3KP6A

Staphylococcus epidermidis tcar in complex with salicylate
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
139
Chain Sequence
VRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural study of TcaR and its complexes with multiple antibiotics from Staphylococcus epidermidis.
pubmed doi rcsb
source organism Staphylococcus epidermidis rp62a
molecule tags Transcription regulator
total genus 50
structure length 139
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kp6A00
3V4GA 5ICCA 4KN4X 3FX3A 1YLFA 2BYVE 3R0AA 2E7WA 2CYYA 3KZZA 2W57A 4NHJA 3W6JB 4IF4A 2KRFA 1OYIA 3WTWC 3W6KB 3TO6A 2PI0A 1KU9A 4G7HF 3KP2A 2H09A 4BAYA 1HKQA 4L5IA 4S04A 2L4MA 3ABTA 1YYVA 2CW0F 4HBLA 4GCVA 1I1GA 3U9GA 5L3FA 1SMTA 1S7OA 2X4HA 3SQNA 4G7OF 2QZ8A 2ACJA 1O57A 3WTUC 2GXGA 5LLQA 2HEOA 3HHGA 3ISPA 4FHTA 1I1SA 4HOBA 3WGGA 1L0OC 5FLXZ 5FD6A 5L3GA 5E17F 2VODA 3QU3A 2UWMA 2FSWA 3V7RA 4HX8A 1Z05A 1WKMA 3F8CA 3ZN1A 4A0YA 1SD4A 1ZG1A 1IN4A 4LGWA 2XROA 1SFUA 2VOPA 2A07F 2PG4A 5HLHA 3WG9A 1MJBA 2OQRA 3O2PE 4RB1A 1ZRDA 1R5HA 3ECOA 3FMSA 2F5CA 4MNUA 3VB2A 4EGZA 3GFJA 5E1ZB 2EK5A 1D8JA 3PFIA 5HS9A 1DDNA 4O5VA 4HF2A 1KGSA 1FZPB 4RB0A 3D5LA 5LRSA 2WV0A 5E1WA 2ZCWA 1IUYA 3WGHA 3MQ0A 4RGSA 1IXSB 2AS5F 1IN5A 1ZN2A 3CLOA 1XCBA 4LMYA 3K1PA 3CUQA 1Z6RA 3GUDA 4LB6B 2KIMA 3C18A 1Z9CA 2FOKA 4L5JA 2DI3A 3BY6A 2OAZA 2O6GE 3E5XA 2JTVA 1GVJA 4UVCA 1V3FA 2VONA 3HSFA 5BPIA 5E20A 1R1UA 1AOYA 2FMYA 4M6YA 3M7GA 2XAQA 3T5XA 1XSVA 1D3YA 4GO1A 3TKYA 1G6NA 5HLIA 2VBYA 2XAGA 1PDNC 2PMHA 3KFWX 2H6CA 1K78B 2G7UA 4CHUA 2XAHA 1WI9A 3KP7A 1W4MA 1AWCA 4EGYA 1P92A 4RAYA 1LDDA 5K1YA 1ZG3A 4EV0A 5FO5A 1R23A 2HR3A 4FT8A 2XASA 3GX4X 5DUIA 5E1XA 2K02A 5A2QK 2C6YA 3V8LA 4RGXA 3H3ZA 3BJOA 5KVRA 1ZLKA 2Q8KA 2Q2EA 1R1VA 3RYRA 1BI3A 4AVPA 2YX4A 1K79A 1EH6A 4AIJA 1K78A 2IRFG 4WXCA 3WTYC 2WTEA 2IT0A 2BGCA 2M30A 1P2FA 1MKMA 1FBSA 2B0LA 3RPQA 1L3LA 3J7AO 2V9VA 1KA8A 3RJPA 1RIOH 3S2WA 3DP7A 2CG4A 1DPRA 3RDIA 1ON2A 1S29A 1QGPA 4MQ9F 2W25A 2P7VB 4M6XA 1T98A 3HRMA 1IRGA 1XMAA 1FY7A 1EH8A 2HYFA 1FPQA 1R22A 1KQ8A 2DU9A 2G7HA 1XD7A 2E7XA 1BI2A 1U5TB 5DV5A 2DPUA 4GYIA 5TRDA 4I09A 4UNOA 3IWFA 4A5MA 5LGTA 3SFZA 2D1VA 3MEXA 3K1MA 2DTRA 3WU1B 3JW4A 4XBFA 3GYHX 2LDUA 4DQ2A 4KA4A 3TQNA 5JI6A 3BWGA 3HTSB 1J59A 5JHUA 4EM2A 2RGVA 3WTTC 4YFXF 3HRTA 5LRRA 3OV8A 3R61A 2A6HF 1B9NA 4JQFA 2MBFA 2MD5A 4P96A 4EVIA 1U5TA 4QLCU 4ZYEA 3EETA 4XSXF 1WWXA 1H9GA 4LLGF 4ENJA 3KE2A 4XLPF 2Z99A 4M9ZA 2VT3A 3QOPA 4WXHA 5D8KB 4IRIA 4A12A 2LKPA 3EUHA 4U0WA 4RS8A 4U7DA 4I2OA 3WTSC 4IJAA 5D4RA 1QQIA 1G4DA 4M74A 5D4SA 2HKOA 3IHUA 4ESFA 5AIQA 4U7BA 1FWZA 2EJRA 1UCRA 5IT9Z 2DK8A 2IP2A 5BS6A 3CUQC 3E5UA 4CZZA 1RI7A 1BC7C 3BDDA 4QWQA 2K27A 4HV6A 3WTXC 3GVAA 3VODA 4I0BA 3F8MA 3AAFA 2VE9A 5FD5A 1OKRA 5LGNA 2UXNA 4ON0A 1HW5A 3BROA 4HA8A 4ESJA 4O3MA 2QWWA 2M45A 5L3EA 3COAC 2JRTA 1DUXC 2QENA 3ZMSA 2R3SA 1ZARA 1U2WA 3IRRA 5H20A 1P4AA 4ZZDA 4ASNA 4MEYF 5CVVA 3N97A 2ZFWA 2K7LA 3DKWA 4ENNA 1S7AA 5ERIA 1XGMA 3F6VA 5H6QA 4EM0B 3F8FA 5L3BA 4HV5A 5AONA 1IN8A 3FM5A 4PCQA 1B9MA 4IXAA 5D5UB 2VXZA 3IRQA 5ICEA 1LNWA 3QP6A 1QO0D 1EH7A 3LA7A 1FBUA 3T0YA 1T38A 3JTHA 1D5VA 4ZYGA 3FHZA 4HF0A 3P9KA 3F72A 2ISYA 2A69F 2ZJ2A 2VBZA 3R4KA 2P5VA 2Y0MA 4P5OA 2QBYB 4GYGA 1XDSA 1FBQA 4LG0B 5AIPA 3H3UA 3WTZA 3QRFF 4L18B 2P6TA 2HGCA 1PP7U 1XSDA 3KLNA 4MGRA 2JPBA 3B02A 2BEOA 1FOKA 2P8TA 4LD5A 3DPLC 5IT9K 1BI1A 1HXDA 2HDCA 4LLNA 2L02A 3JSPA 3QPHA 2QBYA 4HW0A 2WWYA 3LQQA 2HZTA 2JPCA 4B8XA 1TQMA 1QNTA 4B09A 4BYYA 4LG0A 2E1NA 3BP8A 1T39A 5F6FA 1P4WA 1YO5C 1YS6A 4IVNA 3J81Z 2ETHA 1HKTA 4UV8A 5CYVA 5DD4A 4HX4A 1FLIA 5BQTA 2UXXA 1G3YA 1TTYA 4R79A 1Z91A 1KYZA 3E6DA 4ZYHA 2MLGA 1LDKB 5K5OA 3KP4A 3KEOA 3P9CA 2FMLA 2H94A 4BHCA 3SZPA 1U5TC 3L7WA 1B1BA 2EB7A 2RC4A 3GO5A 4LB5A 2GZWA 5E8IA 3DEUA 2Z33A 3IWZA 4L0ZB 3K2ZA 4KMFA 2OD5A 5HDGA 1P4XA 1ZH5A 3R0JA 4MTDA 3LSTA 3KP3A 4U0VA 5A2QZ 1R00A 3I54A 3FF5A 2VOOA 4KN7X 4RGRA 4EMSA 1HBXG 2L3DA 1BI0A 4PGHA 4IRHA 2J5PA 1O3SA 5CVIA 3WU0A 3ZPLA 3O6BB 4KNYA 1KU2A 3R6SA 1ZLJA 3NQOA 2R7DA 3VEPA 2ESHA 3LAPA 1B59A 4MQVA 3TDZC 5ILUA 1H0MA 1IXCA 2FBIA 2OA4A 3CTAA 3TOBA 2YX7A 3EDPA 5BOXA 4L9TA 2ZNZA 3Q9VA 2MC3A 3KEQA 1G3SA 1S6LA 4KUMA 4HLXA 3J81K 2FBKA 2STWA 5L3DA 1JHFA 2OQGA 4U88A 5K5QA 1MGTA 2AXLA 4G9YA 1E17A 4LK0F 3ZP5A 2IA0A 2IA1A 2X0LA 2GA2A 4ZH4F 3GWZA 4YFKF 5K5RA 3I71A 5LEKA 2FEZA 2IJLA 1LB2A 1J5YA 3BOQA 3WODF 5HLGA 2QYOA 4KIGA 2Q0OA 2GIVA 2IVMA 2KJBA 3TO9A 5ICFA 2ZKZA 4LLLA 4M71A 1KU7A 2JZYA 4Q47A 1YFHA 2W24A 1YW9A 2GA1A 4P9FA 1K6OA 4NQWA 3MZHA 1OPCA 5ICGA 1IN7A 1FNNA 4S05A 2A61A 2VC1A 1MJ9A 2OZ6A 2BBYA 2PLYA 4M73A 1O7LA 3WGIA 1J0RA 3I53A 1T2KA 4I98B 2DW4A 3HHHA 3FXQA 1BM9A 4XRFA 3ULQB 4TV7A 1F9NA 2HFHA 2DFIA 2K4BA 2W85A 4A5NA 1CF7B 4A0XA 4G6DA 3DFGA 5CVJA 3HSRA 3BPVA 2Z9OA 1DP7P 2TDXA 1YS7A 2VE8A 1O3QA 2P6SA 1S8NA 4GXOA 4YIFA 4EM1A 2ELHA 3QPTA 2FQ3A 3R60A 2UZKA 1LQ1A 2GQQA 3ZMDA 1TBXA 2QQAA 2JT1A 1KYWA 1ONVA 1JHHA 3NRVA 1BOAA 3REOA 1YTYA 4Q48A 1XB4A 2H6BA 5DDGA 4EJTA 3ROUA 1J9IA 2PFBA 2XRNA 3JSOA 2RN7A 2NRAC 1XMKA 2FBHA 2P5KA 4U0YA 3FMQA 1Y0UA 3HYIA 2XHKA 1WQ2A 2QQBA 4L9VA 4CXFA 2EFPA 1YIOA 4MEXF 1BIAA 3I0TA 4KICA 3U2RA 2H27A 4ETSA 1DPUA 4A2UA 2RKHA 3QU6A 2XGXA 3E6MA 1OR7A 4HF1A 1G3TA 4FX4A 5J8FA 2BV6A 2JSCA 4IHSA 4PDKA 5CVUA 4EJUA 3LFKA 3PQKA 1OMIA 5DCMB 1MDMB 3GZ6A 3FXRA 4R8HA 1HKSA 4AIHA 2G9WA 2NNYA 5HOOA 4Y13A 2STTA 1IZ1A 5F1RA 1R5GA 5LHGA 5BMZA 3GLXA 2XKPA 1KU3A 2HTJA 3RKYA 3I64A 4WF2A 3ZMUA 4RGUA 4I7HA 4L9JA 2DBBA 4I01A 2V1UA 1P6RA 4CO8A 5FGMA 2VBWA 3E97A 1YQAA 4BNCA 4M9SA 4P55A 4Y17A 3LAJA 2EA2A 3MAJA 3EYYA 1ZGJA 2CQKA 5DCMA 2LSOA 1W7PB 2XUBA 4FX0A 2HKXA 2V1DA 3F21A 4HYEA 2HOEA 3FXUA 2DK5A 4OMYA 1MZBA 3ABUA 3E6CC 3LWFA 1GXQA 3J80K 4BHPA 2BE5F 4UXNA 2QVOA 5LEJA 4N9IA 3K1NA 4P9UA 5DCFA 1FYKA 4R1HA 1U3EM 1W5TA 2P4WA 3CJNA 3F6OA 1JXSA 2A3SA 2PJPA 1W7PA 5JFRA 3GXOA 3MWMA 3P9IA 3NEUA 3I5UA 3K9TA 2QUFA 2LF8A 4AWXB 2GWRA 2P5LC 4H0EA 2EFQA 1IF1A 2O8XA 1QPMA 1FYMA 2KJCA 4I0AA 1H9TA 3CO6C 2DQRA 2V1XA 2PN6A 2EFNA 2XVCA 1O3RA 4KMUX 4EJOA 3O3KA 1WRJA 4KDPA 1VTNC 3JAMK 3CUOA 1U8RA 3T1BA 2RV8A 1TQIA 3ECHA 1XSXA 1IW7F 3DQVC 1UB9A 3LA3A 1Z6TA 3ZMVA 4MTEA 3WTVC 1W7PD 1J2XA 3M8EA 5DYMA 1O3TA 2J5OA 3K0LA 3ERED 2Y48A 4A0ZA 3C7JA 4I02A 3MFKA 2A68F 4RB2C 1JE8A 1UHMA 5DEQA 3QP5A 2PMUA 2VC0A 3IC7A 2PBIA 3L2CA 1ON1A 1IXRC 2PQ8A 4IRGA 3FM3A 3IKVA 2ESNA 2HQNA 4ESBA 5D5WB 1A04A 2L4AA 3GZ5A 3LQRA 5D5VB 1SD5A 5HVQC 4BXUA 3M1EA 2D45A 2NNNA 4HZFA 1TNTA 4Q5SF 2V6CA 3F22A 2MH2A 1ZYRF 5JR3A 2FE3A 4NB5A 1GXPA 1ZRFA 3MCZA 3DXJF 3RYPA 1RZ4A 2EV5A 4KT5C 2IW5A 3VFZA 3TO7A 2Z5UA 2GXBA 2M5WA 2QQ9A 3DV8A 3E6BA 2PEXA 1EV7A 4PGGA 2IPQX 2ISZA 2DAOA 5HDNA 4ZYDA 3SHFA 1R36A 4JBAA 3Q5FA 1R7JA 4M72A 1SAXA 3ZMTA 2OU2A 2COMA 3I58A 4IHTA 3IKTA 1XN7A 2EV0A 2YU3A 2FXAA 3L9FA 3OOPA 1STZA 3G73A 4M9XA 2VBXA 3GEZA 1E2XA 1PUEE 4N0BA 2XV4S 1K7AA 3CUQB 2FU4A 2M87A 1ZHFA 3FMRA 1I6XA 1GHCA 1MJAA 2QM3A 1LVAA 3C3WA 5HS8A 3QAHA 4OIOF 5BPDA 2FF4A 1I27A 2IA2A 1QZYA 1XGNA 4OIRF 1HW1A 1NHAA 3DPTA 2XAJA 4KIBA 4HAMA 2YR2A 3KP5A 1U6GA 3N4MA 4AIKA 1SD6A 2R7FA 1B6AA 5LHIA 1R58A 1F5TA 3FWEA 2MH9A 4WK8F 1XDUA 3WE3A 1HQCA 4A6EA 2A6EF 2GAUA 3TGNA 3JTGA 1HSTA 2FNAA 2HWVA 1TW2A 5E18F 1FT9A 2L54A 5LBQA 2CO5A 2ZBKA 3HOSA 1FP1D 1TW3A 2F5EA 4YIIA 3KZYA 1WSUA 1BC8C 2ZMEB 3RKWA 3HRUA 2KIFA 1ZG5A 1FSEA 3BJAA 4YFNF 2V79A 4F7ZA 3F8BA 5D5XB 4HLYA 2Z3YA 3F8NA 2O61A 4G8XA 4Z2YA 2HTSA 2OZUA 5LGUA 3I4PA 1UFMA 2VN2A 2W84A 4UVAA 3K69A 3RPUA 2KIUA 4UV9A 1RNLA 4KYWA 5HDKA 4CGZA 3SXYA 1USSA 1RUOA 4D0PA 2EWNA 2DT5A 2VT2A 5FLXK 3RIRA 2ZMEA 6PAXA 4G6QA 2HQRA 1F4KA 1SFXA 3D0SA 4HDUA 1YW8A 2HS5A 2CGPA 2KKOA 4BH9A 3KP6A 2DO7A 2CSOA 2FA5A 4YG2F 3Q9SA 1PP8F 3M8FA 1RUNA 1BN5A 2MLKA 4HQMA 5FB2A 4XLNF 4LK1F 1KQ9A 3FZVA 3RI4A 3GF2A 1ULYA 5D8LB 2YSRA 1S3JA 2ZO4A 2QLZA 4ZZLA 1Q1HA 4UHTA 1BBYA 3G3ZA 3ZQ7A 1T0FA 5EEHA 2E1CA 2RQPA 5CJ9A 1IRFA 1X3UA 3GFIA 3HOTA 4PZJA 1SD7A 5EEGA 1J75A 4XSZF 1LJ9A 3B73A 4KFCA 5DUKA 4CYDA 3CO7C 1TQPA 2CWEA 3H92A 5ILVA 4RAZA 3KCCA 2XIGA 2O03A 2WC2A 5FFZA 5E8GA 3HIFA 3E5QA 3MZYA 5J6XA 2L01A 4CDGA 4GGGA 1TLHB 3J80Z 4BQAA 2M1BA 1CF7A 2XAFA 5KK1A 1SMYF 5DD8A 2LNBA 1TNSA 1FC3A 4OOIA 3P7NA 2EFOA 4HDVA 2OBPA 3SZTA 4E70A 2F5FA 1USTA 2NAZA 4G7ZF 5TJJA 1CGPA 4OMZA 1D8KA 1XGSA 2A5YB 2EA4A 3HSEA 4LFUA 2XKOA 2P7CB 1OYYA 3GFMA 1YW7A 3V7SA 2DQLA 4WX9A 2O0YA 2FNPA 4CICA 4EQQA 1ZRCA 3V8KA 3PQJA 1T6SA 3CDHA 4WWCA 2RDPA 4UVBA 5HS7A 4HX7A 2FRHA 4EJVA 3RKXA 1O7FA 1XCVA 3ML6A 3F3XA 1I5ZA 1SFEA 3F23A 1C0WA 3JAMZ 1QZZA 2Y75A 1JGSA 2DLLA 1FYLA 3BPXA 4ENMA 3EQLF 3WE2A 4WCGA 3DF8A 2K4JA 5ILSA 3TOAA 3ZMZA 3I59B 5IT3A 3IL2A 1BIBA 3LA2A 1UHWA 2M8EA 1Z1DA 1BJAA 1IAWA 1HW2A 3HTUA 3ELKA 4Y15A 2F2EA 2F5DA 3GW2A 2YPRA 4UUVA 1J7KA 5J8CA 4Q4ZF 4N9HA 3KLOA 3KETA 3C1DA 4G94A 1MDMA 3L09A 3L00A 4KIFA 1XGOA 3T8TA 2CFXA 4IPAA 3I59A 2K86A 3E3VA 1FX7A 1YG2A 2ADUA 2D2WA 2RNJA 4WXDA 4O6JA 1V4RA 3ZN0A 4L0YB 2NYXA 1R1TA 4L9NA 1F1ZA 5D6FA 5F64A 3VOEA 4A6DA 3M9AA 2O3FA 5D6EA 3T8RA 5CLSA 2RVCA 4DNCA 1LEAA 4HQEA 3V8JA 3U1DA 1QBJA 3V7CA 4BHBA 2ZXJA 5JVTA 2EFWA 1IN6A 3TDUC 4OU0A 4MHGA 2LF7A 5LHHA 5ED4A 3RTRA 2HYGD 4JK1X 2D1HA 5L3CA 5CVRA 1Z7UA 2NS0A 3GFLA 1G3WA 1REPC 3HRSA 1MD0A 1W5SA 2DPDA 1LDJA 3EYIA 1FP2A 3BZ6A 1FSHA 1ZAOA 3HUGA 2MA3A 4RB3C 4K2EA 5H6RA 2ZNYA 1ZGAA 4ENKA 1LEBA 4OIPF 4EJWA 4OINF 1ODDA 5FFXA 1U78A 3BJ6A 1B4AA 1ZREA 4OIQF 2EV6A 4AD9A 1OYWA 1KQ0A 4LJZF 1HSJA
chains in the Genus database with same CATH superfamily
4ABZA 3V4GA 3A1YA 5FRNA 2JQ7A 5ICCA 4KN4X 4W97A 2HQAA 1HCRA 3FX3A 1YLFA 2BYVE 3K10A 3R0AA 1VNDA 2VJIA 2E7WA 5F0CA 1R9TJ 4BDZA 3HOYJ 2CYYA 3KZZA 2W57A 4NHJA 1LFBA 3W6JB 4B3AA 3GTPJ 3GTOJ 2B9SA 5KNLA 3EPZA 4IF4A 2KRFA 3CMMA 1OYIA 3WTWC 4PUSA 3W6KB 2JWTA 5EF6A 2F48A 3TO6A 2DT6A 3GTGJ 2LVSA 2WAQN 2VASA 4MO7A 5DM7F 4Y4RA 2PI0A 1KU9A 1Z3YA 5F08A 4G7HF 3KP2A 2H09A 4BAYA 1HKQA 4L5IA 4S04A 2M8GX 2L4MA 3ABTA 4UB8C 2WY7Q 2NVYJ 1ZK8A 3BQYA 4H4KC 3PL8A 1YYVA 2P0WA 2CW0F 2DYRH 4HBLA 4GCVA 1I1GA 3U9GA 1U9OA 2A05A 3JREA 3BR6A 5L3FA 1SMTA 3K6GA 1S7OA 2X4HA 3SQNA 4XKCA 4G7OF 3H0DA 3DTKA 3U21A 1HLVA 2QZ8A 2ACJA 2DMQA 4E7HA 3CCMI 1O57A 4XONA 2M7BA 2B63J 3WTUC 3VDXA 2GXGA 3OYGA 1D1CA 4F91B 2B7EA 5LLQA 2HEOA 3LOCA 4DZJA 1YOVB 3HHGA 3ISPA 2QF7A 1JKPC 3DU5A 4FHTA 1I1SA 1JUSA 3CCSI 3DKYA 4HOBA 3FKIJ 1JT6A 3Q3SA 3WGGA 5M5YJ 1L0OC 1OR7C 3OYEA 2NOGA 5FLXZ 5FD6A 5L3GA 5E17F 2VODA 3QU3A 2UWMA 2FSWA 3V7RA 4PJ0C 1OLTA 3M3YJ 4HX8A 2IGKA 4JYKA 1Z05A 1WKMA 5EEAA 3F8CA 4ITVA 3ZN1A 4DGWB 4A0YA 2IGMA 3Q0UA 2A5WA 1SD4A 2X51A 3H0GJ 2F4MB 3K70C 1ZG1A 4A3EJ 1IN4A 3W6VA 4LGWA 4EEFG 1UJ8A 2XROA 3OYHA 1SFUA 3G1LA 1TWAJ 2VOPA 3S1MJ 3TEDA 3VYTB 2A07F 3BR3A 2PG4A 5HLHA 3DEWA 3WG9A 1MJBA 2DT7B 2OQRA 3S1RJ 4GRIA 3O2PE 4RB1A 1ZRDA 3JRHA 3S2DJ 2ZFUA 1R5HA 3ECOA 3FMSA 3G1OA 3HOUJ 2F5CA 4OWRB 4MNUA 1POGA 1XTAA 1VQ4I 3DPUA 3VB2A 2DYSH 4EGZA 3HKZA 3GFJA 1X4OA 2HDDA 1N75A 5E1ZB 2A6TA 2EK5A 3FDYA 1D8JA 4YELA 3PFIA 2E60A 5HS9A 5HODA 3ZQIA 1DDNA 1ZELA 1TZLA 2DDBA 4O5VA 5H2FC 2LFBA 4M3DA 3BZCA 4HF2A 1KGSA 1FZPB 3DBRB 4RB0A 3D5LA 2KFDA 3EUKL 5LRSA 3JRGA 5C4JJ 2WV0A 3MKZA 5E1WA 2ZCWA 2JA2A 1IUYA 3WGHA 4E6KG 1ETWA 3ASOH 1R49A 3MQ0A 4RGSA 1IXSB 1A31A 2AS5F 2LG4A 1IN5A 1ZN2A 5HNHA 3CLOA 1IRZA 1XCBA 4LMYA 3K1PA 4RM2A 1WZ2A 3OWTA 3CUQA 3ZXSA 3W3CA 3PNYA 1Z6RA 3GUDA 4LB6B 3BR5A 2KIMA 3C18A 3U1KA 1Z9CA 2FOKA 4L5JA 1QVTA 3RZDJ 2R7QA 3AG1H 2DI3A 4JX6A 3BY6A 2OAZA 2O6GE 3E5XA 3GBGA 2E1MC 1ETOA 4GFBA 2R7ZJ 4X0GA 4CCNA 5B1AH 3CCQI 4YEJA 2JTVA 3CCRI 2KZGA 1GVJA 4UVCA 1V3FA 4B43A 3HSFA 2VONA 2CRGA 5GP9A 2W00A 5BPIA 5E20A 3A02A 3IAM2 1R1UA 3DLAA 1AOYA 2FMYA 1PYVA 1NG6A 2VJJA 3S93A 4M6YA 3M7GA 