3KPLA

Crystal structure of hla b*4402 in complex with eeylqafty a self peptide from the abcd3 protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kplA01
1P1ZB 4UIKL 3QZWA 4DN3H 5IQ7H 1TETH 5HHXL 1BFTA 5HXMA 4NT6B 4NN7C 1NAMB 1ADQH 3AXLB 5LAXA 3VXNA 4P46A 3WN5C 4ELMF 1C7TA 3MV7B 3P0GB 4PJHF 4JN1L 4AEIL 2N7BA 1M7DB 4FXGB 2FYYA 5BRZA 3WD5H 2AGJL 2ICWB 3N9GL 4AIOA 5DR5L 1BMGA 3C5JB 1QTYT 1RIHH 5FDYA 2VIRB 3HG1D 4HIJA 3BGAA 2F58L 3MC0A 2AQ3A 4P2OA 3NAAH 4PTTB 3IKCA 2PYED 1QFWL 2ADGB 2DQFA 2VDOH 2Y23A 2NY3C 3QCTH 1A7QH 4KFZC 4HIIB 3NA9H 3C8HA 1EAJA 5C07D 2AJYH 1AXTH 4MVBD 2W38A 2WW8A 1HXYB 2E7CA 4MXQA 5D7JB 4L8DA 5HYSG 5D5ME 4WENB 1T2QL 1JPGA 3AUVA 3JV6B 3CMGA 2C7UB 2AJVL 2ZUQC 1HQ4A 4DGYL 4JY6A 4YIQA 4ZSOB 3QI9D 3K4AA 2ED7A 1MNUL 1F4WL 4GBXD 5EOQL 2Z92B 2IPUK 4KMLB 4N8VA 2BVPA 1F5WA 3ZMRA 2JIXD 2YPVL 2AJZA 4B41A 3PGCA 4MD4B 3O3BB 1SM3L 3L3IA 2DQEL 4NM4H 4WV1A 3DVGB 4S1SL 1GIGH 2EICA 2QKIA 3ECBB 4O00A 3U0PB 3WIFB 5D8JL 4UT9H 2P47B 3DSFL 3MLUL 5DLMH 2J4WL 4PJGB 4HUKB 3F7RA 4JE4B 3TJEH 5IHUL 2APBA 4KHTL 1AKJA 4KV5E 4D8PB 3JUZA 2OXHA 1UWXH 4TRPL 2VLLA 2GJ6E 4OD2B 5BXFA 4DJMA 2OM5A 1S8DB 3MNVA 1MRDL 3T4AA 1HHKA 2F54B 1BECA 5HVFB 2VJXA 2VDNH 3O2DL 1DLFH 2CIIA 1WZLA 4HFUH 4LLQB 1U8QA 1J11A 3PABA 4P46D 1AGCA 1DQLH 5DFVD 1KCVH 2NXYB 3B6SA 1PG7L 1MHHB 5FECB 4HUVA 4F15B 1MHPL 1XF5A 3QA3A 5H94A 5KSBB 4HFWB 5BRZD 4LSQL 4S1DC 5DJ6B 1VESA 5EZIL 3KLSA 4ODUA 5K9OB 5GS1C 2Y6SC 4MDJB 4X6CF 3NZ8A 4P2OD 3D9AL 2BNUA 4PY7A 1MH5A 5DK2B 4TNWK 2X1WL 1LE9A 3D25B 5FA4A 2MPAL 3MODH 3U30B 1A1MA 3GMRA 4XCFL 1BGXH 1SEBA 4ZUWA 5CD3A 1MF2H 2HH0L 3L3OB 1C5BH 1HKLH 3ULUE 1RY7B 5EFIB 4NZUH 4WY7H 4S1QL 4RBPH 1OARL 1S3KH 2WNGA 2UY6A 4JFEA 5J9PB 4M8VA 4OZGF 4MCZB 1WIUA 4JB9H 1H8NA 2NTFB 4B7LA 1KIQB 5M7QA 5D6CB 1GGTA 1DQMH 2NXZC 4KKLC 4F7PB 5D7IB 3TNNB 2YKLH 3UAJD 4XVSL 1RK0B 2UYLA 1JV5A 5E7FA 2ZG2A 1FE8H 1B4RA 2UY7A 3MRIA 5ALCL 1A7NH 1FC2D 2WBJC 3PHQB 3S5LG 4EIZC 1GH7A 3MYJB 3BGMB 4K7PH 1FNGB 3ZO0A 5ACZB 1AKJD 3ZE1F 3FO1A 3ZTNL 3MLTA 1OTUC 3QUZB 4OI9A 4JG1L 1AC6A 2GTZA 4U1SA 3WCYA 1CFSB 4NFCA 1CFTA 4PS4L 3QCUH 5EIVA 5C92A 3KYKH 4KVNH 4PP2A 2HKHH 2R1WB 3O2WH 1PSKL 3MJ9A 5EC1A 4CKVX 3O3DB 4PGBA 1FRGH 4HV8A 1ZOXA 2J3SA 1I9JL 1L0QA 3BEWA 3F58L 3S96A 5IEKA 1MSPA 5DZLA 1CDJA 5DQDH 4PJ9A 4DW2H 4R4ND 1DUZA 3AB0B 1B4JH 1EBAA 2AKRB 3WIIH 2UZIH 3NBNA 5HGAA 2DQIH 2VDPH 3GJFA 3JV4B 4MX7B 5CKAA 4C83B 1A1OA 3GUTB 1RZFH 1SYSA 43CAB 4G6KH 1A7PL 5D7LE 5BQ7A 5BVJB 5GISL 4CADA 5K59F 2A74B 4H1LG 2FNBA 4R3SA 4JGJA 4ZDHA 1BZ7A 3IXAB 2VH5H 3KYNB 4JFED 4B0MM 3IT8D 3DGGA 2WINA 5D2LE 4FFZH 4OQTL 1G9NL 3GSQA 1AQDB 3SKUD 4LPYA 3PXJA 3T09A 4ZO8A 2R8SL 2HRPL 1CFQA 3HE7A 3MNZB 1EPFA 3B9KC 5KS9B 3OR7A 5IMMB 3QNZA 5HHNB 1T5WA 4HLZH 2NX5B 5B4MC 1ZANL 5IHZB 4KAQL 4L4VB 4YBQD 3MV8B 3EFFA 1UKTA 3O9WC 1I3VA 3BZ4A 3ROLB 3ARQA 3Q1SH 3DTXA 1SJXA 3WEXA 1AHWC 1T04B 2DMKA 3KG5A 3QIBA 1BFVH 4AEHH 3QWQB 4G43A 2VUOA 3DRTB 5TPWL 4R7DA 5FFLA 4LSDA 4XCCL 4M7LL 4JR9L 2E9IA 4HH9A 4IDJH 4PR5B 2XWJA 5DJXB 3VDBA 4DN4L 1JMXA 3JVGC 3C2AH 2FGWL 5DD6B 4U6VL 3D18A 2VTFA 4LARH 4ZPVB 3MRLA 2FX9H 1K8IB 2E8YA 1X9QA 1SEQH 4ONFL 3EDEA 4UQ3A 3RNKB 2CXKA 1PD6A 4D3CH 2WLYA 4UOW1 1TENA 1OD9A 2Z0BA 1YEEL 1ZT7B 4M5YL 5ID1B 2E6JA 4M7JH 5TE7H 4XXCA 3TT3H 5C0CA 2VDMH 5HGBB 3W2DH 4D0DA 5ILTH 5BW7C 3JBG7 3QO0B 1N8ZA 3FO9B 3IAGC 1QBAA 1SBSH 4HWBA 1HI6B 3SDCC 4FXKA 4PJ9D 2NYYC 3EYVB 5I16A 1N64L 4FZ8L 4PREA 5HGHB 5I66A 5E5RB 2FO1A 1H3UA 4LCIH 1DUYA 1YEFH 4TULL 1QA9B 1U41A 3L7FA 1DR9A 2VAAA 5DI8B 3ZDZE 3JTTB 4JPWH 1NBQA 4YZFF 1KIUA 2CPCA 1YA5A 3QUML 2XZQL 1K85A 1T66C 5DJZA 4UT6L 3HE7D 4NUGL 5HPMA 5IBLD 3IU3A 1Y6KR 2EO9A 5F8QC 1F4HA 3GKWH 2WUCL 4NQTA 4TTDC 2NY7L 1QRNB 2MHAA 4MDIA 4LFHG 4P23A 3SCMB 1GRWA 5E08H 3RPKA 3MGTA 4J8RB 5BVPH 3BH8A 4NO0A 4NN6C 2YUWA 3QIBD 2Y9RT 1RK1B 4HIEB 1SBBA 2W9LA 3MLVL 4JO4L 1M05B 1H9VA 1JNNL 3BW9B 1WAAA 3PP4H 5F6HJ 3IKKA 5JXED 1LO3H 1MI5E 4PJBE 4XP9H 1NEZB 4NGHH 1AFVH 3MUGB 5C0AB 3GO1H 2YD3A 1ZA6A 5E00B 1JI1A 2OQJB 1PW3A 1YJDC 1YPZF 1U8OB 3QJFB 3UBXA 4QTHB 5C2BL 4D2NA 5EBLB 1AXSA 4Y5VA 4OF8A 4RFEA 4JDTH 1JF1A 2CXGA 1EV2E 4X7DC 1M71B 2FGZA 2Y7QB 2A0LC 4GKOA 5DRWB 1M6OA 4ENEC 5MEOB 3E2HB 4UDTB 3VD7A 5ITFB 4WUKH 1OOAA 1IM3B 3STLA 4JREB 3WN5B 1WEJH 3VFUA 3FQWA 4XCYB 3NFPB 3FQUB 3LS5H 5EO9B 4LL9A 4XI5D 2GY7B 4I5BB 4OCMC 4GAGH 2YN5A 4KZEH 3WJJA 4QRSA 3V4VH 1FIGL 3OB8A 3VFNA 4XP6H 4S10A 2ADIA 4JVUA 1WF5A 4LF3A 4QOKB 3SDDB 4RDQF 4ELKB 4YO0A 1WFOA 2WZPD 2NY3B 4XC3H 5ELIA 3UDWC 3MRFA 3WKNA 4X6DF 5DEZA 5HYSA 2B7DT 2HFGL 3D69B 4HKJA 4P3CL 4Y16A 2VLJB 3DMMB 4X4MA 4MCYA 5IT2L 5DMIL 2Z8VC 2F5BH 5TH2A 5F96H 4PV9B 5I1IH 3AVEA 3VXSA 4TOYL 4C56A 3ARZA 4TVPE 2KQNA 4NQEA 1E0OB 1UQSA 3D85D 1T0PB 1MWAB 2X42A 1NJ9B 1Z0MA 1E28B 4GRLC 1XGRB 1RURL 2IQAB 3IS1X 2C4XA 5E6IA 4KJWC 1FL6B 3L3KB 3F5WA 3V79C 1Z2KA 3VGGA 3LKOB 4NO0D 5I1AB 1BQHG 4KK9C 1CR9L 4PDCE 2EO1A 2ZSVA 1FHGA 1I85C 1YMME 5HI4C 3TFKC 1Z9OA 4YBHA 2IFFL 1RU9L 2VXTL 5E8OA 4ZFOB 4ODBD 1UWEL 2FL5B 3C8KB 4XPGH 5FM8A 3RFZC 2E27H 1IGCH 