RU3A 3GO8A 2X8AA 3OTOM 4PT5A 4XGIA 3HJSA 3CF6E 1MJGM 2N35A 2DAMA 4CJ6A 2VQFM 2UUCM 2W82A 1G8PA 1Z59A 4ANRA 2UXCM 1PJJA 5IREB 2XSZA 3W67A 2BNKA 1ZV1A 3FUUA 1NNJA 2QPAA 4KO8A 1WJ7A 4JI7M 1Q3CA 2WZJA 3U5ZB 1LV7A 2QNJA 1G59A 2A5YB 4DV7M 1WXQA 1OQYA 4B7FA 4R7GA 4M9SA 1OTRA 4W5WA 4GHAA 2R6FA 1XHBA 1Z6TA 2LXEA 4LZZA 3B74A 2JZ0A 4I4LA 2OPFA 3K1JA 2DWMA 7CATA 3CGWA 1NHGC 4QOZC 1HJPA 2LVQD 3B7QA 3KS8A 4Z8XA 2APLA 2BJWA 3HGIA 2L7HA 2LVPC 4LF6M 1OIZA 2DWNA 1L2BA 4IBIA 4L6V6 2DWLA 2JY7A 1TF0B 2EKKA 2L4FA 4MGYE 1IN5A 4DV5M 1UM8A 5FSWA 3A42A 4BBAA 2R46A 3HHXA 3GRRA 4REZA 3U6SA 2F5NA 1IBKM 1GKIA 1VEKA 2DENA 2WSEF 3Q8XA 5DYIA 5KPZA 4B3MM 2Y0TA 2NQ8C 1NHWC 3HHZA 2Y21A 3SAUA 4LF9M 3U6MA 3NBIA 4LJ7A 1N77A 2EO2A 3M0EA 1L1TA 2KW0A 2F5OA 1E9SA 2H1RA 2KNZA 1DGHA 3A46A 2DZLA 4G3OA 4ITQA 4LGMA 3UGJA 1HNWM 4MGZE 3TWKA 5C1BA 2DZNB 4RF1A 2KRKA 1TH4A 3SHGB 2OQ4A 5EP4A 1R5LA 3U6DA 4JN6A 3T15A 3W0FA 1QQWA 3VDPA 1GJSA 2LH0A 1DGBA 2JXNA 5EXXA 1QUSA 3I4VA 4G4NA 1IBLM 4JI0M 3QYBA 1IFYA 4NRVA 4WURA 4QHSA 3A98B 2BJVA 3DA1A 1OAOC 2QP9X 4IBFA 3W68A 3HWSA 4FWGA 4JI1M 4NRWA 1ORYB 3LCVB 4B08A 3GPUA 4MB7A 1NJFA 3LMMA 4M9XA 4CISA 2JY8A 2YQZA 2QBYA 4I8OA 2R18A 4DR5M 1V92A 2J7NA 4LGYA 4JYAM 4KT0F 1DO2A 1GLNA 2V1UA 4IJFA 2CWBA 2Z3XA 5E6JA 5EP3A 5FTMA 3SAWA 4JXJA 5KO3A 3ILKA 3GLGE 1HNXM 1J09A 5A2QS 3J80S 4GEWA 1K3XA 1VG5A 3K2LA 4QHTA 1IBMM 1OAIA 2V1CA 4K0KM 3L28A 2C96A 3THGA 1XNQM 2JZ1A 3H4MA 1R7RA 3KP0E 2L6OA 1PM5A 2CHVA 2XLJA 3E9SA 2OOAA 1GL7A 2XFTA 2XEPA 3E21A 2CV2A 2HKJA 5DFLA 2J7OA 1JR3D 2MROB 2UU9M 1T3TA 1D0LA 3I4YA 4MH0E 1YSYA 1GO5A 4OU7A 3GRYA 1XNRM 4LZJA 3FRIA 4OW0A 3SHFA 3WHLA 4IBCA 2CV1A 2LHCA 3SFZA 2I7NA 2KA6B 3AKZA 1IQPA 1LTMA 3HU3A 3VDUA 3GLIA 1QZEA 1NV9A 1C1KA 2HWJA 3KS4A 1L8QA 4F2LA 2P5TA 3SMSA 4M0WA 1A5TA 4HLQA 3GLIE 1L2DA 4IBKA 1SXJC 4L78A 4DUZM 2DHRA 2KDLA 2C99A 4NSRA 5KPRA 2G5GX 2K47A 4IIWA 4LF4M 1YLAA 3ZC7B 3U6LA 3KOYE 3VK8A 4X66M 3FD9A 4LFBM 4KHPM 4PCZA 1J7KA 3BXWA 3SYLA 5C18A 4B7GA 3FTFA 3KP1E 2KZSA 2HAKA 3RGSA 2XZUA 2Y20A 4EIWA 4S12A 3L25A 4LJ6A 3F92A 3FRHA 4AKHA 1AUAA 2QCUA 1DGGA 3I01M 4FWDA 1UFZA 2XH9A 3KOWE 5ITRA 1SXJD 2I7PA 4LRTA 1JQJC 2CHGA 3I51A 1NSFA 2LTUA 5ITUA 1DV0A 2CV0A 4R3DA 2UUAM 1MX0A 3PNYA 1Y8GA 3PNVA 2XZFA 3C58A 2QBYB 3HJ8A 4LF7M 2G3QA 2JUJA 1TR8A 3PXGA 4LG2A 5E26A 2F5SA 1VEGA 3LW5F 1NNUC 2RKOA 1IXRC 2VIIA 3UK6A 4DBGB 3AJIB 3GLGB 2VF8A 4TUWA 3B7ZA 2XSZD 1ZMWA 5KPTA 1YUBA 3VFDA 5BR8M 4M9ZA 2QHOB 1PGYA 3SARA 2GQFA 1Q39A 3FKEA 2Q2EB 3KSJA 3MJ5A 4FVMA 5EJCA 4NXMM 3AOEA 3LQQA 4DUYM 3CF2A 2KEBA 1C7YA 2CP8A 2VQEM 3FUVA 5FTKA 1ZMVA 2FH0A 2O5RA 3BBZA 4MGHA 4DR7M 3IG5A 3L27A 5ITTA 3DOAA 4CGYB 2JP7A 4L15A 2ERCA 4X62M 1YE9A 3FUWA 4AG6A 5L8RF 1G71A 1MN3A 3QAUA 2J5YA 2KZUA 1NV8A 1VEJA 2M5ZA 3TPZA 3NBXX 4B7HA 1J5EM 3SYKA 3U6QA 1OIPA 3K8ZA 4GC9A 2LWXA 4RNAA 3GLIB 2D7EA 2VF7A 4JI2M 4IBGA 4P17A 2RRUA 1XC8A 4GKKM 2ZTDA 3SAVA 4FCTA 5EP1A 2R0IA 1W5SA 4GKJM 3L29A 3KXEC 2FS1A 4KODA 2DAKA 1N78A 1IY1A 3GP1A 3HHWA 4JI6M 1OJLA 3RE8A 2DAEA 1W5TA 1NVMA 1AIPC 4II7A 3W0LB 5EXPA 2R62A 1WGNA 2CEAA 4X65M 3U6OA 2DHYA 2JY6B 1XWIA 2LBCA 3V76A 5IWAM 2DXIA 4G4QA 3C9PA 4LF5M 4R71A 2YNMD 4MM3B 3R8FA 2CFOA 2DKLA 3Q8GA 3TQSA 2VDBB 4LF8M 1OFHA 2RGHA 3FTDA 1IM2A 1R2YA 4P16A 3PFIA 4FCWA 3KDSE 2O25A 1G41A 1OFIA 3K9PA 3ZQJA 3GLGA 5ITYA 1HQCA 1QANA 4GHLA
