3KPLA

Crystal structure of hla b*4402 in complex with eeylqafty a self peptide from the abcd3 protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kplA01
1BWMA 3IFPB 4ZMAT 2QSQA 1X6LA 1BREA 3GSXA 2RIKA 1ZHNA 5J0BA 1CFQB 3VI4F 2BERA 2MSPA 4L8DB 3QO1A 2FATL 2ED9A 2EE3A 4YIQB 2F5BL 5KTEL 3QUMB 4ELMB 2QLVB 4G7YH 4XMLL 4HKZA 5L0QC 3KPMA 3O3DA 3ROLA 3W9EA 2BVOA 5E99H 1E4XL 3NTCL 2HT4D 5HYEA 1FGNL 1GGUA 2DMBA 3S5LB 4NKOA 4QNPF 5CBAA 1IC4L 4PJHA 5FKAB 2NY3B 4F2MB 5C09E 4XNXH 4N0CC 1IAOA 2I9LB 4J6RL 5CHNB 3ILQD 3LS5L 2Y6SC 1XT5A 3HNTH 1CIUA 4PJGE 1HDMB 1S7XA 4M3KB 4XVJL 4YXKH 3BZFB 2BOBA 2DB8A 1QNZL 3WD5L 2GEEA 2HYMA 4U1JB 5C92A 2NY1D 3HC4L 5CLTA 1FZJB 4NYLB 1E6OH 1KULA 1A64A 4OZHE 2GK2A 4JY5H 4MXQD 3GBNH 5D71L 3VFUB 2CMRH 4KJPC 5DC9B 5KS9B 1KCVL 3ZTNH 4XP9L 5ICZB 1UWGL 4TRPL 1YEEH 3MJ8A 1ZMYA 5DD1L 4PJCF 3D0LA 3DUSA 5F72S 2P49B 4KKBC 3D18B 4G43A 4KUZH 4OCLC 3VFRB 3W11D 3K2MC 4MDIA 4LVHC 1XR8B 2UY6A 2XT1B 3MTRA 1A7BA 1N0XL 4RNRA 1CGSL 5FB8B 1C08A 5D93B 1EA9C 1S7WA 2IAMC 1TTUA 1VACB 1X5KA 4D9LH 2Y25A 5IW1A 5DMKA 1ZT4A 4HV8B 2I5YL 4RGNB 3BDYH 4QRPB 5KN5A 1U3HC 1C16A 1KENH 3VXSE 2Y7QB 3BVNA 1RU9L 4MVBC 4L29A 5HI3D 1F6AB 4PRHB 1JN6B 3BDXA 3IDXL 4PD4J 3FB7B 4PJCA 3C60B 1UCBH 3BESR 4MAUL 3DMMD 2UZYB 1F8TL 3I02A 4ZAKC 3N0PB 4MNGE 1UJTA 1UM4H 1MFDH 4JVWA 1V7NL 1OY3B 5ACZB 4NHCH 3SKOB 1HXMA 4I0PA 3RWCB 2Z31A 4FQCH 2A9ML 3OF6D 5INCA 1S7SA 3ALPA 3ZKXB 3ZYJA 3TJHA 4LNVA 5HYJE 3QCUL 2Z93B 4JQVA 4PBVC 5JO5A 1ZLUH 4PY8J 5BOPA 2HLAA 1LE9A 5H94A 5IW3A 4G6KH 5KVGH 4PJ8B 3UYRH 2LAAA 1OM3H 3NBNA 4Y2OA 4YZFE 4OZ4A 2X4QA 2R2EA 5I1KH 4KJQD 2G9HB 1YN7A 3WIIL 5B8CA 1A7NH 1QSFD 1KACB 3H3KA 5DZOA 4F8QA 2O5ZL 1ZANH 