1LFUP 1A6QA 2XAQA 3T5XA 4C9YA 1XSVA 4BJTA 1D3YA 4G12A 4CA0A 2OTJI 1FOXA 4GO1A 3TKYA 4UUSA 2DXIA 4A93J 2Q2EB 2ICWG 1G6NA 4NQWB 5HLIA 3RQIA 2VBYA 4DYCA 2XAGA 1PDNC 1S7EA 5K7FA 2PMHA 3BG7A 3KFWX 4I99C 5KCMA 2H6CA 1K78B 2IS1A 2XF7A 2G7UA 4CHUA 2XAHA 1WI9A 2TRTA 3KP7A 1LFPA 1W4MA 5BNGA 2KRCA 4QPQA 4CCLA 3BCAA 1AWCA 4EGYA 4B4CA 2X6WA 1P92A 4RAYA 1LDDA 3KEYA 5K1YA 3OYCA 2R0QC 4BL0B 1ZG3A 2LBFB 4EV0A 5FO5A 1R23A 3M07A 3OR1C 3I4MJ 2HR3A 2ZXWH 4FT8A 2Y9YA 3CDIA 1RPWA 4DBQA 2XASA 4AIDA 5JHFA 5IPAA 3GX4X 5DUIA 1IJWC 2BXZA 5E1XA 2K02A 2XPWA 5A2QK 2C6YA 1MBHA 3CMAI 4BU2A 3QWLA 1KONA 1OCPA 3V8LA 2E2JJ 4RGXA 3H3ZA 3RSNA 3PSFA 1XPXA 3BJOA 5KVRA 1ZLKA 4XLAA 2Q8KA 1TT5B 1R1VA 2Q2EA 3B6CA 3RYRA 1BI3A 2H8WA 5F27A 4AVPA 2YX4A 5KAFC 4DIQA 1K79A 1P9QC 1EH6A 4AIJA 1K78A 2IRFG 1MMGA 4WXCA 3WTYC 2WTEA 2IT0A 4E7SA 2LR8A 2QGUA 2KZVA 2BGCA 2JA6J 2Y69H 2M30A 4HSRA 1P2FA 1MKMA 1FBSA 2B0LA 3RPQA 1L3LA 1XX5A 3J7AO 4IKFA 2V9VA 3S15J 2WB1A 2MFZA 1KA8A 3RJPA 1RIOH 2JUCA 3S2WA 5IYDJ 2LBFA 2WV1A 4AUXA 3DP7A 2CG4A 3HOZJ 1DPRA 3HZJA 4XRMA 3AG3H 3RDIA 4NNJA 3VSKA 2BY1A 2CS3A 1W0TA 1ON2A 1S29A 4IHVA 4IO9F 1IV6A 1DP3A 1QGPA 3D5SC 1KZHA 1RESA 1XS9A 4MQ9F 2W25A 2P7VB 3HOWJ 4M6XA 3FBIB 1T98A 3TP0A 3HRMA 1IRGA 1S5LC 1XMAA 1FY7A 3DEEA 1EH8A 2HYFA 3PIOF 1ETQA 2K5CA 3FXLA 1FPQA 3S8PA 4CCKA 2VPRA 5C4XJ 1R22A 3BQZA 5GPCA 1KQ8A 5IY5H 2EINH 2DU9A 2G7HA 3A0HC 1XD7A 3OSGA 2VQGA 4HNTA 2E7XA 1QRYA 1BI2A 1U5TB 1SFKA 5DV5A 5IYCJ 2DPUA 4GYIA 5TRDA 2VI6A 3E0JB 3IWFA 4I09A 3UNGC 4A5MA 5LGTA 4UNOA 3SFZA 2D1VA 3MEXA 1YJNI 2R7XA 3K1MA 1JKOC 2DTRA 5J1YA 1IDZA 1AKHB 3SYTA 3VSLA 3WU1B 3JW4A 4XBFA 3GYHX 1IG7A 2LDUA 1OCRH 4DQ2A 4KA4A 4IHXA 3TQNA 2UUZA 5JI6A 3GTMJ 2AXTC 3BWGA 1ITYA 3HTSB 4X1EA 1Z0XA 4YIRX 1VQ7I 4BXFA 3OYMA 2CH0A 2DMNA 1J59A 5JHUA 3I55I 3DBLB 4EM2A 2LTPA 1YRNB 2RGVA 5M5XJ 3WTTC 5EG0B 2X6XA 4YFXF 4KISA 3HRTA 1OCTC 5LRRA 3OV8A 3R61A 2A6HF 1RETA 1B9NA 2BVMA 2MBFA 2L7ZA 3OOUA 4JQFA 2MD5A 2OCEA 2X1EA 2K9LA 4P96A 4EVIA 1PJRA 1U5TA 2FUG2 9ANTA 4QLCU 3ASNH 2EIJH 4ZYEA 4C2UA 4Y3OA 5GADJ 3EETA 4XSXF 1XC5A 1WWXA 1G2HA 4PSXA 1H9GA 4LLGF 4ENJA 2H8RA 3KE2A 4XLPF 1AKHA 2X6OA 4MIMA 2M0CA 2Z99A 4M9ZA 3DU6A 4A3GJ 1JI8A 4D5FA 2VT3A 5TGTA 3QOPA 1DGRM 4WXHA 1G8XA 5D8KB 4CCJA 4IRIA 1VQNI 2NVTJ 3H1CA 4A12A 2LKPA 3EUHA 4BE1A 3CJTB 4U0WA 4RS8A 4ZDLA 4U7DA 4BDYA 4I2OA 3ZQQA 3H5AA 3WTSC 2QSGX 4IJAA 5D4RA 1QQIA 3PSIA 1WJEA 1G4DA 4BY7J 1YRNA 4M74A 3MKLA 5D4SA 2DTZA 5EG0A 2LY1A 2HKOA 4PSWA 4CSWA 1A36A 2CV0A 4F92B 3IHUA 1NK2P 1Z67A 1OISA 5AIQA 4ESFA 5J1RA 4U7BA 3GTQJ 1FWZA 4E7KA 2WADA 2EJRA 1UCRA 2IS6A 2DK8A 5IT9Z 3HOXJ 4BS9A 2EZIA 2EZKA 4FE4A 2IP2A 4PJNA 3BR2A 4YRVA 3CMEI 5BS6A 2MW8A 2VJ4A 3CUQC 3E5UA 4CZZA 1RI7A 1BC7C 4UB6C 3WU2C 4BUPA 3LSRA 1FMWA 1NH3A 2VJ5A 3JRBA 3BDDA 1X19A 1I50J 4QWQA 2WA0A 2K27A 3FKJA 4HV6A 3GVAA 3VODA 3WTXC 4I0BA 2ZJRF 5EZGA 3F8MA 2X85A 1QVUA 3AAFA 4A3LJ 2VE9A 4NC8A 5FD5A 1OKRA 4IOAF 5LGNA 2ID6A 2UXNA 4ON0A 2KIQA 1HW5A 3BROA 4HA8A 4F3QA 1OCZH 2OC6A 4ESJA 4O3MA 1MMNA 2QWWA 3E7LA 4RLFA 2M45A 5L3EA 3Q0WA 3COAC 2GOMA 1HDPA 2JRTA 1DUXC 1Y39A 2G0EA 5J4YA 4AM3A 3I4NJ 1K6YA 2QENA 2CQXA 2XC7A 1VQKI 3ZMSA 1IRXA 4AYBA 2DA7A 2R3SA 1ZARA 1U2WA 3IRRA 1X1PA 5H20A 2Y30A 4BGDA 5GAHJ 1P4AA 4ZZDA 4ASNA 2EIKH 2LOOA 1GDTA 4MEYF 5CVVA 3N97A 2ZFWA 3FXMA 2K7LA 3DKWA 1VFCA 3AL0B 4ENNA 1S7AA 5B5EC 5ERIA 3PFYA 1XGMA 2AHQA 2ZMEC 2IEKA 3F6VA 1K61A 5H6QA 4EM0B 2L7MP 2VXDA 1V5EA 2XGDA 1Y8QB 3F8FA 4BJ6C 5L3BA 4HV5A 5AONA 1X1CA 3ZR8X 1MNMC 1IV8A 1IN8A 1ORKA 3FM5A 1SVOA 4PCQA 1B9MA 4IXAA 5D5UB 2EPFA 1MBGA 2VXZA 3IRQA 5ICEA 1LNWA 3QP6A 1QO0D 1EH7A 3LA7A 1FBUA 3T0YA 1T38A 3JTHA 1YE9A 1D5VA 5FKNA 2QSFX 2MABA 2O7OA 4ZYGA 2PMZN 3FHZA 2CQQA 3BR0A 4HF0A 2K9QA 1MMSA 2K85A 3P9KA 4AC0A 3F72A 2L2OA 2ISYA 2A69F 2ZJ2A 4BJ5C 2VBZA 3R4KA 4NBQA 2P5VA 3A2KA 3C2HA 2Y0MA 1WCMJ 4P5OA 2QBYB 3BCBA 3AFHA 4GYGA 3CZ6A 3IUOA 4XLEA 5FKMA 1XDSA 3OSFA 2NVUB 2IS4A 3D5RC 1D5YA 1FBQA 4LG0B 2CU7A 1WH5A 2H1LA 1WJBA 5AIPA 3S2HJ 3H3UA 3PO3J 3WTZA 4W1UA 3QRFF 4L18B 3AG2H 2E5ZA 1T0FC 3K4NA 2P6TA 2HGCA 1PP7U 2MSYA 3DTEA 5EGOB 1XSDA 3HKZN 3KLNA 1X4PA 4MGRA 2JPBA 3B02A 5IP9J 2BEOA 1FOKA 2MGQA 3MD2A 5EZHA 2P8TA 4LD5A 3CC2I 1G59A 1I6HJ 1MMDA 3V42A 1DU6A 3DPLC 5IT9K 1BI1A 2R7OA 3F0CA 1HXDA 2HDCA 4LLNA 3TW7A 2OJED 2L02A 1FOWA 3LMMA 1RRJA 3JSPA 2I10A 4LG3A 1JTYA 4HG2A 3QPHA 4BQNA 2QBYA 4IQJA 4HW0A 1T08B 3FXKA 2WWYA 1BW5A 3LQQA 4CCOA 2HZTA 2AQEA 4M3GA 1FIAA 2EBIA 5IP6A 1FEXA 2JPCA 4Y33A 4B8XA 1TQMA 1QNTA 4B09A 4BYYA 1MSFC 2R5ZB 3K4BA 4LG0A 2E1NA 3O8HA 2HOAA 1JT0A 3BT9A 4XICA 1Y56A 4RAFA 2R5YB 3BP8A 1T39A 5F6FA 1P4WA 3E1SA 4CYCA 1YO5C 2D5VA 4HPQA 5EGOA 1GT0C 1YS6A 4IVNA 4IZZA 3DWLE 3J81Z 2ETHA 1HKTA 3FISA 4UV8A 5CYVA 5DD4A 4HX4A 1FLIA 5BQTA 2UXXA 4XKVA 1SFOJ 3CCUI 2OF7A 4PJMA 1G3YA 1TTYA 4R79A 1Z91A 1KYZA 1LVKA 3E6DA 4ZYHA 2MLGA 1LDKB 5K5OA 5IOYA 2LMDA 3G2BA 1UAAA 1EF4A 2XSJC 3Q0VA 2YUSA 2WBMA 3BG3A 3KP4A 3KEOA 3P9CA 2FMLA 2H94A 2L5QA 3A03A 4BHCA 4V2GA 3SZPA 2BY0A 1U5TC 2L7FP 1B1BA 3L7WA 4QIWN 4NC6A 3M1CA 4BEHB 3K4KA 1VI0A 2R5ZA 2EB7A 2VIXA 2RC4A 3BG9A 2CUJA 3GO5A 3OS0A 4LB5A 3CDLA 3GMEA 4L5EA 1D0ZA 1RC9A 2R5YA 2GZWA 5E8IA 3DEUA 1E3PA 5EDNA 2Z33A 1QZEA 1TWCJ 3IWZA 4L0ZB 2HNHA 3K2ZA 1W1WE 4KMFA 1U0JA 2PMZA 1UZCA 2OD5A 1UELB 5HDGA 2XPUA 1P4XA 2CMPA 2XB0X 1ZH5A 2N8GA 2WY8Q 2JN6A 2ZSIB 3EUHC 3R0JA 4BE2A 4MTDA 3PM1A 3LSTA 4X6AJ 3KP3A 1BJZA 4U0VA 5A2QZ 3C2BA 1R00A 2DOFA 3CJRB 3FF5A 3I54A 1N77A 4Y52J 1N25A 3HL2A 3HPHA 2VOOA 4KN7X 4RGRA 3BG5A 4EMSA 3PJRA 1HBXG 1FTTA 2VKDA 3PO2J 4B44A 2L3DA 3GTJJ 1BI0A 4PGHA 4IRHA 2CJJA 5E3OA 2DA1A 2J5PA 2Y2ZA 1O3SA 3H9JA 4BEHA 2CUZA 1LPQA 5CVIA 2V26A 3WU0A 3ZPLA 3HBLA 5C44J 3O6BB 2MD0A 2BW3B 5M3MJ 2LKSA 4P1WA 4KNYA 3M4OJ 2R7UA 2HOTA 1S72I 2KL4A 1KU2A 3R6SA 1ZLJA 3NQOA 2R7DA 2RQQA 4FISA 2WB1N 3S14J 3VEPA 2ESHA 3LAPA 1B59A 4MQVA 2R93J 3TDZC 4XKBA 4KT6A 2R7SA 4HEA2 5ILUA 4RDUA 4QPOA 1H0MA 1IXCA 4IEJA 3X2QH 2FBIA 2OA4A 1I3AA 3K2AA 2KT0A 1MH4A 4LOCA 1SC7A 3FBNB 3CTAA 4ANJA 2TCTA 3TOBA 5JVGF 1GV5A 2YX7A 3HM5A 3EDPA 5BOXA 4FASD 1V55H 1MIJA 4L9TA 2ZNZA 1U8BA 2GOXB 3Q9VA 2KDZA 4XORA 1YITI 2L9NA 2MC3A 1TWHJ 2BY2A 1UHSA 3KEQA 1G3SA 3W2WA 2RREA 2BW3A 1S6LA 2DFHA 1J09A 3OIPA 4KUMA 2M2EA 4E4HA 3KX2A 4FQGA 4HLXA 2JJ7A 3QYFA 1IUFA 3J81K 2OV7A 3DCFA 1VQMI 4JX5A 4I6ZA 3VWBA 5DTDA 2FBKA 2STWA 5L3DA 1JHFA 1P7IA 1SVLA 2OQGA 2XB5A 4U88A 3DLLF 1JJ6C 1U9NA 5K5QA 1TL8A 5C3EJ 4RAGA 3H35A 1X2MA 2AQFA 1MGTA 2AXLA 3RKQA 4G9YA 1E17A 3OR2C 4LK0F 4KITB 3S17J 3ZP5A 2IA0A 3CP8A 2IA1A 3W2AA 2X0LA 2CQNA 2DOAA 5JLXA 2GA2A 4ZH4F 2EIMH 5DS9A 1TT0A 3GWZA 4YFKF 2V9KA 5K5RA 4V19K 2LREA 3ZGKA 2E1OA 3I71A 5LEKA 2FEZA 2OUMA 2IJLA 1LB2A 1J5YA 5DM6F 3BOQA 4JX4A 3QQAA 4IOCF 2QEXI 3WODF 4PK4A 1CQTA 5HLGA 1AHDP 2QYOA 4KIGA 1XG1A 2Q0OA 3KIOA 5GTIC 3CC7I 2GIVA 5FLVA 3HPGA 2IVMA 2KJBA 2L9SA 5ICFA 3TO9A 2X1DA 1ETKA 1Y6IA 3GCMA 1V5GA 2ZKZA 1T8IA 1HOMA 4LLLA 4A3FJ 4M71A 1KU7A 2KMUA 2EQRA 3CP2A 2JZYA 4Q47A 1YFHA 3JRIA 2EH3A 2W24A 1YW9A 3HGYA 4CZCA 1DGWY 2GA1A 4CCMA 1WJAA 3OS2A 4GDFA 2CV1A 4P9FA 4D9JA 2K9MA 1K6OA 3LSKA 4NQWA 2JSPA 4XR6A 3MZHA 1OPCA 5ICGA 1IN7A 1FNNA 4S05A 2HYJA 2VKHA 2F4IA 2A61A 2VC1A 1MJ9A 1LUJB 3SJMA 1JGGA 2OZ6A 2BBYA 3TMOA 1MNDA 2ECCA 3HGGA 2ME0A 3G4SI 2PLYA 4AU7A 4M73A 2ZJQF 1O7LA 3WGIA 2FQ4A 2X1CA 5FRMA 2XPVA 2QKLB 2O8KA 1J0RA 3I53A 2Q1ZB 1T2KA 4I98B 2DW4A 1Z77A 3HHHA 2DOEA 4S0HB 3ABKH 5J4VA 3SDBA 3FXQA 1ACIA 3ZQCA 2HVQA 4J00A 1AU7A 1BM9A 4XRFA 2XF5A 2GIZA 3ULQB 4TV7A 4BBRJ 2ZJPF 1Y1WJ 1F9NA 2HFHA 2DFIA 1HDDC 3HB9A 3CLQA 3RQ4A 5KAIC 2K4BA 2LC2A 2W85A 4A5NA 1CF7B 4A0XA 5GTHC 1FTZA 4G6DA 4IL6C 3DFGA 4EATA 4HSTA 1T56A 3CCEI 5CVJA 2KQRA 3HSRA 4CH7A 3BPVA 2Z9OA 5CQEA 1DP7P 1E3HA 2TDXA 1YS7A 2VE8A 3J7YJ 1W36D 1O3QA 2P6SA 4XLCA 3J7ZI 1S8NA 4GXOA 4YIFA 4EM1A 2ELHA 3QPTA 2FQ3A 3R60A 2UZKA 1LQ1A 5B1BH 1R4NB 4AYBN 2GQQA 2I8DA 5F04A 1X3ZB 2OTLI 1FOYA 3ZMDA 1TBXA 1SANA 2DA6A 2QQAA 1W0UA 2JT1A 1KYWA 1ONVA 1JHHA 3NRVA 4LIVA 4BQQA 1BOAA 4E7IA 3REOA 3G6EI 3PNVA 1YTYA 3HDDA 2Y0SA 5FJ8J 4Q48A 3H9GA 1XB4A 2R92J 2W82A 1I3QJ 2V4JC 4DYRA 1GLNA 2H6BA 3TL4X 4A3IJ 1VF9A 5DDGA 5FLMJ 2LYCA 3P5JA 4EJTA 1A5JA 3H5NA 3ROUA 1J9IA 2PFBA 3SEZA 2XRNA 3JSOA 2RN7A 1O4XA 3IP4B 4NDLA 1Y1VJ 4E7ZA 1GV2A 1A6IA 4NC7A 4QTRA 3FIWA 1BR4A 2NRAC 2E5NA 3AG4H 1XMKA 2FBHA 1R6RA 1TP4A 4ZDOA 4B1RA 2P5KA 4BXXJ 4U0YA 3FMQA 1D1BA 3L2UA 1Y0UA 3HYIA 2XHKA 1WQ2A 1BA5A 3CJQB 5K7HA 2QQBA 4L9VA 4DW6A 4CXFA 2EFPA 1YIOA 2GBYA 3HJEA 3UR3C 4MEXF 3ZQHA 1BIAA 2DMPA 1R71A 3I0TA 3LSHA 1XMXA 2HXIA 4KICA 1YJWI 3U2RA 2H27A 4ZYAA 4BY1J 4ETSA 2EZHA 1DPUA 4XLFA 2X48A 5F0FA 3TW6A 4A2UA 1IC8A 3OYLA 2RKHA 4ZJZA 4I76A 3QU6A 2XGXA 2NXNB 3E6MA 1OR7A 4E7JA 4RBOA 5TISC 4N4OB 1G3TA 2FOWA 3LL7A 4FX4A 4HF1A 4XLHA 2DMTA 2E19A 5J8FA 2FX0A 2BV6A 2XGEA 2JSCA 3IV5A 4IHSA 4PDKA 5E3LA 5CVUA 4DJAA 4EJUA 2F4OB 3MVPA 1DU0A 1X1DA 2F6CA 2ZB9A 1EJ9A 3LFKA 4E7LA 1PUFB 2V6EA 3PQKA 4XN0A 4BKXA 2FD5A 1OMIA 5DCMB 5FROA 1E3OC 2M4KA 1MDMB 3OYIA 3GZ6A 3CF2A 3B6AA 3FXRA 4UY8I 2LLKA 4R8HA 1HKSA 4AIHA 2G9WA 3BR1A 3VPRA 5CPRB 2NNYA 3RCOA 5HOOA 1Z7LA 1S9HA 3K7AJ 4Y13A 2CW8A 4IHYA 3LFUA 1IZ1A 5F1RA 3S3MA 2STTA 1R5GA 5LHGA 5BMZA 3GLXA 2XKPA 2GLOA 1KU3A 2HTJA 3RKYA 3I64A 4WF2A 5B66C 3QPLA 3ZMUA 2E1MB 4RGUA 3BTJA 4I7HA 3FK6A 4L9JA 2DBBA 2QSHX 2VUMJ 4I01A 5J40A 2V1UA 1P6RA 4CO8A 5FGMA 2V7FA 2VBWA 5HLTA 3E97A 1YQAA 4XRSG 3OYAA 4BNCA 1YHQI 3K70D 1X2NA 4M9SA 4P55A 4Y17A 3LAJA 3L2QA 3OIOA 1PUFA 3PUBA 3FHNA 2EA2A 2OCCH 2HPIA 3MAJA 3EYYA 3EUAA 1ZGJA 2CQKA 5DCMA 2LSOA 1W7PB 4MFEA 3IH4A 2XUBA 4FX0A 2JK3A 3SEQA 2HKXA 2V1DA 3F21A 4HYEA 2HOEA 4II2A 3ZQGA 4Z6YA 4M3EA 3FXUA 1BL0A 2DK5A 3TBIA 4OMYA 2NOJB 1MZBA 3ABUA 3E6CC 3WHCA 4C30A 3LWFA 1GXQA 5GPAA 3J80K 4BHPA 2BE5F 4UXNA 2QVOA 5LEJA 3IAS2 4KJZA 4XRSA 1TWGJ 2K3FA 4N9IA 3ABMH 3K1NA 1MBFA 2JA8J 1F43A 4P9UA 5DCFA 3OMYA 1WJFA 4G6TB 5K7ZA 2O5RA 5FKKA 1SEUA 1FYKA 3JCUC 4R1HA 1T95A 1U3EM 3GZNB 1E0EA 1W5TA 1FJLA 2P4WA 1WGXA 1MBEA 4NUBA 3HUGB 4FCYA 3CJNA 3F6OA 1JXSA 4A3BJ 2A3SA 2PJPA 2VL8A 1W7PA 2KP6A 5JFRA 3ZRGA 3GXOA 3MWMA 2DJNA 3P9IA 3NEUA 3I5UA 2R7TA 5IP7J 4BBSJ 3QODA 2CUEA 4XNFA 3K9TA 3FXOA 2ID3A 2QUFA 4FTHA 2KPMA 2LF8A 4AWXB 2GWRA 2P5LC 2HOSA 4DZPA 3OYJA 1MSEC 4H0EA 2VPLA 1LE8B 3PUFA 2EFQA 1IF1A 1A35A 2O8XA 5CKTA 1QPMA 4XOPA 1FYMA 1NTCA 5J47A 2KJCA 4I0AA 2L9RA 4J01A 2LP0A 3CO6C 1H9TA 2DQRA 3A4CA 4HRIA 3ZCOA 1GUUA 2V1XA 2PN6A 2EFNA 2XVCA 1O3RA 1MW7A 2V1NA 3S1QJ 4KMUX 4EJOA 4A3CJ 3HOVJ 3CQZJ 3O3KA 2W1OA 1WRJA 3K4JA 3CESA 1VTNC 4BACA 4KDPA 3JAMK 3CUOA 3S32A 1SVMA 3T1BA 1U8RA 2RV8A 1TQIA 3ECHA 1V5FA 2DFFA 2PX9A 3K4MA 3N05A 3OIQA 1XSXA 1IW7F 3DQVC 1UB9A 3LA3A 1IO2A 1Z6TA 3ZMVA 4MTEA 3WTVC 3JRFA 1W7PD 2XDVA 3OY9A 1J2XA 3M8EA 5DYMA 1O3TA 1N78A 2J5OA 3LSJA 4A3MJ 2JUGA 3K0LA 2VLAA 3RZOJ 3QYEA 1OFCX 3ERED 1D0YA 2GXAA 4DBRA 2Y48A 4A0ZA 1ZGWA 3C7JA 1WFXA 1ZR2A 4I02A 3MFKA 2A68F 4RB2C 2KRHA 1JE8A 1UHMA 5DEQA 2LK2A 3QP5A 2PMUA 2VQLA 2VC0A 2ME6A 3IC7A 3KYCB 2PBIA 3GTKJ 3L2CA 1ON1A 1IXRC 1WH7A 2PQ8A 4IRGA 4RA2A 2DA2A 2K3PA 3BG6A 3FM3A 3NWSA 3IKVA 4M3BA 2ESNA 2HQNA 4ESBA 5D5WB 2ECBA 4B48A 1A04A 3OYNA 2L4AA 3GZ5A 3LQRA 2E36A 4ZC3A 3MKWB 5D5VB 1ZR4A 3DTIA 1SD5A 4Y7NJ 5HVQC 1JUMA 4BXUA 3M1EA 2D45A 2NNNA 4HZFA 1MNEA 4JP0A 1RKWA 4IQ4A 4XOTA 3MN2A 5HNFA 1TNTA 5B3SH 4XL9A 2HDWA 3WHBA 5E3NA 5FKLA 4Q5SF 2V6CA 3F22A 2MH2A 1ZYRF 5JR3A 1P7JA 2FE3A 4NB5A 2VKVA 1GXPA 1ZRFA 2VQCA 3MCZA 2ZXIA 2LKXA 1WI3A 2JVHA 3DXJF 3RYPA 4J19A 1RZ4A 1X3WB 2EV5A 4KT5C 3OYDA 2IW5A 3CCJI 1ERDA 4HNUA 3VFZA 3TO7A 1BOBA 2Z5UA 2GXBA 4BE0A 3SFIA 2M5WA 2R4GA 2QQ9A 2NVXJ 3DV8A 1OCOH 1APLC 3E6BA 2EZLA 2PEXA 1WVRA 1EV7A 2DN0A 4PGGA 2IPQX 2ISZA 2DAOA 5HDNA 4ZYDA 3SHFA 