chains in the Genus database with same CATH topology
4Z6YA 2YR0A 4GH9A 5IT9S 3GPXA 4JV5M 2XF3A 4M0DA 1E9RA 1HT2E 4FWHA 5H37D 2HL7A 2DWZB 4MGKE 3QWLA 1XMQM 1EE8A 2D7GA 2R45A 3M7GA 4DV4M 3T38A 1H6UA 1L1ZA 2UXBM 2ZAMA 4YHHM 2CHQA 4L8RC 4LCBA 3TWLA 1TDHA 3A45A 1MU5A 4B3RM 3HU1A 4X64M 4JI3M 1IN6A 1N33M 1HQYE 4LJ8A 3GLFA 1G4AE 1Z5BA 1FJGM 3AL0C 3LQRA 4FCVA 2G8LA 4NXNM 4DV1M 5F3WA 1S3SA 4DR6M 1NY5A 4OVZA 5FLXS 3DFZA 1DGFA 3RGPA 3GRVA 3JR4A 1PJIA 3LVWA 3L26A 2LNHC 3BOSA 4I5SA 5EP2A 3KW6A 2F5QA 1TDZA 1QAQA 1DO0A 1TH2A 2E5LM 1IN7A 4PD2A 2AHMA 3FYCA 1VDDA 3U6EA 4FD2A 3T1YM 3GLHA 4CHTB 1SXJE 3TL4X 1L2CA 3D8LA 3M6AA 4QNRA 4DR4M 4DV2M 2DZOB 1IY0A 2QZ4A 4RF0A 3GPYA 3AV0A 3GQ4A 1G3IA 2XFSA 1X37A 2FOIC 4BLCA 4IBEA 4QNMA 1K82A 3UMMA 4HL4A 3GPPA 4FW9A 1Z5CA 2RGOA 5ITQA 1KSFX 1KYIA 2KXEA 2ZAOA 1XXHA 3D8BA 5KQ8A 2C5RA 4DR3M 3U6CA 4L4UA 1D2NA 3HKPA 4D82A 5FTNA 3R9XB 4WW0A 3B9PA 3AOGA 3U60B 1QAOA 4GRIA 1GVNA 3U61A 1QZMA 3AOEC 5EXSA 2X49A 2ZANA 1NJGA 2Z4SA 5JI3E 1QVRA 4MGIE 4OX9M 4PDGA 3SC3A 4LFCM 2DVWB 3RFWA 1ZAEA 1IY2A 3VK7A 4NOOB 3ZH9B 4AZFA 4NSOB 1ZQ9A 4DV3M 2Y0QA 4AI6A 3GLFB 1N75A 4LRSA 3SATA 3J2PB 4GITA 3DZDA 4G4RA 3KVWA 2V6ZM 4GC5A 3JR5A 1HT1E 4OVZB 2Z4RA 3U6PA 5KQDA 3UJNA 3EIEA 4B3SM 1TGUA 2XGNA 1Q3BA 3HHYA 4AW4A 3VKGA 4AKGA 1XMOM 3HJQA 2FE8A 2L7IA 2FFJA 3VLFB 4AKIA 3FUTA 5LMNM 2F5PA 2F4VM 1SXJB 5IZ7D 4D81A 1IXZA 4GMQA 4XBOA 3GLHB 5JI2E 3NWLA 3KOXE 1NY6A 5ITXA 1IXSB 1R6BX 4IBBA 3WHKA 4ZPXA 2ZBKB 5ITXE 3HU2A 2KRUA 4LJAA 3UZUA 2M60A 1QAMA 3J7BA 2R4EA 3K92A 4L16A 2C9OA 3MK6A 4LJ5A 4D80A 1K3WA 3L2AA 2EUCA 3CTWB 3E4RA 3U5ZA 4LJ4A 3J81S 4BB9A 3J27B 2QENA 4IBJA 3KFUG 3KSXA 4IBDA 2L09A 3MHVC 3U60A 3T1HM 2EA0A 4I81A 2X4AA 1XXHB 1I94M 3AFHA 1JR3A 1HNZM 2R4JA 2JA2A 5FTLA 3U61B 3CF0A 3FTEA 3IG8A 4A3VB 2R65A 4LJ9A 4YY3M 2UXDM 4QOSA 4LFAM 2FNAA 3FUXA 3SMPA 3TWMA 3EIHA 1N36M 4DR2M 1KFVA 4DV0M 1IN4A 3GQ3A 4IJEA 5BPVA 1GL6A 3GRUA 5GKNA 3VKHA 1QYRA 1R2ZA 3PVSA 1I4WA 2HCBA 5DYGA 3ZCBB 4AQYM 3KOZE 1TH3A 3JAMS 2C98A 4GIPA 3FTCA 4KLNA 1FNNA 4G6ZA 3TE6A 5EXTA 1N34M 2D7HA 1HR0M 2HHHM 4JI8M 2ZM6M 1Z5AA 4G4OA 4DR1M 4AG5A 4JI5M 2Z7JA 5LMUM 4LY6A 4JI4M 4B3TM 1SXJA 4DV6M 4NL4H 3LVVA 3SBJA 1E94E 8CATA 2CUZA 3GQ5A 2UUBM 1E32A 3SASA 1N32M 3J7AS 5FTJA 1IN8A 2YFQA 4PDIA 3FYDA 2C9CA 2CE7A 5DNYA 1DGHB 5EQTA 3GO8A 2X8AA 3OTOM 4PT5A 4XGIA 3HJSA 3CF6E 2VQFM 2UUCM 2W82A 1G8PA 1Z59A 2UXCM 1PJJA 5IREB 2XSZA 2BNKA 3FUUA 1NNJA 2QPAA 4KO8A 4JI7M 1Q3CA 3U5ZB 1LV7A 1G59A 2A5YB 4DV7M 1WXQA 4B7FA 4R7GA 4M9SA 4W5WA 4GHAA 1XHBA 1Z6TA 2LXEA 4LZZA 4I4LA 2OPFA 3K1JA 2DWMA 7CATA 1NHGC 4QOZC 3KS8A 4Z8XA 3HGIA 2BJWA 2L7HA 4LF6M 2DWNA 1L2BA 4IBIA 2DWLA 4MGYE 1IN5A 4DV5M 1UM8A 5FSWA 3A42A 4BBAA 2R46A 3HHXA 3GRRA 4REZA 3U6SA 2F5NA 1IBKM 1GKIA 5KPZA 4B3MM 3Q8XA 5DYIA 2Y0TA 2NQ8C 1NHWC 3HHZA 2Y21A 3SAUA 4LF9M 3U6MA 3NBIA 4LJ7A 1N77A 2EO2A 3M0EA 1L1TA 2KW0A 2F5OA 1E9SA 2H1RA 1DGHA 3A46A 4ITQA 4LGMA 3UGJA 1HNWM 