2FATL 4XVJH 3O81A 4O2EB 3PWNB 2ESVB 5F7FA 2NNAB 5EWIH 2AQ1A 3QIWC 1NBZB 3KLAB 4XNQB 4NNXA 3U6RA 5CP7B 2CO6B 4ZOCA 4HWEL 3BIAX 4P5KB 4OZHB 4XMPL 4RWYL 5D5MF 2HN7B 3HI1A 3PJSA 5T1DH 2YUVA 2E9WA 4ZS7H 5B38B 2APWA 4IOIA 4U6HB 5T5FH 4JDVB 4P5MA 2BDNH 4OLVL 1YNKL 3ZYIA 5T3ZH 2AK1H 2GSGB 3GHBH 4JO1H 4Y2DD 3VDCA 3HC4L 3SE3A 4OZFB 2E6PA 5GS1B 1RZGA 4WCYH 4MWFA 4WTZG 2A6JB 3B2VH 4ZAKD 1T4KA 4KRLB 4YEFA 1MJUH 1KIPB 2QSQA 43C9B 3KPTA 2DYPA 4LQFL 3IGAA 5EU7C 2LABA 3HZKA 3SGEI 2XZAH 4L3EE 4X0KA 4GG6A 3OXSA 2XQBL 4JM2A 1P84J 5D9SA 5A3IC 5KJRH 1GGUA 8FABB 3U1SL 2HFEA 3I75A 4KV5F 1FFQA 4UILH 1CT8B 2ERJB 3VXPA 3O4LB 4FFYL 2NW3B 4PB0H 5SV4A 3HE6A 2W60B 4WTXA 3DURA 3VXSD 3W0WA 4C56D 4NQED 1CTNA 3QG6B 1FYHB 3KYOB 4AG4H 2NXZB 4G8FB 2BOBA 2XZZA 4XH2A 5J56B 4X6FB 4MD5A 2VITA 4AT6A 3TBVB 3PV6B 3FHAA 1LMKA 2QR0A 5HJ3B 3P30H 3BRGC 1RJLB 3S5LA 3BEVA 2AJSL 1QBLH 2DB8A 3Q0HA 1QBMH 3DXAE 12E8H 5M94B 1AE6H 2JELH 5IW1A 4HPYL 2I9LA 1MVFA 3GIZH 3BUYB 3FFCA 4WU5B 4C4KO 1H3PH 1WBXA 4QXTA 3RVXD 2PW2B 4EVNB 3I9GL 1QSEB 5MERB 1IGJA 3TA3C 4X6BB 3SGEH 1KJ2A 3QFDA 4OIIH 1TQBC 4R2GB 3TBWA 3QWOB 4PRAA 3ULUF 4AK1A 3LKNA 3UROR 5C2UB 3IETA 2GCYB 4W81A 4Q2ZB 3GMPA 4I8DA 1NDMA 2WQRA 4KDWA 2DQUL 1OAQL 2DM4A 4LSTH 1S9WA 2YD4A 3MOAL 3RWIB 3V6FA 1ZWIB 1LQSR 3HCVB 4KI1A 4F58L 4ZO6A 4G6ML 1NGQH 4BKLA 1IBGL 5HI3D 2HRLA 5IR1A 2DN7A 5I76A 1ORQB 4HGWB 5CHNA 3A67H 1UG9A 2FRGP 4JCLA 4YWGH 3RA7H 4F37K 4KC3B 2UWEA 4QNPE 1CD1B 1F8TH 3TO2A 4ESKA 4H20H 1U8PA 2DYPD 5E1AB 3D5OF 4H1LA 1DDHA 3VH8A 3DX7B 1QVOA 4JM2D 3MRMA 1I9RH 1PYWA 4LPUA 1GOGA 5AYUL 1HWGB 4GW1B 5F7UA 4FP8H 1CF8L 1B88A 4R4FL 3O8XA 1JFQH 5LXGL 3HE6D 2CLRB 2AXFA 4J7RA 4NQCB 5DJDB 3BD5A 3PL6B 5HDOA 4HJGB 5SWZB 5DHVA 4I3GA 1U8JA 4YNYA 1GXEA 3B9KB 2MCPL 5GRUH 3GSRA 1OAUL 5KOMC 1DBAH 4HWBL 2F74A 4OM0L 4GW5B 4WEUD 3MRHB 2IG2H 3O9WB 2DWEA 1MIML 1G7MA 4LCWA 2ZCHH 4KDTC 1FFOA 2D31A 4OTXH 3SDXE 1JGDB 4G7YH 1QSFB 3T0EA 1RMFH 1DBMH 2ZSWA 3HZYB 4QRPE 3U82B 4PRIA 3NABH 1CFNA 3FFCD 4Y4HD 2Y5TB 1RHHB 3STZB 3WO4C 4N0UE 1A7RH 3W81A 1AGDA 4G8EA 1LP9A 3GZKA 4ODXB 1OW0C 1EAPA 1DVFA 3MRKB 4M6NH 5F89B 1EZVY 3DI2B 2EZ0C 1RZ8A 5TF0A 4AYFA 3KYMA 3V95A 3VXMB 4XXDA 1U9KA 3O6KH 1GGBL 4IM8A 5GGSA 5F21B 5EOCH 5D2NE 5HYIA 2ATKA 2E3VA 1OSPH 3NA4A 1WWCA 3SDCB 2Y72A 3BWAB 2G5BB 4LHUD 5JMOC 5I1DB 1MQKL 1H15A 5AWNL 4HKXB 4KK8C 4BSWB 4RAVA 3TF7A 4NYLA 3R4DA 1FFPA 5TE4L 4EN3B 1F6AA 1M1SA 2N4IA 4UDUB 2NR6C 1KPRB 2H2PD 4JJ5A 1E6JH 1KFAH 1KEMH 3B83A 4ZTOH 3QCVL 5A2IH 3HUJE 4JFFA 2H8PA 2AK4A 1C12B 3DVNA 4NQVB 2XN9D 1H3VA 2A83A 2YPLA 4AEFA 4Y1AB 3D2UA 3KDMB 2MMXA 1XH3A 5JHLL 4PJ7A 5IROC 3MBEC 4MNGB 1G7PB 4MJ6B 4ZFGH 1NBYB 3QULA 3FKUS 3O3EA 3TJHD 4W6WB 2A6DA 1ZLVH 5IK3B 3DROA 3VXRA 4LAQH 4LCWD 1A6AB 4HUMB 4H8WL 2FLBT 4MA8H 2AEIT 3CC5A 4Y7MA 5ICZA 1X5AA 4JPIB 3T0ED 1Z5LB 5EU6E 5BOPA 4PRID 1JE6A 4HEME 3L5JA 4Q9BA 4ZD3H 1HINH 4KPHH 3WSQH 3SKOB 2OJZH 1QLEL 4HG4K 5DJ2A 2A6KB 3E3QC 5L7XL 1HILB 4BZ1L 4EIGB 4K7FB 4CGTA 3CFCH 3ZSTA 3ZDZF 2D7QA 3MXWH 1MRCH 4G42A 4WUUA 4BZ2H 5F7EL 3L3GA 4LIQH 3QB7C 5GS3A 2P8PB 2HKFH 1J8HB 4CJ1A 5L2KE 5CILL 4NRYB 1YZZA 1K3ZA 3ZYOA 4GW4A 7CGTA 2YPKB 1KIRA 4HJJH 3EJZC 1UM4L 3FAXA 4U7MA 4CMHC 1S7XA 1QEWB 2R39A 2UUDK 3I2CL 5A2JH 4DCQB 3VD5A 1ZLUH 3BP7A 1JN6B 3ES6A 1BOYA 3G6JA 4HPOL 2FEEI 1KSRA 3ULVH 1R3HA 1KGCE 2IANE 4OGXH 1AY1L 3RUGB 4ELMA 4U1NA 3JTSB 3M45A 1JNLL 2CUIA 4PJHA 4KRPC 2R2CA 1J05A 3HB3D 3SGKC 1C16B 3HMXH 3WUWB 3EHBC 1X7QB 4PJBF 2Y36L 5F9WB 1A6WL 1A2YB 1ZGLM 2F53A 1CE6B 1PKQA 3EJYD 4WEBL 4O4YL 1B6DA 2V2WA 2VLRD 1H3XA 1A3LH 3RWGB 4NC2B 2GAZA 2XQYK 1KYOK 4YDLC 5FO9A 1LO0L 4I0PB 2AK4D 4JFPB 3BZDA 1RSFA 1FNSL 3QEHA 2YPLD 1T1WA 3D2UD 2VQ1A 1JNHB 3H42L 3UYRL 1Q72H 4RDQG 2FX8L 2V2TA 4JANB 4LFHD 1GGCL 5T3XD 4U0RB 3DO7B 1GPOH 4GAYB 4PG9B 5C0DB 1BQHA 4GRLB 2X4PA 3FQRA 4OB5H 2F19L 5JOFA 1HHHA 4JVPA 2EC9T 4UV4L 5ESQB 3VXRD 4Z0XA 5I1GL 1FZJB 2QLVB 3KPMA 5IGXH 1AR1D 1S7TB 2VL4A 1GJIA 2KZWA 3QEGH 4OFVA 5INCB 3PHOA 2D3VA 4J3SA 5L8LB 1YN7B 2GIYA 2NZIA 5KVFH 4I77H 4YHZL 4M4RA 3EGSB 1UEMA 3KNBA 4UV7L 1X3DA 4JG0L 5HHVH 5I1HL 4GKSB 1OAXH 1S7SA 4U1MB 3UJIH 5I2IA 2R2EB 1BJ1J 3C5ZC 1XR9B 2H6PB 1VEPA 2IPKB 2G2RB 1CXKA 3GMQA 4HHAA 3CXHJ 4ODVH 4WUUD 2C9AA 1JF5A 3HI6L 4LMQI 1MFCL 3QDHA 4GRWB 1DEEB 1OGAA 4AQOA 4HIHA 3WNMA 1A4JA 2CRYA 3N85L 3U7YL 5E7BA 1P4BH 3HRPA 4JPVH 4BSVB 4RNRA 2OJEB 4FTVD 4WTZA 4MNQA 3IJYA 4ONHA 1C08A 4Y4FB 1MCSA 4AZ8A 4OLXH 4UNVA 2EH7L 2F54E 4KQ3L 2VABA 4PLOB 5CBAB 1B2WL 3IFLL 3R1GH 9CGTA 2E7MA 5INDB 4I18B 3PGDB 1SJHA 4N0CC 2AI0H 5FUZL 1KJ2L 1Y0LB 4NWUL 3QHZH 3MRCB 5T1KD 2F53D 2D7MA 3QAZB 5KSBE 4KU1A 1R5IA 4WW1A 4X6CA 5IB2B 1U91B 1N5AB 1U36A 2ILLA 1AIFB 2CDEB 2P43B 4MD0B 1FFNA 2MQCA 5CJ8A 1G6RH 4C4KT 3IDJA 2J8UB 1N4XH 4IRJB 2A9ML 2VDKH 5EZLB 1ZTXH 3AFLA 3HKFA 4YXLL 2FO4A 5B22A 3DV4A 1KF9B 4OZGA 2AEPL 4X5XB 1OPGH 4Z76B 3LPFA 1JWMA 4RFNB 4XWGL 4IDLA 4AY0A 1U3ZA 3BMVA 3QPQD 2DQJL 5I1EL 2ADJB 4J6RL 4LHJB 15C8L 4MS8C 1NGZA 5L6YL 5D7IE 3HR5B 3F8UB 1MLCA 4JM4H 1IARB 5DVLA 1C1EH 2IBGA 4ZFFB 1XZ0B 3S4SB 