3LQAL 1YMHB 4YNYA 1TQBB 4GW4A 2B8OT 3CFJA 5JQ6L 2VH5H 2MNUA 4XRCB 2C4FT 5DJZB 4CVXA 3QUZA 4XPTL 3MRMA 5DFVD 1XAUA 1ZVYA 3P0GB 3T3PF 3KLHD 1MCWW 5ERWA 5D2LB 5SWZB 5B39A 4P5TA 1MAJA 1BJ1J 3RWHB 4LSTL 3RDTA 2CO6B 2BZDA 4HUXA 4M8QA 5K59E 4ORGA 1CBVL 2NZ9C 4PJBF 3EYFB 3M07A 5C0RL 3L7EA 1SMOA 1CICC 2PW2B 1S9WA 5T1DH 2YSSB 3F5WA 4KY1L 5IP4A 4G9DB 1T1ZA 5DVMA 4DGVL 3F7VB 3V7AE 4O5LL 2CLVB 3FT3A 3F7YA 4EIGB 3AMLA 3LQAC 4OZGE 1PW3A 1FHGA 2PN5A 4UT9H 2CLRA 5T1LB 2FJFA 3P4OB 4TSBL 3RL2B 3GMLB 1JYVA 3DV4A 3FFDB 5SX5K 1FV1A 4PJBA 3A6BH 1J0ZA 3IXAB 1CT8A 3FRPG 4KROC 3UDWA 1HHGA 3IJHB 4L3EE 4F7TB 1MRCH 3ISWA 3QDGA 1SBSH 4OCSH 1ZEAH 1OTUC 1V3JA 3FQNB 2XTJE 2NPLX 3MXVL 3WO4B 2XZAH 3SDYL 2YEZB 2HVJB 4OLUL 5D7SL 4YC2B 3BPOC 5MENA 2DQJH 4QRRB 5HHOE 5IR1A 3QDJE 3L1OL 3VFMB 3VXUE 3WKNA 1MUJB 1MJ7H 1NCCL 1P1ZB 4XC1H 4N5EA 1UG9A 5GGTA 5FM4A 1VENA 4M7LL 3HLAB 1RJCA 5A2JH 4AT6A 1AIFB 4OUUA 1CDBA 1RULH 3VXRB 4J2XA 1J1OH 1MQ8A 3PF2A 5EBMB 2EYTA 3Q5TA 1S7RA 1LK2B 1UH4A 1WZ1L 3MLXH 1I4FB 5I8CA 1CVSC 5J11C 1KTRL 3RZCB 3BO8B 1Y18B 3ME0A 1H15A 4NQCD 1QR1A 5CZXD 1HKFA 3A0OA 3V4PL 1ZGLM 5EO1A 2GITB 5EUKA 1S7UB 1KB9J 1MY5A 3D69A 4G80B 3ZDZF 1YNTB 1FQ9C 4R7NA 4IIQB 3WXWH 3QEHA 3OAYK 4Y4HA 3TYFA 4C83B 4CMMA 5CJ8A 3HB3D 5EFIA 4BQ6A 1CFVL 4L4VA 3K1KC 3VH8B 2VR5A 4LCCC 4WI3A 5FYJD 3BSZL 4RX4D 2A6KB 4OD3L 5D1QB 2FSEB 4UTAL 3V0AC 4OFKA 1SY6H 2ZSVB 3SJVB 5FYLH 1O5DT 1KB5H 5TPWH 3R06B 2DLIA 4Y89A 5MHSD 1U6AH 4FQLL 1ZHBB 4EBQL 3O2DL 3LIZH 5L2KB 1G7IA 5JHDE 3KPPA 5CJOL 5EUOE 2DJUA 4X6DF 1A1MB 5F7KC 4F7CA 3VFPB 1IEHA 3ELAT 4FMFA 2K7QA 2DL9A 2Q6WA 5DI8A 2DQFA 4LDOB 1W2KT 2YPLA 3O0RH 3W9DA 2YMXL 3QT2A 4KZDH 2OLDA 4MJIB 4X7FC 1JZ8A 4MA8H 