4MGZE 3TWKA 5C1BA 2DZNB 4RF1A 2KRKA 1TH4A 3SHGB 2OQ4A 5EP4A 3U6DA 4JN6A 3T15A 3W0FA 1QQWA 3VDPA 2LH0A 1DGBA 5EXXA 3I4VA 4G4NA 1IBLM 4JI0M 4NRVA 4WURA 4QHSA 3A98B 2BJVA 3DA1A 2QP9X 4IBFA 3HWSA 4FWGA 4JI1M 4NRWA 1ORYB 4B08A 3GPUA 4MB7A 1NJFA 3LMMA 4M9XA 4CISA 2YQZA 2QBYA 4I8OA 2R18A 4DR5M 2J7NA 4LGYA 4JYAM 1DO2A 1GLNA 2V1UA 4IJFA 2Z3XA 5E6JA 5EP3A 5FTMA 3SAWA 4JXJA 5KO3A 3ILKA 1HNXM 1J09A 5A2QS 3J80S 1K3XA 3K2LA 4QHTA 1IBMM 2V1CA 4K0KM 3L28A 2C96A 3THGA 1XNQM 3H4MA 1R7RA 3KP0E 2L6OA 1PM5A 2CHVA 2XLJA 3E9SA 1GL7A 2XFTA 2XEPA 2CV2A 2HKJA 2J7OA 1JR3D 2UU9M 1T3TA 4MH0E 3I4YA 1YSYA 4OU7A 3GRYA 1XNRM 4LZJA 4OW0A 3SHFA 3WHLA 4IBCA 2CV1A 3SFZA 2I7NA 2KA6B 3AKZA 3HU3A 1IQPA 3VDUA 3GLIA 1C1KA 3KS4A 1L8QA 1L2DA 2P5TA 3SMSA 4M0WA 4HLQA 4IBKA 1SXJC 4L78A 4DUZM 2DHRA 5KPRA 2C99A 4NSRA 4LF4M 2G5GX 2K47A 4IIWA 3ZC7B 3U6LA 3KOYE 3VK8A 4X66M 3FD9A 4LFBM 4KHPM 4PCZA 1J7KA 3SYLA 5C18A 4B7GA 3FTFA 3KP1E 2KZSA 3RGSA 2XZUA 2Y20A 4EIWA 4S12A 3L25A 4LJ6A 4AKHA 2QCUA 1DGGA 4FWDA 2XH9A 3KOWE 5ITRA 1SXJD 2I7PA 4LRTA 1JQJC 2CHGA 3I51A 1NSFA 5ITUA 2CV0A 4R3DA 2UUAM 1MX0A 3PNYA 3PNVA 2XZFA 3C58A 2QBYB 3HJ8A 4LF7M 4LG2A 3PXGA 5E26A 2F5SA 1NNUC 2RKOA 1IXRC 2VIIA 3UK6A 3AJIB 3GLGB 4TUWA 2XSZD 5KPTA 1YUBA 3VFDA 5BR8M 4M9ZA 3SARA 4FVMA 1Q39A 3FKEA 2Q2EB 3KSJA 3MJ5A 5EJCA 4NXMM 3AOEA 3LQQA 4DUYM 3CF2A 2KEBA 2VQEM 3FUVA 5FTKA 2O5RA 4MGHA 4DR7M 3IG5A 3L27A 5ITTA 3DOAA 4CGYB 4L15A 2ERCA 4X62M 1YE9A 3FUWA 4AG6A 3QAUA 3TPZA 2KZUA 2M5ZA 4B7HA 1J5EM 3SYKA 3U6QA 3K8ZA 4GC9A 2LWXA 4RNAA 3GLIB 2D7EA 4JI2M 4IBGA 1XC8A 4GKKM 3SAVA 4FCTA 5EP1A 1W5SA 4GKJM 3L29A 3KXEC 4KODA 1N78A 1IY1A 3GP1A 3HHWA 4JI6M 1OJLA 3RE8A 1W5TA 1NVMA 4II7A 3W0LB 5EXPA 2R62A 2CEAA 4X65M 3U6OA 1XWIA 5IWAM 2DXIA 4G4QA 4LF5M 2YNMD 4MM3B 3R8FA 2CFOA 3TQSA 4LF8M 1OFHA 2RGHA 3FTDA 1IM2A 1R2YA 4P16A 3PFIA 4FCWA 3KDSE 1G41A 1OFIA 3GLGA 5ITYA 1HQCA 1QANA 4GHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOY E;  3KP1 E;  3KOW E;  3KOZ E;  3KOX E;  3KP0 E; 
#chains in the Genus database with same CATH topology
 4F1I A;  4Z6Y A;  2MJ5 B;  2YR0 A;  4GH9 A;  5IT9 S;  3GPX A;  4JV5 M;  2XF3 A;  4M0D A;  1E9R A;  3HZJ A;  3I04 M;  1HT2 E;  4FWH A;  5H37 D;  2HL7 A;  2DWZ B;  3E46 A;  4MGK E;  3QWL A;  1EFU B;  1XMQ M;  1EE8 A;  2D7G A;  2R45 A;  3M7G A;  4DV4 M;  3HY5 A;  2K9D A;  1WHC A;  3T38 A;  1H6U A;  1GJT A;  1VDL A;  1L1Z A;  2UXB M;  2ZAM A;  4YHH M;  2CHQ A;  4XK8 F;  4L8R C;  1D0K A;  4LCB A;  1TDH A;  3TWL A;  3A45 A;  1MU5 A;  4B3R M;  3C3E A;  3HU1 A;  4X64 M;  4JI3 M;  2KNA A;  1IN6 A;  1Q02 A;  1N33 M;  1HQY E;  4LJ8 A;  3GLF A;  1G4A E;  1Z5B A;  1FJG M;  3AL0 C;  3LQR A;  4FCV A;  1D0M A;  2G8L A;  4NXN M;  3GLF E;  4DV1 M;  5F3W A;  1S3S A;  4DR6 M;  1NY5 A;  4OVZ A;  5FLX S;  3DFZ A;  1DGF A;  1PJS A;  3GRV A;  3RGP A;  2JY5 A;  3LVW A;  3JR4 A;  1QDT A;  3L26 A;  1PJI A;  4NC6 A;  2LNH C;  1NO1 A;  3BOS A;  4I5S A;  5EP2 A;  2LVA A;  1XB2 B;  3KW6 A;  2F5Q A;  1TDZ A;  2OOB A;  1QAQ A;  1DO0 A;  1TH2 A;  2O01 F;  2E5L M;  1IN7 A;  4PD2 A;  2AHM A;  2MH8 A;  3FYC A;  1VDD A;  1T43 