3T65B 4JDZA 2NQCA 1OT1A 4L8CA 4GRMA 3IXTA 5EIIB 4RX4D 4LCCC 4Q9RL 2SEBB 4NN5C 4WW2F 4XVTH 2Q6WB 5EN2A 4PP8C 5HHQA 4LVOB 4LKXA 1FGNH 4IS6A 4X9BA 2WK2A 3OTTA 1OGAD 3SJVA 3QDME 4KJYB 1A7OH 1NGPL 2CR6A 2P5WB 3D3VB 3MNWA 5ALBL 4XCEA 3CXDH 2J7LA 4DEPC 5KSAA 3W11C 4MNQD 1PZUB 4WGVB 4U1LA 2AEQH 3L3HA 5E2UH 4FNLL 2AJ3B 4KHXL 3U4EA 5JW3L 1I9EA 1EFXB 3WLWD 1JGVL 5HD8D 4NKOB 4ZG1A 4ZUTB 4Y5XA 4QHUB 2DL9A 2AXJA 1CL7I 1HWHB 4UUJB 4ZS6C 2QQNH 1OCWH 1N3NB 1UH2A 3FRPA 4ALAL 4ZYKA 1EGJH 3CFKA 3QT2A 3MCLH 2G5RA 1K5NA 1VA9A 1G9EA 1EMTH 3HI5H 1H8SA 3VJ6B 2E9BA 4JRYA 3MLZL 4NHUE 3WBDA 1P53A 4DQOL 2DM3A 4QHNB 2ZKHL 5I19H 4R96B 3T2PA 1NMCC 4QF1B 4X7CC 2JE8A 1UXSB 1FDLL 4L8SC 1MFNA 5IVOA 1E27B 1KPUB 1TZGL 3DARA 4K23L 2R15A 2VZSA 4TUOA 3EO0A 1G9NC 4WFHE 1VGKA 5ICXA 5KVGH 1A47A 2K1MA 1EXUB 1YJDH 5CEZD 2EXYD 2IMNA 2HJFA 5GZND 4I0CC 1MHCB 5BV7L 4OLUL 1H0DB 4J1UA 3MA9H 1T21A 3RZWA 1PG7X 5TJWK 2RJMA 5KS9E 5EC2B 2KBGA 3ZLQC 4UNTA 4FQ1H 5DUPH 5FHAL 3G08B 1D5XB 2Z35B 4L4VE 5E1HB 3V4PL 4EXPX 5CSZA 4KJQD 4GLRI 2DTSA 3MV8E 1YEIL 1CL7H 2HTLD 5C0BA 4OGZA 4R7NB 1OP3H 4EEEA 3M8OH 5DEFA 4TQEL 3QG7H 2R23A 4F7CA 5T3XL 3D39A 2M26A 4PTUB 1KPVB 2X1QA 4PGZA 1TZIA 3O6FA 3UJJL 4JQXC 4PJDE 5DRZB 3VFTA 4L9LA 4X8XA 3SJVD 5C08A 5ABDE 1ZEAH 4YHML 1LE5A 3RY5A 2Z8RA 2IADA 1ZVSB 4PJFB 5KSAD 1Q0XH 2A2QT 3W9EB 3QI9C 4PRNA 3GSWA 5IQ9B 1B6UA 3E6HA 4M8QA 3S35L 3VRLE 1ZGLA 3SDXF 2IEPA 3ZYJA 1MLBB 3EJJX 3MRQA 3BFOA 5F7DA 5IIEB 3LDBB 1CFVL 4AJ0A 1ITCA 2OSLB 1F42A 3PQYB 4XMKH 3U7WL 5IMLA 1MCBA 4Y19B 2JCCB 1M4KA 4X4XB 1UJTA 5FUCC 2OR8A 4MAYA 3G5XB 4QHLA 3HFML 1Q0YL 2G9HB 5I1KH 3CPLB 5D1XA 5IB3B 4JRYD 4O2FA 4UT7L 1X6LA 3LCYA 2GTWA 5GSVA 5IMOB 1MRFH 4OFKA 1NLBH 1A5FH 1UB5B 2YMXL 4LPXA 1F2XK 4G80B 1UWGL 3P0VH 4CW1A 3H6JA 4YAQB 2HLAB 4OCSL 1U8HB 1PAMA 1FCCA 1I1YB 3VRJB 3LEYL 4P46C 1S78D 2BY0A 5B8CA 1I8MA 4M6OL 1T89A 3H2WA 5EORH 5DFVC 3PHSA 1I7UA 5FGBA 3EYUH 2AV1B 4BELD 3SO3C 1MCPL 3FN0L 1NC4A 3DBXA 1BZ9B 4P59L 4EZMA 4HXBH 5JO5A 4P48A 3LS4H 3MV9B 1UM5H 4P9MH 2BP3A 3W39A 4P3DA 2GSIB 2GEEA 4P2OC 3HZVB 3DUUA 1EHNA 1FG9C 3EOTH 3S36H 2DLGA 1LWRA 3HUJF 1T1ZA 5ISZA 3WDHA 3CXHK 5BJTB 3D39D 4DGIH 4S1RH 4TNWF 2PKDA 2EYRB 1IAMA 4MXQC 3OJVC 1A6UL 3QXDB 2DQHH 1RFDL 1YPZA 1X5GA 5C08D 5D1QB 5C09A 4FQJH 2EIBA 4ZUSB 4LGPB 2EKSA 3ARVA 4LEXL 3ZTJH 4AH2B 1SYVB 4X9HA 1UJ3A 4PJIE 3U36A 3WIHA 3ZKNC 1IGYA 1RD6A 4ACPA 3UAJC 1NCCL 2Y25A 4I48A 2GYSA 3MBXL 4FQ2L 2XI9A 3MRBA 5AAMA 1FNLA 5LGHL 4KRPB 3G9VA 5DUBB 3GM0A 2Z4QB 1YEHH 5DS8B 1I3UA 2ZUUA 4JPKL 3EIFA 2CLZA 4WV1C 4BH7A 4K8RL 4Z8FL 3FT3A 4MAYD 5JW4N 4U6XA 5HDQH 1BP3B 4YDLB 2I9TB 1N0XH 4BQBA 1NL0H 5D1XD 4LPVA 5E8DH 1NDGA 2FBJL 3ZT7A 3QHFL 4OJFL 3OJMB 1OD7A 2YWYA 3ETBF 5CWSA 4QOKE 4X6DA 3ZKMD 5E2TH 4I2XE 4JRXE 4XCNB 3SDYL 3RU8H 1JI2A 2PTVA 3GK8L 3ZZ1A 3EZJB 5MENB 2MQ0A 4XNYH 4OCYH 2GFBA 3VWKA 5CMAA 5IHLB 4N9GA 2XTJB 4JFZL 4GKNB 2EEBA 1HEZB 4EUPG 2ZJSH 1LO2L 1UB6A 1GZQB 1AD0A 1P4LA 3H7LA 5GIRB 3PWPB 1DQJB 1NC4D 4HMDA 4P9HL 4UAOC 2VE6B 4H26B 1QG3A 3C5SB 4R4NC 4ZXBA 4CMMB 2P42B 1KLFA 3U9UB 5BS0B 3X3GL 3BX7C 1O0VA 1YMHA 3C5ZB 3Q6FA 5JPMB 3FO0H 4UQ2A 4PJCB 2L7UA 3V0WL 5D70L 3EOAB 2OP4L 3IB4A 5IW6A 5ISZD 5D1ZB 2J1KA 4KY1H 3GSNL 1U6AH 4QEGA 3DRQB 2IC2A 2CUHA 3SDAB 1RUKL 3UYPA 3UZVB 3WMSA 4ODTL 5C09D 5AD0B 3NACL 2ESVE 1LHZA 5CEZL 4GUPB 4CVZA 5D5MA 2V7HA 1DBKL 5CINL 4F7EB 1YN6A 1BD2A 3LV3B 3RKDC 4OZHE 4HK3N 3CNKA 2AV7A 3QYCA 3BIKB 4WFFE 2B1HH 3TCLB 4XPBL 5D72L 2W65A 4HIXH 1GAFL 3Q2CA 4G5ZL 2P5EB 4KUCF 2EYSB 2VR9A 1LEKB 3VMOA 1ODAA 3RWEA 3WKML 1IGFL 4MB5A 4L29A 1XGQA 2V2XA 5EBMA 5HHMD 3U9PL 2ZUSA 5C9JA 5K9KB 1KN4H 1VEMA 4PP1D 2W9EL 4R4BA 4HS8H 3O0RH 4GO6B 4PGEB 2X5PA 4W4NA 2GT9B 2ZZUT 1AGFB 2O5YL 2NLJB 3ULVE 3HTLX 3OJ2C 2GJ6A 3FQTA 5ANMB 1U8LA 4DOHB 1IL1A 3O4LE 3BGFC 1KCUL 1JPSL 1NCDH 1WFUA 2BHZA 1F45A 2GK0A 4RZCB 5GGRA 3MFFB 3HC0B 2V9QA 3IDXH 2XWBA 3GBMH 3LQZA 5BZWA 4PJ9C 1DN0A 1TNMA 2HA1A 4ZXBD 3JWOL 4OZ4B 1N59A 4MJIB 5GGUB 2PTTB 1KT2B 2ORBH 2QQQA 3BH9B 4P2YA 1DANU 3OHXB 4O5LH 3TIEA 1I8LA 3PE9A 5MEQA 5KSBF 5DJAA 2MKWA 4LCCB 1MFBH 4NN5B 5GSRB 2Q3AA 4P2RB 5H35A 2XACC 4DGVH 4JZJA 1BQLH 1YNTA 3I02B 1F58H 2EYTB 5I8KH 5K9QI 1R3JB 4JHZA 1UFUA 2PR4L 4HJ0D 1JZ7A 2VUYA 3BMWA 5IB4A 2JB6B 5C6TL 3HE7C 5IBLC 1C5CH 4JY5L 3MUY1 1KB5L 5EH1A 1MJ8H 1HHJA 3BE1H 1BD2D 4ZODA 1I8KB 3HN3A 4AMKH 4KROD 1F3JB 2QQLL 2EC9U 1S5IL 4QHMB 3QIBC 2OR9L 3RNQB 1MCLA 3QJHB 2VYRE 5HYFA 2NY1B 2IBZY 4NKMB 5D7IF 2GJZB 3TN0D 3CU1A 3S34H 5JA9A 3DUSA 2CQVA 5EO0A 1QKZH 1HCFX 3BP6B 5DA0B 1BVKA 4X9FA 4OGYL 2B1AH 2QADC 2FH8A 1FCGA 3VFGH 3MRRB 5DRNA 5GZOD 1Z9SA 1NMCB 4TYUA 2CMRL 1XCQA 3WFEH 1OTSD 4F9LA 1JK8A 4IRSA 1RUQL 5B39B 4J4PD 3VD3A 2WBWB 4IHOB 3T4YB 3REVA 2CK0H 1U92A 1K2DA 3OX8A 1MFAL 4XXCC 4U2ZA 3NVQA 4NQCE 3VFMA 5I9QC 1CXLA 4XI5C 1WZ1H 4KH2A 1KXQE 4GMTL 5FO8A 4M9OA 5TDPB 5I30L 3WNLA 3HG1B 4L5FL 4PRHB 1VFUA 1FAKT 1LK2A 1GGIH 5JQ6L 4JHWL 2PYEB 3BKJL 1T1YA 2CGRH 5CD5D 1EK3A 2OZ4H 1QSFE 4MXWL 1KTLA 2IAMD 3VXQA 2AW2A 5CJQH 5C07B 5TDNB 2YA1A 5KSVB 4NM8H 2P45B 1XMWA 2VXSH 4UIKH 