3O3BB 5BS0A 2VTFA 3S7GA 2IH1B 2QKIA 3VXTA 1ORQA 4GG6E 4YDKH 2A73B 4XPHH 1NANH 4XWOD 4GRWE 3X13B 3ZE0F 4X99A 1JZ7A 4X6DA 5F8RC 3TF7C 2OYPA 3O6ML 5I19H 3LAFA 4I2XA 4H20H 3VWKB 3BUYB 1GGIH 4KMTH 1ROWA 3O6FC 3SE8H 1P6AB 5GS1B 3UPCA 3DRQB 2OP4L 4S11A 3LN9A 1DBKL 1HNFA 1N64L 3GSWB 1LDPH 1LK3H 1GL4B 3RRQA 1J1PL 4JFHD 3MRIB 3W5MA 2R69L 4I0CC 4Q7DA 1J8HE 1OLLA 3BKYL 5CEZD 1JBJA 1EO8H 2FJGA 4FFVC 2PO6C 4NJAL 2NY3D 3FB5B 5I0DA 1TTGA 1UA6H 4AJ0A 4P4KC 3V6ZA 2WP3T 4O9HL 3WL9A 1AGFA 3SDCA 3THML 4DK6A 5E6IC 1U8IA 1GPOL 4X7SH 5D2NC 3MFFB 3DX7B 3C5ZC 4PJ7F 1VCAA 4NO2B 3WNOA 1HSBB 2HVKB 3EDFA 5DJDA 4DUVA 2A6DA 1SYVA 3I9GL 4TN9A 3H3BC 3WNNA 4PRPA 3IFLL 3MUGB 1U41A 4HGWB 1MWAA 4ODSL 1XGQA 4XGZA 1T7VA 2HH0L 5DXWA 4WEUD 4JKWA 5E94A 3S96A 1FORL 3WDJA 4LLMB 5C7XH 3DROA 1XGRA 3F58L 2FNBA 3S34H 3WFBH 3PWVA 4IDLA 2KUTA 2CH8A 3G08A 1BFVL 3NCJH 1FFNA 4EI5A 4OFPA 5KG9B 3ULVL 4F37F 3O9WA 1BGXL 1OGAB 3TT3L 5J13B 3AAZA 4OGYL 4BZ1L 4PJ7A 5IBTL 4JKKA 5C0IA 4HW6A 3BJ91 5D4QA 1FP5A 3EFFB 4QXUL 1JJUA 4RGND 2DLFH 1OTTC 4XXCC 4QRPD 1IM3A 5BMFL 2VE6B 2GHWB 1CXFA 1A7QH 5C0ND 3IGAA 3U7YH 5EOQL 1JGLL 4JG1L 4QRQB 5HVHC 4HC1H 4PRHD 5I30H 3CXDH 3B6SA 4OM0H 1G84A 4D9RE 3C60D 4JQIL 3NCFB 3NIFE 2YKLL 3VWJB 1WBYA 1AKJA 1B4RA 4MA1C 3U30C 4WO4C 5GS2D 5T1MB 5KVEL 4KPHL 4Y1AE 1MREH 4OSUH 4P2RD 2AKRB 3EYUL 3WLBB 4NWTL 1VSCA 4G6AD 2W59A 5ADPH 4PGBA 4X80L 4XP6L 2D4DA 4YHOL 1OARL 4M62L 4KUCF 3S36L 4JHBA 3V6FB 4JO1L 3UYOD 1CFSA 5IFJA 1DLFL 5LXGL 1E4KC 3ULVC 3NFSH 1N3NB 3QO0B 5I1HL 4KVNL 3BMWA 5AEAA 2VQ1A 12E8L 1NAKH 2WY3A 3OJDA 5EBLA 4HK3N 4HWEL 2R56H 1FZOA 1ZHKA 5CWSB 1CXHA 5DRZA 1HH9B 1R3KA 1OT2A 2HTKD 2EH8H 1QSEB 3L95A 1AE6H 4J4PA 1HZHH 3QUMH 