A;  2MGW A;  3U6E A;  4FD2 A;  3T1Y M;  3GLH A;  4CHT B;  1SXJ E;  3TL4 X;  2DNA A;  3D8L A;  3M6A A;  1V33 A;  3GLH E;  4HEO A;  1IXS A;  4QNR A;  1L2C A;  3K9O A;  4DV2 M;  4DR4 M;  2DZO B;  2B3T A;  1IY0 A;  1JB0 F;  2QZ4 A;  4RF0 A;  3GPY A;  3AV0 A;  3LCU A;  3GQ4 A;  1G3I A;  3FE3 A;  2XFS A;  1EIJ A;  1X37 A;  2FOI C;  4BLC A;  4IBE A;  4QNM A;  1K82 A;  1ZMU A;  3UMM A;  4HL4 A;  3QYE A;  3GPP A;  4FW9 A;  2JWS A;  1Z5C A;  2RGO A;  5ITQ A;  1T6O A;  2GNO A;  1KSF X;  2WSF F;  1KYI A;  1PRB A;  1WGL A;  2KXE A;  1XXH A;  2ZAO A;  3D8B A;  2R44 A;  5KQ8 A;  4DR3 M;  4L4U A;  3U6C A;  1D2N A;  3HKP A;  4D82 A;  2ZTC A;  5FTN A;  1XXH E;  3R9X B;  4WW0 A;  3B9P A;  3AOG A;  3U60 B;  1QAO A;  2EJS A;  1GVN A;  4GRI A;  3U61 A;  1F4I A;  1QZM A;  3AOE C;  5EXS A;  2X49 A;  2ZAN A;  1NJG A;  2Z4S A;  3H4J A;  5JI3 E;  2DI0 A;  1QVR A;  4MGI E;  4OX9 M;  1VQ1 A;  4PDG A;  1PJQ A;  3SC3 A;  4LFC M;  2DVW B;  2K6B A;  3RFW A;  1ZAE A;  1IY2 A;  1OKS A;  1P3Q Q;  3VK7 A;  1WIV A;  4NOO B;  2Z8Y M;  3ZH9 B;  4AZF A;  4NSO B;  3MMP A;  1ZQ9 A;  4DV3 M;  2LHG A;  2Y0Q A;  4AI6 A;  3GLF B;  1N75 A;  4LRS A;  3SAT A;  3J2P B;  4GIT A;  3DZD A;  4G4R A;  1R4G A;  4RKU F;  3KVW A;  3IHP A;  2V6Z M;  4GC5 A;  3JR5 A;  1HT1 E;  4OVZ B;  2Z4R A;  2L2D A;  3U6P A;  5KQD A;  3UJN A;  1WR1 B;  3EIE A;  1TGU A;  4B3S M;  1V34 A;  2XGN A;  1Q3B A;  1TTE A;  2DAI A;  3C3D A;  3HHY A;  4AW4 A;  4CIZ A;  3HJQ A;  1XMO M;  4AKG A;  3VKG A;  2FE8 A;  2L7I A;  3B7N A;  2H5X A;  2FFJ A;  1SG9 A;  3VLF B;  4AKI A;  2QSF X;  3FUT A;  2DAG A;  5LMN M;  2F5P A;  4Q7J A;  1SXJ B;  2F4V M;  2CRU A;  5IZ7 D;  4D81 A;  1IXZ A;  4GMQ A;  4XBO A;  3GLH B;  4UN2 B;  5JI2 E;  3NWL A;  3KOX E;  1NY6 A;  5ITX A;  1IXS B;  1R6B X;  4IBB A;  3WHK A;  2EKF A;  4ZPX A;  2KHH A;  2ZBK B;  5ITX E;  3HU2 A;  2KRU A;  4LJA A;  3UZU A;  2M60 A;  1QAM A;  3J7B A;  2R4E A;  3K92 A;  4L16 A;  2C9O A;  3MK6 A;  4LJ5 A;  4D80 A;  1K3W A;  3L2A A;  2EUC A;  3CTW B;  3E4R A;  3U5Z A;  4LJ4 A;  2LVN C;  3B89 A;  3J81 S;  4BB9 A;  3J27 B;  2QEN A;  4IBJ A;  3KFU G;  1GAB A;  3KSX A;  1PJT A;  4IBD A;  2L09 A;  3MHV C;  3U60 A;  3T1H M;  2OO9 A;  2EA0 A;  2KNV A;  4I81 A;  2X4A A;  1XXH B;  1QDR A;  1I94 M;  3AFH A;  2BWB A;  1JR3 A;  1HNZ M;  2R4J A;  2JA2 A;  4Y28 F;  1BVS A;  5FTL A;  1JR3 E;  3U61 B;  3T6P A;  3CF0 A;  3FTE A;  3IG8 A;  4A3V B;  2R65 A;  4LJ9 A;  4YY3 M;  2UXD M;  4QOS A;  2JNH A;  4LFA M;  2FNA A;  3FUX A;  3SMP A;  1CUK A;  3TWM A;  2MR9 A;  3EIH A;  1N36 M;  4DR2 M;  2WSC F;  1KFV A;  2QQ8 A;  4DV0 M;  1IN4 A;  3GQ3 A;  4IJE A;  5BPV A;  1GL6 A;  3GRU A;  5GKN A;  2C5R A;  3VKH A;  1QYR A;  1R2Z A;  3PVS A;  1I4W A;  2HCB A;  5DYG A;  3ZCB B;  4AQY M;  3KOZ E;  1TH3 A;  3JAM S;  2C98 A;  4GIP A;  3FTC A;  4KLN A;  1FNN A;  4G6Z A;  3TE6 A;  5EXT A;  1N34 M;  2D7H A;  2L4E A;  1HR0 M;  2HHH M;  4JI8 M;  2ZM6 M;  1Z5A A;  4G4O A;  4DR1 M;  4AG5 A;  4JI5 M;  2Z7J A;  5LMU M;  4LY6 A;  4JI4 M;  4B3T M;  2K0B X;  1SXJ A;  4WP2 A;  4DV6 M;  4NL4 H;  3LVV