1HOCB 4Q6IA 5HHXH 1TVBB 4M6ML 4TPRL 4ZUVA 5D7LA 1D5ZB 3MRGB 3GSUA 3ULUD 4X4YB 2RQ8A 3QI9B 4HX1B 4GBXB 1W72A 2AGJH 4JKLA 3N9GH 5DR5H 3RIAF 1RHFA 3SPVA 2BJML 5DWUH 4YFLI 3QWRD 1N0LA 4P23C 2Z8WC 5JOPE 2JIXB 5T1LA 5FF6B 5DT1H 3VXME 3UPCA 2F58H 3IFPB 4LLYA 3JWDH 4I9WE 1AJ7L 2FJHA 1NH6A 4DAGL 1NGYB 3HMWL 5KS9F 3OGOE 1BIHA 2BSTA 3BP4A 3RAJL 2Q8BL 3RY4A 4I3SH 1G7HB 1J0KA 4MLIA 2W1NA 1UENA 2DDQL 3WE6B 4C57C 2C1OA 1T2QH 2FWOA 4CVUA 1YQVL 1K4CA 3G6DL 4FN0A 4Y5VC 3FMGL 3MV11 4KGJA 2IPUG 1BVLB 3JV5A 4HWZB 1MNUH 1F4WH 4PJDF 5B3JE 4IRSD 5EOQH 3WIHL 4ONGL 3QZWB 5DJ0A 3MROA 4KVCL 2DOCA 4DTGH 3VXNB 3VW3L 4LSPL 2YPVH 3O3AA 5EZJB 2Q8AL 4Z77B 3V5DB 1SM3H 1QHOA 2DQEH 4JY4B 4Y1AE 4PG2A 4K3DL 2PCPA 3UCRA 2H26A 3VRLF 2FYYB 5BRZB 2OI9A 4F33A 1CGUA 4NBZB 4S1SH 3WJJC 4MNGE 4V3EB 5D8JH 4RRPG 3DSFH 3MLUH 5KN5B 3AS2A 4TVSa 3UX9B 4PGDA 4L3AA 4P2OB 5IHUH 1TJGL 4CDGC 5I71C 3LEXB 3HR6A 2DQFB 4J3OC 4TRPH 3TC9A 1FAIL 1EHLH 5E94A 2IF7A 1F4YL 4XHQA 3SEPA 5ADPL 4HK3J 3V7AE 1PZ5B 1MRDH 4Y16C 4BFIA 1JPTL 1TVDA 3O2DH 1FV1A 4L8DB 5CIPB 5DVOA 2CKBL 5E8EA 1HSAA 1U2HA 1N7ML 1J87A 4WI2A 1HQ4B 3QBTB 3EYFA 2NW2A 4YIQB 1PG7H 5GGRY 5JLZA 4YPGA 1MHPH 5DMJB 4MQTB 3G5YA 1AGBA 4LSQH 3RHWK 4QRRA 5EZIH 5IP4A 1YYLL 2BVPB 3LVEA 5E6IC 3F7VB 1J8HE 5T1LD 2O5ZL 2IH1A 1NUFA 2AJUL 3D9AH 3PGCB 4APQA 4D9QD 4NWTH 4U1HA 3L3IB 4GSDL 4D9RE 1R0AH 2DQTL 2MPAH 3U4BL 4WV1B 3UTPE 2FHFA 4XCFH 3RTQA 1CXIA 1FVEA 3SOBH 2HH0H 4RCAA 4EBQH 4L4TD 4P49A 1DP0A 4BK5A 1ZT1B 3L5XL 4S1QH 3RVXC 1OARH 3EO1A 1FQ9C 5DMKA 3RUGE 3TO4B 2OTWA 2VLLB 4PJBA 5J1AA 1T2JA 3BZFA 3P4OB 5E8PA 2X40A 5IVZA 3FOLB 5FEBA 4JGUA 3BJLA 2CIIB 4XVSH 3BN9D 4EUPA 4HT1L 1IGIL 3PABB 1AGCB 4KTYA 3U46A 1K6QL 5JIIA 4HUVB 4PJIF 1L9MA 2WMPA 3KPSE 1D9KA 5ALCH 1MCWW 1XF5B 2X4RB 3I6KA 5H94B 3QUKA 5J12C 2FDBP 5DVKA 4HLZG 5HI3C 4ODUB 3QIUA 3WFZA 3SE3C 5DJYA 5CEXA 2C1PA 3ALXA 2F8VA 3NZ8B 4XPTL 5BMFL 2CO7B 1MH5B 3GKZA 3GNMH 4PY7B 4EOWL 3ZTNH 1KG0B 5SX5K 3LN9A 4IOFD 4U1JA 1PEZA 1LE9B 1G7QA 5FA4B 4CN4A 2H32A 1XF4A 4PD4K 2O5XH 4M3KB 4JG1H 3P73A 1A1MB 3GMRB 2DQDL 5DD5L 3MCKA 4JFHE 4ZUWB 2FZ3B 4LVNC 5CD3B 4JM2C 1RUPL 4PS4H 1RIUH 3MLSL 3X3FH 3M07A 2R1YB 3EBAA 2YBRB 1A9EA 3HE6C 3TPUB 3VGHA 5IB5A 2OCFD 5DC4B 4X8JB 4IMKA 4XMLH 1D6VL 4RSVA 5FYLD 5J3HD 3DX6B 2FJFB 3F58H 4QRRD 1EVTC 5FOBA 4ETQA 1RZIA 2DLFL 3RDTB 4XP5L 2XWTA 4APQD 2CKNA 4TSAL 4MXVE 4U3CA 4GRWE 4LGRB 3TBYB 1FZMA 5F6HI 3N1FC 2LQRA 2B39A 2P8LA 3TBSA 3WHXB 4JHAL 2WBJD 5EO1A 5KBNC 3RTQD 1A7PH 4MQ7A 4V2CB 4WHTA 5GISH 1ZHKB 4BFEA 1YMMA 2B2XL 5KZCD 2R69L 2N7AA 4QTIL 2BRRH 1INQB 3FO1B 5ENWA 2ATPA 4KI5C 3MLTB 1I3RB 4OQTH 3IVKA 1G9NH 1UADC 3GRWH 1OTUD 3MJ8A 4UU9A 1ZLSL 2GTZB 3ULUL 2R8SH 2HRPH 5EZOL 1DQTA 1ZHBB 2R1XB 4DFHA 1G7LB 2H2SC 5GS0D 1ZANH 4KAQH 4WFED 4DVBA 4R9HA 1FL3B 1ZE3C 3SKJL 5EC1B 4PGBB 4IRZL 4JFQA 4L8BA 3BGFB 3HRZB 3HNSL 1D9KD 4P2QE 2J8UE 3CCHB 2IALA 2X4OB 3BEWB 4OZHF 4WO4A 3S96B 5C6WH 5IEKB 5TPWH 3QIUD 2XG5A 3TH4T 2DJSA 5JMRA 1OF2A 3B3IA 4M7LH 4JR9H 3ILPB 1DUZB 4LLUA 3UC0L 5I1JH 4NKIL 3IDYB 5IG7A 3GJFB 2FGWH 4U6VH 3T77A 3VA6A 1A1OB 3X14A 5FA3A 5GGTA 3JWNC 3X11A 4ONFH 5BQ7B 1OM3L 3IDNA 1HXMA 1BFOA 4LKCB 2JKXA 2MFNA 4R3SB 4ZDHB 1BZ7B 2X4SB 3DGGB 1YEEH 1T7WA 1IEAA 4PLJD 3O8XC 2BSSB 2WINB 4M5YH 1S7WB 1T7VA 1QFOA 4M61A 3GSQB 4XGZB 2FR4B 3SBWA 2OYPA 2YRZA 3HE7B 4WW2A 3L5IA 5E5MB 3OR7B 4DZBA 1VPOL 1T5WB 1L0YA 2JJSA 2EIZB 4X80L 4GT7A 4PJEE 3EFFB 4U33A 3BZ4B 5LBSL 2VISA 3DTXB 3Q3GA 3WEXB 1N64H 5A2LH 3UXFA 4FZ8H 1KENL 1W8NA 1XGPA 1OWRM 3T0EC 4TULH 4G43B 3ROOA 3NN8A 4BH8B 4XVUD 5C8JA 3RX8A 2Q86B 5DQ9A 3MA7A 5C0FA 1YMMD 3DXAA 3ZHLA 1BFSA 4XBPB 4MB3A 2CLVA 3V5KB 1INDH 3D18B 2X05A 3CDGB 4B50A 3OAZK 4NKDA 5MHSE 1DVFC 4NUGH 1OAZL 4UQ3B 1W72L 4IEFB 2DD8L 2WUCH 3IDIA 4JFOA 1CYGA 5DXWA 4CVWA 2NY7H 3REWA 3SQBA 4LCYA 3LKRA 3R0MA 2X89A 2K9UA 4R6UA 2BOCA 4FQCL 2BVUA 3H8NA 2V5TA 1C5DA 3MLVH 5I9QB 2RBLA 1N8ZB 3CLEH 4WO4D 4FXKB 1YUHA 4YHPA 1YYML 4V2BA 3TF7C 3ESVF 4A6YA 4EDXB 5I16B 4F80A 1FYTD 4PREB 5I66B 5IJVA 1J0HA 1CDCA 3HB3C 3ARFA 5C2BH 4HBCH 3BRDA 5BV7C 1JNJA 2W92A 3L7FB 4DKFL 2VAAB 5JPNB 5HDBE 3BT2L 3EJYC 1KACB 2R56L 4XTRC 3VFVA 4WGWB 1ZS8A 5DGRA 5I17B 2EIDA 3T0DA 3DECA 5DJZB 1IGML 3CUPB 1T66D 3EYSL 1B90A 3D85B 1IJ9A 5HPMB 3IU3B 5ERWB 1A14L 2UUDH 3MLRL 3BDYL 2NY6D 3S6CA 2VLKE 2AABL 2C4FT 5FB8B 2D7TL 1FIGH 1XF3B 3ABZA 3QDJD 3BQUA 2G60H 4NO0B 1HN1A 2V5MA 3OAYK 3KAAA 3QDGE 3ARBA 1P4IL 2ZNXA 1ZLWK 3K46A 3C8DA 4PJFE 5C3LD 2V17L 3T04D 1X5XA 1QLRB 1RJZA 3SDXA 2HFGH 3VFPA 3GBNH 1ZA6B 5IT2H 5DMIH 5KANI 3PNWA 4R26L 4BUHA 4QRPA 2Y1VA 2DI9A 3UBXB 4TOYH 1AXSB 4Y5VB 4RFEB 5IKCB 3AC0A 3F62A 3FL7A 3PQYE 4N0UA 2VAJA 1H5BA 4G6FD 4OLEA 2JCCE 3DNKA 1RUMH 4RAUB 3MV01 4YHNA 5BZDA 2X89D 2BXYA 3BJ91 3VFUB 4K9EL 5JNYA 5DTFA 1CR9H 4KQ4L 1NKRA 1J1XH 2ZP0T 1P6AB 4RRPA 5HDLA 4L1DA 3FTGB 4ZOBA 2X4QA 4Y2DB 4YHLL 3WV0A 5F88B 2JF1A 3RVTC 4QRSB 5F1IA 1RU9H 1L8JA 1CVSC 1UWEH 5FYKE 2ADIB 3V6ZA 5SWQA 3QNYA 5D2NA 4ZAKB 4H88H 1X4ZA 4NQXB 3QPXL 5I71B 1IAKB 4YO0B 3GMLA 5FYKU 4E41D 4K3EL 4PGJA 2BNQB 3ARFD 