1R36A 3HC7A 2NS8A 4JBAA 1ZTRA 1R7JA 3ZQLA 3Q5FA 1QA6A 2M0MA 4M72A 1V54H 2CQ7A 1SAXA 3ZMTA 2Z16A 1MBJA 1YX5A 3ERMA 3VYUB 5GAEJ 2OU2A 2QKMB 2COMA 5EYRA 3I58A 4IHTA 3IKTA 2VQHA 2CV2A 2R7WA 1XN7A 2EV0A 2M9HA 3BLYA 5J1UA 2YU3A 1QU3A 2FXAA 3L9FA 3OOPA 5IYBJ 1STZA 4A3KJ 2IBDA 5E79C 3G73A 4M9XA 2NVQJ 2VBXA 3GEZA 3ONQA 2O9LA 1E2XA 4F55A 2VB6A 1VQLI 2EILH 4AVZA 4N0BA 1PUEE 1HA8A 1AA7A 2XV4S 4D5CA 1K7AA 3CUQB 2FU4A 4C2MJ 2M87A 3DKXA 1ZHFA 5M5WJ 3FMRA 1I6XA 1GHCA 2CFOA 2RAEA 1MJAA 2QM3A 3UKGA 3S16J 1LVAA 1OCCH 3S3OA 3C3WA 1I39A 5HS8A 3QAHA 4OIOF 5BPDA 1VQPI 2FF4A 1I27A 2IA2A 1QZYA 1XGNA 1RR8C 3BC8A 4PFPA 4OIRF 1QHHD 3FXJA 1HW1A 1NHAA 4RM3A 3DPTA 2LH9A 4JOMA 2XAJA 3VYRB 4KIBA 3VYSB 2KISA 4HAMA 1TWFJ 2E2HJ 2YR2A 3KP5A 1U6GA 2DA3A 2LY9A 4C3IJ 3N4MA 4AIKA 4FETA 3PNTA 2H1KA 1SD6A 2R7FA 1B6AA 3MZ8A 5LHIA 1R58A 3MMYB 3SZGA 1F5TA 3FWEA 2MH9A 4UUSB 4WK8F 1XDUA 3WE3A 2WAEA 2PJRB 1HQCA 3BTCA 4A6EA 2A6EF 2MC4A 2GAUA 4IHWA 4A3DJ 3TGNA 3JTGA 1BR1A 4D7NA 2YS9A 2E35A 1HSTA 2FNAA 2HWVA 2QA4I 2F5VA 1TW2A 2WAQA 3I9V2 3QOEA 1YJ9I 2BXYA 5E18F 3LSMA 2VKEA 5IOZA 1FT9A 2L54A 5LBQA 2CO5A 4C3JJ 2ZBKA 3HOSA 1FP1D 1TW3A 2F5EA 4YIIA 2IS2A 2KHMA 3KZYA 2JA5J 1WSUA 2DDAA 1BC8C 1WJCA 1K4TA 2ZMEB 3KYDB 4PFOA 1MBKA 2Y0SN 3RKWA 2WAFA 4A3JJ 3HRUA 2KIFA 1Y8RB 1ZG5A 4XIDA 1FSEA 3BJAA 1IGNA 1M1EB 4YFNF 2V79A 4F7ZA 2XRLA 2Y31A 3F8BA 5D5XB 4HLYA 2UV1A 2DMUA 2Z3YA 3F8NA 2O61A 4G8XA 1H88C 2QQ8A 4Z2YA 2HTSA 2OZUA 5LGUA 3JR9A 3NARA 4BQOA 1VZ0A 3I4PA 2M4GA 1UFMA 2ZC2A 2PJRA 2BHYA 2VN2A 2W84A 2IGNA 2E71A 1ETVA 1H8AC 3AL0C 4UVAA 3K69A 3RPUA 5JLWA 4CUGA 2KIUA 4MLOA 1RNLA 2MYSA 4UV9A 4KYWA 3M8JA 5HDKA 4CGZA 5CQGA 3SXYA 4LITA 1VQ9I 3W2VA 4V2FA 1USSA 3K4CA 3L2RA 1RUOA 3GTLJ 4D0PA 3H3VK 2EWNA 4PJJA 3A0BC 3CCVI 2DT5A 2VT2A 4II3A 1HF0A 5FLXK 3RIRA 5M3FJ 2ZMEA 2BHZA 6PAXA 3HXLA 4G6QA 2HQRA 1ENHA 1F4KA 1SFXA 3D0SA 2HI3A 4HDUA 2JA7J 3NAUA 1YW8A 1NG7A 2HS5A 5J3LA 2CGPA 2DODA 2KKOA 1MH3A 4BH9A 3KP6A 4D7MA 5F0HA 5KHDA 1VQ5I 1FMVA 3O8GA 2DO7A 1ZQ3P 2CSOA 2FA5A 4A69C 4YG2F 1UMQA 3Q9SA 1PP8F 3M8FA 3RPUD 1TC3C 1RUNA 1BN5A 3S1NJ 2MG4A 2MLKA 4HQMA 5FB2A 4XLNF 4FE7A 4LK1F 1JTXA 1KQ9A 4XM3A 3OYBA 3BTLA 3FZVA 3RI4A 3GF2A 1ULYA 1JJ8C 2DA4A 5D8LB 2JRMA 2W48A 2YSRA 1EA3A 1S3JA 2ZO4A 2CW7A 2QLZA 4ZZLA 1Q1HA 2XAUA 4UHTA 3CCLI 1BBYA 1Z21A 3G3ZA 1Y0NA 2L0KA 3ZQ7A 3F9KA 2V9PA 1T0FA 5EEHA 2E1CA 1SAUA 2RQPA 1DQUA 5CJ9A 1IRFA 1X3UA 3GFIA 3H5RA 4PZJA 3KYLA 3HOTA 1SD7A 5EEGA 1J75A 4XSZF 1LJ9A 3B73A 1JKRC 4KFCA 2YU9J 5DUKA 4CYDA 3CO7C 1TQPA 2AO9A 1Q1VA 1VQOI 4M6VA 4XKWA 2CWEA 3H92A 4ZDPA 5ILVA 1IDYA 2BVLA 2M7AA 4RAZA 3KCCA 2IAIA 2XIGA 2O03A 2IGOA 2WC2A 5FFZA 5E8GA 1YX3A 3HIFA 4UUTA 2FJ1A 3E5QA 3MZYA 5J6XA 2L01A 4CDGA 2LD5A 4GGGA 1TLHB 3JRAA 3J80Z 4ZTFA 3L2VA 4BQAA 1UG2A 2M1BA 2R7RA 1CF7A 2I5UA 3H36A 1X1BA 2XAFA 3K4LA 2HVRA 2W4SA 5KK1A 1SMYF 5DD8A 3AKZA 2LNBA 4ZTJA 1EKEA 1TNSA 1FC3A 3C2GA 4OOIA 3P7NA 2EFOA 4HDVA 2OBPA 3SZTA 3HEFA 3WG7H 4E70A 2F5FA 1LKXA 1USTA 2NAZA 1WJ5A 4G7ZF 3S3NA 4M3FA 5TJJA 5LFAA 1CGPA 4OMZA 3HG9A 1D8KA 1R5ID 1BW6A 1T33A 1XGSA 2A5YB 4XN3A 2ZXHA 3L1PA 2EA4A 3HSEA 4LFUA 1GVDA 2QCOA 2XKOA 1WJDA 1K83J 1OYYA 2P7CB 3GFMA 2DFEA 1YW7A 3V7SA 2DQLA 4WX9A 2ZSHB 2JMWA 2O0YA 2FNPA 4XK4A 4CICA 4EQQA 4QSHA 3V8KA 1ZRCA 2Y9ZA 3PQJA 1T6SA 3CDHA 4WWCA 2R7VA 2RDPA 5LD2C 2HU9A 5EJCA 3QPSA 4UVBA 3PIPF 4LIUA 4HX7A 5HS7A 1D0XA 2FRHA 4EJVA 3RKXA 1O7FA 2DCEA 2ELJA 1XCVA 3ML6A 3F3XA 1I5ZA 1SFEA 3IH2A 3F23A 1C0WA 3JAMZ 1QZZA 2Y75A 1HC8A 2IXSA 1JGSA 1VQ6I 4PJLA 5GAGJ 2DLLA 3FK7A 3OL3A 1ZKGA 4B47A 1FYLA 3BPXA 4ENMA 3EQLF 3WE2A 2M34A 4WCGA 2K9NA 3DF8A 2K4JA 1B8IB 5ILSA 1NK3P 3TOAA 1BR2A 1WHUA 2HZDA 3ZMZA 3I59B 1QPIA 5IT3A 3ZQFA 3IL2A 3JRCA 3NWTA 1BIBA 3LA2A 3H9QA 1UHWA 2M8EA 3KZIC 2K9SA 4C2TA 1Z1DA 2XGCA 3L2WA 1F36A 2OPTA 1BJAA 2XF6A 1IAWA 1HW2A 1PVEA 3OL4A 3HTUA 2XSDC 3ELKA 3I3LA 2BZTA 4Y15A 2F2EA 2Z2SB 2E2IJ 2F5DA 1OJLA 3LNQA 3GW2A 2HVSA 2YPRA 1FIPA 4UUVA 1J7KA 4B3XA 2RNGA 5J8CA 4Q4ZF 1H89C 1X1AA 2BY3A 2E34A 4N9HA 4N4NB 3KLOA 3KETA 2X9DA 3I56I 3C1DA 3LSIA 4G94A 1MDMA 1B8IA 1W5CC 3BTIA 2HXOA 1UG0A 3L09A 3L00A 4KIFA 1XGOA 2HPMA 3T8TA 5FKOA 2CFXA 4IPAA 3I59A 2K86A 1D1AA 3CD6I 1YI2I 3E3VA 1FX7A 1YG2A 2ADUA 2D2WA 2RNJA 4WXDA 1K4SA 4O6JA 3MKYB 4DYQA 1V4RA 3ZN0A 1JUPA 4L0YB 2NYXA 1R1TA 2KLOA 4L9NA 1F1ZA 4DOZA 4RMNA 5D6FA 5F64A 3VOEA 4A6DA 2L7KA 3M9AA 2O3FA 3J7AY 1OQYA 5D6EA 3T8RA 5CLSA 3OYKA 2RVCA 1B72B 3QYBA 4DNCA 2CUFA 1LEAA 4IX7A 2W7NA 4HQEA 3CMYA 3CC4I 3V8JA 3U1DA 3OS1A 2DA5A 2GM4A 2LY2A 2K40A 4U87A 3JRDA 2KDOA 1JKQC 1QBJA 1W36C 1Z3XA 2COBA 3V7CA 3ZOBA 4BHBA 2ZXJA 3TP3A 5JVTA 3A01B 2EFWA 1ETXA 1IN6A 3ESWB 3TDUC 3SDGA 4OAZA 2L9VA 3LSGA 4C3HJ 4RLQA 4OU0A 2HQ5A 2LRDA 4MHGA 1RR7A 2LF7A 2P81A 3RTRA 5LHHA 5ED4A 5E3MA 2HYGD 3ABLH 2DJIA 1R4MB 4OAYA 4D1QA 1QHGA 4JK1X 2D1HA 5L3CA 4F93B 5CVRA 1Z7UA 2NS0A 3G1MA 3GFLA 1G3WA 1REPC 3HRSA 4MFDA 1MD0A 1ETYA 1W5SA 2DPDA 2ELKA 2Z1DA 1LDJA 3EYIA 1FP2A 3BZ6A 1FSHA 3KPHA 1X58A 2JVGA 3D1NI 1B72A 3G71I 3DBHB 1ZAOA 3HUGA 2MA3A 3CCYA 4RB3C 4K2EA 2M3AA 5F1JA 3IH3A 4XQFA 1RKTA 4CYCB 5H6RA 2ZNYA 3OYFA 4XMYA 1ZGAA 4ENKA 1LEBA 4OIPF 4EJWA 4OINF 1ODDA 3LSPA 3A01A 5FFXA 3BZKA 1U78A 3BJ6A 2NS7A 1B4AA 1ZREA 4HNVA 2EV6A 4OIQF 4AD9A 1OYWA 1WPKA 2BOLA 1MMAA 2X6YA 4F52A 3GLLA 3CF5F 1LE8A 1VQ8I 1KQ0A 1YIJI 4LJZF 1HSJA
chains in the Genus database with same CATH topology
3V4GA 5ICCA 4KN4X 3FX3A 1YLFA 2BYVE 3R0AA 2E7WA 2CYYA 3KZZA 2W57A 4NHJA 3W6JB 4IF4A 2KRFA 1OYIA 3WTWC 3W6KB 3TO6A 2PI0A 1KU9A 4G7HF 3KP2A 2H09A 4BAYA 1HKQA 4L5IA 4S04A 2L4MA 3ABTA 1YYVA 2CW0F 4HBLA 4GCVA 1I1GA 3U9GA 5L3FA 1SMTA 1S7OA 2X4HA 3SQNA 4G7OF 2QZ8A 2ACJA 1O57A 3WTUC 2GXGA 5LLQA 2HEOA 3HHGA 3ISPA 4FHTA 1I1SA 4HOBA 3WGGA 1L0OC 5FLXZ 5FD6A 5L3GA 5E17F 2VODA 3QU3A 2UWMA 2FSWA 3V7RA 4HX8A 1Z05A 1WKMA 3F8CA 3ZN1A 4A0YA 1SD4A 1ZG1A 1IN4A 4LGWA 2XROA 1SFUA 2VOPA 2A07F 2PG4A 5HLHA 3WG9A 1MJBA 2OQRA 3O2PE 4RB1A 1ZRDA 1R5HA 3ECOA 3FMSA 2F5CA 4MNUA 3VB2A 4EGZA 3GFJA 5E1ZB 2EK5A 1D8JA 3PFIA 5HS9A 1DDNA 4O5VA 4HF2A 1KGSA 1FZPB 4RB0A 3D5LA 5LRSA 2WV0A 5E1WA 2ZCWA 1IUYA 3WGHA 3MQ0A 4RGSA 1IXSB 2AS5F 1IN5A 1ZN2A 3CLOA 1XCBA 4LMYA 3K1PA 3CUQA 1Z6RA 3GUDA 4LB6B 2KIMA 3C18A 1Z9CA 2FOKA 4L5JA 2DI3A 3BY6A 2OAZA 2O6GE 3E5XA 2JTVA 1GVJA 4UVCA 1V3FA 2VONA 3HSFA 5BPIA 5E20A 1R1UA 1AOYA 2FMYA 4M6YA 3M7GA 2XAQA 3T5XA 1XSVA 1D3YA 4GO1A 3TKYA 1G6NA 5HLIA 2VBYA 2XAGA 1PDNC 2PMHA 3KFWX 2H6CA 1K78B 2G7UA 4CHUA 2XAHA 1WI9A 3KP7A 1W4MA 1AWCA 4EGYA 1P92A 4RAYA 1LDDA 5K1YA 1ZG3A 4EV0A 5FO5A 1R23A 2HR3A 4FT8A 2XASA 3GX4X 5DUIA 5E1XA 2K02A 5A2QK 2C6YA 3V8LA 4RGXA 3H3ZA 3BJOA 5KVRA 1ZLKA 2Q8KA 2Q2EA 1R1VA 3RYRA 1BI3A 4AVPA 2YX4A 1K79A 1EH6A 4AIJA 1K78A 2IRFG 4WXCA 3WTYC 2WTEA 2IT0A 2BGCA 2M30A 1P2FA 1MKMA 1FBSA 2B0LA 3RPQA 1L3LA 3J7AO 2V9VA 1KA8A 3RJPA 1RIOH 3S2WA 3DP7A 2CG4A 1DPRA 3RDIA 1ON2A 1S29A 1QGPA 4MQ9F 2W25A 2P7VB 4M6XA 1T98A 3HRMA 1IRGA 1XMAA 1FY7A 1EH8A 2HYFA 1FPQA 1R22A 1KQ8A 2DU9A 2G7HA 1XD7A 2E7XA 1BI2A 1U5TB 5DV5A 2DPUA 4GYIA 5TRDA 4I09A 4UNOA 3IWFA 4A5MA 5LGTA 3SFZA 2D1VA 3MEXA 3K1MA 2DTRA 3WU1B 3JW4A 4XBFA 3GYHX 2LDUA 4DQ2A 4KA4A 3TQNA 5JI6A 3BWGA 3HTSB 1J59A 5JHUA 4EM2A 2RGVA 3WTTC 4YFXF 3HRTA 5LRRA 3OV8A 3R61A 2A6HF 1B9NA 4JQFA 2MBFA 2MD5A 4P96A 4EVIA 1U5TA 4QLCU 4ZYEA 3EETA 4XSXF 1WWXA 1H9GA 4LLGF 4ENJA 3KE2A 4XLPF 2Z99A 4M9ZA 2VT3A 3QOPA 4WXHA 5D8KB 4IRIA 4A12A 2LKPA 3EUHA 4U0WA 4RS8A 4U7DA 4I2OA 3WTSC 4IJAA 5D4RA 1QQIA 1G4DA 4M74A 5D4SA 2HKOA 3IHUA 4ESFA 5AIQA 4U7BA 1FWZA 2EJRA 1UCRA 5IT9Z 2DK8A 2IP2A 5BS6A 3CUQC 3E5UA 4CZZA 1RI7A 1BC7C 3BDDA 4QWQA 2K27A 4HV6A 3WTXC 3GVAA 3VODA 4I0BA 3F8MA 3AAFA 2VE9A 5FD5A 1OKRA 5LGNA 2UXNA 4ON0A 1HW5A 3BROA 4HA8A 4ESJA 4O3MA 2QWWA 2M45A 5L3EA 3COAC 2JRTA 1DUXC 2QENA 3ZMSA 2R3SA 1ZARA 1U2WA 3IRRA 5H20A 1P4AA 4ZZDA 4ASNA 4MEYF 5CVVA 3N97A 2ZFWA 2K7LA 3DKWA 4ENNA 1S7AA 5ERIA 1XGMA 3F6VA 5H6QA 4EM0B 3F8FA 5L3BA 4HV5A 5AONA 1IN8A 3FM5A 4PCQA 1B9MA 4IXAA 5D5UB 2VXZA 3IRQA 5ICEA 1LNWA 3QP6A 1QO0D 1EH7A 3LA7A 1FBUA 3T0YA 1T38A 3JTHA 1D5VA 4ZYGA 3FHZA 4HF0A 3P9KA 3F72A 2ISYA 2A69F 2ZJ2A 2VBZA 3R4KA 2P5VA 2Y0MA 4P5OA 2QBYB 4GYGA 1XDSA 1FBQA 4LG0B 5AIPA 3H3UA 3WTZA 3QRFF 4L18B 2P6TA 2HGCA 1PP7U 1XSDA 3KLNA 4MGRA 2JPBA 3B02A 2BEOA 1FOKA 2P8TA 4LD5A 3DPLC 5IT9K 1BI1A 1HXDA 2HDCA 4LLNA 2L02A 3JSPA 3QPHA 2QBYA 4HW0A 2WWYA 3LQQA 2HZTA 2JPCA 4B8XA 1TQMA 1QNTA 4B09A 4BYYA 4LG0A 2E1NA 3BP8A 1T39A 5F6FA 1P4WA 1YO5C 1YS6A 4IVNA 3J81Z 2ETHA 1HKTA 4UV8A 5CYVA 5DD4A 4HX4A 1FLIA 5BQTA 2UXXA 1G3YA 1TTYA 4R79A 1Z91A 1KYZA 3E6DA 4ZYHA 2MLGA 1LDKB 5K5OA 3KP4A 3KEOA 3P9CA 2FMLA 2H94A 4BHCA 3SZPA 1U5TC 3L7WA 1B1BA 2EB7A 2RC4A 3GO5A 4LB5A 2GZWA 5E8IA 3DEUA 2Z33A 3IWZA 4L0ZB 3K2ZA 4KMFA 2OD5A 5HDGA 1P4XA 1ZH5A 3R0JA 4MTDA 3LSTA 3KP3A 4U0VA 5A2QZ 1R00A 3I54A 3FF5A 2VOOA 4KN7X 4RGRA 4EMSA 1HBXG 2L3DA 1BI0A 4PGHA 4IRHA 2J5PA 1O3SA 5CVIA 3WU0A 3ZPLA 3O6BB 4KNYA 1KU2A 3R6SA 1ZLJA 3NQOA 2R7DA 3VEPA 2ESHA 3LAPA 1B59A 4MQVA 3TDZC 5ILUA 1H0MA 1IXCA 2FBIA 2OA4A 3CTAA 3TOBA 2YX7A 3EDPA 5BOXA 4L9TA 2ZNZA 3Q9VA 2MC3A 3KEQA 1G3SA 1S6LA 4KUMA 4HLXA 3J81K 2FBKA 2STWA 5L3DA 1JHFA 2OQGA 4U88A 5K5QA 1MGTA 2AXLA 4G9YA 1E17A 4LK0F 3ZP5A 2IA0A 2IA1A 2X0LA 2GA2A 4ZH4F 3GWZA 4YFKF 5K5RA 3I71A 5LEKA 2FEZA 2IJLA 1LB2A 1J5YA 3BOQA 3WODF 5HLGA 2QYOA 4KIGA 2Q0OA 2GIVA 2IVMA 2KJBA 3TO9A 5ICFA 2ZKZA 4LLLA 4M71A 1KU7A 2JZYA 4Q47A 1YFHA 2W24A 1YW9A 2GA1A 4P9FA 1K6OA 4NQWA 3MZHA 1OPCA 5ICGA 1IN7A 1FNNA 4S05A 2A61A 2VC1A 1MJ9A 2OZ6A 2BBYA 2PLYA 4M73A 1O7LA 3WGIA 1J0RA 3I53A 1T2KA 4I98B 2DW4A 3HHHA 3FXQA 1BM9A 4XRFA 3ULQB 4TV7A 1F9NA 2HFHA 2DFIA 2K4BA 2W85A 4A5NA 1CF7B 4A0XA 4G6DA 3DFGA 5CVJA 3HSRA 3BPVA 2Z9OA 1DP7P 2TDXA 1YS7A 2VE8A 1O3QA 2P6SA 1S8NA 4GXOA 4YIFA 4EM1A 2ELHA 3QPTA 2FQ3A 3R60A 2UZKA 1LQ1A 2GQQA 3ZMDA 1TBXA 2QQAA 2JT1A 1KYWA 1ONVA 1JHHA 3NRVA 1BOAA 3REOA 1YTYA 4Q48A 1XB4A 2H6BA 5DDGA 4EJTA 3ROUA 1J9IA 2PFBA 2XRNA 3JSOA 2RN7A 2NRAC 1XMKA 2FBHA 2P5KA 4U0YA 3FMQA 1Y0UA 3HYIA 2XHKA 1WQ2A 2QQBA 4L9VA 4CXFA 2EFPA 1YIOA 4MEXF 1BIAA 3I0TA 4KICA 3U2RA 2H27A 4ETSA 1DPUA 4A2UA 2RKHA 3QU6A 2XGXA 3E6MA 1OR7A 4HF1A 1G3TA 4FX4A 5J8FA 2BV6A 2JSCA 4IHSA 4PDKA 5CVUA 4EJUA 3LFKA 3PQKA 1OMIA 5DCMB 1MDMB 3GZ6A 3FXRA 4R8HA 1HKSA 4AIHA 2G9WA 2NNYA 5HOOA 4Y13A 2STTA 1IZ1A 5F1RA 1R5GA 5LHGA 5BMZA 3GLXA 2XKPA 1KU3A 2HTJA 3RKYA 3I64A 4WF2A 3ZMUA 4RGUA 4I7HA 4L9JA 2DBBA 4I01A 2V1UA 1P6RA 4CO8A 5FGMA 2VBWA 3E97A 1YQAA 4BNCA 4M9SA 4P55A 4Y17A 3LAJA 2EA2A 3MAJA 3EYYA 1ZGJA 2CQKA 5DCMA 2LSOA 1W7PB 2XUBA 4FX0A 2HKXA 2V1DA 3F21A 4HYEA 2HOEA 3FXUA 2DK5A 4OMYA 1MZBA 3ABUA 3E6CC 3LWFA 1GXQA 3J80K 4BHPA 2BE5F 4UXNA 2QVOA 5LEJA 4N9IA 3K1NA 4P9UA 5DCFA 1FYKA 4R1HA 1U3EM 1W5TA 2P4WA 3CJNA 3F6OA 1JXSA 2A3SA 2PJPA 1W7PA 5JFRA 3GXOA 3MWMA 3P9IA 3NEUA 3I5UA 3K9TA 2QUFA 2LF8A 4AWXB 2GWRA 2P5LC 4H0EA 2EFQA 1IF1A 2O8XA 1QPMA 1FYMA 2KJCA 4I0AA 1H9TA 3CO6C 2DQRA 2V1XA 2PN6A 2EFNA 2XVCA 1O3RA 4KMUX 4EJOA 3O3KA 1WRJA 4KDPA 1VTNC 3JAMK 3CUOA 1U8RA 3T1BA 2RV8A 1TQIA 3ECHA 1XSXA 1IW7F 3DQVC 1UB9A 3LA3A 1Z6TA 3ZMVA 4MTEA 3WTVC 1W7PD 1J2XA 3M8EA 5DYMA 1O3TA 2J5OA 3K0LA 3ERED 2Y48A 4A0ZA 3C7JA 4I02A 3MFKA 2A68F 4RB2C 1JE8A 1UHMA 5DEQA 3QP5A 2PMUA 2VC0A 3IC7A 2PBIA 3L2CA 1ON1A 1IXRC 2PQ8A 4IRGA 3FM3A 3IKVA 2ESNA 2HQNA 4ESBA 5D5WB 1A04A 2L4AA 3GZ5A 3LQRA 5D5VB 1SD5A 5HVQC 4BXUA 3M1EA 2D45A 2NNNA 4HZFA 1TNTA 4Q5SF 2V6CA 3F22A 2MH2A 1ZYRF 5JR3A 2FE3A 4NB5A 1GXPA 1ZRFA 3MCZA 3DXJF 3RYPA 1RZ4A 2EV5A 4KT5C 2IW5A 3VFZA 3TO7A 2Z5UA 2GXBA 2M5WA 2QQ9A 3DV8A 3E6BA 2PEXA 1EV7A 4PGGA 2IPQX 2ISZA 2DAOA 5HDNA 4ZYDA 3SHFA 1R36A 4JBAA 3Q5FA 1R7JA 4M72A 1SAXA 3ZMTA 2OU2A 2COMA 3I58A 4IHTA 3IKTA 1XN7A 2EV0A 