A;  3SBJ A;  1E94 E;  8CAT A;  2CUZ A;  3GQ5 A;  2UUB M;  1E32 A;  3SAS A;  2BWE A;  2LVO C;  1N32 M;  3J7A S;  5FTJ A;  1IN8 A;  2YFQ A;  4PDI A;  3FYD A;  2C9C A;  2CE7 A;  5DNY A;  1DGH B;  5EQT A;  3HX3 A;  3IEC A;  1QUT A;  1RU3 A;  3GO8 A;  2X8A A;  3OTO M;  4PT5 A;  4XGI A;  3HJS A;  3CF6 E;  1MJG M;  2N35 A;  2DAM A;  4CJ6 A;  2VQF M;  2UUC M;  2W82 A;  1G8P A;  1Z59 A;  4ANR A;  2UXC M;  1PJJ A;  5IRE B;  2XSZ A;  3W67 A;  2BNK A;  1ZV1 A;  3FUU A;  1NNJ A;  2QPA A;  4KO8 A;  1WJ7 A;  4JI7 M;  1Q3C A;  2WZJ A;  3U5Z B;  1LV7 A;  2QNJ A;  1G59 A;  2A5Y B;  4DV7 M;  1WXQ A;  1OQY A;  4B7F A;  4R7G A;  4M9S A;  1OTR A;  4W5W A;  4GHA A;  2R6F A;  1XHB A;  1Z6T A;  2LXE A;  4LZZ A;  3B74 A;  2JZ0 A;  4I4L A;  2OPF A;  3K1J A;  2DWM A;  7CAT A;  3CGW A;  1NHG C;  4QOZ C;  1HJP A;  2LVQ D;  3B7Q A;  3KS8 A;  4Z8X A;  2APL A;  2BJW A;  3HGI A;  2L7H A;  2LVP C;  4LF6 M;  1OIZ A;  2DWN A;  1L2B A;  4IBI A;  4L6V 6;  2DWL A;  2JY7 A;  1TF0 B;  2EKK A;  2L4F A;  4MGY E;  1IN5 A;  4DV5 M;  1UM8 A;  5FSW A;  3A42 A;  4BBA A;  2R46 A;  3HHX A;  3GRR A;  4REZ A;  3U6S A;  2F5N A;  1IBK M;  1GKI A;  1VEK A;  2DEN A;  2WSE F;  3Q8X A;  5DYI A;  5KPZ A;  4B3M M;  2Y0T A;  2NQ8 C;  1NHW C;  3HHZ A;  2Y21 A;  3SAU A;  4LF9 M;  3U6M A;  3NBI A;  4LJ7 A;  1N77 A;  2EO2 A;  3M0E A;  1L1T A;  2KW0 A;  2F5O A;  1E9S A;  2H1R A;  2KNZ A;  1DGH A;  3A46 A;  2DZL A;  4G3O A;  4ITQ A;  4LGM A;  3UGJ A;  1HNW M;  4MGZ E;  3TWK A;  5C1B A;  2DZN B;  4RF1 A;  2KRK A;  1TH4 A;  3SHG B;  2OQ4 A;  5EP4 A;  1R5L A;  3U6D A;  4JN6 A;  3T15 A;  3W0F A;  1QQW A;  3VDP A;  1GJS A;  2LH0 A;  1DGB A;  2JXN A;  5EXX A;  1QUS A;  3I4V A;  4G4N A;  1IBL M;  4JI0 M;  3QYB A;  1IFY A;  4NRV A;  4WUR A;  4QHS A;  3A98 B;  2BJV A;  3DA1 A;  1OAO C;  2QP9 X;  4IBF A;  3W68 A;  3HWS A;  4FWG A;  4JI1 M;  4NRW A;  1ORY B;  3LCV B;  4B08 A;  3GPU A;  4MB7 A;  1NJF A;  3LMM A;  4M9X A;  4CIS A;  2JY8 A;  2YQZ A;  2QBY A;  4I8O A;  2R18 A;  4DR5 M;  1V92 A;  2J7N A;  4LGY A;  4JYA M;  4KT0 F;  1DO2 A;  1GLN A;  2V1U A;  4IJF A;  2CWB A;  2Z3X A;  5E6J A;  5EP3 A;  5FTM A;  3SAW A;  4JXJ A;  5KO3 A;  3ILK A;  3GLG E;  1HNX M;  1J09 A;  5A2Q S;  3J80 S;  4GEW A;  1K3X A;  1VG5 A;  3K2L A;  4QHT A;  1IBM M;  1OAI A;  2V1C A;  4K0K M;  3L28 A;  2C96 A;  3THG A;  1XNQ M;  2JZ1 A;  3H4M A;  1R7R A;  3KP0 E;  2L6O A;  1PM5 A;  2CHV A;  2XLJ A;  3E9S A;  2OOA A;  1GL7 A;  2XFT A;  2XEP A;  3E21 A;  2CV2 A;  2HKJ A;  5DFL A;  2J7O A;  1JR3 D;  2MRO B;  2UU9 M;  1T3T A;  1D0L A;  3I4Y A;  4MH0 E;  1YSY A;  1GO5 A;  4OU7 A;  3GRY A;  1XNR M;  4LZJ A;  3FRI A;  4OW0 A;  3SHF A;  3WHL A;  4IBC A;  2CV1 A;  2LHC A;  3SFZ A;  2I7N A;  2KA6 B;  3AKZ A;  1IQP A;  1LTM A;  3HU3 A;  3VDU A;  3GLI A;  1QZE A;  1NV9 A;  1C1K A;  2HWJ A;  3KS4 A;  1L8Q A;  4F2L A;  2P5T A;  3SMS A;  4M0W A;  1A5T A;  4HLQ A;  3GLI E;  1L2D A;  4IBK A;  1SXJ C;  4L78 A;  4DUZ M;  2DHR A;  2KDL A;  2C99 A;  4NSR A;  5KPR A;  2G5G X;  2K47 A;  4IIW A;  4LF4 M;  1YLA A;  3ZC7 B;  3U6L A;  3KOY E;  