3MRFB 5MEPB 2HG5B 4HKJB 4ZPTA 4HWEH 5IVXB 4RWYH 4XMPH 2OLDA 3CVIL 5GS0L 4BQ6A 3GM8A 3DUHA 3MV9E 5IJKA 3T0XA 4OF0A 4XWOD 1JBJA 3HUJA 5ESVB 4NQEB 4J3UA 1YNKH 5B3JF 4LU5L 1QSVA 1T0NA 2QJDA 3HC4H 3FQNA 3FT4A 4LEOA 5HHOE 4NQUA 1S9KC 3F5WB 1QBBA 3BQUD 3EDJA 1SMAA 5FYJE 4XZUA 3CFEA 3ARBD 3QPQC 2LU3A 5CP3A 3OKKA 2JK5A 2XQBH 3QQ3A 1FO0L 1KELL 4WI4A 3U1SH 1FZKA 3WFHA 2OTUB 4FFYH 4ODSH 3MJ9H 3DVIA 4QHKI 3WDJA 4NNXB 4O51A 3QIWD 4BQCA 2DQGL 4ZO7A 3KXFB 4EXKA 5GGQL 4L3CA 2ICEA 1TTFA 5EU5A 3D0VB 1U8KA 1YECL 3PJSB 2EEDA 4TVPL 1DBJL 1Q9LA 4P5MB 4DWHA 2AJSH 3GJFH 3N1MC 1CICB 5J12B 3ARUA 1MAKA 2ICES 3FB7A 4HPYH 3ALPA 3NCCB 4LBEA 1Q9WA 1KLUB 3NIGE 3VRIB 4MWFB 5MENE 1WFTA 1T4KB 5HD8C 3QHTC 3SE9L 2VR4A 1WIPA 3I9GH 4MNHA 3S35X 2XTJE 3SKNA 3L1OL 2DYPB 3IGAB 3E0GA 2IANA 3HZKB 4X0KB 4YGAB 4HC1A 3OXSB 4LVNB 1CGSL 4JM2B 5D9SB 1AP2B 3GFUA 4FQPA 1NAMA 3AXLA 3GB7B 3I75B 5M95B 1EEZA 4MHHI 3RUGF 1QRKA 3P4MA 1R3LA 3HE6B 1M7DA 3DURB 3MOAH 4FXGA 5DFWH 5BS0E 1SVCP 5DC9B 3NIDE 4Y4KC 2ICWA 2VC2L 2HFTA 3DX8B 4G8GD 4PJCE 4RAHA 4G6MH 4S2SB 1IBGH 3EUUA 4PTTA 3VFRA 4MD5B 2AP2A 4AT6B 3CD4A 2M2DA 2ADGA 2QR0B 4Z7NE 1MFEL 1B0GB 4YUEL 4HIIA 4HCRL 2EXYC 1JCKA 5IW1B 4LNRA 5GZNC 4LQ1A 4FMKA 1N5YL 1JF6A 5GGTL 2NZ9D 1G7IA 1JL8A 3DO3A 4G3YL 5AYUH 5DURD 3JV6A 1WBXB 4QXTB 4Y4HB 3PGFH 4Q9CA 1CF8H 2R0ZL 3LRSA 1F4AA 4R4FH 4XAKE 1OY3B 3MXVL 1W0VB 3TA3D 1INEL 3TBWB 3SN6N 4A2MA 4PRAB 5L2JA 2MCPH 2W9DL 3LKNB 1EH9A 3IETB 2P5EE 1OAUH 3GMPB 4OM0H 3K8KA 3RWHA 4MD4A 3THML 3S3SA 4HULB 1MIMH 1S9WB 3GSVA 1ZVHA 3V6FB 3DVGA 3U0PA 3WIFA 5KSAC 3QUYA 5DD0L 3UBXI 3BESR 4M48L 4BKLB 5D7KE 4LHUB 1OTTC 5I76B 3RVWC 5CEYA 4MXVF 4GRWF 1GC1L 3VI4E 1MCEA 3QCTL 4FG6D 1A7QL 2UWEB 4OD2A 4Y5XC 5EA0L 5ANME 3AMKA 3FN9A 2NY0C 1ETZB 4DOHE 1U8PB 4GXUN 2F54A 3GMOA 4YXKH 1DDHB 3B8SA 3VH8B 4FQHA 1BQSA 5F9OL 1OAYL 1NLDH 4F2MB 1B0WA 2DKUA 3ARPA 4QXGH 3JWOC 3UP1A 5K9JL 4YQXL 1MHHA 2XN9B 1PLGL 5LKNA 2FX7L 2AXFB 4BK4A 1GGBH 5B38G 4J23A 4MJIE 5KSBA 4YNYB 5J11B 4C54A 2VZUA 5JIPA 1FSKC 2ZUWA 5DJCB 3K4DA 1S7UB 4P2RE 4PJ5B 4OZFG 1F4XL 4YPJA 2DWEB 1IZJA 5AG8A 4XPAH 1KCGC 2MWCA 3D25A 1FFOB 5TE4H 2E7LE 2J8UF 3DV6B 2YA2A 3SGJC 3A0OA 1ROWA 2ADFL 5DHYA 3T0EB 2IGFH 4M7KL 3W5MA 5J1TC 2ZSWB 3QCVH 3FB5B 4PRIB 2R0LL 4JKPH 1KB9K 2RHEA 2NTFA 4NZJA 1AGDB 4NZRH 4G8EB 1LP9B 2WIIB 3OKOB 1FIEA 4KTDL 4RIRB 4F7PA 5D7IA 1IAIM 2I26N 4KUCD 1ACYL 5HGGS 3TNNA 3H9SB 4HFUL 4XBEH 3LMJH 5CGYD 2EZ0D 3KYMB 4HSQA 1G1CA 3O6FC 4XXDB 5FM4A 3MRDA 4L9LC 3CSBA 4QRTB 1FLRL 1HNFA 3TCXA 3QUYD 5ID0B 3NCJL 5E9DD 3RL1A 4PJEF 1WCBB 1Q38A 5JW4R 3QDMA 1FNGA 5I75B 1MPAL 1H15B 3KS0J 3VI3F 2BXZA 4RAVB 1XGYH 5GXBB 3GGWB 1FFPB 1P7QB 2FIKA 1LNUB 1BGXL 1PX4A 1QLEH 5L7XH 1MF2L 1CFSA 4BZ1H 2LV4A 4N5EA 4PJXF 1C5BL 1HKLL 1ZVYA 5E0QA 3D1MC 4P5TA 5F7EH 4MAYC 2VLRB 1QFPA 1V3KA 1BJ1H 2H8PB 3O3DA 3VXOA 4UZGA 5CILH 3G9AB 5D1XC 1H3TA 2AK4B 3VDAA 3DVNB 3HG1E 1UM4H 4PRHE 2YPLB 1DQML 4MZ3A 3D2UB 2EDTA 1AXIB 2PYEE 4P2CG 3NCFB 3Q5TA 4UTBL 3I2CH 4Y8DC 3ZKMC 1TTGA 4XB8A 2RR3A 5E8NB 4HPOH 4NHUA 4WI6A 1J8KA 4Y89A 1MCKA 1EHXA 2YD8A 2PYFA 1WSST 4K71C 1LGVA 3VXRB 1A7NL 1AY1H 4OD1L 3GUTA 5B8CC 1T89C 1JNLH 3UTTA 3CC5B 5FGBC 3FB6A 5ICZB 3N50A 4HS3B 2D2OA 5BVJA 1AO7E 1LEIB 1PDKA 2ZOKA 4K7PL 2A74A 2Y36H 1A6WH 5ESAB 4U1IA 4I1NB 2IMMA 3KYNA 4GG6F 4O4YH 4Q97A 3TT1H 4NRZB 5HYJA 1LO0H 2LVCA 5DJ2B 1FNSH 2BVOA 8CGTA 3MNZA 5KS9A 3I3DA 4ZNEE 3H42H 3UYRH 4G42B 5IHZA 2FX8H 3QXUA 4KVNL 1GGCH 4YBLB 3MV8A 4NC1C 3O2WL 3BPLB 1FRGL 3VXTB 3LQAL 3K1KC 4GW4B 1FBIL 3WFCL 1K8DB 2P46B 1T04A 4Z7UE 4F8TA 4UV4H 1S7XB 3HS0A 6FABL 3EJZD 5I1GH 2E6QA 3KPPB 3DRTA 1LK3L 4YFEA 3BYYA 5CZVL 1GOHA 5DQDL 4NKQB 4FTVB 3BP7B 5DUML 4D94A 4PYGA 3ES6B 3G6JB 4PJDA 3UTQA 1UJ3C 2XIDA 2X44D 5IMKA 5DJXA 3QDMD 4UBDD 2VDPL 4UV7H 4ELMB 4JG0H 4YDIL 4U1NB 3ZT5A 5I1HH 4G6KL 3I84A 3ISWA 2R29L 4PJFF 4N5ED 4N0CA 3HNTL 4G7VH 1FZOB 4OI7A 1QO3A 5T1KB 3EHBD 4N1CA 2F53B 1FJ1B 1NSNL 4P5TD 2V2WB 1NCAL 4FFZL 5ID1A 4U0QB 3RWJB 1JHLH 1MFCH 3OKLB 1V8HA 3AAZB 3QEHB 4PP1C 1T1WB 4HUWA 2DBLL 3QO0A 3U7YH 2VL5A 3FO9A 2XKUA 2JCCF 2V2TB 5I74B 2BC4B 2EH7H 1CLZL 4ZTPL 3VWKC 2D0HA 2WANA 4KQ3H 5HGHA 3KPMB 1B2WH 3WNKA 4JFXB 4U3XA 1UA6L 1VFOA 1QA9A 1VB9A 2HJLA 3UTTD 4PRPD 3JTTA 3RWDA 4Q9QL 1KJ2H 3B9AA 4NWUH 4WNQB 1R24B 5C0RL 4HC1L 2GI7A 4QCIA 1L9NA 3QXVA 4WFHD 1GCFA 4OV6F 2WSKA 1NAML 1U3HB 5HYJD 2XA8L 4ZXBC 4GQPH 2FX9L 1S7SB 2XZCH 3ERYA 5I2IB 3HAEG 3K2UH 3GMQB 3RY6A 4HHAB 2A9MH 1SJEB 3SCMA 4NFDA 2ITDB 1B0RB 1ZXQA 4EJ1C 1TVHB 1NFIB 3TT3L 4PJAB 1OGAB 4M1GL 1RK1A 1YEJL 2AEPH 1JGLL 5C0IA 1A4JB 5C86A 1EA9C 1WBZA 3UMTA 2XT1B 3B8YA 3BSZL 3S3PA 2WWMD 3V7AG 4YGVB 3DJ9A 3IJYB 3AM8A 1C08B 4MNQB 2DQJH 5I8EB 4H1LH 4J6RH 3MUGA 15C8H 1SQ2N 2R0KL 5L6YH 4NCC1 4KROC 5IW3A 4QTHA 4QYOB 1I8IA 1TNNA 5EBLA 4HUUB 4PJIA 1QZ1A 2FCBA 4N0CD 5DGQA 2C26A 4LSVL 5DHVH 5DRWA 2GKIA 4L1HA 4YDJB 4Q9RH 2F8OA 3E2HA 4UDTA 1R5IB 5ITFA 1IM3A 1J0ZA 3IAPA 4WW1B 4X6CB 4KWUA 1HIML 2IBZX 2X9WA 3BP5B 3NFPA 3V5HA 3FQUA 5AEAA 2Z93A 5CGMA 3IDJB 2ID5A 3GKWL 4I5BA 1NGPH 1L0XA 3IJHB 5ALBH 5GZOC 