2YU3A 2FXAA 3L9FA 3OOPA 1STZA 3G73A 4M9XA 2VBXA 3GEZA 1E2XA 1PUEE 4N0BA 2XV4S 1K7AA 3CUQB 2FU4A 2M87A 1ZHFA 3FMRA 1I6XA 1GHCA 1MJAA 2QM3A 1LVAA 3C3WA 5HS8A 3QAHA 4OIOF 5BPDA 2FF4A 1I27A 2IA2A 1QZYA 1XGNA 4OIRF 1HW1A 1NHAA 3DPTA 2XAJA 4KIBA 4HAMA 2YR2A 3KP5A 1U6GA 3N4MA 4AIKA 1SD6A 2R7FA 1B6AA 5LHIA 1R58A 1F5TA 3FWEA 2MH9A 4WK8F 1XDUA 3WE3A 1HQCA 4A6EA 2A6EF 2GAUA 3TGNA 3JTGA 1HSTA 2FNAA 2HWVA 1TW2A 5E18F 1FT9A 2L54A 5LBQA 2CO5A 2ZBKA 3HOSA 1FP1D 1TW3A 2F5EA 4YIIA 3KZYA 1WSUA 1BC8C 2ZMEB 3RKWA 3HRUA 2KIFA 1ZG5A 1FSEA 3BJAA 4YFNF 2V79A 4F7ZA 3F8BA 5D5XB 4HLYA 2Z3YA 3F8NA 2O61A 4G8XA 4Z2YA 2HTSA 2OZUA 5LGUA 3I4PA 1UFMA 2VN2A 2W84A 4UVAA 3K69A 3RPUA 2KIUA 4UV9A 1RNLA 4KYWA 5HDKA 4CGZA 3SXYA 1USSA 1RUOA 4D0PA 2EWNA 2DT5A 2VT2A 5FLXK 3RIRA 2ZMEA 6PAXA 4G6QA 2HQRA 1F4KA 1SFXA 3D0SA 4HDUA 1YW8A 2HS5A 2CGPA 2KKOA 4BH9A 3KP6A 2DO7A 2CSOA 2FA5A 4YG2F 3Q9SA 1PP8F 3M8FA 1RUNA 1BN5A 2MLKA 4HQMA 5FB2A 4XLNF 4LK1F 1KQ9A 3FZVA 3RI4A 3GF2A 1ULYA 5D8LB 2YSRA 1S3JA 2ZO4A 2QLZA 4ZZLA 1Q1HA 4UHTA 1BBYA 3G3ZA 3ZQ7A 1T0FA 5EEHA 2E1CA 2RQPA 5CJ9A 1IRFA 1X3UA 3GFIA 3HOTA 4PZJA 1SD7A 5EEGA 1J75A 4XSZF 1LJ9A 3B73A 4KFCA 5DUKA 4CYDA 3CO7C 1TQPA 2CWEA 3H92A 5ILVA 4RAZA 3KCCA 2XIGA 2O03A 2WC2A 5FFZA 5E8GA 3HIFA 3E5QA 3MZYA 5J6XA 2L01A 4CDGA 4GGGA 1TLHB 3J80Z 4BQAA 2M1BA 1CF7A 2XAFA 5KK1A 1SMYF 5DD8A 2LNBA 1TNSA 1FC3A 4OOIA 3P7NA 2EFOA 4HDVA 2OBPA 3SZTA 4E70A 2F5FA 1USTA 2NAZA 4G7ZF 5TJJA 1CGPA 4OMZA 1D8KA 1XGSA 2A5YB 2EA4A 3HSEA 4LFUA 2XKOA 2P7CB 1OYYA 3GFMA 1YW7A 3V7SA 2DQLA 4WX9A 2O0YA 2FNPA 4CICA 4EQQA 1ZRCA 3V8KA 3PQJA 1T6SA 3CDHA 4WWCA 2RDPA 4UVBA 5HS7A 4HX7A 2FRHA 4EJVA 3RKXA 1O7FA 1XCVA 3ML6A 3F3XA 1I5ZA 1SFEA 3F23A 1C0WA 3JAMZ 1QZZA 2Y75A 1JGSA 2DLLA 1FYLA 3BPXA 4ENMA 3EQLF 3WE2A 4WCGA 3DF8A 2K4JA 5ILSA 3TOAA 3ZMZA 3I59B 5IT3A 3IL2A 1BIBA 3LA2A 1UHWA 2M8EA 1Z1DA 1BJAA 1IAWA 1HW2A 3HTUA 3ELKA 4Y15A 2F2EA 2F5DA 3GW2A 2YPRA 4UUVA 1J7KA 5J8CA 4Q4ZF 4N9HA 3KLOA 3KETA 3C1DA 4G94A 1MDMA 3L09A 3L00A 4KIFA 1XGOA 3T8TA 2CFXA 4IPAA 3I59A 2K86A 3E3VA 1FX7A 1YG2A 2ADUA 2D2WA 2RNJA 4WXDA 4O6JA 1V4RA 3ZN0A 4L0YB 2NYXA 1R1TA 4L9NA 1F1ZA 5D6FA 5F64A 3VOEA 4A6DA 3M9AA 2O3FA 5D6EA 3T8RA 5CLSA 2RVCA 4DNCA 1LEAA 4HQEA 3V8JA 3U1DA 1QBJA 3V7CA 4BHBA 2ZXJA 5JVTA 2EFWA 1IN6A 3TDUC 4OU0A 4MHGA 2LF7A 5LHHA 5ED4A 3RTRA 2HYGD 4JK1X 2D1HA 5L3CA 5CVRA 1Z7UA 2NS0A 3GFLA 1G3WA 1REPC 3HRSA 1MD0A 1W5SA 2DPDA 1LDJA 3EYIA 1FP2A 3BZ6A 1FSHA 1ZAOA 3HUGA 2MA3A 4RB3C 4K2EA 5H6RA 2ZNYA 1ZGAA 4ENKA 1LEBA 4OIPF 4EJWA 4OINF 1ODDA 5FFXA 1U78A 3BJ6A 1B4AA 1ZREA 4OIQF 2EV6A 4AD9A 1OYWA 1KQ0A 4LJZF 1HSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  5ICC A;  4KN4 X;  3FX3 A;  1YLF A;  2BYV E;  3R0A A;  2E7W A;  2CYY A;  3KZZ A;  2W57 A;  4NHJ A;  3W6J B;  4IF4 A;  2KRF A;  1OYI A;  3WTW C;  3W6K B;  3TO6 A;  2PI0 A;  1KU9 A;  4G7H F;  3KP2 A;  2H09 A;  4BAY A;  1HKQ A;  4L5I A;  4S04 A;  2L4M A;  3ABT A;  1YYV A;  2CW0 F;  4HBL A;  4GCV A;  1I1G A;  3U9G A;  5L3F A;  1SMT A;  1S7O A;  2X4H A;  3SQN A;  4G7O F;  2QZ8 A;  2ACJ A;  1O57 A;  3WTU C;  2GXG A;  5LLQ A;  2HEO A;  3HHG A;  3ISP A;  4FHT A;  1I1S A;  4HOB A;  3WGG A;  1L0O C;  5FLX Z;  5FD6 A;  5L3G A;  5E17 F;  2VOD A;  3QU3 A;  2UWM A;  2FSW A;  3V7R A;  4HX8 A;  1Z05 A;  1WKM A;  3F8C A;  3ZN1 A;  4A0Y A;  1SD4 A;  1ZG1 A;  1IN4 A;  4LGW A;  2XRO A;  1SFU A;  2VOP A;  2A07 F;  2PG4 A;  5HLH A;  3WG9 A;  1MJB A;  2OQR A;  3O2P E;  4RB1 A;  1ZRD A;  1R5H A;  3ECO A;  3FMS A;  2F5C A;  4MNU A;  3VB2 A;  4EGZ A;  3GFJ A;  5E1Z B;  2EK5 A;  1D8J A;  3PFI A;  5HS9 A;  1DDN A;  4O5V A;  4HF2 A;  1KGS A;  1FZP B;  4RB0 A;  3D5L A;  5LRS A;  2WV0 A;  5E1W A;  2ZCW A;  1IUY A;  3WGH A;  3MQ0 A;  4RGS A;  1IXS B;  2AS5 F;  1IN5 A;  1ZN2 A;  3CLO A;  1XCB A;  4LMY A;  3K1P A;  3CUQ A;  1Z6R A;  3GUD A;  4LB6 B;  2KIM A;  3C18 A;  1Z9C A;  2FOK A;  4L5J A;  2DI3 A;  3BY6 A;  2OAZ A;  2O6G E;  3E5X A;  2JTV A;  1GVJ A;  4UVC A;  1V3F A;  2VON A;  3HSF A;  5BPI A;  5E20 A;  1R1U A;  1AOY A;  2FMY A;  4M6Y A;  3M7G A;  2XAQ A;  3T5X A;  1XSV A;  1D3Y A;  4GO1 A;  3TKY A;  1G6N A;  5HLI A;  2VBY A;  2XAG A;  1PDN C;  2PMH A;  3KFW X;  2H6C A;  1K78 B;  2G7U A;  4CHU A;  2XAH A;  1WI9 A;  3KP7 A;  1W4M A;  1AWC A;  4EGY A;  1P92 A;  4RAY A;  1LDD A;  5K1Y A;  1ZG3 A;  4EV0 A;  5FO5 A;  1R23 A;  2HR3 A;  4FT8 A;  2XAS A;  3GX4 X;  5DUI A;  5E1X A;  2K02 A;  5A2Q K;  2C6Y A;  3V8L A;  4RGX A;  3H3Z A;  3BJO A;  5KVR A;  1ZLK A;  2Q8K A;  2Q2E A;  1R1V A;  3RYR A;  1BI3 A;  4AVP A;  2YX4 A;  1K79 A;  1EH6 A;  4AIJ A;  1K78 A;  2IRF G;  4WXC A;  3WTY C;  2WTE A;  2IT0 A;  2BGC A;  2M30 A;  1P2F A;  1MKM A;  1FBS A;  2B0L A;  3RPQ A;  1L3L A;  3J7A O;  2V9V A;  1KA8 A;  3RJP A;  1RIO H;  3S2W A;  3DP7 A;  2CG4 A;  1DPR A;  3RDI A;  1ON2 A;  1S29 A;  1QGP A;  4MQ9 F;  2W25 A;  2P7V B;  4M6X A;  1T98 A;  3HRM A;  1IRG A;  1XMA A;  1FY7 A;  1EH8 A;  2HYF A;  1FPQ A;  1R22 A;  1KQ8 A;  2DU9 A;  2G7H A;  1XD7 A;  2E7X A;  1BI2 A;  1U5T B;  5DV5 A;  2DPU A;  4GYI A;  5TRD A;  4I09 A;  4UNO A;  3IWF A;  4A5M A;  5LGT A;  3SFZ A;  2D1V A;  3MEX A;  3K1M A;  2DTR A;  3WU1 B;  3JW4 A;  4XBF A;  3GYH X;  2LDU A;  4DQ2 A;  4KA4 A;  3TQN A;  5JI6 A;  3BWG A;  3HTS B;  1J59 A;  5JHU A;  4EM2 A;  2RGV A;  3WTT C;  4YFX F;  3HRT A;  5LRR A;  3OV8 A;  3R61 A;  2A6H F;  1B9N A;  4JQF A;  2MBF A;  2MD5 A;  4P96 A;  4EVI A;  1U5T A;  4QLC U;  4ZYE A;  3EET A;  4XSX F;  1WWX A;  1H9G A;  4LLG F;  4ENJ A;  3KE2 A;  4XLP F;  2Z99 A;  4M9Z A;  2VT3 A;  3QOP A;  4WXH A;  5D8K B;  4IRI A;  4A12 A;  2LKP A;  3EUH A;  4U0W A;  4RS8 A;  4U7D A;  4I2O A;  3WTS C;  4IJA A;  5D4R A;  1QQI A;  1G4D A;  4M74 A;  5D4S A;  2HKO A;  3IHU A;  4ESF A;  5AIQ A;  4U7B A;  1FWZ A;  2EJR A;  1UCR A;  5IT9 Z;  2DK8 A;  2IP2 A;  5BS6 A;  3CUQ C;  3E5U A;  4CZZ A;  1RI7 A;  1BC7 C;  3BDD A;  4QWQ A;  2K27 A;  4HV6 A;  3WTX C;  3GVA A;  3VOD A;  4I0B A;  3F8M A;  3AAF A;  2VE9 A;  5FD5 A;  1OKR A;  5LGN A;  2UXN A;  4ON0 A;  1HW5 A;  3BRO A;  4HA8 A;  4ESJ A;  4O3M A;  2QWW A;  2M45 A;  5L3E A;  3COA C;  2JRT A;  1DUX C;  2QEN A;  3ZMS A;  2R3S A;  1ZAR A;  1U2W A;  3IRR A;  5H20 A;  1P4A A;  4ZZD A;  4ASN A;  4MEY F;  5CVV A;  3N97 A;  2ZFW A;  2K7L A;  3DKW A;  4ENN A;  1S7A A;  5ERI A;  1XGM A;  3F6V A;  5H6Q A;  4EM0 B;  3F8F A;  5L3B A;  4HV5 A;  5AON A;  1IN8 A;  3FM5 A;  4PCQ A;  1B9M A;  4IXA A;  5D5U B;  2VXZ A;  3IRQ A;  5ICE A;  1LNW A;  3QP6 A;  1QO0 D;  1EH7 A;  3LA7 A;  1FBU A;  3T0Y A;  1T38 A;  3JTH A;  1D5V A;  4ZYG A;  3FHZ A;  4HF0 A;  3P9K A;  3F72 A;  2ISY A;  2A69 F;  2ZJ2 A;  2VBZ A;  3R4K A;  2P5V A;  2Y0M A;  4P5O A;  2QBY B;  4GYG A;  1XDS A;  1FBQ A;  4LG0 B;  5AIP A;  3H3U A;  3WTZ A;  3QRF F;  4L18 B;  2P6T A;  2HGC A;  1PP7 U;  1XSD A;  3KLN A;  4MGR A;  2JPB A;  3B02 A;  2BEO A;  1FOK A;  2P8T A;  4LD5 A;  3DPL C;  5IT9 K;  1BI1 A;  1HXD A;  2HDC A;  4LLN A;  2L02 A;  3JSP A;  3QPH A;  2QBY A;  4HW0 A;  2WWY A;  3LQQ A;  2HZT A;  2JPC A;  4B8X A;  1TQM A;  1QNT A;  4B09 A;  4BYY A;  4LG0 A;  2E1N A;  3BP8 A;  1T39 A;  5F6F A;  1P4W A;  1YO5 C;  1YS6 A;  4IVN A;  3J81 Z;  2ETH A;  1HKT A;  4UV8 A;  5CYV A;  5DD4 A;  4HX4 A;  1FLI A;  5BQT A;  2UXX A;  1G3Y A;  1TTY A;  4R79 A;  1Z91 A;  1KYZ A;  3E6D A;  4ZYH A;  2MLG A;  1LDK B;  5K5O A;  3KP4 A;  3KEO A;  3P9C A;  2FML A;  2H94 A;  4BHC A;  3SZP A;  1U5T C;  3L7W A;  1B1B A;  2EB7 A;  2RC4 A;  3GO5 A;  4LB5 A;  2GZW A;  5E8I A;  3DEU A;  2Z33 A;  3IWZ A;  4L0Z B;  3K2Z A;  4KMF A;  2OD5 A;  5HDG A;  1P4X A;  1ZH5 A;  3R0J A;  4MTD A;  3LST A;  3KP3 A;  4U0V A;  5A2Q Z;  1R00 A;  3I54 A;  3FF5 A;  2VOO A;  4KN7 X;  4RGR A;  4EMS A;  1HBX G;  2L3D A;  1BI0 A;  4PGH A;  4IRH A;  2J5P A;  1O3S A;  5CVI A;  3WU0 A;  3ZPL A;  3O6B B;  4KNY A;  1KU2 A;  3R6S A;  1ZLJ A;  3NQO A;  2R7D A;  3VEP A;  2ESH A;  3LAP A;  1B59 A;  4MQV A;  3TDZ C;  5ILU A;  1H0M A;  1IXC A;  2FBI A;  2OA4 A;  3CTA A;  3TOB A;  2YX7 A;  3EDP A;  5BOX A;  4L9T A;  2ZNZ A;  3Q9V A;  2MC3 A;  3KEQ A;  1G3S A;  1S6L A;  4KUM A;  4HLX A;  3J81 K;  2FBK A;  2STW A;  5L3D A;  1JHF A;  2OQG A;  4U88 A;  5K5Q A;  1MGT A;  2AXL A;  4G9Y A;  1E17 A;  4LK0 F;  3ZP5 A;  2IA0 A;  2IA1 A;  2X0L A;  2GA2 A;  4ZH4 F;  3GWZ A;  4YFK F;  5K5R A;  3I71 A;  5LEK A;  2FEZ A;  2IJL A;  1LB2 A;  1J5Y A;  3BOQ A;  3WOD F;  5HLG A;  2QYO A;  4KIG A;  2Q0O A;  2GIV A;  2IVM A;  2KJB A;  3TO9 A;  5ICF A;  2ZKZ A;  4LLL A;  4M71 A;  1KU7 A;  2JZY A;  4Q47 A;  1YFH A;  2W24 A;  1YW9 A;  2GA1 A;  4P9F A;  1K6O A;  4NQW A;  3MZH A;  1OPC A;  5ICG A;  1IN7 A;  1FNN A;  4S05 A;  2A61 A;  2VC1 A;  1MJ9 A;  2OZ6 A;  2BBY A;  2PLY A;  4M73 A;  1O7L A;  3WGI A;  1J0R A;  3I53 A;  1T2K A;  4I98 B;  2DW4 A;  3HHH A;  3FXQ A;  1BM9 A;  4XRF A;  3ULQ B;  4TV7 A;  1F9N A;  2HFH A;  2DFI A;  2K4B A;  2W85 A;  4A5N A;  1CF7 B;  4A0X A;  4G6D A;  3DFG A;  5CVJ A;  3HSR A;  3BPV A;  2Z9O A;  1DP7 P;  2TDX A;  1YS7 A;  2VE8 A;  1O3Q A;  2P6S A;  1S8N A;  4GXO A;  4YIF A;  4EM1 A;  2ELH A;  3QPT A;  2FQ3 A;  3R60 A;  2UZK A;  1LQ1 A;  2GQQ A;  3ZMD A;  1TBX A;  2QQA A;  2JT1 A;  1KYW A;  1ONV A;  1JHH A;  3NRV A;  1BOA A;  3REO A;  1YTY A;  4Q48 A;  1XB4 A;  2H6B A;  5DDG A;  4EJT A;  3ROU A;  1J9I A;  2PFB A;  2XRN A;  3JSO A;  2RN7 A;  2NRA C;  1XMK A;  2FBH A;  2P5K A;  4U0Y A;  3FMQ A;  1Y0U A;  3HYI A;  2XHK A;  1WQ2 A;  2QQB A;  4L9V A;  4CXF A;  2EFP A;  1YIO A;  4MEX F;  1BIA A;  3I0T A;  4KIC A;  3U2R A;  2H27 A;  4ETS A;  1DPU A;  4A2U A;  2RKH A;  3QU6 A;  2XGX A;  3E6M A;  1OR7 A;  4HF1 A;  1G3T A;  4FX4 A;  5J8F A;  2BV6 A;  2JSC A;  4IHS A;  4PDK A;  5CVU A;  4EJU A;  3LFK A;  3PQK A;  1OMI A;  5DCM B;  1MDM B;  3GZ6 A;  3FXR A;  4R8H A;  1HKS A;  4AIH A;  2G9W A;  2NNY A;  5HOO A;  4Y13 A;  2STT A;  1IZ1 A;  5F1R A;  1R5G A;  5LHG A;  5BMZ A;  3GLX A;  2XKP A;  1KU3 A;  2HTJ A;  3RKY A;  3I64 A;  4WF2 A;  3ZMU A;  4RGU A;  4I7H A;  4L9J A;  2DBB A;  4I01 A;  2V1U A;  1P6R A;  4CO8 A;  5FGM A;  2VBW A;  3E97 A;  1YQA A;  4BNC A;  4M9S A;  4P55 A;  4Y17 A;  3LAJ A;  2EA2 A;  3MAJ A;  3EYY A;  1ZGJ A;  2CQK A;  5DCM A;  2LSO A;  1W7P B;  2XUB A;  4FX0 A;  2HKX A;  2V1D A;  3F21 A;  4HYE A;  2HOE A;  3FXU A;  2DK5 A;  4OMY A;  1MZB A;  3ABU A;  3E6C C;  3LWF A;  1GXQ A;  3J80 K;  4BHP A;  2BE5 F;  4UXN A;  2QVO A;  5LEJ A;  4N9I A;  3K1N A;  4P9U A;  5DCF A;  1FYK A;  4R1H A;  1U3E M;  1W5T A;  2P4W A;  3CJN A;  3F6O A;  1JXS A;  2A3S A;  2PJP A;  1W7P A;  5JFR A;  3GXO A;  3MWM A;  3P9I A;  3NEU A;  3I5U A;  3K9T A;  2QUF A;  2LF8 A;  4AWX B;  2GWR A;  2P5L C;  4H0E A;  2EFQ A;  1IF1 A;  2O8X A;  1QPM A;  1FYM A;  2KJC A;  4I0A A;  1H9T A;  3CO6 C;  2DQR A;  2V1X A;  2PN6 A;  2EFN A;  2XVC A;  1O3R A;  4KMU X;  4EJO A;  3O3K A;  1WRJ A;  4KDP A;  1VTN C;  3JAM K;  3CUO A;  1U8R A;  3T1B A;  2RV8 A;  1TQI A;  3ECH A;  1XSX A;  1IW7 F;  3DQV C;  1UB9 A;  3LA3 A;  1Z6T A;  3ZMV A;  4MTE A;  3WTV C;  1W7P D;  1J2X A;  3M8E A;  5DYM A;  1O3T A;  2J5O A;  3K0L A;  3ERE D;  2Y48 A;  4A0Z A;  3C7J A;  4I02 A;  3MFK A;  2A68 F;  4RB2 C;  1JE8 A;  1UHM A;  5DEQ A;  3QP5 A;  2PMU A;  2VC0 A;  3IC7 A;  2PBI A;  3L2C A;  1ON1 A;  1IXR C;  2PQ8 A;  4IRG A;  3FM3 A;  3IKV A;  2ESN A;  2HQN A;  4ESB A;  5D5W B;  1A04 A;  2L4A A;  3GZ5 A;  3LQR A;  5D5V B;  1SD5 A;  5HVQ C;  4BXU A;  3M1E A;  2D45 A;  2NNN A;  4HZF A;  1TNT A;  4Q5S F;  2V6C A;  3F22 A;  