5CJQH 4KK9D 4WCYH 4TPRL 5ADOH 4BSWA 1YUHB 4EQ2A 2XZCL 3MZGB 5BRZB 3MA7B 1UADC 3OKLB 3I6GB 2AJZB 1HILA 3EYVB 3V9FA 4WTZA 2Q8BL 2QR0B 4LK4A 4OCRH 3QUYC 1RURL 4AIXA 3OHXB 3QWQB 1T6VN 3U0PA 2DQUH 4JY6A 3GO1L 3SGEI 4CN6A 1SYSB 1BQHG 3JWDL 4NGHH 1EAJA 4MJ5B 2EDOA 2JJUA 4WFEE 3L5WB 3B8SA 4RBPH 2NY0B 2BJMH 3BKML 2JLLA 1OAQL 3F62A 5LAXB 5H8DA 5IBLD 4G8EB 3H9YA 1ZLUK 4GLRH 4DJMA 2BVTA 1AFVH 3JTTB 3AB0C 5IKCB 1IBGH 1A21A 3DGGB 4KMQA 5L6YH 2H9GA 4G8FA 1MF2H 2FO4A 1F4YL 1RZ8B 2B4CL 3GBLA 4YHMH 4ZQKB 3UTPD 5EC1A 5FUOL 5SWQA 5IJVA 4KHXH 5JORB 1VESA 4QYOA 4K3JH 4IS6A 1WIOA 1DSFH 5T1LD 4P48A 4PP1C 4YDJB 5BW7C 4OF0A 4RWHA 4E42B 4NDMB 3I3EA 2VZUA 4KJWD 1G9NL 1MCLA 1MEXH 2O61B 4XP5L 1FVEB 3AREB 2RBLA 3U1SH 4PRBA 3WSQH 4GAFB 3S88H 3TWCH 4PLKC 1JRHL 3OKOB 4KK6C 4JFFE 2I26N 4N9GB 4MXQA 2XQYK 3D5OF 4NM4L 4EUPB 2B5IC 1UXWB 4KV5E 3B2VL 1FG2A 2ADFL 4ZFOL 1OAXL 3T4AA 2DI7A 5GS3A 4QKXB 4MA3B 4Z77A 5E4EB 3DURA 3JWDC 4X6CF 1FFPB 5DRWA 1FNGA 4X5XA 4TNWK 3CXHK 4QRRD 5DK2B 2EECA 3GIVB 5DUMH 4LARL 1BVZA 4UB0L 3H2WA 4DN3L 2ORBH 3NGBC 5EO9B 5GGRA 4TVPD 2GUOB 3IJSB 1W0VA 4NO5A 3MNVB 3UEZA 1JGDB 2DIBA 3NIDE 1MVUB 2B4CC 3MLTB 4G42B 3VXRD 2ZOKA 4I9WD 1GYAA 4H5SB 4TOYH 3MLZL 2EIDA 4Y2DA 6FABH 2EXWC 4RAUB 4LOUD 1FIGH 1G9NC 3DTXB 4NZTH 5LGHL 4X6CA 3RZCD 1G0DA 2IFGA 2ARJA 3DMMA 5KJRL 2JJTC 43C9B 4XAKD 1IGCH 2FIKA 3EOBA 5E2TH 5C0CE 3NIGF 2JJSC 1FYTB 3CPLB 3WN5B 4HT1L 1UQSA 5IF0B 2EC8A 5E03A 3KHQA 4R4BB 5JW3H 2R2BA 2ZOLB 3HZMB 4BQBA 2MPAH 3GHEH 3C6LB 3FO0H 2CIIB 4M3JA 4MZ3A 4HS6B 3ECBB 5D1QD 5JUEH 2NY6B 1CDYA 3DX8A 4P5KB 3SJVD 1I8IA 5FF6A 1I7RB 1EH9A 2R0LH 1FJ1A 3VMPA 5EU4A 1QSFA 3QUKA 4I4WB 1V8HA 3EYSH 5FKPA 5L2KD 1ZK9A 5HYFA 