4JZNB 1YQ2A 1XCTA 1OTSC 5E2JA 5BVPL 2FO4B 4QOKA 3SDDA 4KHXH 5JW3H 3DV4B 5I15L 4OZGB 3QRGL 4I2XA 4JRXA 1JGVH 2X4TB 2VRAA 3X12B 4G9DA 3OAUL 4NJ9L 1PJ9A 3BZEB 5DF0A 3TPUE 2VDQL 4NGHL 1RV6X 3BKCH 3WUWG 3DMMA 4Y88A 1IT9L 1NGZB 3LOWA 3VCLB 4ALAH 1K9TA 4JO2L 1MLCB 3SQOL 3LZFH 2JJVA 3MLZH 3A6CL 4DQOH 1MWAA 3LY6A 2ZKHH 1I8LC 2DLTA 4GRMB 3IXTB 5AG9A 4KRMB 2IQAA 3ZSSA 1A02N 1I7ZA 1OLZA 1FDLH 4IS6B 3F6LA 3LKOA 3WLBB 5I6XB 4JZJC 2HJKA 1KTKE 4K23H 2F15A 3SJVB 3NIDF 4PJCF 4GAGL 2WUBL 3MNWB 3F12B 3MZGB 3BVNA 3O4OB 3ULUC 3C2SA 5KSAB 3C8KA 5GRYA 5BV7H 4U1LB 4OLUH 4MA7L 1QUNA 2B5IB 25C8L 4Z7NF 3MO1B 1P7HL 3CLFL 2ESVA 2NNAA 3V4PH 4QXWA 1NBZA 3LQMA 2HMIC 3QSKB 2EDJA 1YEIH 4CVXA 3DYOA 2DWDA 1EFQA 1FNEA 4OZHA 1S7QA 4ZS6D 5F7YC 2HN7A 4TQEH 1D5IL 3CFKB 4M5ZH 1LDPL 5T3XH 1RJYA 5B38A 5JIKA 1KXTB 5TDOA 4JRYB 3IFNH 2GSGA 1BJMA 1JP5A 3RVUD 1CGTA 5CSGA 3M17A 4ZFZB 4OZFA 1NFDE 2DL2A 5FM5M 5GRVL 1FSKB 4F9LC 4IRSC 4QOKD 3SDDD 1KCRL 3S35H 1RULL 2AQ2A 1LD9B 1UVQA 2I07A 4JRXD 3QUMA 43C9A 4TUOB 5ICXB 1CFVH 2RCSL 3WXVL 2C3XA 1E4XI 4MJ5B 3N0PB 2HJFB 3ARGA 1UWXK 2J12B 3BDXA 4J1UB 4M1DL 1IGCL 1CT8A 4GS7C 1OP5H 3VI4F 3O4LA 2BY1A 5EWIL 1Q0YH 3O6LL 3CSGA 2W60A 1TITA 3MRPB 5CSZB 1CDHA 3T2NL 5GQBA 5ACMA 4UT7H 3CFDA 3QG6A 3V52H 3LPGA 4HH8A 3SKMB 5I73B 4G8FA 5MP6L 5DEFB 2K7PA 2R23B 5GRZA 2YMXH 4F7CB 1P69B 3D39B 3CX5K 3TBVA 5I8OH 1UWGH 5F6IB 1TZIB 1CS6A 1RJLA 2F5AL 5CCKL 4Q6IC 4R90L 4OCSH 3VFTB 3HHRB 3Q5OA 2J8OA 2AK1L 1Z3GL 2X4UA 3QXAA 3T3PE 3LEYH 1H3GA 2YSSA 1CZ8L 5HGDB 2IADB 3BUYA 4YXHL 4ORGA 2IH3B 3KPOB 3NCYS 4CU8A 3GSWB 4YLQT 3FN0H 4P59H 4M8QB 1XR8B 4ZMAT 5MERA 1DQQA 4HKZB 5F7DB 4X6BA 2XZAL 1E4XH 4HEPG 3RHWF 2XNAB 3S4SG 4NCC2 3T1WA 2GCYA 1E4JA 3GBLA 3CZFA 1RPQA 4U1KB 4V3DB 1FP5A 4MAYB 4QHLB 2D4DA 5D1XB 3GJEA 4LASL 1A6UH 1DZBA 1I9IL 1CWVA 1R3IH 1RFDH 4X9IA 4AG4L 2O26U 5DVMA 4LRNL 4LEXH 1ORQA 4HGWA 4N9OB 4S0TD 3P30L 2DKSA 4U1GC 4CW1B 5C71A 1NCCH 1CD1A 3BN9C 3D0LB 2A6IA 3MBXH 4FQ2H 5F44A 2JELL 5B8CB 1I8MB 1CN4A 5C0GB 1I7UB 3DX7A 3ARGD 3PDGA 4PG2C 4GW1A 3PWJB 1NC4B 2OI9C 1BHGA 5JO5B 2QSTA 4LPCA 3KPLB 5IUSA 2CLRA 2KH2B 1D5MB 1T6WA 3UTSE 3PL6A 4M6AA 3LPWA 2FBJH 3QHFH 4OJFH 3DUUB 4IOFC 2VDRL 3IDGA 5EBWA 3SDYH 3QO1A 1T1ZB 5ISZB 4GW5A 3MRHA 4TUKL 5D7SH 3MSPA 4LSTL 4XP4L 1T1XB 4WWKA 1QLFB 4MXQD 1N6UA 2R4RH 1V7ML 4JFZH 5C09B 4OF7A 3VMPA 3X13A 3HZYA 2EKSB 3UZEA 4PPTA 3RJQB 2JJWA 5J3HC 3U36B 4MZ2A 4YWGL 2Y5TA 4OCWL 3ZKND 4I48B 2OMBA 32C2B 5CGTA 2NTSP 1Z9MA 2DLIA 4ODXA 4APQC 2EDQA 4K9EC 3MRKA 3V0WH 4FP8L 1RVFL 5D70H 3BD4A 2OP4H 4BH7B 3VXMA 3FT3B 5SX5H 2FSEB 1CGYA 4U6XB 3RTQC 3QQ4A 1J1PL 5LG1A 5HHMB 4G9FE 2KL6A 4RWHA 2H1PL 1NDGB 4R8WL 4D0CA 3C6LA 5CJ5A 4YX2L 1WJ3A 5CWSB 1F11A 1RUKH 1XIWA 2XFXB 4X5WA 3OKMA 4ODTH 1DBAL 2DS4A 3NACH 3TV3L 4N5UA 5CEZH 2BNQE 3IF1B 3H3PL 3QUXA 2Y4SA 4ODWA 1JZ2A 3T3ME 4HKXA 5J89A 2ZCHL 4Z7UF 4OTXL 5GS0C 1DBKH 5CINH 4EN3A 5IVXE 4N9GB 3BAEL 4UDUA 1DQDL 1KPRA 4X99A 1UB6B 3RBGA 4URTB 4XPBH 3AREA 3U0WL 3NABL 1D9KC 1GAFH 4X83A 4NQEE 4JKKA 4G5ZH 4NJAL 3QIUC 1C12A 1A64A 2XOTA 3HAEA 4ZXBB 3WL9B 4X98A 3WKMH 4Y1AA 1IGFH 1Z9LA 1QR1B 3KDMA 3U9PH 3U79A 5DK0B 2IPTL 1JGUH 3GEWB 4UQ2B 2BVTA 4MNGA 2W9EH 1NBYA 5ECJE 5IW6B 4Z5RA 5I1LA 4FQLL 5DQJA 4RQQB 2O5YH 4OFDA 1A6AA 4WWKD 5EOCL 4JQIL 5EIQA 2PETA 4PLJC 2A1WL 2YUXA 3IJSB 4JPIA 1DTUA 1U8MB 1BOGB 4FXLA 1JPSH 4IMKC 3ARWA 4YE4L 4CVZB 3L7EB 5D5MB 4GMSL 1EEQA 3OF6A 3KXFE 1NGXA 3PWUB 1IAIL 1BD2B 2G75A 1ZGLP 4KROB 2A6KA 2AV7B 5DVNA 5H37G 3RKDD 1CG9B 3JWOH 2RIKA 3MQIA 1HH6A 1YY9D 4AENA 1MWAL 2R9HD 1OL0A 4PJ8B 1MEXL 1MCHA 2HWZL 3U2SA 3VWJB 3ZKXC 5JOPD 2P8PA 3TN0B 1X5JA 5KSUA 4XVUC 1IE5A 5C7XH 5IBTL 1CCZA 1GL4B 4I9WD 1PKOA 4L29B 5EBMB 5C9JB 4V1DB 4LLVA 1A3RL 3C6LD 5DK3A 5IB1A 1WITA 2MTPA 1XIWD 1JN6A 3RGVA 4ZFGL 5IOPA 1BEYH 2KQMA 1CE1L 2J5LB 2PXYC 5LWYL 5C6TH 3QUXD 3MLPA 4JY5H 1BZQK 2WV3A 4HMEA 3RUGA 4EN3D 3FQTB 3LSOA 4KJPC 3JTSA 1ACZA 4MA8L 1U8LB 1T3FB 2JB5L 2I5YL 2QQLH 1IZKA 4XAWL 2ZUTA 1S5IH 5E2VL 2W0LA 3ARED 2OR9H 1CE6A 5GGRB 4LVEA 3V7MA 5I8CA 4ZD3L 4WO4C 4KPHL 1MCWM 1FH5L 4I0PA 5BZWB 3WSQL 4JFPA 4KMTL 5KTEL 1DN0B 4Q6YA 2YWZA 3KPSA 2R2HB 2VZTA 1JNHA 2X1PA 4HKBA 3MXWL 4OGYH 4MAUL 4BZ2L 3TIEB 5DZNA 5MEQB 5KG9B 3DO7A 4GAYA 5DJAB 2A77L 1NCNA 3V6BR 2IAMB 2C3VA 3QR2A 4J3WA 1UZ6F 3MGOA 5ESQA 1FZJA 1RUQH 1YNTB 3MJ7A 1L6ZA 4N8CH 5DSCB 3QEQE 1TLKA 5INCA 3BHBB 1TZHA 1YN7A 3W9DB 4Z0BH 3I6LE 1MFAH 4GG8B 5IB4B 1VDGA 3SBWC 3ULVL 1IAOA 4WW2C 5E4IA 3EGSA 4OGXL 3TNMA 4GMTH 3OB0K 2NY6C 2IJ0C 4QWWC 1HHJB 2JJSC 1U93B 3C60B 4O02L 3H9HA 4Q74A 5I30H 4L5FH 2R2EA 2ITCB 1XR9A 1JYWA 4NUJB 3WHE1 2G2RA 4JHWH 5JQ6H 1G6VK 4MJ4A 4CL7A 1A3LL 4B53A 4MXWH 1A6ZA 4UOW0 3WFBH 2FB4L 1MHEB 1DEEA 3KJ4B 1QACA 5DDHA 1GC1C 1J10A 1BVKB 3BPOC 3UTPD 5GRVK 4BSVA 4M6MH 2QADD 4TPRH 2OJEA 2X9XA 4Y4FA 3RGVD 2YS4A 4LDEB 1NGWA 4OB5L 2NY2D 4P4RB 1JWSA 5IGXL 5CBAA 3I85A 1YEKL 5DYOA 3VE0A 3IRPX 1EUTA 2BJMH 2HLFD 4I18A 4YK4C 3PGDA 4NN7B 1U92B 4OCLC 4WHDA 2XN9E 1Y0LA 4AIXA 3MRCA 4I77L 5HVGB 1AJ7H 5C0CD 3HMWH 4OT1H 5HHVL 1U91A 5FGCE 4GS7B 