2MH2 A;  1ZYR F;  5JR3 A;  2FE3 A;  4NB5 A;  1GXP A;  1ZRF A;  3MCZ A;  3DXJ F;  3RYP A;  1RZ4 A;  2EV5 A;  4KT5 C;  2IW5 A;  3VFZ A;  3TO7 A;  2Z5U A;  2GXB A;  2M5W A;  2QQ9 A;  3DV8 A;  3E6B A;  2PEX A;  1EV7 A;  4PGG A;  2IPQ X;  2ISZ A;  2DAO A;  5HDN A;  4ZYD A;  3SHF A;  1R36 A;  4JBA A;  3Q5F A;  1R7J A;  4M72 A;  1SAX A;  3ZMT A;  2OU2 A;  2COM A;  3I58 A;  4IHT A;  3IKT A;  1XN7 A;  2EV0 A;  2YU3 A;  2FXA A;  3L9F A;  3OOP A;  1STZ A;  3G73 A;  4M9X A;  2VBX A;  3GEZ A;  1E2X A;  1PUE E;  4N0B A;  2XV4 S;  1K7A A;  3CUQ B;  2FU4 A;  2M87 A;  1ZHF A;  3FMR A;  1I6X A;  1GHC A;  1MJA A;  2QM3 A;  1LVA A;  3C3W A;  5HS8 A;  3QAH A;  4OIO F;  5BPD A;  2FF4 A;  1I27 A;  2IA2 A;  1QZY A;  1XGN A;  4OIR F;  1HW1 A;  1NHA A;  3DPT A;  2XAJ A;  4KIB A;  4HAM A;  2YR2 A;  3KP5 A;  1U6G A;  3N4M A;  4AIK A;  1SD6 A;  2R7F A;  1B6A A;  5LHI A;  1R58 A;  1F5T A;  3FWE A;  2MH9 A;  4WK8 F;  1XDU A;  3WE3 A;  1HQC A;  4A6E A;  2A6E F;  2GAU A;  3TGN A;  3JTG A;  1HST A;  2FNA A;  2HWV A;  1TW2 A;  5E18 F;  1FT9 A;  2L54 A;  5LBQ A;  2CO5 A;  2ZBK A;  3HOS A;  1FP1 D;  1TW3 A;  2F5E A;  4YII A;  3KZY A;  1WSU A;  1BC8 C;  2ZME B;  3RKW A;  3HRU A;  2KIF A;  1ZG5 A;  1FSE A;  3BJA A;  4YFN F;  2V79 A;  4F7Z A;  3F8B A;  5D5X B;  4HLY A;  2Z3Y A;  3F8N A;  2O61 A;  4G8X A;  4Z2Y A;  2HTS A;  2OZU A;  5LGU A;  3I4P A;  1UFM A;  2VN2 A;  2W84 A;  4UVA A;  3K69 A;  3RPU A;  2KIU A;  4UV9 A;  1RNL A;  4KYW A;  5HDK A;  4CGZ A;  3SXY A;  1USS A;  1RUO A;  4D0P A;  2EWN A;  2DT5 A;  2VT2 A;  5FLX K;  3RIR A;  2ZME A;  6PAX A;  4G6Q A;  2HQR A;  1F4K A;  1SFX A;  3D0S A;  4HDU A;  1YW8 A;  2HS5 A;  2CGP A;  2KKO A;  4BH9 A;  3KP6 A;  2DO7 A;  2CSO A;  2FA5 A;  4YG2 F;  3Q9S A;  1PP8 F;  3M8F A;  1RUN A;  1BN5 A;  2MLK A;  4HQM A;  5FB2 A;  4XLN F;  4LK1 F;  1KQ9 A;  3FZV A;  3RI4 A;  3GF2 A;  1ULY A;  5D8L B;  2YSR A;  1S3J A;  2ZO4 A;  2QLZ A;  4ZZL A;  1Q1H A;  4UHT A;  1BBY A;  3G3Z A;  3ZQ7 A;  1T0F A;  5EEH A;  2E1C A;  2RQP A;  5CJ9 A;  1IRF A;  1X3U A;  3GFI A;  3HOT A;  4PZJ A;  1SD7 A;  5EEG A;  1J75 A;  4XSZ F;  1LJ9 A;  3B73 A;  4KFC A;  5DUK A;  4CYD A;  3CO7 C;  1TQP A;  2CWE A;  3H92 A;  5ILV A;  4RAZ A;  3KCC A;  2XIG A;  2O03 A;  2WC2 A;  5FFZ A;  5E8G A;  3HIF A;  3E5Q A;  3MZY A;  5J6X A;  2L01 A;  4CDG A;  4GGG A;  1TLH B;  3J80 Z;  4BQA A;  2M1B A;  1CF7 A;  2XAF A;  5KK1 A;  1SMY F;  5DD8 A;  2LNB A;  1TNS A;  1FC3 A;  4OOI A;  3P7N A;  2EFO A;  4HDV A;  2OBP A;  3SZT A;  4E70 A;  2F5F A;  1UST A;  2NAZ A;  4G7Z F;  5TJJ A;  1CGP A;  4OMZ A;  1D8K A;  1XGS A;  2A5Y B;  2EA4 A;  3HSE A;  4LFU A;  2XKO A;  2P7C B;  1OYY A;  3GFM A;  1YW7 A;  3V7S A;  2DQL A;  4WX9 A;  2O0Y A;  2FNP A;  4CIC A;  4EQQ A;  1ZRC A;  3V8K A;  3PQJ A;  1T6S A;  3CDH A;  4WWC A;  2RDP A;  4UVB A;  5HS7 A;  4HX7 A;  2FRH A;  4EJV A;  3RKX A;  1O7F A;  1XCV A;  3ML6 A;  3F3X A;  1I5Z A;  1SFE A;  3F23 A;  1C0W A;  3JAM Z;  1QZZ A;  2Y75 A;  1JGS A;  2DLL A;  1FYL A;  3BPX A;  4ENM A;  3EQL F;  3WE2 A;  4WCG A;  3DF8 A;  2K4J A;  5ILS A;  3TOA A;  3ZMZ A;  3I59 B;  5IT3 A;  3IL2 A;  1BIB A;  3LA2 A;  1UHW A;  2M8E A;  1Z1D A;  1BJA A;  1IAW A;  1HW2 A;  3HTU A;  3ELK A;  4Y15 A;  2F2E A;  2F5D A;  3GW2 A;  2YPR A;  4UUV A;  1J7K A;  5J8C A;  4Q4Z F;  4N9H A;  3KLO A;  3KET A;  3C1D A;  4G94 A;  1MDM A;  3L09 A;  3L00 A;  4KIF A;  1XGO A;  3T8T A;  2CFX A;  4IPA A;  3I59 A;  2K86 A;  3E3V A;  1FX7 A;  1YG2 A;  2ADU A;  2D2W A;  2RNJ A;  4WXD A;  4O6J A;  1V4R A;  3ZN0 A;  4L0Y B;  2NYX A;  1R1T A;  4L9N A;  1F1Z A;  5D6F A;  5F64 A;  3VOE A;  4A6D A;  3M9A A;  2O3F A;  5D6E A;  3T8R A;  5CLS A;  2RVC A;  4DNC A;  1LEA A;  4HQE A;  3V8J A;  3U1D A;  1QBJ A;  3V7C A;  4BHB A;  2ZXJ A;  5JVT A;  2EFW A;  1IN6 A;  3TDU C;  4OU0 A;  4MHG A;  2LF7 A;  5LHH A;  5ED4 A;  3RTR A;  2HYG D;  4JK1 X;  2D1H A;  5L3C A;  5CVR A;  1Z7U A;  2NS0 A;  3GFL A;  1G3W A;  1REP C;  3HRS A;  1MD0 A;  1W5S A;  2DPD A;  1LDJ A;  3EYI A;  1FP2 A;  3BZ6 A;  1FSH A;  1ZAO A;  3HUG A;  2MA3 A;  4RB3 C;  4K2E A;  5H6R A;  2ZNY A;  1ZGA A;  4ENK A;  1LEB A;  4OIP F;  4EJW A;  4OIN F;  1ODD A;  5FFX A;  1U78 A;  3BJ6 A;  1B4A A;  1ZRE A;  4OIQ F;  2EV6 A;  4AD9 A;  1OYW A;  1KQ0 A;  4LJZ F;  1HSJ A; 
#chains in the Genus database with same CATH topology
 4ABZ A;  3V4G A;  3A1Y A;  5FRN A;  2JQ7 A;  5ICC A;  4KN4 X;  4W97 A;  2HQA A;  1HCR A;  3FX3 A;  1YLF A;  2BYV E;  3K10 A;  3R0A A;  1VND A;  2VJI A;  2E7W A;  5F0C A;  1R9T J;  4BDZ A;  3HOY J;  2CYY A;  3KZZ A;  2W57 A;  4NHJ A;  1LFB A;  3W6J B;  4B3A A;  3GTP J;  3GTO J;  2B9S A;  5KNL A;  3EPZ A;  4IF4 A;  2KRF A;  3CMM A;  1OYI A;  3WTW C;  4PUS A;  3W6K B;  2JWT A;  5EF6 A;  2F48 A;  3TO6 A;  2DT6 A;  3GTG J;  2LVS A;  2WAQ N;  2VAS A;  4MO7 A;  5DM7 F;  4Y4R A;  2PI0 A;  1KU9 A;  1Z3Y A;  5F08 A;  4G7H F;  3KP2 A;  2H09 A;  4BAY A;  1HKQ A;  4L5I A;  4S04 A;  2M8G X;  2L4M A;  3ABT A;  4UB8 C;  2WY7 Q;  2NVY J;  1ZK8 A;  3BQY A;  4H4K C;  3PL8 A;  1YYV A;  2P0W A;  2CW0 F;  2DYR H;  4HBL A;  4GCV A;  1I1G A;  3U9G A;  1U9O A;  2A05 A;  3JRE A;  3BR6 A;  5L3F A;  1SMT A;  3K6G A;  1S7O A;  2X4H A;  3SQN A;  4XKC A;  4G7O F;  3H0D A;  3DTK A;  3U21 A;  1HLV A;  2QZ8 A;  2ACJ A;  2DMQ A;  4E7H A;  3CCM I;  1O57 A;  4XON A;  2M7B A;  2B63 J;  3WTU C;  3VDX A;  2GXG A;  3OYG A;  1D1C A;  4F91 B;  2B7E A;  5LLQ A;  2HEO A;  3LOC A;  4DZJ A;  1YOV B;  3HHG A;  3ISP A;  2QF7 A;  1JKP C;  3DU5 A;  4FHT A;  1I1S A;  1JUS A;  3CCS I;  3DKY A;  4HOB A;  3FKI J;  1JT6 A;  3Q3S A;  3WGG A;  5M5Y J;  1L0O C;  1OR7 C;  3OYE A;  2NOG A;  5FLX Z;  5FD6 A;  5L3G A;  5E17 F;  2VOD A;  3QU3 A;  2UWM A;  2FSW A;  3V7R A;  4PJ0 C;  1OLT A;  3M3Y J;  4HX8 A;  2IGK A;  4JYK A;  1Z05 A;  1WKM A;  5EEA A;  3F8C A;  4ITV A;  3ZN1 A;  4DGW B;  4A0Y A;  2IGM A;  3Q0U A;  2A5W A;  1SD4 A;  2X51 A;  3H0G J;  2F4M B;  3K70 C;  1ZG1 A;  4A3E J;  1IN4 A;  3W6V A;  4LGW A;  4EEF G;  1UJ8 A;  2XRO A;  3OYH A;  1SFU A;  3G1L A;  1TWA J;  2VOP A;  3S1M J;  3TED A;  3VYT B;  2A07 F;  3BR3 A;  2PG4 A;  5HLH A;  3DEW A;  3WG9 A;  1MJB A;  2DT7 B;  2OQR A;  3S1R J;  4GRI A;  3O2P E;  4RB1 A;  1ZRD A;  3JRH A;  3S2D J;  2ZFU A;  1R5H A;  3ECO A;  3FMS A;  3G1O A;  3HOU J;  2F5C A;  4OWR B;  4MNU A;  1POG A;  1XTA A;  1VQ4 I;  3DPU A;  3VB2 A;  2DYS H;  4EGZ A;  3HKZ A;  3GFJ A;  1X4O A;  2HDD A;  1N75 A;  5E1Z B;  2A6T A;  2EK5 A;  3FDY A;  1D8J A;  4YEL A;  3PFI A;  2E60 A;  5HS9 A;  5HOD A;  3ZQI A;  1DDN A;  1ZEL A;  1TZL A;  2DDB A;  4O5V A;  5H2F C;  2LFB A;  4M3D A;  3BZC A;  4HF2 A;  1KGS A;  1FZP B;  3DBR B;  4RB0 A;  3D5L A;  2KFD A;  3EUK L;  5LRS A;  3JRG A;  5C4J J;  2WV0 A;  3MKZ A;  5E1W A;  2ZCW A;  2JA2 A;  1IUY A;  3WGH A;  4E6K G;  1ETW A;  3ASO H;  1R49 A;  3MQ0 A;  4RGS A;  1IXS B;  1A31 A;  2AS5 F;  2LG4 A;  1IN5 A;  1ZN2 A;  5HNH A;  3CLO A;  1IRZ A;  1XCB A;  4LMY A;  3K1P A;  4RM2 A;  1WZ2 A;  3OWT A;  3CUQ A;  3ZXS A;  3W3C A;  3PNY A;  1Z6R A;  3GUD A;  4LB6 B;  3BR5 A;  2KIM A;  3C18 A;  3U1K A;  1Z9C A;  2FOK A;  4L5J A;  1QVT A;  3RZD J;  2R7Q A;  3AG1 H;  2DI3 A;  4JX6 A;  3BY6 A;  2OAZ A;  2O6G E;  3E5X A;  3GBG A;  2E1M C;  1ETO A;  4GFB A;  2R7Z J;  4X0G A;  4CCN A;  5B1A H;  3CCQ I;  4YEJ A;  2JTV A;  3CCR I;  2KZG A;  1GVJ A;  4UVC A;  1V3F A;  4B43 A;  3HSF A;  2VON A;  2CRG A;  5GP9 A;  2W00 A;  5BPI A;  5E20 A;  3A02 A;  3IAM 2;  1R1U A;  3DLA A;  1AOY A;  2FMY A;  1PYV A;  1NG6 A;  2VJJ A;  3S93 A;  4M6Y A;  3M7G A;  1LFU P;  1A6Q A;  2XAQ A;  3T5X A;  4C9Y A;  1XSV A;  4BJT A;  1D3Y A;  4G12 A;  4CA0 A;  2OTJ I;  1FOX A;  4GO1 A;  3TKY A;  4UUS A;  2DXI A;  4A93 J;  2Q2E B;  2ICW G;  1G6N A;  4NQW B;  5HLI A;  3RQI A;  2VBY A;  4DYC A;  2XAG A;  1PDN C;  1S7E A;  5K7F A;  2PMH A;  3BG7 A;  3KFW X;  4I99 C;  5KCM A;  2H6C A;  1K78 B;  2IS1 A;  2XF7 A;  2G7U A;  4CHU A;  2XAH A;  1WI9 A;  2TRT A;  3KP7 A;  1LFP A;  1W4M A;  5BNG A;  2KRC A;  4QPQ A;  4CCL A;  3BCA A;  1AWC A;  4EGY A;  4B4C A;  2X6W A;  1P92 A;  4RAY A;  1LDD A;  3KEY A;  5K1Y A;  3OYC A;  2R0Q C;  4BL0 B;  1ZG3 A;  2LBF B;  4EV0 A;  5FO5 A;  1R23 A;  3M07 A;  3OR1 C;  3I4M J;  2HR3 A;  2ZXW H;  4FT8 A;  2Y9Y A;  3CDI A;  1RPW A;  4DBQ A;  2XAS A;  4AID A;  5JHF A;  5IPA A;  3GX4 X;  5DUI A;  1IJW C;  2BXZ A;  5E1X A;  2K02 A;  2XPW A;  5A2Q K;  2C6Y A;  1MBH A;  3CMA I;  4BU2 A;  3QWL A;  1KON A;  1OCP A;  3V8L A;  2E2J J;  4RGX A;  3H3Z A;  3RSN A;  3PSF A;  1XPX A;  3BJO A;  5KVR A;  1ZLK A;  4XLA A;  2Q8K A;  1TT5 B;  1R1V A;  2Q2E A;  3B6C A;  3RYR A;  1BI3 A;  2H8W A;  5F27 A;  4AVP A;  2YX4 A;  5KAF C;  4DIQ A;  1K79 A;  1P9Q C;  1EH6 A;  4AIJ A;  1K78 A;  2IRF G;  1MMG A;  4WXC A;  3WTY C;  2WTE A;  2IT0 A;  4E7S A;  2LR8 A;  2QGU A;  2KZV A;  2BGC A;  2JA6 J;  2Y69 H;  2M30 A;  4HSR A;  1P2F A;  1MKM A;  1FBS A;  2B0L A;  3RPQ A;  1L3L A;  1XX5 A;  3J7A O;  4IKF A;  2V9V A;  3S15 J;  2WB1 A;  2MFZ A;  1KA8 A;  3RJP A;  1RIO H;  2JUC A;  3S2W A;  5IYD J;  2LBF A;  2WV1 A;  4AUX A;  3DP7 A;  2CG4 A;  3HOZ J;  1DPR A;  3HZJ A;  4XRM A;  3AG3 H;  3RDI A;  4NNJ A;  3VSK A;  2BY1 A;  2CS3 A;  1W0T A;  1ON2 A;  1S29 A;  4IHV A;  4IO9 F;  1IV6 A;  1DP3 A;  1QGP A;  3D5S C;  1KZH A;  1RES A;  1XS9 A;  4MQ9 F;  2W25 A;  2P7V B;  3HOW J;  4M6X A;  3FBI B;  1T98 A;  3TP0 A;  3HRM A;  1IRG A;  1S5L C;  1XMA A;  1FY7 A;  3DEE A;  1EH8 A;  2HYF A;  3PIO F;  1ETQ A;  2K5C A;  3FXL A;  1FPQ A;  3S8P A;  4CCK A;  2VPR A;  5C4X J;  1R22 A;  3BQZ A;  5GPC A;  1KQ8 A;  5IY5 H;  2EIN H;  2DU9 A;  2G7H A;  3A0H C;  1XD7 A;  3OSG A;  2VQG A;  4HNT A;  2E7X A;  1QRY A;  1BI2 A;  1U5T B;  1SFK A;  5DV5 A;  5IYC J;  2DPU A;  4GYI A;  5TRD A;  2VI6 A;  3E0J B;  3IWF A;  4I09 A;  3UNG C;  4A5M A;  5LGT A;  4UNO A;  3SFZ A;  2D1V A;  3MEX A;  1YJN I;  2R7X A;  3K1M A;  1JKO C;  2DTR A;  5J1Y A;  1IDZ A;  1AKH B;  3SYT A;  3VSL A;  3WU1 B;  3JW4 A;  4XBF A;  3GYH X;  1IG7 A;  2LDU A;  1OCR H;  4DQ2 A;  4KA4 A;  4IHX A;  3TQN A;  2UUZ A;  5JI6 A;  3GTM J;  2AXT C;  3BWG A;  1ITY A;  3HTS B;  4X1E A;  1Z0X A;  4YIR X;  1VQ7 I;  4BXF A;  3OYM A;  2CH0 A;  2DMN A;  1J59 A;  5JHU A;  3I55 I;  3DBL B;  4EM2 A;  2LTP A;  1YRN B;  2RGV A;  5M5X J;  3WTT C;  5EG0 B;  2X6X A;  4YFX F;  4KIS A;  3HRT A;  1OCT C;  5LRR A;  3OV8 A;  3R61 A;  2A6H F;  1RET A;  1B9N A;  2BVM A;  2MBF A;  2L7Z A;  3OOU A;  4JQF A;  2MD5 A;  2OCE A;  2X1E A;  2K9L A;  4P96 A;  4EVI A;  1PJR A;  1U5T A;  2FUG 2;  9ANT A;  4QLC U;  3ASN H;  2EIJ H;  4ZYE A;  4C2U A;  4Y3O A;  5GAD J;  3EET A;  4XSX F;  1XC5 A;  1WWX A;  1G2H A;  4PSX A;  1H9G A;  4LLG F;  4ENJ A;  2H8R A;  3KE2 A;  4XLP F;  1AKH A;  2X6O A;  4MIM A;  2M0C A;  2Z99 A;  4M9Z A;  3DU6 A;  4A3G J;  1JI8 A;  4D5F A;  2VT3 A;  5TGT A;  3QOP A;  1DGR M;  4WXH A;  1G8X A;  5D8K B;  4CCJ A;  4IRI A;  1VQN I;  2NVT J;  3H1C A;  4A12 A;  2LKP A;  3EUH A;  4BE1 A;  3CJT B;  4U0W A;  4RS8 A;  4ZDL A;  4U7D A;  4BDY A;  4I2O A;  3ZQQ A;  3H5A A;  3WTS C;  2QSG X;  4IJA A;  5D4R A;  1QQI A;  3PSI A;  1WJE A;  1G4D A;  4BY7 J;  1YRN A;  4M74 A;  3MKL A;  5D4S A;  2DTZ A;  5EG0 A;  2LY1 A;  2HKO A;  4PSW A;  4CSW A;  1A36 A;  2CV0 A;  4F92 B;  3IHU A;  1NK2 P;  1Z67 A;  1OIS A;  5AIQ A;  4ESF A;  5J1R A;  4U7B A;  3GTQ J;  1FWZ A;  4E7K A;  2WAD A;  2EJR A;  1UCR A;  2IS6 A;  2DK8 A;  5IT9 Z;  3HOX J;  4BS9 A;  2EZI A;  