5EB9A 3PDGA 2P45B 4YHIB 3FKUS 3BXNB 3BEVB 3QZWB 1DN0B 1KPVA 3O2WL 5HI4D 3MRQB 2X5PA 1YNLL 4E41E 2GK0B 4X7CC 1R0AL 4NZJA 1JHKL 2FEEI 1RV6X 4O2EA 3RBGA 4Q9QH 4Z0BH 4MJID 1J86A 3RWEB 4D8PB 5DHVA 3DIFB 3UO1H 2VLKE 3KDMA 1CU4H 1BOGB 3CFDA 4XPBH 3GMMB 4HIJA 4FS0A 5GGVY 5A3IC 1C5DB 1YN6A 1CGTA 1XR9A 2PF6A 5DDHA 3LV3A 4U2ZA 1OB1A 3CSBA 3VWKD 1NFIB 2XA8L 4I8DA 4FA8A 3LKRA 1P4LB 1DQLH 5IFAH 5E9DE 2N7AA 5FGBC 2OR9L 5I73B 5D6DC 1JZ4A 3EYOB 4QXGL 2CRZA 3TBVB 1GC1H 5TDNA 4AMKL 3SGDH 2GW5A 4DN4H 4Q0XH 1J0IA 5GHWH 1NEZB 2IQAA 5BO1H 4XNQA 1CLCA 2CUMA 1F3RB 5DSCA 5IQ9B 1PD6A 3AS1A 1JZ6A 4ZDHA 1FZKB 5F6IC 3ZT5A 4HPOH 4TVPH 1WITA 5CINL 2Q7YB 3MODL 1NQBA 3RI5F 4LNRA 4MA7H 4N0YH 5CP7B 4XMKL 1EEYB 2AJXL 2AK4E 5E0QA 1BLNA 3GM0A 1AXTL 1GOFA 2ZUVA 1FNFA 5C9KA 5ALBL 3QEGH 4ZNEA 3MRDB 5J8OA 1FNSL 5JXEC 2V7NB 3VRJB 1F4HA 5H2BB 3WJJA 2BK8A 1UZ6E 4WW1B 3DRTB 1AI1L 4ZXBC 3MGAA 4IJ3B 4LIQL 4X98B 1F90L 4LBEA 4Z6AT 5A16B 2AK1L 4NNYA 1KCRL 4F3FB 2VDRH 1ZT7A 1UVQB 2YRLA 3EOAB 4H26A 4WRLA 1HQRB 3H9ZA 1OGAD 4X7TA 1GAFL 4NN6C 2VDLL 1P9MC 1QYGH 2P46B 3GIZH 4B50A 3FO1B 1I1YB 5B22A 2GSIB 1BBDL 4NQCA 5IB5A 4MNQE 5DMJB 2DYPA 1FNLA 4GUPB 1JPSH 2J8OA 4XVTH 2J6EA 1A02N 3GGWB 4HZLA 4JFEA 1JHTA 2XACC 3FFCE 4G3YL 5EDXA 3OR7A 2BNQE 3VI3E 2CO7B 5E00A 4EQ3A 2HN7A 4MCYB 3RI5K 4AENB 3VWJD 4K8RD 1PG7H 2VLJE 5F7UA 1FAIH 1T1YB 4PG9B 2B0SL 4P49A 4K7PH 1F97A 1IEAB 4RX4A 3SO5A 5GRJH 3SOBH 2CDGB 1PX4A 2FBOJ 3V0WH 1KYOK 1G7PB 1NSNL 4Q6YA 1NCWH 4HX1B 3DV6A 3FHQA 4MAYC 2H26A 3EO1B 3ALXA 3HNSL 5FYKL 5F7NC 2CUHA 1WGOA 2XFXB 3U2SB 3UJTL 3MR9B 3TC9A 5MI0B 4GO6B 2F8VA 3LN4B 1G7LA 1ZGLA 5C09B 1K5NB 1JGEB 1N4XL 3IETA 1UJ3C 2J8UE 1NL0L 3GB7B 4ZTPL 3TN0C 4H25A 