3VK8 A;  4X66 M;  3FD9 A;  4LFB M;  4KHP M;  4PCZ A;  1J7K A;  3BXW A;  3SYL A;  5C18 A;  4B7G A;  3FTF A;  3KP1 E;  2KZS A;  2HAK A;  3RGS A;  2XZU A;  2Y20 A;  4EIW A;  4S12 A;  3L25 A;  4LJ6 A;  3F92 A;  3FRH A;  4AKH A;  1AUA A;  2QCU A;  1DGG A;  3I01 M;  4FWD A;  1UFZ A;  2XH9 A;  3KOW E;  5ITR A;  1SXJ D;  2I7P A;  4LRT A;  1JQJ C;  2CHG A;  3I51 A;  1NSF A;  2LTU A;  5ITU A;  1DV0 A;  2CV0 A;  4R3D A;  2UUA M;  1MX0 A;  3PNY A;  1Y8G A;  3PNV A;  2XZF A;  3C58 A;  2QBY B;  3HJ8 A;  4LF7 M;  2G3Q A;  2JUJ A;  1TR8 A;  3PXG A;  4LG2 A;  5E26 A;  2F5S A;  1VEG A;  3LW5 F;  1NNU C;  2RKO A;  1IXR C;  2VII A;  3UK6 A;  4DBG B;  3AJI B;  3GLG B;  2VF8 A;  4TUW A;  3B7Z A;  2XSZ D;  1ZMW A;  5KPT A;  1YUB A;  3VFD A;  5BR8 M;  4M9Z A;  2QHO B;  1PGY A;  3SAR A;  2GQF A;  1Q39 A;  3FKE A;  2Q2E B;  3KSJ A;  3MJ5 A;  4FVM A;  5EJC A;  4NXM M;  3AOE A;  3LQQ A;  4DUY M;  3CF2 A;  2KEB A;  1C7Y A;  2CP8 A;  2VQE M;  3FUV A;  5FTK A;  1ZMV A;  2FH0 A;  2O5R A;  3BBZ A;  4MGH A;  4DR7 M;  3IG5 A;  3L27 A;  5ITT A;  3DOA A;  4CGY B;  2JP7 A;  4L15 A;  2ERC A;  4X62 M;  1YE9 A;  3FUW A;  4AG6 A;  5L8R F;  1G71 A;  1MN3 A;  3QAU A;  2J5Y A;  2KZU A;  1NV8 A;  1VEJ A;  2M5Z A;  3TPZ A;  3NBX X;  4B7H A;  1J5E M;  3SYK A;  3U6Q A;  1OIP A;  3K8Z A;  4GC9 A;  2LWX A;  4RNA A;  3GLI B;  2D7E A;  2VF7 A;  4JI2 M;  4IBG A;  4P17 A;  2RRU A;  1XC8 A;  4GKK M;  2ZTD A;  3SAV A;  4FCT A;  5EP1 A;  2R0I A;  1W5S A;  4GKJ M;  3L29 A;  3KXE C;  2FS1 A;  4KOD A;  2DAK A;  1N78 A;  1IY1 A;  3GP1 A;  3HHW A;  4JI6 M;  1OJL A;  3RE8 A;  2DAE A;  1W5T A;  1NVM A;  1AIP C;  4II7 A;  3W0L B;  5EXP A;  2R62 A;  1WGN A;  2CEA A;  4X65 M;  3U6O A;  2DHY A;  2JY6 B;  1XWI A;  2LBC A;  3V76 A;  5IWA M;  2DXI A;  4G4Q A;  3C9P A;  4LF5 M;  4R71 A;  2YNM D;  4MM3 B;  3R8F A;  2CFO A;  2DKL A;  3Q8G A;  3TQS A;  2VDB B;  4LF8 M;  1OFH A;  2RGH A;  3FTD A;  1IM2 A;  1R2Y A;  4P16 A;  3PFI A;  4FCW A;  3KDS E;  2O25 A;  1G41 A;  1OFI A;  3K9P A;  3ZQJ A;  3GLG A;  5ITY A;  1HQC A;  1QAN A;  4GHL A; 
#chains in the Genus database with same CATH homology
 4Z6Y A;  2YR0 A;  4GH9 A;  5IT9 S;  3GPX A;  4JV5 M;  2XF3 A;  4M0D A;  1E9R A;  1HT2 E;  4FWH A;  5H37 D;  2HL7 A;  2DWZ B;  4MGK E;  3QWL A;  1XMQ M;  1EE8 A;  2D7G A;  2R45 A;  3M7G A;  4DV4 M;  3T38 A;  1H6U A;  1L1Z A;  2UXB M;  2ZAM A;  4YHH M;  2CHQ A;  4L8R C;  4LCB A;  3TWL A;  1TDH A;  3A45 A;  1MU5 A;  4B3R M;  3HU1 A;  4X64 M;  4JI3 M;  1IN6 A;  1N33 M;  1HQY E;  4LJ8 A;  3GLF A;  1G4A E;  1Z5B A;  1FJG M;  3AL0 C;  3LQR A;  4FCV A;  2G8L A;  4NXN M;  4DV1 M;  5F3W A;  1S3S A;  4DR6 M;  1NY5 A;  4OVZ A;  5FLX S;  3DFZ A;  1DGF A;  3RGP A;  3GRV A;  3JR4 A;  1PJI A;  3LVW A;  3L26 A;  2LNH C;  3BOS A;  4I5S A;  5EP2 A;  3KW6 A;  2F5Q A;  1TDZ A;  1QAQ A;  1DO0 A;  1TH2 A;  2E5L M;  1IN7 A;  4PD2 A;  2AHM A;  3FYC A;  1VDD A;  3U6E A;  4FD2 A;  3T1Y M;  3GLH A;  4CHT B;  1SXJ E;  3TL4 X;  1L2C A;  3D8L A;  3M6A A;  4QNR A;  4DR4 M;  4DV2 M;  2DZO B;  1IY0 A;  2QZ4 A;  4RF0 A;  3GPY A;  3AV0 A;  