2EZK A;  4FE4 A;  2IP2 A;  4PJN A;  3BR2 A;  4YRV A;  3CME I;  5BS6 A;  2MW8 A;  2VJ4 A;  3CUQ C;  3E5U A;  4CZZ A;  1RI7 A;  1BC7 C;  4UB6 C;  3WU2 C;  4BUP A;  3LSR A;  1FMW A;  1NH3 A;  2VJ5 A;  3JRB A;  3BDD A;  1X19 A;  1I50 J;  4QWQ A;  2WA0 A;  2K27 A;  3FKJ A;  4HV6 A;  3GVA A;  3VOD A;  3WTX C;  4I0B A;  2ZJR F;  5EZG A;  3F8M A;  2X85 A;  1QVU A;  3AAF A;  4A3L J;  2VE9 A;  4NC8 A;  5FD5 A;  1OKR A;  4IOA F;  5LGN A;  2ID6 A;  2UXN A;  4ON0 A;  2KIQ A;  1HW5 A;  3BRO A;  4HA8 A;  4F3Q A;  1OCZ H;  2OC6 A;  4ESJ A;  4O3M A;  1MMN A;  2QWW A;  3E7L A;  4RLF A;  2M45 A;  5L3E A;  3Q0W A;  3COA C;  2GOM A;  1HDP A;  2JRT A;  1DUX C;  1Y39 A;  2G0E A;  5J4Y A;  4AM3 A;  3I4N J;  1K6Y A;  2QEN A;  2CQX A;  2XC7 A;  1VQK I;  3ZMS A;  1IRX A;  4AYB A;  2DA7 A;  2R3S A;  1ZAR A;  1U2W A;  3IRR A;  1X1P A;  5H20 A;  2Y30 A;  4BGD A;  5GAH J;  1P4A A;  4ZZD A;  4ASN A;  2EIK H;  2LOO A;  1GDT A;  4MEY F;  5CVV A;  3N97 A;  2ZFW A;  3FXM A;  2K7L A;  3DKW A;  1VFC A;  3AL0 B;  4ENN A;  1S7A A;  5B5E C;  5ERI A;  3PFY A;  1XGM A;  2AHQ A;  2ZME C;  2IEK A;  3F6V A;  1K61 A;  5H6Q A;  4EM0 B;  2L7M P;  2VXD A;  1V5E A;  2XGD A;  1Y8Q B;  3F8F A;  4BJ6 C;  5L3B A;  4HV5 A;  5AON A;  1X1C A;  3ZR8 X;  1MNM C;  1IV8 A;  1IN8 A;  1ORK A;  3FM5 A;  1SVO A;  4PCQ A;  1B9M A;  4IXA A;  5D5U B;  2EPF A;  1MBG A;  2VXZ A;  3IRQ A;  5ICE A;  1LNW A;  3QP6 A;  1QO0 D;  1EH7 A;  3LA7 A;  1FBU A;  3T0Y A;  1T38 A;  3JTH A;  1YE9 A;  1D5V A;  5FKN A;  2QSF X;  2MAB A;  2O7O A;  4ZYG A;  2PMZ N;  3FHZ A;  2CQQ A;  3BR0 A;  4HF0 A;  2K9Q A;  1MMS A;  2K85 A;  3P9K A;  4AC0 A;  3F72 A;  2L2O A;  2ISY A;  2A69 F;  2ZJ2 A;  4BJ5 C;  2VBZ A;  3R4K A;  4NBQ A;  2P5V A;  3A2K A;  3C2H A;  2Y0M A;  1WCM J;  4P5O A;  2QBY B;  3BCB A;  3AFH A;  4GYG A;  3CZ6 A;  3IUO A;  4XLE A;  5FKM A;  1XDS A;  3OSF A;  2NVU B;  2IS4 A;  3D5R C;  1D5Y A;  1FBQ A;  4LG0 B;  2CU7 A;  1WH5 A;  2H1L A;  1WJB A;  5AIP A;  3S2H J;  3H3U A;  3PO3 J;  3WTZ A;  4W1U A;  3QRF F;  4L18 B;  3AG2 H;  2E5Z A;  1T0F C;  3K4N A;  2P6T A;  2HGC A;  1PP7 U;  2MSY A;  3DTE A;  5EGO B;  1XSD A;  3HKZ N;  3KLN A;  1X4P A;  4MGR A;  2JPB A;  3B02 A;  5IP9 J;  2BEO A;  1FOK A;  2MGQ A;  3MD2 A;  5EZH A;  2P8T A;  4LD5 A;  3CC2 I;  1G59 A;  1I6H J;  1MMD A;  3V42 A;  1DU6 A;  3DPL C;  5IT9 K;  1BI1 A;  2R7O A;  3F0C A;  1HXD A;  2HDC A;  4LLN A;  3TW7 A;  2OJE D;  2L02 A;  1FOW A;  3LMM A;  1RRJ A;  3JSP A;  2I10 A;  4LG3 A;  1JTY A;  4HG2 A;  3QPH A;  4BQN A;  2QBY A;  4IQJ A;  4HW0 A;  1T08 B;  3FXK A;  2WWY A;  1BW5 A;  3LQQ A;  4CCO A;  2HZT A;  2AQE A;  4M3G A;  1FIA A;  2EBI A;  5IP6 A;  1FEX A;  2JPC A;  4Y33 A;  4B8X A;  1TQM A;  1QNT A;  4B09 A;  4BYY A;  1MSF C;  2R5Z B;  3K4B A;  4LG0 A;  2E1N A;  3O8H A;  2HOA A;  1JT0 A;  3BT9 A;  4XIC A;  1Y56 A;  4RAF A;  2R5Y B;  3BP8 A;  1T39 A;  5F6F A;  1P4W A;  3E1S A;  4CYC A;  1YO5 C;  2D5V A;  4HPQ A;  5EGO A;  1GT0 C;  1YS6 A;  4IVN A;  4IZZ A;  3DWL E;  3J81 Z;  2ETH A;  1HKT A;  3FIS A;  4UV8 A;  5CYV A;  5DD4 A;  4HX4 A;  1FLI A;  5BQT A;  2UXX A;  4XKV A;  1SFO J;  3CCU I;  2OF7 A;  4PJM A;  1G3Y A;  1TTY A;  4R79 A;  1Z91 A;  1KYZ A;  1LVK A;  3E6D A;  4ZYH A;  2MLG A;  1LDK B;  5K5O A;  5IOY A;  2LMD A;  3G2B A;  1UAA A;  1EF4 A;  2XSJ C;  3Q0V A;  2YUS A;  2WBM A;  3BG3 A;  3KP4 A;  3KEO A;  3P9C A;  2FML A;  2H94 A;  2L5Q A;  3A03 A;  4BHC A;  4V2G A;  3SZP A;  2BY0 A;  1U5T C;  2L7F P;  1B1B A;  3L7W A;  4QIW N;  4NC6 A;  3M1C A;  4BEH B;  3K4K A;  1VI0 A;  2R5Z A;  2EB7 A;  2VIX A;  2RC4 A;  3BG9 A;  2CUJ A;  3GO5 A;  3OS0 A;  4LB5 A;  3CDL A;  3GME A;  4L5E A;  1D0Z A;  1RC9 A;  2R5Y A;  2GZW A;  5E8I A;  3DEU A;  1E3P A;  5EDN A;  2Z33 A;  1QZE A;  1TWC J;  3IWZ A;  4L0Z B;  2HNH A;  3K2Z A;  1W1W E;  4KMF A;  1U0J A;  2PMZ A;  1UZC A;  2OD5 A;  1UEL B;  5HDG A;  2XPU A;  1P4X A;  2CMP A;  2XB0 X;  1ZH5 A;  2N8G A;  2WY8 Q;  2JN6 A;  2ZSI B;  3EUH C;  3R0J A;  4BE2 A;  4MTD A;  3PM1 A;  3LST A;  4X6A J;  3KP3 A;  1BJZ A;  4U0V A;  5A2Q Z;  3C2B A;  1R00 A;  2DOF A;  3CJR B;  3FF5 A;  3I54 A;  1N77 A;  4Y52 J;  1N25 A;  3HL2 A;  3HPH A;  2VOO A;  4KN7 X;  4RGR A;  3BG5 A;  4EMS A;  3PJR A;  1HBX G;  1FTT A;  2VKD A;  3PO2 J;  4B44 A;  2L3D A;  3GTJ J;  1BI0 A;  4PGH A;  4IRH A;  2CJJ A;  5E3O A;  2DA1 A;  2J5P A;  2Y2Z A;  1O3S A;  3H9J A;  4BEH A;  2CUZ A;  1LPQ A;  5CVI A;  2V26 A;  3WU0 A;  3ZPL A;  3HBL A;  5C44 J;  3O6B B;  2MD0 A;  2BW3 B;  5M3M J;  2LKS A;  4P1W A;  4KNY A;  3M4O J;  2R7U A;  2HOT A;  1S72 I;  2KL4 A;  1KU2 A;  3R6S A;  1ZLJ A;  3NQO A;  2R7D A;  2RQQ A;  4FIS A;  2WB1 N;  3S14 J;  3VEP A;  2ESH A;  3LAP A;  1B59 A;  4MQV A;  2R93 J;  3TDZ C;  4XKB A;  4KT6 A;  2R7S A;  4HEA 2;  5ILU A;  4RDU A;  4QPO A;  1H0M A;  1IXC A;  4IEJ A;  3X2Q H;  2FBI A;  2OA4 A;  1I3A A;  3K2A A;  2KT0 A;  1MH4 A;  4LOC A;  1SC7 A;  3FBN B;  3CTA A;  4ANJ A;  2TCT A;  3TOB A;  5JVG F;  1GV5 A;  2YX7 A;  3HM5 A;  3EDP A;  5BOX A;  4FAS D;  1V55 H;  1MIJ A;  4L9T A;  2ZNZ A;  1U8B A;  2GOX B;  3Q9V A;  2KDZ A;  4XOR A;  1YIT I;  2L9N A;  2MC3 A;  1TWH J;  2BY2 A;  1UHS A;  3KEQ A;  1G3S A;  3W2W A;  2RRE A;  2BW3 A;  1S6L A;  2DFH A;  1J09 A;  3OIP A;  4KUM A;  2M2E A;  4E4H A;  3KX2 A;  4FQG A;  4HLX A;  2JJ7 A;  3QYF A;  1IUF A;  3J81 K;  2OV7 A;  3DCF A;  1VQM I;  4JX5 A;  4I6Z A;  3VWB A;  5DTD A;  2FBK A;  2STW A;  5L3D A;  1JHF A;  1P7I A;  1SVL A;  2OQG A;  2XB5 A;  4U88 A;  3DLL F;  1JJ6 C;  1U9N A;  5K5Q A;  1TL8 A;  5C3E J;  4RAG A;  3H35 A;  1X2M A;  2AQF A;  1MGT A;  2AXL A;  3RKQ A;  4G9Y A;  1E17 A;  3OR2 C;  4LK0 F;  4KIT B;  3S17 J;  3ZP5 A;  2IA0 A;  3CP8 A;  2IA1 A;  3W2A A;  2X0L A;  2CQN A;  2DOA A;  5JLX A;  2GA2 A;  4ZH4 F;  2EIM H;  5DS9 A;  1TT0 A;  3GWZ A;  4YFK F;  2V9K A;  5K5R A;  4V19 K;  2LRE A;  3ZGK A;  2E1O A;  3I71 A;  5LEK A;  2FEZ A;  2OUM A;  2IJL A;  1LB2 A;  1J5Y A;  5DM6 F;  3BOQ A;  4JX4 A;  3QQA A;  4IOC F;  2QEX I;  3WOD F;  4PK4 A;  1CQT A;  5HLG A;  1AHD P;  2QYO A;  4KIG A;  1XG1 A;  2Q0O A;  3KIO A;  5GTI C;  3CC7 I;  2GIV A;  5FLV A;  3HPG A;  2IVM A;  2KJB A;  2L9S A;  5ICF A;  3TO9 A;  2X1D A;  1ETK A;  1Y6I A;  3GCM A;  1V5G A;  2ZKZ A;  1T8I A;  1HOM A;  4LLL A;  4A3F J;  4M71 A;  1KU7 A;  2KMU A;  2EQR A;  3CP2 A;  2JZY A;  4Q47 A;  1YFH A;  3JRI A;  2EH3 A;  2W24 A;  1YW9 A;  3HGY A;  4CZC A;  1DGW Y;  2GA1 A;  4CCM A;  1WJA A;  3OS2 A;  4GDF A;  2CV1 A;  4P9F A;  4D9J A;  2K9M A;  1K6O A;  3LSK A;  4NQW A;  2JSP A;  4XR6 A;  3MZH A;  1OPC A;  5ICG A;  1IN7 A;  1FNN A;  4S05 A;  2HYJ A;  2VKH A;  2F4I A;  2A61 A;  2VC1 A;  1MJ9 A;  1LUJ B;  3SJM A;  1JGG A;  2OZ6 A;  2BBY A;  3TMO A;  1MND A;  2ECC A;  3HGG A;  2ME0 A;  3G4S I;  2PLY A;  4AU7 A;  4M73 A;  2ZJQ F;  1O7L A;  3WGI A;  2FQ4 A;  2X1C A;  5FRM A;  2XPV A;  2QKL B;  2O8K A;  1J0R A;  3I53 A;  2Q1Z B;  1T2K A;  4I98 B;  2DW4 A;  1Z77 A;  3HHH A;  2DOE A;  4S0H B;  3ABK H;  5J4V A;  3SDB A;  3FXQ A;  1ACI A;  3ZQC A;  2HVQ A;  4J00 A;  1AU7 A;  1BM9 A;  4XRF A;  2XF5 A;  2GIZ A;  3ULQ B;  4TV7 A;  4BBR J;  2ZJP F;  1Y1W J;  1F9N A;  2HFH A;  2DFI A;  1HDD C;  3HB9 A;  3CLQ A;  3RQ4 A;  5KAI C;  2K4B A;  2LC2 A;  2W85 A;  4A5N A;  1CF7 B;  4A0X A;  5GTH C;  1FTZ A;  4G6D A;  4IL6 C;  3DFG A;  4EAT A;  4HST A;  1T56 A;  3CCE I;  5CVJ A;  2KQR A;  3HSR A;  4CH7 A;  3BPV A;  2Z9O A;  5CQE A;  1DP7 P;  1E3H A;  2TDX A;  1YS7 A;  2VE8 A;  3J7Y J;  1W36 D;  1O3Q A;  2P6S A;  4XLC A;  3J7Z I;  1S8N A;  4GXO A;  4YIF A;  4EM1 A;  2ELH A;  3QPT A;  2FQ3 A;  3R60 A;  2UZK A;  1LQ1 A;  5B1B H;  1R4N B;  4AYB N;  2GQQ A;  2I8D A;  5F04 A;  1X3Z B;  2OTL I;  1FOY A;  3ZMD A;  1TBX A;  1SAN A;  2DA6 A;  2QQA A;  1W0U A;  2JT1 A;  1KYW A;  1ONV A;  1JHH A;  3NRV A;  4LIV A;  4BQQ A;  1BOA A;  4E7I A;  3REO A;  3G6E I;  3PNV A;  1YTY A;  3HDD A;  2Y0S A;  5FJ8 J;  4Q48 A;  3H9G A;  1XB4 A;  2R92 J;  2W82 A;  1I3Q J;  2V4J C;  4DYR A;  1GLN A;  2H6B A;  3TL4 X;  4A3I J;  1VF9 A;  5DDG A;  5FLM J;  2LYC A;  3P5J A;  4EJT A;  1A5J A;  3H5N A;  3ROU A;  1J9I A;  2PFB A;  3SEZ A;  2XRN A;  3JSO A;  2RN7 A;  1O4X A;  3IP4 B;  4NDL A;  1Y1V J;  4E7Z A;  1GV2 A;  1A6I A;  4NC7 A;  4QTR A;  3FIW A;  1BR4 A;  2NRA C;  2E5N A;  3AG4 H;  1XMK A;  2FBH A;  1R6R A;  1TP4 A;  4ZDO A;  4B1R A;  2P5K A;  4BXX J;  4U0Y A;  3FMQ A;  1D1B A;  3L2U A;  1Y0U A;  3HYI A;  2XHK A;  1WQ2 A;  1BA5 A;  3CJQ B;  5K7H A;  2QQB A;  4L9V A;  4DW6 A;  4CXF A;  2EFP A;  1YIO A;  2GBY A;  3HJE A;  3UR3 C;  4MEX F;  3ZQH A;  1BIA A;  2DMP A;  1R71 A;  3I0T A;  3LSH A;  1XMX A;  2HXI A;  4KIC A;  1YJW I;  3U2R A;  2H27 A;  4ZYA A;  4BY1 J;  4ETS A;  2EZH A;  1DPU A;  4XLF A;  2X48 A;  5F0F A;  3TW6 A;  4A2U A;  1IC8 A;  3OYL A;  2RKH A;  4ZJZ A;  4I76 A;  3QU6 A;  2XGX A;  2NXN B;  3E6M A;  1OR7 A;  4E7J A;  4RBO A;  5TIS C;  4N4O B;  1G3T A;  2FOW A;  3LL7 A;  4FX4 A;  4HF1 A;  4XLH A;  2DMT A;  2E19 A;  5J8F A;  2FX0 A;  2BV6 A;  2XGE A;  2JSC A;  3IV5 A;  4IHS A;  4PDK A;  5E3L A;  5CVU A;  4DJA A;  4EJU A;  2F4O B;  3MVP A;  1DU0 A;  1X1D A;  2F6C A;  2ZB9 A;  1EJ9 A;  3LFK A;  4E7L A;  1PUF B;  2V6E A;  3PQK A;  4XN0 A;  4BKX A;  2FD5 A;  1OMI A;  5DCM B;  5FRO A;  1E3O C;  2M4K A;  1MDM B;  3OYI A;  3GZ6 A;  3CF2 A;  3B6A A;  3FXR A;  4UY8 I;  2LLK A;  4R8H A;  1HKS A;  4AIH A;  2G9W A;  3BR1 A;  3VPR A;  5CPR B;  2NNY A;  3RCO A;  5HOO A;  1Z7L A;  1S9H A;  3K7A J;  4Y13 A;  2CW8 A;  4IHY A;  3LFU A;  1IZ1 A;  5F1R A;  3S3M A;  2STT A;  1R5G A;  5LHG A;  5BMZ A;  3GLX A;  2XKP A;  2GLO A;  1KU3 A;  2HTJ A;  3RKY A;  3I64 A;  4WF2 A;  5B66 C;  3QPL A;  3ZMU A;  2E1M B;  4RGU A;  3BTJ A;  4I7H A;  3FK6 A;  4L9J A;  2DBB A;  2QSH X;  2VUM J;  4I01 A;  5J40 A;  2V1U A;  1P6R A;  4CO8 A;  5FGM A;  2V7F A;  2VBW A;  5HLT A;  3E97 A;  1YQA A;  4XRS G;  3OYA A;  4BNC A;  1YHQ I;  3K70 D;  1X2N A;  4M9S A;  4P55 A;  4Y17 A;  3LAJ A;  3L2Q A;  3OIO A;  1PUF A;  3PUB A;  3FHN A;  2EA2 A;  2OCC H;  2HPI A;  3MAJ A;  3EYY A;  3EUA A;  1ZGJ A;  2CQK A;  5DCM A;  2LSO A;  1W7P B;  4MFE A;  3IH4 A;  2XUB A;  4FX0 A;  2JK3 A;  3SEQ A;  2HKX A;  2V1D A;  3F21 A;  4HYE A;  2HOE A;  4II2 A;  3ZQG A;  4Z6Y A;  4M3E A;  3FXU A;  1BL0 A;  2DK5 A;  3TBI A;  4OMY A;  2NOJ B;  1MZB A;  3ABU A;  3E6C C;  3WHC A;  4C30 A;  3LWF A;  1GXQ A;  5GPA A;  3J80 K;  4BHP A;  2BE5 F;  4UXN A;  2QVO A;  5LEJ A;  3IAS 2;  4KJZ A;  4XRS A;  1TWG J;  2K3F A;  4N9I A;  3ABM H;  3K1N A;  1MBF A;  2JA8 J;  1F43 A;  4P9U A;  5DCF A;  3OMY A;  1WJF A;  4G6T B;  5K7Z A;  2O5R A;  5FKK A;  1SEU A;  1FYK A;  3JCU C;  4R1H A;  1T95 A;  1U3E M;  3GZN B;  1E0E A;  1W5T A;  1FJL A;  2P4W A;  1WGX A;  1MBE A;  4NUB A;  3HUG B;  4FCY A;  3CJN A;  3F6O A;  1JXS A;  4A3B J;  2A3S A;  2PJP A;  2VL8 A;  1W7P A;  2KP6 A;  5JFR A;  3ZRG A;  3GXO A;  3MWM A;  2DJN A;  3P9I A;  3NEU A;  3I5U A;  2R7T A;  5IP7 J;  4BBS J;  3QOD A;  2CUE A;  4XNF A;  3K9T A;  3FXO A;  2ID3 A;  2QUF A;  4FTH A;  2KPM A;  2LF8 A;  4AWX B;  2GWR A;  2P5L C;  2HOS A;  4DZP A;  3OYJ A;  1MSE C;  4H0E A;  2VPL A;  1LE8 B;  3PUF A;  2EFQ A;  1IF1 A;  1A35 A;  2O8X A;  5CKT A;  1QPM A;  4XOP A;  1FYM A;  1NTC A;  5J47 A;  2KJC A;  4I0A A;  2L9R A;  4J01 A;  2LP0 A;  3CO6 C;  1H9T A;  2DQR A;  3A4C A;  4HRI A;  3ZCO A;  1GUU A;  2V1X A;  2PN6 A;  2EFN A;  2XVC A;  1O3R A;  1MW7 A;  2V1N A;  3S1Q J;  