1N5AA 2Q8BH 1AIFA 4I0PD 4XX1E 3EZ8A 4MD0A 1IEBA 4NZTL 3A6BL 1PVHA 2LVEA 2VNCA 3KPSD 1LK2B 4PJ5E 4P2QA 2J8UA 1F13A 4IRJA 4ODVL 1MJ7L 3GMMB 3V9FA 2X41A 3ARFC 3G6DH 2DLHA 4JKMA 3VXQB 2FJGB 3FMGH 2BNRE 4ISVB 3R06A 3OBAA 3WIHH 4ONGH 4PRIE 5FO7A 3KPQA 4A2LA 4KVCH 4ZUVB 3PWLA 3VW3H 1NMBL 4LSPH 1NFDF 2ZPKL 2ADJA 2ZUQB 1IC4L 2Q8AH 1IC5L 4XWOC 3RIAK 1LP9E 2ZCKH 4K3DH 1W72B 4OKDA 5JORB 3H9SE 3OKDB 3RJDA 4ZFFA 3MRJA 4P23D 4X5LA 5CS7A 3BQUC 4HDIA 5T1LB 3T65A 1BIIB 4LLYB 4ZOEA 3G6AA 1TJGH 3QHZL 3SY0B 2FJHB 3ARBC 1GOFA 2Q6WA 3BP4B 4PJEA 3QFJB 3MACL 1F4YH 3MREA 5ADPH 2XXCB 4X7FC 3RZCA 4X7SL 4DUXA 1NCBL 5I1CH 4N90E 1CLYL 1T0MA 4Z78B 4U6YA 1JPTH 4L4TB 4LVHC 4NRXB 1I4FA 1LO5A 1MAJA 1N4XL 2VDKL 2C1OB 4G59A 4HG4J 2P8MB 2V5YA 4PJXA 3ZE0E 4HW6A 1K4CB 1N7MH 2Q7NA 3B2UC 5E70A 4JZOB 2AJ3A 1IC7L 2VOTA 1EFXA 1WC7A 3CFBB 1H5BC 4PUBL 3T3PF 4CNIA 5DJ0B 4ZUTA 1YYLH 2PTUA 2VLRE 2DJUA 3G5VA 5DD1H 3K8LA 4WHCA 1IKNA 2O5ZH 1URLA 2AK4E 2QHRL 1OAKL 4UUJA 2YPLE 4GSDH 1N3NA 1NBVH 3QEUB 4PRBA 3MPCA 4Y5YA 1FLTX 4LRIA 2OI9B 3U4BH 1PBYA 4UTAL 3OV6A 4KKCD 4FFWD 3OXRA 4NOFA 5D2NC 4B5EA 4P2QD 4OUOA 3VXUE 3DLQR 2LTQC 2YRLA 3L5XH 4IRJD 4R96A 2ZWLT 3P0YL 3STBA 3TZVA 4QF1A 1HH9B 4QGYA 1UXSA 1FGNL 1A6VH 2YR3A 1E27A 3OPZL 4MQXC 1X6NA 4X7EC 4Y16D 2W0PA 1FV1B 5B39G 1U3YA 1KYOJ 1HSAB 4HT1H 5IJKC 1MJJB 3O45A 2AEQL 3EYFB 3OR6A 2XY2A 5JLZB 4YPGB 1HHIA 1A4KA 5EC2A 3UJTL 1S9XA 4Y2OA 3G5YB 4B7IA 2V6HA 1AGBB 4QRRB 4XNUL 2FEDD 3LQAC 5E6ID 3R8QA 2IH1B 4APQB 1HKFA 4R7NA 5EU4B 4WWID 2BERA 2OR7A 4U1HB 5BMFH 4EOWH 2VLKA 1WGOA 4CJ0A 3HC3H 3CVHA 1KPVA 1EMTL 2MNUA 2DQDH 1WTLA 2WBJB 3MMEA 2NZ9C 4FTVE 5DD5H 3VG0L 3RZCD 3RTQB 1FVEB 1VADA 1RUPH 3T1FB 3QDGA 3ZKQD 4O9HL 5IBUB 3JV0A 5KZCB 4W4OA 3EO1B 2X70B 1NAKL 5DMKB 1ZVSA 4PJFA 2OTWB 2BY2A 3OZ9L 5BO1L 4QRUB 4PJBB 5J1AB 5IQ9A 3BZFB 5LQBH 3GSOA 1TPXC 4HUNB 5IVZB 2EE6A 2CDGA 1GZPA 1D6VH 5HI5D 1MLBA 1FVCA 5IIEA 3T8XB 4EUPB 5KVGL 2FECI 2BFVL 1EERB 2ENYA 3BD3A 2DLFH 5MHSD 3ARDA 1U8NB 2Y06L 5HY9A 2OSLA 4XP5H 4TSAH 3MA9L 2JCCA 3EFDL 1KEGL 1D9KB 1G7JB 3KPRE 4JHAH 5HSFA 1YNLH 5DJYB 4FZEL 5IB3A 5CEXB 2C1PB 2DQCL 1YEGL 4WJ5B 1ZT4A 5L0QC 3DYPA 2B2XH 4FG6C 2R69H 3P9MA 3M8OL 4QTIH 5CFHA 4NP4L 4LLDB 4U1JB 1UB5A 4Y0GA 1G7QB 3TZVD 4XBGB 1XF4B 1F02I 4G80A 3P73B 1BM3H 1NANH 4AQ1B 4MJ2A 1ZLSH 3MCKB 3ULUH 3O41B 4M7ZC 3PWVA 1Y6NR 2HLAA 2R2BA 5EUOB 3QZWG 2X4NA 4LLMA 4LPWA 3UO1L 5F3HB 3TBTA 1XEDA 3SKJH 3O6ML 2EDRA 4IRZH 4QRQB 3MOBL 3T3MF 3W0WD 1BQUA 3FT2A 3HNSH 1J9CT 1KN2H 4TSBL 3MV9A 5C0EA 4ZQKB 1CD9B 1NMAH 1AI1L 5FOBB 1T20B 1V05A 5F1NB 3UC0H 2P49B 4NFBA 4DZ8A 1RZJC 2XWTB 2MKLC 4XMKL 3ZE2E 3VFWA 4PJAE 1G6RB 4NKIH 1AHWB 1CFBA 2VLKD 1YDPB 4NSKB 1FZMB 1IVLA 5HHOA 3ZKXB 2P8LB 1EDQA 4BQ9A 2EYRA 5EO1B 4RGNE 2Z91B 3QXDA 5GJTL 1OM3H 3QDGD 4LK4A 1YMMB 2NY5L 5HVHC 5D1QA 4K7PX 5ENWB 2ATPB 1M7IA 1SYVA 4KI5D 2DIBA 3MJ8B 2DM2A 3P0VL 3BOVA 5CBEB 1T83A 1TJIL 3CH1A 3IFOB 5C0ND 5CGYC 4QHKJ 2H2SD 4DVBB 4X80H 4Q0XL 5J4MA 4DVRH 5D2LF 5DUBA 4M43L 3EYUL 5FM5O 3ARDD 35C8L 1M7XA 4JFQB 5EPMA 3HNVL 1WWAX 5LBSH 1G9ML 5DS8A 4L8BB 2AEWA 4DUWA 1KENH 1WK0A 1KJMB 3LS4L 2N1KA 3QUYC 5DMYA 3MUHL 5JHDB 4WHYG 4WO4B 2D7NA 3LKPA 4BFGA 1WBYA 1JTPA 2BMKA 3B3IB 4LLUB 5I0ZA 1DLHA 3S36L 3FB8B 5DO2D 1FYTB 2Z8SA 3CSYA 4OFPA 5IG7B 2VQTA 3L95A 4ODHH 2C3WA 3T77B 5T33H 5FYKD 3X14B 5FA3B 5MENA 4Z7VE 1EBPA 4YHIB 1JUFA 4DUVA 1X44A 4F3FA 1FPTH 1OAZH 1HXMB 1W72H 3V0VA 1Z6JT 2DD8H 4GKNA 2YEZB 2L4OA 1IEAB 2YK1L 1KTRL 4M61B 4F15C 3O8XD 1JGEB 4LGSB 5GIRA 4OF3A 4FQCH 1DQJA 3MCG1 4PRDA 2VE6A 5LGKA 4WW2B 1T03L 4DZBB 1T7XA 4G6AD 4PGCA 2NY6B 2OMNA 3RGHA 5BS0A 5KVDL 1EVUA 2WWKO 5FIEA 3QDJB 1YYMH 5JPMA 4PJCA 2VISB 3Q3GB 5JW4Q 4NN6B 1UXWA 1XGPB 1IMHC 5F7NC 5HHOD 3ROOB 3NN8B 2J6EA 4DKFH 5IESL 2EH8H 3BT2H 5C8JB 5FYJD 4MA3A 4QGTA 5DQ9B 2R56H 3DRQA 3MA7B 3SDAA 5C0FB 5E5UB 1HZHL 4P57B 3TH2T 5F9JA 1CTOA 4QXUL 1IGMH 3EYSH 4NKDB 3LV3A 1DVFD 4WI3A 1A14H 3MLRH 5KOVC 2VXQH 4JFOB 4KZDL 2AABH 3AU1B 1S7RA 2D7TH 3DIFA 3TCLA 4YK4B 1ORSA 4LCYB 5GHWL 3LKRB 3W82A 3L9RA 2BOCB 4AM0A 1XF2B 2P5EA 1C5DB 2D03L 2HAZA 2EYSA 1A7BA 2NCMA 2V17H 4UBDC 5HHPA 4NO5B 2EE3A 1BJ8A 4XPFL 4YHPB 4PV8B 2IFGA 1FL5B 1LO4L 4A6YB 1CVRA 1DANT 3NTCL 4R26H 4E41B 4EI5A 5IJVB 3ARFB 2GT9A 1AQKL 4N5EC 5D4QA 2NLJA 3L6FA 3MV7E 3PIQA 1B9ZA 2RAMA 4TUJA 4P5TC 5FYLH 2E8ZA 4H0HB 4XTRD 1ZS8B 4JFFD 3V6OE 1KNOA 3EOYG 4FQQB 4HAGA 4RZCA 2QSCH 3MFFA 2CDFA 4K9EH 4KQ4H 3HC0A 1VEOA 2B4CL 3IDMA 3LN4B 4YHLH 4Z95L 2Q87A 4GH7B 4XNMB 3P4NA 5BS0D 4MJIA 1KT2A 3BQUB 4GKZB 4QT5B 3QPXH 1T22B 1ED3A 3ARBB 4K3EH 1RI8A 4F7MB 4P2RA 3WXWL 5GRJL 3H9ZA 4IIQA 1NCUA 1VKXB 3I02A 3VG9C 2E7LA 2EYTA 4ZSOE 4LVHB 3ZDYE 3CVIH 5GS0H 1R3JA 3TYGH 1OGTA 3LRHA 4EUPH 3HZMA 1L6XA 2VLME 4NO2A 3RL2A 5F8RC 3QIWB 2CD0A 3H9YA 4OZIB 1WZKA 2VN7A 1WISA 2Q1EA 3P11L 5D71L 1F3JA 4RGOL 3PDOB 4YHNB 1NCDL 5BZDB 4LOUD 4PJGE 3S98A 3BN3B 3QJHA 4NQDA 5JNYB 5DTFB 4JAMB 1HQRA 2P5ED 3LKQA 4NKMA 5SWSA 1N26A 1MCQA 2WWMC 2X4QB 3CVHL 3NH7L 4EI6B 3RVTD 5KW9L 5A16B 4YZFE 3V6ZB 1KELH 5SWQB 1TMCA 1MOEA 2LTQB 4X7TA 