3GQ4 A;  1G3I A;  2XFS A;  1X37 A;  2FOI C;  4BLC A;  4IBE A;  4QNM A;  1K82 A;  3UMM A;  4HL4 A;  3GPP A;  4FW9 A;  1Z5C A;  2RGO A;  5ITQ A;  1KSF X;  1KYI A;  2KXE A;  2ZAO A;  1XXH A;  3D8B A;  5KQ8 A;  2C5R A;  4DR3 M;  3U6C A;  4L4U A;  1D2N A;  3HKP A;  4D82 A;  5FTN A;  3R9X B;  4WW0 A;  3B9P A;  3AOG A;  3U60 B;  1QAO A;  4GRI A;  1GVN A;  3U61 A;  1QZM A;  3AOE C;  5EXS A;  2X49 A;  2ZAN A;  1NJG A;  2Z4S A;  5JI3 E;  1QVR A;  4MGI E;  4OX9 M;  4PDG A;  3SC3 A;  4LFC M;  2DVW B;  3RFW A;  1ZAE A;  1IY2 A;  3VK7 A;  4NOO B;  3ZH9 B;  4AZF A;  4NSO B;  1ZQ9 A;  4DV3 M;  2Y0Q A;  4AI6 A;  3GLF B;  1N75 A;  4LRS A;  3SAT A;  3J2P B;  4GIT A;  3DZD A;  4G4R A;  3KVW A;  2V6Z M;  4GC5 A;  3JR5 A;  1HT1 E;  4OVZ B;  2Z4R A;  3U6P A;  5KQD A;  3UJN A;  3EIE A;  4B3S M;  1TGU A;  2XGN A;  1Q3B A;  3HHY A;  4AW4 A;  3VKG A;  4AKG A;  1XMO M;  3HJQ A;  2FE8 A;  2L7I A;  2FFJ A;  3VLF B;  4AKI A;  3FUT A;  5LMN M;  2F5P A;  2F4V M;  1SXJ B;  5IZ7 D;  4D81 A;  1IXZ A;  4GMQ A;  4XBO A;  3GLH B;  5JI2 E;  3NWL A;  3KOX E;  1NY6 A;  5ITX A;  1IXS B;  1R6B X;  4IBB A;  3WHK A;  4ZPX A;  2ZBK B;  5ITX E;  3HU2 A;  2KRU A;  4LJA A;  3UZU A;  2M60 A;  1QAM A;  3J7B A;  2R4E A;  3K92 A;  4L16 A;  2C9O A;  3MK6 A;  4LJ5 A;  4D80 A;  1K3W A;  3L2A A;  2EUC A;  3CTW B;  3E4R A;  3U5Z A;  4LJ4 A;  3J81 S;  4BB9 A;  3J27 B;  2QEN A;  4IBJ A;  3KFU G;  3KSX A;  4IBD A;  2L09 A;  3MHV C;  3U60 A;  3T1H M;  2EA0 A;  4I81 A;  2X4A A;  1XXH B;  1I94 M;  3AFH A;  1JR3 A;  1HNZ M;  2R4J A;  2JA2 A;  5FTL A;  3U61 B;  3CF0 A;  3FTE A;  3IG8 A;  4A3V B;  2R65 A;  4LJ9 A;  4YY3 M;  2UXD M;  4QOS A;  4LFA M;  2FNA A;  3FUX A;  3SMP A;  3TWM A;  3EIH A;  1N36 M;  4DR2 M;  1KFV A;  4DV0 M;  1IN4 A;  3GQ3 A;  4IJE A;  5BPV A;  1GL6 A;  3GRU A;  5GKN A;  3VKH A;  1QYR A;  1R2Z A;  3PVS A;  1I4W A;  2HCB A;  5DYG A;  3ZCB B;  4AQY M;  3KOZ E;  1TH3 A;  3JAM S;  2C98 A;  4GIP A;  3FTC A;  4KLN A;  1FNN A;  4G6Z A;  3TE6 A;  5EXT A;  1N34 M;  2D7H A;  1HR0 M;  2HHH M;  4JI8 M;  2ZM6 M;  1Z5A A;  4G4O A;  4DR1 M;  4AG5 A;  4JI5 M;  2Z7J A;  5LMU M;  4LY6 A;  4JI4 M;  4B3T M;  1SXJ A;  4DV6 M;  4NL4 H;  3LVV A;  3SBJ A;  1E94 E;  8CAT A;  2CUZ A;  3GQ5 A;  2UUB M;  1E32 A;  3SAS A;  1N32 M;  3J7A S;  5FTJ A;  1IN8 A;  2YFQ A;  4PDI A;  3FYD A;  2C9C A;  2CE7 A;  5DNY A;  1DGH B;  5EQT A;  3GO8 A;  2X8A A;  3OTO M;  4PT5 A;  4XGI A;  3HJS A;  3CF6 E;  2VQF M;  2UUC M;  2W82 A;  1G8P A;  1Z59 A;  2UXC M;  1PJJ A;  5IRE B;  2XSZ A;  2BNK A;  3FUU A;  1NNJ A;  2QPA A;  4KO8 A;  4JI7 M;  1Q3C A;  3U5Z B;  1LV7 A;  1G59 A;  2A5Y B;  4DV7 M;  1WXQ A;  4B7F A;  4R7G A;  4M9S A;  4W5W A;  4GHA A;  1XHB A;  1Z6T A;  2LXE A;  4LZZ A;  4I4L A;  2OPF A;  3K1J A;  2DWM A;  7CAT A;  1NHG C;  4QOZ C;  3KS8 A;  4Z8X A;  3HGI A;  2BJW A;  2L7H A;  4LF6 M;  2DWN A;  1L2B A;  4IBI A;  2DWL A;  4MGY E;  1IN5 A;  4DV5 M;  1UM8 A;  5FSW A;  3A42 A;  4BBA A;  2R46 A;  3HHX A;  3GRR A;  4REZ A;  3U6S A;  2F5N A;  1IBK M;  1GKI A;  5KPZ A;  4B3M M;  3Q8X A;  5DYI A;  2Y0T