4KMU X;  4EJO A;  4A3C J;  3HOV J;  3CQZ J;  3O3K A;  2W1O A;  1WRJ A;  3K4J A;  3CES A;  1VTN C;  4BAC A;  4KDP A;  3JAM K;  3CUO A;  3S32 A;  1SVM A;  3T1B A;  1U8R A;  2RV8 A;  1TQI A;  3ECH A;  1V5F A;  2DFF A;  2PX9 A;  3K4M A;  3N05 A;  3OIQ A;  1XSX A;  1IW7 F;  3DQV C;  1UB9 A;  3LA3 A;  1IO2 A;  1Z6T A;  3ZMV A;  4MTE A;  3WTV C;  3JRF A;  1W7P D;  2XDV A;  3OY9 A;  1J2X A;  3M8E A;  5DYM A;  1O3T A;  1N78 A;  2J5O A;  3LSJ A;  4A3M J;  2JUG A;  3K0L A;  2VLA A;  3RZO J;  3QYE A;  1OFC X;  3ERE D;  1D0Y A;  2GXA A;  4DBR A;  2Y48 A;  4A0Z A;  1ZGW A;  3C7J A;  1WFX A;  1ZR2 A;  4I02 A;  3MFK A;  2A68 F;  4RB2 C;  2KRH A;  1JE8 A;  1UHM A;  5DEQ A;  2LK2 A;  3QP5 A;  2PMU A;  2VQL A;  2VC0 A;  2ME6 A;  3IC7 A;  3KYC B;  2PBI A;  3GTK J;  3L2C A;  1ON1 A;  1IXR C;  1WH7 A;  2PQ8 A;  4IRG A;  4RA2 A;  2DA2 A;  2K3P A;  3BG6 A;  3FM3 A;  3NWS A;  3IKV A;  4M3B A;  2ESN A;  2HQN A;  4ESB A;  5D5W B;  2ECB A;  4B48 A;  1A04 A;  3OYN A;  2L4A A;  3GZ5 A;  3LQR A;  2E36 A;  4ZC3 A;  3MKW B;  5D5V B;  1ZR4 A;  3DTI A;  1SD5 A;  4Y7N J;  5HVQ C;  1JUM A;  4BXU A;  3M1E A;  2D45 A;  2NNN A;  4HZF A;  1MNE A;  4JP0 A;  1RKW A;  4IQ4 A;  4XOT A;  3MN2 A;  5HNF A;  1TNT A;  5B3S H;  4XL9 A;  2HDW A;  3WHB A;  5E3N A;  5FKL A;  4Q5S F;  2V6C A;  3F22 A;  2MH2 A;  1ZYR F;  5JR3 A;  1P7J A;  2FE3 A;  4NB5 A;  2VKV A;  1GXP A;  1ZRF A;  2VQC A;  3MCZ A;  2ZXI A;  2LKX A;  1WI3 A;  2JVH A;  3DXJ F;  3RYP A;  4J19 A;  1RZ4 A;  1X3W B;  2EV5 A;  4KT5 C;  3OYD A;  2IW5 A;  3CCJ I;  1ERD A;  4HNU A;  3VFZ A;  3TO7 A;  1BOB A;  2Z5U A;  2GXB A;  4BE0 A;  3SFI A;  2M5W A;  2R4G A;  2QQ9 A;  2NVX J;  3DV8 A;  1OCO H;  1APL C;  3E6B A;  2EZL A;  2PEX A;  1WVR A;  1EV7 A;  2DN0 A;  4PGG A;  2IPQ X;  2ISZ A;  2DAO A;  5HDN A;  4ZYD A;  3SHF A;  1R36 A;  3HC7 A;  2NS8 A;  4JBA A;  1ZTR A;  1R7J A;  3ZQL A;  3Q5F A;  1QA6 A;  2M0M A;  4M72 A;  1V54 H;  2CQ7 A;  1SAX A;  3ZMT A;  2Z16 A;  1MBJ A;  1YX5 A;  3ERM A;  3VYU B;  5GAE J;  2OU2 A;  2QKM B;  2COM A;  5EYR A;  3I58 A;  4IHT A;  3IKT A;  2VQH A;  2CV2 A;  2R7W A;  1XN7 A;  2EV0 A;  2M9H A;  3BLY A;  5J1U A;  2YU3 A;  1QU3 A;  2FXA A;  3L9F A;  3OOP A;  5IYB J;  1STZ A;  4A3K J;  2IBD A;  5E79 C;  3G73 A;  4M9X A;  2NVQ J;  2VBX A;  3GEZ A;  3ONQ A;  2O9L A;  1E2X A;  4F55 A;  2VB6 A;  1VQL I;  2EIL H;  4AVZ A;  4N0B A;  1PUE E;  1HA8 A;  1AA7 A;  2XV4 S;  4D5C A;  1K7A A;  3CUQ B;  2FU4 A;  4C2M J;  2M87 A;  3DKX A;  1ZHF A;  5M5W J;  3FMR A;  1I6X A;  1GHC A;  2CFO A;  2RAE A;  1MJA A;  2QM3 A;  3UKG A;  3S16 J;  1LVA A;  1OCC H;  3S3O A;  3C3W A;  1I39 A;  5HS8 A;  3QAH A;  4OIO F;  5BPD A;  1VQP I;  2FF4 A;  1I27 A;  2IA2 A;  1QZY A;  1XGN A;  1RR8 C;  3BC8 A;  4PFP A;  4OIR F;  1QHH D;  3FXJ A;  1HW1 A;  1NHA A;  4RM3 A;  3DPT A;  2LH9 A;  4JOM A;  2XAJ A;  3VYR B;  4KIB A;  3VYS B;  2KIS A;  4HAM A;  1TWF J;  2E2H J;  2YR2 A;  3KP5 A;  1U6G A;  2DA3 A;  2LY9 A;  4C3I J;  3N4M A;  4AIK A;  4FET A;  3PNT A;  2H1K A;  1SD6 A;  2R7F A;  1B6A A;  3MZ8 A;  5LHI A;  1R58 A;  3MMY B;  3SZG A;  1F5T A;  3FWE A;  2MH9 A;  4UUS B;  4WK8 F;  1XDU A;  3WE3 A;  2WAE A;  2PJR B;  1HQC A;  3BTC A;  4A6E A;  2A6E F;  2MC4 A;  2GAU A;  4IHW A;  4A3D J;  3TGN A;  3JTG A;  1BR1 A;  4D7N A;  2YS9 A;  2E35 A;  1HST A;  2FNA A;  2HWV A;  2QA4 I;  2F5V A;  1TW2 A;  2WAQ A;  3I9V 2;  3QOE A;  1YJ9 I;  2BXY A;  5E18 F;  3LSM A;  2VKE A;  5IOZ A;  1FT9 A;  2L54 A;  5LBQ A;  2CO5 A;  4C3J J;  2ZBK A;  3HOS A;  1FP1 D;  1TW3 A;  2F5E A;  4YII A;  2IS2 A;  2KHM A;  3KZY A;  2JA5 J;  1WSU A;  2DDA A;  1BC8 C;  1WJC A;  1K4T A;  2ZME B;  3KYD B;  4PFO A;  1MBK A;  2Y0S N;  3RKW A;  2WAF A;  4A3J J;  3HRU A;  2KIF A;  1Y8R B;  1ZG5 A;  4XID A;  1FSE A;  3BJA A;  1IGN A;  1M1E B;  4YFN F;  2V79 A;  4F7Z A;  2XRL A;  2Y31 A;  3F8B A;  5D5X B;  4HLY A;  2UV1 A;  2DMU A;  2Z3Y A;  3F8N A;  2O61 A;  4G8X A;  1H88 C;  2QQ8 A;  4Z2Y A;  2HTS A;  2OZU A;  5LGU A;  3JR9 A;  3NAR A;  4BQO A;  1VZ0 A;  3I4P A;  2M4G A;  1UFM A;  2ZC2 A;  2PJR A;  2BHY A;  2VN2 A;  2W84 A;  2IGN A;  2E71 A;  1ETV A;  1H8A C;  3AL0 C;  4UVA A;  3K69 A;  3RPU A;  5JLW A;  4CUG A;  2KIU A;  4MLO A;  1RNL A;  2MYS A;  4UV9 A;  4KYW A;  3M8J A;  5HDK A;  4CGZ A;  5CQG A;  3SXY A;  4LIT A;  1VQ9 I;  3W2V A;  4V2F A;  1USS A;  3K4C A;  3L2R A;  1RUO A;  3GTL J;  4D0P A;  3H3V K;  2EWN A;  4PJJ A;  3A0B C;  3CCV I;  2DT5 A;  2VT2 A;  4II3 A;  1HF0 A;  5FLX K;  3RIR A;  5M3F J;  2ZME A;  2BHZ A;  6PAX A;  3HXL A;  4G6Q A;  2HQR A;  1ENH A;  1F4K A;  1SFX A;  3D0S A;  2HI3 A;  4HDU A;  2JA7 J;  3NAU A;  1YW8 A;  1NG7 A;  2HS5 A;  5J3L A;  2CGP A;  2DOD A;  2KKO A;  1MH3 A;  4BH9 A;  3KP6 A;  4D7M A;  5F0H A;  5KHD A;  1VQ5 I;  1FMV A;  3O8G A;  2DO7 A;  1ZQ3 P;  2CSO A;  2FA5 A;  4A69 C;  4YG2 F;  1UMQ A;  3Q9S A;  1PP8 F;  3M8F A;  3RPU D;  1TC3 C;  1RUN A;  1BN5 A;  3S1N J;  2MG4 A;  2MLK A;  4HQM A;  5FB2 A;  4XLN F;  4FE7 A;  4LK1 F;  1JTX A;  1KQ9 A;  4XM3 A;  3OYB A;  3BTL A;  3FZV A;  3RI4 A;  3GF2 A;  1ULY A;  1JJ8 C;  2DA4 A;  5D8L B;  2JRM A;  2W48 A;  2YSR A;  1EA3 A;  1S3J A;  2ZO4 A;  2CW7 A;  2QLZ A;  4ZZL A;  1Q1H A;  2XAU A;  4UHT A;  3CCL I;  1BBY A;  1Z21 A;  3G3Z A;  1Y0N A;  2L0K A;  3ZQ7 A;  3F9K A;  2V9P A;  1T0F A;  5EEH A;  2E1C A;  1SAU A;  2RQP A;  1DQU A;  5CJ9 A;  1IRF A;  1X3U A;  3GFI A;  3H5R A;  4PZJ A;  3KYL A;  3HOT A;  1SD7 A;  5EEG A;  1J75 A;  4XSZ F;  1LJ9 A;  3B73 A;  1JKR C;  4KFC A;  2YU9 J;  5DUK A;  4CYD A;  3CO7 C;  1TQP A;  2AO9 A;  1Q1V A;  1VQO I;  4M6V A;  4XKW A;  2CWE A;  3H92 A;  4ZDP A;  5ILV A;  1IDY A;  2BVL A;  2M7A A;  4RAZ A;  3KCC A;  2IAI A;  2XIG A;  2O03 A;  2IGO A;  2WC2 A;  5FFZ A;  5E8G A;  1YX3 A;  3HIF A;  4UUT A;  2FJ1 A;  3E5Q A;  3MZY A;  5J6X A;  2L01 A;  4CDG A;  2LD5 A;  4GGG A;  1TLH B;  3JRA A;  3J80 Z;  4ZTF A;  3L2V A;  4BQA A;  1UG2 A;  2M1B A;  2R7R A;  1CF7 A;  2I5U A;  3H36 A;  1X1B A;  2XAF A;  3K4L A;  2HVR A;  2W4S A;  5KK1 A;  1SMY F;  5DD8 A;  3AKZ A;  2LNB A;  4ZTJ A;  1EKE A;  1TNS A;  1FC3 A;  3C2G A;  4OOI A;  3P7N A;  2EFO A;  4HDV A;  2OBP A;  3SZT A;  3HEF A;  3WG7 H;  4E70 A;  2F5F A;  1LKX A;  1UST A;  2NAZ A;  1WJ5 A;  4G7Z F;  3S3N A;  4M3F A;  5TJJ A;  5LFA A;  1CGP A;  4OMZ A;  3HG9 A;  1D8K A;  1R5I D;  1BW6 A;  1T33 A;  1XGS A;  2A5Y B;  4XN3 A;  2ZXH A;  3L1P A;  2EA4 A;  3HSE A;  4LFU A;  1GVD A;  2QCO A;  2XKO A;  1WJD A;  1K83 J;  1OYY A;  2P7C B;  3GFM A;  2DFE A;  1YW7 A;  3V7S A;  2DQL A;  4WX9 A;  2ZSH B;  2JMW A;  2O0Y A;  2FNP A;  4XK4 A;  4CIC A;  4EQQ A;  4QSH A;  3V8K A;  1ZRC A;  2Y9Z A;  3PQJ A;  1T6S A;  3CDH A;  4WWC A;  2R7V A;  2RDP A;  5LD2 C;  2HU9 A;  5EJC A;  3QPS A;  4UVB A;  3PIP F;  4LIU A;  4HX7 A;  5HS7 A;  1D0X A;  2FRH A;  4EJV A;  3RKX A;  1O7F A;  2DCE A;  2ELJ A;  1XCV A;  3ML6 A;  3F3X A;  1I5Z A;  1SFE A;  3IH2 A;  3F23 A;  1C0W A;  3JAM Z;  1QZZ A;  2Y75 A;  1HC8 A;  2IXS A;  1JGS A;  1VQ6 I;  4PJL A;  5GAG J;  2DLL A;  3FK7 A;  3OL3 A;  1ZKG A;  4B47 A;  1FYL A;  3BPX A;  4ENM A;  3EQL F;  3WE2 A;  2M34 A;  4WCG A;  2K9N A;  3DF8 A;  2K4J A;  1B8I B;  5ILS A;  1NK3 P;  3TOA A;  1BR2 A;  1WHU A;  2HZD A;  3ZMZ A;  3I59 B;  1QPI A;  5IT3 A;  3ZQF A;  3IL2 A;  3JRC A;  3NWT A;  1BIB A;  3LA2 A;  3H9Q A;  1UHW A;  2M8E A;  3KZI C;  2K9S A;  4C2T A;  1Z1D A;  2XGC A;  3L2W A;  1F36 A;  2OPT A;  1BJA A;  2XF6 A;  1IAW A;  1HW2 A;  1PVE A;  3OL4 A;  3HTU A;  2XSD C;  3ELK A;  3I3L A;  2BZT A;  4Y15 A;  2F2E A;  2Z2S B;  2E2I J;  2F5D A;  1OJL A;  3LNQ A;  3GW2 A;  2HVS A;  2YPR A;  1FIP A;  4UUV A;  1J7K A;  4B3X A;  2RNG A;  5J8C A;  4Q4Z F;  1H89 C;  1X1A A;  2BY3 A;  2E34 A;  4N9H A;  4N4N B;  3KLO A;  3KET A;  2X9D A;  3I56 I;  3C1D A;  3LSI A;  4G94 A;  1MDM A;  1B8I A;  1W5C C;  3BTI A;  2HXO A;  1UG0 A;  3L09 A;  3L00 A;  4KIF A;  1XGO A;  2HPM A;  3T8T A;  5FKO A;  2CFX A;  4IPA A;  3I59 A;  2K86 A;  1D1A A;  3CD6 I;  1YI2 I;  3E3V A;  1FX7 A;  1YG2 A;  2ADU A;  2D2W A;  2RNJ A;  4WXD A;  1K4S A;  4O6J A;  3MKY B;  4DYQ A;  1V4R A;  3ZN0 A;  1JUP A;  4L0Y B;  2NYX A;  1R1T A;  2KLO A;  4L9N A;  1F1Z A;  4DOZ A;  4RMN A;  5D6F A;  5F64 A;  3VOE A;  4A6D A;  2L7K A;  3M9A A;  2O3F A;  3J7A Y;  1OQY A;  5D6E A;  3T8R A;  5CLS A;  3OYK A;  2RVC A;  1B72 B;  3QYB A;  4DNC A;  2CUF A;  1LEA A;  4IX7 A;  2W7N A;  4HQE A;  3CMY A;  3CC4 I;  3V8J A;  3U1D A;  3OS1 A;  2DA5 A;  2GM4 A;  2LY2 A;  2K40 A;  4U87 A;  3JRD A;  2KDO A;  1JKQ C;  1QBJ A;  1W36 C;  1Z3X A;  2COB A;  3V7C A;  3ZOB A;  4BHB A;  2ZXJ A;  3TP3 A;  5JVT A;  3A01 B;  2EFW A;  1ETX A;  1IN6 A;  3ESW B;  3TDU C;  3SDG A;  4OAZ A;  2L9V A;  3LSG A;  4C3H J;  4RLQ A;  4OU0 A;  2HQ5 A;  2LRD A;  4MHG A;  1RR7 A;  2LF7 A;  2P81 A;  3RTR A;  5LHH A;  5ED4 A;  5E3M A;  2HYG D;  3ABL H;  2DJI A;  1R4M B;  4OAY A;  4D1Q A;  1QHG A;  4JK1 X;  2D1H A;  5L3C A;  4F93 B;  5CVR A;  1Z7U A;  2NS0 A;  3G1M A;  3GFL A;  1G3W A;  1REP C;  3HRS A;  4MFD A;  1MD0 A;  1ETY A;  1W5S A;  2DPD A;  2ELK A;  2Z1D A;  1LDJ A;  3EYI A;  1FP2 A;  3BZ6 A;  1FSH A;  3KPH A;  1X58 A;  2JVG A;  3D1N I;  1B72 A;  3G71 I;  3DBH B;  1ZAO A;  3HUG A;  2MA3 A;  3CCY A;  4RB3 C;  4K2E A;  2M3A A;  5F1J A;  3IH3 A;  4XQF A;  1RKT A;  4CYC B;  5H6R A;  2ZNY A;  3OYF A;  4XMY A;  1ZGA A;  4ENK A;  1LEB A;  4OIP F;  4EJW A;  4OIN F;  1ODD A;  3LSP A;  3A01 A;  5FFX A;  3BZK A;  1U78 A;  3BJ6 A;  2NS7 A;  1B4A A;  1ZRE A;  4HNV A;  2EV6 A;  4OIQ F;  4AD9 A;  1OYW A;  1WPK A;  2BOL A;  1MMA A;  2X6Y A;  4F52 A;  3GLL A;  3CF5 F;  1LE8 A;  1VQ8 I;  1KQ0 A;  1YIJ I;  4LJZ F;  1HSJ A; 
#chains in the Genus database with same CATH homology
 3V4G A;  5ICC A;  4KN4 X;  3FX3 A;  1YLF A;  2BYV E;  3R0A A;  2E7W A;  2CYY A;  3KZZ A;  2W57 A;  4NHJ A;  3W6J B;  4IF4 A;  2KRF A;  1OYI A;  3WTW C;  3W6K B;  3TO6 A;  2PI0 A;  1KU9 A;  4G7H F;  3KP2 A;  2H09 A;  4BAY A;  1HKQ A;  4L5I A;  4S04 A;  2L4M A;  3ABT A;  1YYV A;  2CW0 F;  4HBL A;  4GCV A;  1I1G A;  3U9G A;  5L3F A;  1SMT A;  1S7O A;  2X4H A;  3SQN A;  4G7O F;  2QZ8 A;  2ACJ A;  1O57 A;  3WTU C;  2GXG A;  5LLQ A;  2HEO A;  3HHG A;  3ISP A;  4FHT A;  1I1S A;  4HOB A;  3WGG A;  1L0O C;  5FLX Z;  5FD6 A;  5L3G A;  5E17 F;  2VOD A;  3QU3 A;  2UWM A;  2FSW A;  3V7R A;  4HX8 A;  1Z05 A;  1WKM A;  3F8C A;  3ZN1 A;  4A0Y A;  1SD4 A;  1ZG1 A;  1IN4 A;  4LGW A;  2XRO A;  1SFU A;  2VOP A;  2A07 F;  2PG4 A;  5HLH A;  3WG9 A;  1MJB A;  2OQR A;  3O2P E;  4RB1 A;  1ZRD A;  1R5H A;  3ECO A;  3FMS A;  2F5C A;  4MNU A;  3VB2 A;  4EGZ A;  3GFJ A;  5E1Z B;  2EK5 A;  1D8J A;  3PFI A;  5HS9 A;  1DDN A;  4O5V A;  4HF2 A;  1KGS A;  1FZP B;  4RB0 A;  3D5L A;  5LRS A;  2WV0 A;  5E1W A;  2ZCW A;  1IUY A;  3WGH A;  3MQ0 A;  4RGS A;  1IXS B;  2AS5 F;  1IN5 A;  1ZN2 A;  3CLO A;  1XCB A;  4LMY A;  3K1P A;  3CUQ A;  1Z6R A;  3GUD A;  4LB6 B;  2KIM A;  3C18 A;  1Z9C A;  2FOK A;  4L5J A;  2DI3 A;  3BY6 A;  2OAZ A;  2O6G E;  3E5X A;  2JTV A;  1GVJ A;  4UVC A;  1V3F A;  2VON A;  3HSF A;  5BPI A;  5E20 A;  1R1U A;  1AOY A;  2FMY A;  4M6Y A;  3M7G A;  2XAQ A;  3T5X A;  1XSV A;  1D3Y A;  4GO1 A;  3TKY A;  1G6N A;  5HLI A;  2VBY A;  2XAG A;  1PDN C;  2PMH A;  3KFW X;  2H6C A;  1K78 B;  2G7U A;  4CHU A;  2XAH A;  1WI9 A;  3KP7 A;  1W4M A;  1AWC A;  4EGY A;  1P92 A;  4RAY A;  1LDD A;  5K1Y A;  1ZG3 A;  4EV0 A;  5FO5 A;  1R23 A;  2HR3 A;  4FT8 A;  2XAS