1UACL 3GMLB 4EI5D 3M1BB 1BQLL 5GGQH 3HLAA 1CD8A 2VERN 2ZOLB 4ZPTB 5TE6L 3E6FB 5FHBL 1VFMA 3EYOA 1YECH 3ZE0F 1L4IA 1BAFL 4BYHA 5GGSY 1ZHLB 3HUJB 4JQVA 1MJ8L 4E42B 4XHJD 4G8GB 4Y4KA 4AMKL 1UYWL 4PRHA 3GSNA 4JHBA 3FQNB 3TYFB 3FFDB 3FT4B 2PYEA 4GQ9L 1FG2A 4MJID 2Q76A 1VGEH 2APFA 5IWLA 3SE9H 5KVEL 4XZUB 4HXAL 4UINL 2ZCLL 4OKVB 3L1OH 4N0RA 4P2RD 5C09E 5CJBA 1I1AA 5FYKL 5J6HA 1TCRB 3OKKB 4PBXA 4CBPA 4JLRB 1CDYA 1HOCA 2JK5B 4WDIA 1U2CA 1CGSH 2B1AL 1IM9A 3QQ3B 2HFFA 5LCVH 5DURB 1TVBA 4TSCL 3WFHB 1CBVL 1D5ZA 3MRGA 1AO7A 3F7YA 2HVKA 4PLNC 1EO8L 4X4YA 3WFEL 4OLWL 4HX1A 3BO8B 4GBXA 3TA3B 4X9GA 3G5ZA 1TPXB 1TQBB 3RY6C 5E03A 2VC2H 1FFRA 1YY8A 3UTOA 2X1XR 4K8RD 3SCMC 3AGVA 5TQ0H 5EU5B 2APTA 4N68A 5FF6A 4ZNEA 3IFPA 2MJWA 4M62H 5HHME 5JR1L 5IFAL 4NQDD 1MFEH 5MI0C 5BCAA 4YUEH 1BLNB 3FOMA 3IRZA 5SWSD 3VFOB 1MREL 3AM8C 1G7HA 1N5YH 4Z7UA 5GGTH 5GJSL 3MJGX 3WE6A 5FYJL 1FORL 1RZ7L 4G3YH 4M03A 3IYLW 1JWUB 2CGRL 1V3LA 1MIEL 4LSUL 5L0QB 2R0ZH 4HF5L 4MNHB 1GGYA 4ONOA 2VDLL 3EYQC 2KZ1B 2AAVA 5CSBA 1BVLA 3MXVH 4F9PA 1INEH 1I75A 1BX2A 3NZHL 4M7ZB 1EEYB 4OM1H 2W9DH 1ONQA 2XA3A 3E2HC 1EEZB 3LB6C 4JREC 3LKSB 5EZJA 4Z77A 4O2CA 2OK0L 3V5DA 1HCVA 3P4MB 3THMH 1R3LB 4OCRL 3GI8L 3NCEB 4JY4A 2ARJA 5FK9A 3GIVB 4KTEL 5DJ8B 3NFNA 3RVUC 3C6SA 5T3ZE 4Y4KD 1DEDA 5DWUL 4POUB 4E0RA 5KN5A 5DD0H 1HK6A 3P9LA 4M48H 5SX4I 4PRHD 5DT1L 5JXAH 4BM7A 3VFRB 5D96C 3SDDC 4S0SD 3OKEA 3JWDL 3LEXA 2OXGA 5CZXD 1CLCA 1GC1H 3FZUD 2H9GA 4N0YH 1JYNA 5ACLA 5EA0H 4GAJH 4WFGE 1SHMA 4XC1L 3BRFA 4KK6D 3SGJA 3ZHDA 1PZ5A 4LNRB 3KS0H 1I1AD 4I3SL 5F70A 1R6VA 2WP3O 1G7IB 3DMMC 3I6GA 5CIPA 5F9OH 1KB5A 1IM9D 1MVUB 1OAYH 3WJLA 1FGVL 3L3JB 5HVHB 1CGVA 4QNPF 1BD2E 2NX5E 1T6VN 3LRSB 3OQ3B 3WO4B 5K9JH 1AO7D 4YQXH 1P7KA 5CUSL 3S8WA 4NNPL 1PLGH 2FX7H 3KWWB 1MY7A 2A73A 1JPFA 5DEGA 4HQQH 5L2JB 3LIZL 2I60L 2V5SA 4DTGL 3F7VA 4NO3A 4XNXH 1A22B 5KAQF 2FD6L 3RWHB 1F4XH 5FKAA 2MOVA 4V1DE 3BWUC 3GSVB 1MQ8A 4A6YH 3KR3H 2EDXA 3QUYB 2ADFH 1ZSDA 3E8UL 1A3QA 5E9DB 5SX4H 4M7KH 4UIMA 2J6EL 2PO6A 2Z31A 1ZT1A 4HAFA 3HPLB 5CEYB 1LEGB 1OTTD 3ZE2F 2R0LH 3RVWD 4PJAF 3RPIA 2P7TB 3TO4A 3BPCA 4OLYH 4E5XB 1EHLL 5FDWB 3P4OA 1VACB 1DBBH 1MCCA 2NY0D 3FOLA 2WWKT 3GMOB 2ZUYA 5JUEL 4KTDH 4FQHB 4FHBD 4JKWA 1ACYH 2X7LB 4JFDA 1QYGL 1EEUA 1U95A 3KJ6L 5GS2D 1F3DH 1BBDL 3FONA 3L5WB 3RWCA 4HZLA 2X4RA 3ZL4L 1FLRH 3KHOA 4NPYB 3EOBA 3NCJH 3MBEB 2O61A 4ZUUB 4I0KA 3UPRB 1P2CA 4NWTL 4HLJA 1MPAH 1KG0A 1R0AL 2CSPA 2AXHA 5F7WC 4OGAD 4PB9L 2Y5EA 2F9BT 1XGUB 4FQIL 2FZ3A 2H45A 3ULVC 5DD3L 5DHYB 4M00A 2EDLA 3SOBL 5AAWA 3ARGC 1KXVC 2QSVA 3QXWA 3RBSA 3F7PC 4EBQL 1Q9OA 2HT4D 3BKYH 2ERJC 2R1YA 3VU2A 2YBRA 3TPUA 1TJHL 4LP5A 4H25A 4K3GA 1GHFL 1QRNE 4X8JA 2ARWA 3MTRA 4TNVF 4Z7VF 5HVWA 4P99A 4HS6A 2EDKA 2XYCA 5C0BD 3DX6A 4UTBH 2BSRA 1L7TL 2P4AB 2FJFA 2A9NL 1E6OL 1T5XA 3N06B 3S9DB 1OSZB 3RDTA 5L8JB 3O6FD 3MRDB 4HK0B 3TBYA 1ZHNB 4CMHB 1SY6A 4OD1H 1V5JA 1CU4L 5C0AE 3VFSA 3WHXA 2AERT 2J8HA 3LHPH 1E4WH 3RL1B 1ZHKA 2DICA 3AROA 2PO6D 5DRXB 2Z31D 1IFHH 3QDMB 3GNML 5LGJB 1INQA 2E7HA 3TO4D 3GDBA 1I3RA 1QPPA 2O5XL 2FIKB 4R2GC 1YC7A 4N0FB 5TF1H 4Z7WB 1LVEA 1ZHBA 2R1XA 1G7LA 1RIUL 3RP1A 3X3FL 4LSSL 1D5BB 1U58B 1Q94A 4P5TB 4JFDD 2NY4D 3MRNB 4PBWD 1FL3A 1CGXA 3D87B 3VXOB 3LN5B 5E95B 3LQAH 3WFCH 1FBIH 2B0SL 3HRZA 3BXNA 5JZ7C 3S88L 5D6DA 4AL8H 4XP1H 5B3NA 4XMLL 6FABH 3CCHA 2X4OA 1KULA 2EDYA 1LK3H 5CZVH 1BBJB 5DUMH 4YJZL 5IVNA 4XNZC 4I3RL 3NIFE 5CP3H 1FN4B 3ILPA 4NHUB 2PYFB 1CLOL 4LHUG 4NNYB 5CLTA 4MA1C 2CKBA 4MMZC 1NFDA 4KKAD 2D9QB 4YDIH 2VLJE 1ERNA 4IMLA 3UTTB 4PRPB 3FB6B 1CGWA 2R29H 1FVDB 3HNTH 4LKCA 2ZOKB 3VH8G 2ICWI 4U1IB 3VG9B 2BRRL 2X4SA 2YC1B 1NSNH 2BSSA 2HVJB 1IQDA 1NCAH 1S7WA 1EJOH 2IQ9L 4BJLA 3CDCA 3C08L 5HYJB 3GRWL 1ZA3B 1CDBA 4JFYA 3P9WB 3PL6C 4D9LH 4XGZA 4U6TA 2FR4A 4I4WB 2BVOB 4JGMA 5EBGA 5E5MA 1QNZL 4D9QE 2DBLH 1RIVL 3PP3K 4HUXA 2EIZA 4XX1G 3QFJE 3RDTD 3IS0X 4JN2B 5DA4A 5J6GA 1CLZH 4WWKC 4ZTPH 1S9YB 3AS1A 2CK2A 3HS0B 4L4TE 1KJ3L 1UA6H 4FABL 4BH8A 1WICA 5F3BA 1REIA 5JXEA 1EHAA 1A9BB 1O5DT 4PJDB 2Q86A 3UTQB 3O2VL 3QNXA 4Q9QH 5IMKB 5C0RH 4HC1H 5I1JL 3G04B 4XBPA 3V5KA 1NAMH 3MUZ1 2XA8H 3WYRA 3CDGA 1MFDL 3LH2L 1OB1B 1YY9C 1QOKA 1C8PA 4D0BB 2R9HC 1QO3B 1D6EB 2OX5A 4YH6A 4J3XA 3ZDYF 4C55A 2HP4A 3QQ9D 2L0DA 4LIQE 2FIRT 1S7VA 5L9DL 3UTZB 4WI5A 1AD9B 4M1GH 3C6LC 1YEJH 1JGLH 1RZJH 4HUWB 5C9KA 1XIWC 3TESA 1VFAA 2VL5B 4UNUA 3BSZH 4G6JL 3QUXC 2EXWD 4NDMB 1V3MA 3BIBX 3D6GA 4PJGF 4EDXA 4EN3C 2R0KH 3VWKD 3WDIA 4PLKC 1U3JA 3V4UL 3KPNA 1IGTB 2HJLB 3GSXA 2QV2A 5JPNA 1WT5A 2KDGA 3AREC 3BYTA 4OSUL 3RWDB 4LSVH 3EAKA 3Q6GL 1BPVA 4QCIB 1QFUL 5FYLE 5I17A 4QRRE 1INDL 3RI5F 3CUPA 1HIMH 3FQXB 3D85A 1I7RB 5ERWA 5E2WL 4OCXL 5ETUB 3AY4A 3TWCL 4PD4J 5IM7A 4K55A 3FRUA 4GOSA 5FB8A 3UTSA 4LPTA 1XF3A 4NHCH 5D93C 1JZ6A 1IKFL 5JIHA 1DSFL 4UOJA 4U4BA 4GXVL 3I50L 5I15H 2E9JA 1IILE 1VFBA 3QRGH 5C0IB 1WBZB 5MI0B 3TM6A 3OAUH 3CLEL 4NJ9H 5E6YA 5IV2B 1QSEE 3ARRA 1QLRA 1Y6MR 4DEPB 2BRQA 3TLRA 2VDQH 2GUOA 1U8IA 5J7CC 4HWNA 2XY1A 1IT9H 2H3NA 2WBKA 4WFEE 4JO2H 1I8IB 4HBCL