A;  2NQ8 C;  1NHW C;  3HHZ A;  2Y21 A;  3SAU A;  4LF9 M;  3U6M A;  3NBI A;  4LJ7 A;  1N77 A;  2EO2 A;  3M0E A;  1L1T A;  2KW0 A;  2F5O A;  1E9S A;  2H1R A;  1DGH A;  3A46 A;  4ITQ A;  4LGM A;  3UGJ A;  1HNW M;  4MGZ E;  3TWK A;  5C1B A;  2DZN B;  4RF1 A;  2KRK A;  1TH4 A;  3SHG B;  2OQ4 A;  5EP4 A;  3U6D A;  4JN6 A;  3T15 A;  3W0F A;  1QQW A;  3VDP A;  2LH0 A;  1DGB A;  5EXX A;  3I4V A;  4G4N A;  1IBL M;  4JI0 M;  4NRV A;  4WUR A;  4QHS A;  3A98 B;  2BJV A;  3DA1 A;  2QP9 X;  4IBF A;  3HWS A;  4FWG A;  4JI1 M;  4NRW A;  1ORY B;  4B08 A;  3GPU A;  4MB7 A;  1NJF A;  3LMM A;  4M9X A;  4CIS A;  2YQZ A;  2QBY A;  4I8O A;  2R18 A;  4DR5 M;  2J7N A;  4LGY A;  4JYA M;  1DO2 A;  1GLN A;  2V1U A;  4IJF A;  2Z3X A;  5E6J A;  5EP3 A;  5FTM A;  3SAW A;  4JXJ A;  5KO3 A;  3ILK A;  1HNX M;  1J09 A;  5A2Q S;  3J80 S;  1K3X A;  3K2L A;  4QHT A;  1IBM M;  2V1C A;  4K0K M;  3L28 A;  2C96 A;  3THG A;  1XNQ M;  3H4M A;  1R7R A;  3KP0 E;  2L6O A;  1PM5 A;  2CHV A;  2XLJ A;  3E9S A;  1GL7 A;  2XFT A;  2XEP A;  2CV2 A;  2HKJ A;  2J7O A;  1JR3 D;  2UU9 M;  1T3T A;  4MH0 E;  3I4Y A;  1YSY A;  4OU7 A;  3GRY A;  1XNR M;  4LZJ A;  4OW0 A;  3SHF A;  3WHL A;  4IBC A;  2CV1 A;  3SFZ A;  2I7N A;  2KA6 B;  3AKZ A;  3HU3 A;  1IQP A;  3VDU A;  3GLI A;  1C1K A;  3KS4 A;  1L8Q A;  1L2D A;  2P5T A;  3SMS A;  4M0W A;  4HLQ A;  4IBK A;  1SXJ C;  4L78 A;  4DUZ M;  2DHR A;  5KPR A;  2C99 A;  4NSR A;  4LF4 M;  2G5G X;  2K47 A;  4IIW A;  3ZC7 B;  3U6L A;  3KOY E;  3VK8 A;  4X66 M;  3FD9 A;  4LFB M;  4KHP M;  4PCZ A;  1J7K A;  3SYL A;  5C18 A;  4B7G A;  3FTF A;  3KP1 E;  2KZS A;  3RGS A;  2XZU A;  2Y20 A;  4EIW A;  4S12 A;  3L25 A;  4LJ6 A;  4AKH A;  2QCU A;  1DGG A;  4FWD A;  2XH9 A;  3KOW E;  5ITR A;  1SXJ D;  2I7P A;  4LRT A;  1JQJ C;  2CHG A;  3I51 A;  1NSF A;  5ITU A;  2CV0 A;  4R3D A;  2UUA M;  1MX0 A;  3PNY A;  3PNV A;  2XZF A;  3C58 A;  2QBY B;  3HJ8 A;  4LF7 M;  4LG2 A;  3PXG A;  5E26 A;  2F5S A;  1NNU C;  2RKO A;  1IXR C;  2VII A;  3UK6 A;  3AJI B;  3GLG B;  4TUW A;  2XSZ D;  5KPT A;  1YUB A;  3VFD A;  5BR8 M;  4M9Z A;  3SAR A;  4FVM A;  1Q39 A;  3FKE A;  2Q2E B;  3KSJ A;  3MJ5 A;  5EJC A;  4NXM M;  3AOE A;  3LQQ A;  4DUY M;  3CF2 A;  2KEB A;  2VQE M;  3FUV A;  5FTK A;  2O5R A;  4MGH A;  4DR7 M;  3IG5 A;  3L27 A;  5ITT A;  3DOA A;  4CGY B;  4L15 A;  2ERC A;  4X62 M;  1YE9 A;  3FUW A;  4AG6 A;  3QAU A;  3TPZ A;  2KZU A;  2M5Z A;  4B7H A;  1J5E M;  3SYK A;  3U6Q A;  3K8Z A;  4GC9 A;  2LWX A;  4RNA A;  3GLI B;  2D7E A;  4JI2 M;  4IBG A;  1XC8 A;  4GKK M;  3SAV A;  4FCT A;  5EP1 A;  1W5S A;  4GKJ M;  3L29 A;  3KXE C;  4KOD A;  1N78 A;  1IY1 A;  3GP1 A;  3HHW A;  4JI6 M;  1OJL A;  3RE8 A;  1W5T A;  1NVM A;  4II7 A;  3W0L B;  5EXP A;  2R62 A;  2CEA A;  4X65 M;  3U6O A;  1XWI A;  5IWA M;  2DXI A;  4G4Q A;  4LF5 M;  2YNM D;  4MM3 B;  3R8F A;  2CFO A;  3TQS A;  4LF8 M;  1OFH A;  2RGH A;  3FTD A;  1IM2 A;  1R2Y A;  4P16 A;  3PFI A;  4FCW A;  3KDS E;  1G41 A;  1OFI A;  3GLG A;  5ITY A;  1HQC A;  1QAN A;  4GHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...