A;  3GX4 X;  5DUI A;  5E1X A;  2K02 A;  5A2Q K;  2C6Y A;  3V8L A;  4RGX A;  3H3Z A;  3BJO A;  5KVR A;  1ZLK A;  2Q8K A;  2Q2E A;  1R1V A;  3RYR A;  1BI3 A;  4AVP A;  2YX4 A;  1K79 A;  1EH6 A;  4AIJ A;  1K78 A;  2IRF G;  4WXC A;  3WTY C;  2WTE A;  2IT0 A;  2BGC A;  2M30 A;  1P2F A;  1MKM A;  1FBS A;  2B0L A;  3RPQ A;  1L3L A;  3J7A O;  2V9V A;  1KA8 A;  3RJP A;  1RIO H;  3S2W A;  3DP7 A;  2CG4 A;  1DPR A;  3RDI A;  1ON2 A;  1S29 A;  1QGP A;  4MQ9 F;  2W25 A;  2P7V B;  4M6X A;  1T98 A;  3HRM A;  1IRG A;  1XMA A;  1FY7 A;  1EH8 A;  2HYF A;  1FPQ A;  1R22 A;  1KQ8 A;  2DU9 A;  2G7H A;  1XD7 A;  2E7X A;  1BI2 A;  1U5T B;  5DV5 A;  2DPU A;  4GYI A;  5TRD A;  4I09 A;  4UNO A;  3IWF A;  4A5M A;  5LGT A;  3SFZ A;  2D1V A;  3MEX A;  3K1M A;  2DTR A;  3WU1 B;  3JW4 A;  4XBF A;  3GYH X;  2LDU A;  4DQ2 A;  4KA4 A;  3TQN A;  5JI6 A;  3BWG A;  3HTS B;  1J59 A;  5JHU A;  4EM2 A;  2RGV A;  3WTT C;  4YFX F;  3HRT A;  5LRR A;  3OV8 A;  3R61 A;  2A6H F;  1B9N A;  4JQF A;  2MBF A;  2MD5 A;  4P96 A;  4EVI A;  1U5T A;  4QLC U;  4ZYE A;  3EET A;  4XSX F;  1WWX A;  1H9G A;  4LLG F;  4ENJ A;  3KE2 A;  4XLP F;  2Z99 A;  4M9Z A;  2VT3 A;  3QOP A;  4WXH A;  5D8K B;  4IRI A;  4A12 A;  2LKP A;  3EUH A;  4U0W A;  4RS8 A;  4U7D A;  4I2O A;  3WTS C;  4IJA A;  5D4R A;  1QQI A;  1G4D A;  4M74 A;  5D4S A;  2HKO A;  3IHU A;  4ESF A;  5AIQ A;  4U7B A;  1FWZ A;  2EJR A;  1UCR A;  5IT9 Z;  2DK8 A;  2IP2 A;  5BS6 A;  3CUQ C;  3E5U A;  4CZZ A;  1RI7 A;  1BC7 C;  3BDD A;  4QWQ A;  2K27 A;  4HV6 A;  3WTX C;  3GVA A;  3VOD A;  4I0B A;  3F8M A;  3AAF A;  2VE9 A;  5FD5 A;  1OKR A;  5LGN A;  2UXN A;  4ON0 A;  1HW5 A;  3BRO A;  4HA8 A;  4ESJ A;  4O3M A;  2QWW A;  2M45 A;  5L3E A;  3COA C;  2JRT A;  1DUX C;  2QEN A;  3ZMS A;  2R3S A;  1ZAR A;  1U2W A;  3IRR A;  5H20 A;  1P4A A;  4ZZD A;  4ASN A;  4MEY F;  5CVV A;  3N97 A;  2ZFW A;  2K7L A;  3DKW A;  4ENN A;  1S7A A;  5ERI A;  1XGM A;  3F6V A;  5H6Q A;  4EM0 B;  3F8F A;  5L3B A;  4HV5 A;  5AON A;  1IN8 A;  3FM5 A;  4PCQ A;  1B9M A;  4IXA A;  5D5U B;  2VXZ A;  3IRQ A;  5ICE A;  1LNW A;  3QP6 A;  1QO0 D;  1EH7 A;  3LA7 A;  1FBU A;  3T0Y A;  1T38 A;  3JTH A;  1D5V A;  4ZYG A;  3FHZ A;  4HF0 A;  3P9K A;  3F72 A;  2ISY A;  2A69 F;  2ZJ2 A;  2VBZ A;  3R4K A;  2P5V A;  2Y0M A;  4P5O A;  2QBY B;  4GYG A;  1XDS A;  1FBQ A;  4LG0 B;  5AIP A;  3H3U A;  3WTZ A;  3QRF F;  4L18 B;  2P6T A;  2HGC A;  1PP7 U;  1XSD A;  3KLN A;  4MGR A;  2JPB A;  3B02 A;  2BEO A;  1FOK A;  2P8T A;  4LD5 A;  3DPL C;  5IT9 K;  1BI1 A;  1HXD A;  2HDC A;  4LLN A;  2L02 A;  3JSP A;  3QPH A;  2QBY A;  4HW0 A;  2WWY A;  3LQQ A;  2HZT A;  2JPC A;  4B8X A;  1TQM A;  1QNT A;  4B09 A;  4BYY A;  4LG0 A;  2E1N A;  3BP8 A;  1T39 A;  5F6F A;  1P4W A;  1YO5 C;  1YS6 A;  4IVN A;  3J81 Z;  2ETH A;  1HKT A;  4UV8 A;  5CYV A;  5DD4 A;  4HX4 A;  1FLI A;  5BQT A;  2UXX A;  1G3Y A;  1TTY A;  4R79 A;  1Z91 A;  1KYZ A;  3E6D A;  4ZYH A;  2MLG A;  1LDK B;  5K5O A;  3KP4 A;  3KEO A;  3P9C A;  2FML A;  2H94 A;  4BHC A;  3SZP A;  1U5T C;  3L7W A;  1B1B A;  2EB7 A;  2RC4 A;  3GO5 A;  4LB5 A;  2GZW A;  5E8I A;  3DEU A;  2Z33 A;  3IWZ A;  4L0Z B;  3K2Z A;  4KMF A;  2OD5 A;  5HDG A;  1P4X A;  1ZH5 A;  3R0J A;  4MTD A;  3LST A;  3KP3 A;  4U0V A;  5A2Q Z;  1R00 A;  3I54 A;  3FF5 A;  2VOO A;  4KN7 X;  4RGR A;  4EMS A;  1HBX G;  2L3D A;  1BI0 A;  4PGH A;  4IRH A;  2J5P A;  1O3S A;  5CVI A;  3WU0 A;  3ZPL A;  3O6B B;  4KNY A;  1KU2 A;  3R6S A;  1ZLJ A;  3NQO A;  2R7D A;  3VEP A;  2ESH A;  3LAP A;  1B59 A;  4MQV A;  3TDZ C;  5ILU A;  1H0M A;  1IXC A;  2FBI A;  2OA4 A;  3CTA A;  3TOB A;  2YX7 A;  3EDP A;  5BOX A;  4L9T A;  2ZNZ A;  3Q9V A;  2MC3 A;  3KEQ A;  1G3S A;  1S6L A;  4KUM A;  4HLX A;  3J81 K;  2FBK A;  2STW A;  5L3D A;  1JHF A;  2OQG A;  4U88 A;  5K5Q A;  1MGT A;  2AXL A;  4G9Y A;  1E17 A;  4LK0 F;  3ZP5 A;  2IA0 A;  2IA1 A;  2X0L A;  2GA2 A;  4ZH4 F;  3GWZ A;  4YFK F;  5K5R A;  3I71 A;  5LEK A;  2FEZ A;  2IJL A;  1LB2 A;  1J5Y A;  3BOQ A;  3WOD F;  5HLG A;  2QYO A;  4KIG A;  2Q0O A;  2GIV A;  2IVM A;  2KJB A;  3TO9 A;  5ICF A;  2ZKZ A;  4LLL A;  4M71 A;  1KU7 A;  2JZY A;  4Q47 A;  1YFH A;  2W24 A;  1YW9 A;  2GA1 A;  4P9F A;  1K6O A;  4NQW A;  3MZH A;  1OPC A;  5ICG A;  1IN7 A;  1FNN A;  4S05 A;  2A61 A;  2VC1 A;  1MJ9 A;  2OZ6 A;  2BBY A;  2PLY A;  4M73 A;  1O7L A;  3WGI A;  1J0R A;  3I53 A;  1T2K A;  4I98 B;  2DW4 A;  3HHH A;  3FXQ A;  1BM9 A;  4XRF A;  3ULQ B;  4TV7 A;  1F9N A;  2HFH A;  2DFI A;  2K4B A;  2W85 A;  4A5N A;  1CF7 B;  4A0X A;  4G6D A;  3DFG A;  5CVJ A;  3HSR A;  3BPV A;  2Z9O A;  1DP7 P;  2TDX A;  1YS7 A;  2VE8 A;  1O3Q A;  2P6S A;  1S8N A;  4GXO A;  4YIF A;  4EM1 A;  2ELH A;  3QPT A;  2FQ3 A;  3R60 A;  2UZK A;  1LQ1 A;  2GQQ A;  3ZMD A;  1TBX A;  2QQA A;  2JT1 A;  1KYW A;  1ONV A;  1JHH A;  3NRV A;  1BOA A;  3REO A;  1YTY A;  4Q48 A;  1XB4 A;  2H6B A;  5DDG A;  4EJT A;  3ROU A;  1J9I A;  2PFB A;  2XRN A;  3JSO A;  2RN7 A;  2NRA C;  1XMK A;  2FBH A;  2P5K A;  4U0Y A;  3FMQ A;  1Y0U A;  3HYI A;  2XHK A;  1WQ2 A;  2QQB A;  4L9V A;  4CXF A;  2EFP A;  1YIO A;  4MEX F;  1BIA A;  3I0T A;  4KIC A;  3U2R A;  2H27 A;  4ETS A;  1DPU A;  4A2U A;  2RKH A;  3QU6 A;  2XGX A;  3E6M A;  1OR7 A;  4HF1 A;  1G3T A;  4FX4 A;  5J8F A;  2BV6 A;  2JSC A;  4IHS A;  4PDK A;  5CVU A;  4EJU A;  3LFK A;  3PQK A;  1OMI A;  5DCM B;  1MDM B;  3GZ6 A;  3FXR A;  4R8H A;  1HKS A;  4AIH A;  2G9W A;  2NNY A;  5HOO A;  4Y13 A;  2STT A;  1IZ1 A;  5F1R A;  1R5G A;  5LHG A;  5BMZ A;  3GLX A;  2XKP A;  1KU3 A;  2HTJ A;  3RKY A;  3I64 A;  4WF2 A;  3ZMU A;  4RGU A;  4I7H A;  4L9J A;  2DBB A;  4I01 A;  2V1U A;  1P6R A;  4CO8 A;  5FGM A;  2VBW A;  3E97 A;  1YQA A;  4BNC A;  4M9S A;  4P55 A;  4Y17 A;  3LAJ A;  2EA2 A;  3MAJ A;  3EYY A;  1ZGJ A;  2CQK A;  5DCM A;  2LSO A;  1W7P B;  2XUB A;  4FX0 A;  2HKX A;  2V1D A;  3F21 A;  4HYE A;  2HOE A;  3FXU A;  2DK5 A;  4OMY A;  1MZB A;  3ABU A;  3E6C C;  3LWF A;  1GXQ A;  3J80 K;  4BHP A;  2BE5 F;  4UXN A;  2QVO A;  5LEJ A;  4N9I A;  3K1N A;  4P9U A;  5DCF A;  1FYK A;  4R1H A;  1U3E M;  1W5T A;  2P4W A;  3CJN A;  3F6O A;  1JXS A;  2A3S A;  2PJP A;  1W7P A;  5JFR A;  3GXO A;  3MWM A;  3P9I A;  3NEU A;  3I5U A;  3K9T A;  2QUF A;  2LF8 A;  4AWX B;  2GWR A;  2P5L C;  4H0E A;  2EFQ A;  1IF1 A;  2O8X A;  1QPM A;  1FYM A;  2KJC A;  4I0A A;  1H9T A;  3CO6 C;  2DQR A;  2V1X A;  2PN6 A;  2EFN A;  2XVC A;  1O3R A;  4KMU X;  4EJO A;  3O3K A;  1WRJ A;  4KDP A;  1VTN C;  3JAM K;  3CUO A;  1U8R A;  3T1B A;  2RV8 A;  1TQI A;  3ECH A;  1XSX A;  1IW7 F;  3DQV C;  1UB9 A;  3LA3 A;  1Z6T A;  3ZMV A;  4MTE A;  3WTV C;  1W7P D;  1J2X A;  3M8E A;  5DYM A;  1O3T A;  2J5O A;  3K0L A;  3ERE D;  2Y48 A;  4A0Z A;  3C7J A;  4I02 A;  3MFK A;  2A68 F;  4RB2 C;  1JE8 A;  1UHM A;  5DEQ A;  3QP5 A;  2PMU A;  2VC0 A;  3IC7 A;  2PBI A;  3L2C A;  1ON1 A;  1IXR C;  2PQ8 A;  4IRG A;  3FM3 A;  3IKV A;  2ESN A;  2HQN A;  4ESB A;  5D5W B;  1A04 A;  2L4A A;  3GZ5 A;  3LQR A;  5D5V B;  1SD5 A;  5HVQ C;  4BXU A;  3M1E A;  2D45 A;  2NNN A;  4HZF A;  1TNT A;  4Q5S F;  2V6C A;  3F22 A;  2MH2 A;  1ZYR F;  5JR3 A;  2FE3 A;  4NB5 A;  1GXP A;  1ZRF A;  3MCZ A;  3DXJ F;  3RYP A;  1RZ4 A;  2EV5 A;  4KT5 C;  2IW5 A;  3VFZ A;  3TO7 A;  2Z5U A;  2GXB A;  2M5W A;  2QQ9 A;  3DV8 A;  3E6B A;  2PEX A;  1EV7 A;  4PGG A;  2IPQ X;  2ISZ A;  2DAO A;  5HDN A;  4ZYD A;  3SHF A;  1R36 A;  4JBA A;  3Q5F A;  1R7J A;  4M72 A;  1SAX A;  3ZMT A;  2OU2 A;  2COM A;  3I58 A;  4IHT A;  3IKT A;  1XN7 A;  2EV0 A;  2YU3 A;  2FXA A;  3L9F A;  3OOP A;  1STZ A;  3G73 A;  4M9X A;  2VBX A;  3GEZ A;  1E2X A;  1PUE E;  4N0B A;  2XV4 S;  1K7A A;  3CUQ B;  2FU4 A;  2M87 A;  1ZHF A;  3FMR A;  1I6X A;  1GHC A;  1MJA A;  2QM3 A;  1LVA A;  3C3W A;  5HS8 A;  3QAH A;  4OIO F;  5BPD A;  2FF4 A;  1I27 A;  2IA2 A;  1QZY A;  1XGN A;  4OIR F;  1HW1 A;  1NHA A;  3DPT A;  2XAJ A;  4KIB A;  4HAM A;  2YR2 A;  3KP5 A;  1U6G A;  3N4M A;  4AIK A;  1SD6 A;  2R7F A;  1B6A A;  5LHI A;  1R58 A;  1F5T A;  3FWE A;  2MH9 A;  4WK8 F;  1XDU A;  3WE3 A;  1HQC A;  4A6E A;  2A6E F;  2GAU A;  3TGN A;  3JTG A;  1HST A;  2FNA A;  2HWV A;  1TW2 A;  5E18 F;  1FT9 A;  2L54 A;  5LBQ A;  2CO5 A;  2ZBK A;  3HOS A;  1FP1 D;  1TW3 A;  2F5E A;  4YII A;  3KZY A;  1WSU A;  1BC8 C;  2ZME B;  3RKW A;  3HRU A;  2KIF A;  1ZG5 A;  1FSE A;  3BJA A;  4YFN F;  2V79 A;  4F7Z A;  3F8B A;  5D5X B;  4HLY A;  2Z3Y A;  3F8N A;  2O61 A;  4G8X A;  4Z2Y A;  2HTS A;  2OZU A;  5LGU A;  3I4P A;  1UFM A;  2VN2 A;  2W84 A;  4UVA A;  3K69 A;  3RPU A;  2KIU A;  4UV9 A;  1RNL A;  4KYW A;  5HDK A;  4CGZ A;  3SXY A;  1USS A;  1RUO A;  4D0P A;  2EWN A;  2DT5 A;  2VT2 A;  5FLX K;  3RIR A;  2ZME A;  6PAX A;  4G6Q A;  2HQR A;  1F4K A;  1SFX A;  3D0S A;  4HDU A;  1YW8 A;  2HS5 A;  2CGP A;  2KKO A;  4BH9 A;  3KP6 A;  2DO7 A;  2CSO A;  2FA5 A;  4YG2 F;  3Q9S A;  1PP8 F;  3M8F A;  1RUN A;  1BN5 A;  2MLK A;  4HQM A;  5FB2 A;  4XLN F;  4LK1 F;  1KQ9 A;  3FZV A;  3RI4 A;  3GF2 A;  1ULY A;  5D8L B;  2YSR A;  1S3J A;  2ZO4 A;  2QLZ A;  4ZZL A;  1Q1H A;  4UHT A;  1BBY A;  3G3Z A;  3ZQ7 A;  1T0F A;  5EEH A;  2E1C A;  2RQP A;  5CJ9 A;  1IRF A;  1X3U A;  3GFI A;  3HOT A;  4PZJ A;  1SD7 A;  5EEG A;  1J75 A;  4XSZ F;  1LJ9 A;  3B73 A;  4KFC A;  5DUK A;  4CYD A;  3CO7 C;  1TQP A;  2CWE A;  3H92 A;  5ILV A;  4RAZ A;  3KCC A;  2XIG A;  2O03 A;  2WC2 A;  5FFZ A;  5E8G A;  3HIF A;  3E5Q A;  3MZY A;  5J6X A;  2L01 A;  4CDG A;  4GGG A;  1TLH B;  3J80 Z;  4BQA A;  2M1B A;  1CF7 A;  2XAF A;  5KK1 A;  1SMY F;  5DD8 A;  2LNB A;  1TNS A;  1FC3 A;  4OOI A;  3P7N A;  2EFO A;  4HDV A;  2OBP A;  3SZT A;  4E70 A;  2F5F A;  1UST A;  2NAZ A;  4G7Z F;  5TJJ A;  1CGP A;  4OMZ A;  1D8K A;  1XGS A;  2A5Y B;  2EA4 A;  3HSE A;  4LFU A;  2XKO A;  2P7C B;  1OYY A;  3GFM A;  1YW7 A;  3V7S A;  2DQL A;  4WX9 A;  2O0Y A;  2FNP A;  4CIC A;  4EQQ A;  1ZRC A;  3V8K A;  3PQJ A;  1T6S A;  3CDH A;  4WWC A;  2RDP A;  4UVB A;  5HS7 A;  4HX7 A;  2FRH A;  4EJV A;  3RKX A;  1O7F A;  1XCV A;  3ML6 A;  3F3X A;  1I5Z A;  1SFE A;  3F23 A;  1C0W A;  3JAM Z;  1QZZ A;  2Y75 A;  1JGS A;  2DLL A;  1FYL A;  3BPX A;  4ENM A;  3EQL F;  3WE2 A;  4WCG A;  3DF8 A;  2K4J A;  5ILS A;  3TOA A;  3ZMZ A;  3I59 B;  5IT3 A;  3IL2 A;  1BIB A;  3LA2 A;  1UHW A;  2M8E A;  1Z1D A;  1BJA A;  1IAW A;  1HW2 A;  3HTU A;  3ELK A;  4Y15 A;  2F2E A;  2F5D A;  3GW2 A;  2YPR A;  4UUV A;  1J7K A;  5J8C A;  4Q4Z F;  4N9H A;  3KLO A;  3KET A;  3C1D A;  4G94 A;  1MDM A;  3L09 A;  3L00 A;  4KIF A;  1XGO A;  3T8T A;  2CFX A;  4IPA A;  3I59 A;  2K86 A;  3E3V A;  1FX7 A;  1YG2 A;  2ADU A;  2D2W A;  2RNJ A;  4WXD A;  4O6J A;  1V4R A;  3ZN0 A;  4L0Y B;  2NYX A;  1R1T A;  4L9N A;  1F1Z A;  5D6F A;  5F64 A;  3VOE A;  4A6D A;  3M9A A;  2O3F A;  5D6E A;  3T8R A;  5CLS A;  2RVC A;  4DNC A;  1LEA A;  4HQE A;  3V8J A;  3U1D A;  1QBJ A;  3V7C A;  4BHB A;  2ZXJ A;  5JVT A;  2EFW A;  1IN6 A;  3TDU C;  4OU0 A;  4MHG A;  2LF7 A;  5LHH A;  5ED4 A;  3RTR A;  2HYG D;  4JK1 X;  2D1H A;  5L3C A;  5CVR A;  1Z7U A;  2NS0 A;  3GFL A;  1G3W A;  1REP C;  3HRS A;  1MD0 A;  1W5S A;  2DPD A;  1LDJ A;  3EYI A;  1FP2 A;  3BZ6 A;  1FSH A;  1ZAO A;  3HUG A;  2MA3 A;  4RB3 C;  4K2E A;  5H6R A;  2ZNY A;  1ZGA A;  4ENK A;  1LEB A;  4OIP F;  4EJW A;  4OIN F;  1ODD A;  5FFX A;  1U78 A;  3BJ6 A;  1B4A A;  1ZRE A;  4OIQ F;  2EV6 A;  4AD9 A;  1OYW A;  1KQ0 A;  4LJZ F;  1HSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...