3ZDXE 1WC7B 1RIUL 4OLEA 4XCFH 1XZ0A 2HT3C 4YHPA 3MV11 3NN8A 2A77L 1KGCD 3GMRB 4PJGB 2FWOA 4LPXA 1XGTB 3HR5B 5CUSH 5BRZD 4LL9A 1OD7A 4DVRL 1D6VH 2IBZY 4N8PA 3ZMRA 5IGXL 4U3CA 3ARFC 3IFPA 4H88H 4OZHB 1INDL 4UT7H 3INUH 2FX7L 3IFOB 3MLUH 5FO8B 4NM8H 4L8DA 1TFHA 1KIRB 1WICA 2C1PB 3HMXH 5DK0B 3QUMA 3X3FL 1QFPA 1HYSC 2AJSL 1GZQB 3NCYP 2NY0D 4YX2H 2EH7L 4GMSH 2B1HH 2GJ6E 1UM6L 3HC0B 3V5DB 3S5LA 3CVHL 2J7LA 4UILL 2R2HA 5FKAA 2X89D 2MHAB 3R8BB 4F2MA 3QRGH 1H3GA 3LQMA 1UM5L 4OCNC 4LSRL 4LSPL 5A2KH 2I9LA 4NNXA 5CHNA 4KFZC 1TIUA 4V3EB 4P9HL 3VXSB 1RUKH 3BZFA 1MPAH 1E6JH 1XIWB 4AK1A 4KTEH 4PV9B 2VDQH 4EDWH 5C08B 2V2TB 1X5FA 3ARED 3CSYB 1CK0L 2PNDA 4NYLA 1BVKB 2CDEB 5EU7E 4WU5A 3BP5A 3DVIA 4MNGB 3MCLL 1Z3GL 3HZKA 1NBVH 1D5IH 3UJJL 5E56A 1GZPA 3H42H 5A2IH 5KS9A 3SDAB 5ICZA 4PJDE 5GSVB 4LAQL 1D7FA 5F9DC 4HJJL 5F7HA 3TNMA 4X6BA 3FB8B 3D18A 2AEWA 5HYJB 3VFRA 1DVFC 4IOSD 4HAGA 3T65B 3ZL4L 2IGFL 2V17L 4K8RH 1X5LA 1NBYB 5FGCE 5I1LB 5FB8A 1I8LC 4LRNH 3UPRA 3BAEL 2K7PA 3KNBA 5I2IB 3C87A 4WWID 2APWA 3HE7C 1VACA 5AG9A 4HV8A 4W70A 5IJKC 2E7LE 3KJ4B 4NRYB 4UOW0 4P9HC 2Y7QA 4N90D 4ODWB 4MGXA 2W07A 5GGSB 1D5ZA 3TCLA 1F6AA 1IT9H 1T80A 1MRFH 4ODUB 4PRHA 5DEFB 1RJLA 2F5AL 3C60A 1F4XL 3RA7H 3ROOB 1U3YA 1UACH 1I85C 1FO0B 2IJ0C 3MLRH 3QG6B 3GMPB 3B9KC 2VZ3A 5B39G 3MJ7B 5BV7B 2YA1A 1QKZH 1QZ1A 4P2RA 5ACZA 1FYTD 4G8GA 3SKOA 1SEBA 3VFTB 4R90L 2JF1A 1KEML 5FM5M 4H0IA 3HI6H 4P99A 2AERT 3SO3B 1NANI 4M61B 3C6LD 5EWIH 1I1AC 2Z93A 4ZSOE 1MHEB 3NZHL 2C9AA 2F8OA 4NC2B 1CE1H 2VLME 1A3LH 3KJ6H 2NY6D 4N9OB 2A38A 5HYIA 4NRZB 4PJEF 2D3VA 1F11B 3L9RA 4LVHB 5DQDH 5JOEA 3B8YA 1YC7A 1CD1B 2G9HA 2VRAA 3CX5K 1T5WB 5DJ6A 3PWLB 3GUTA 1PSKL 5AWNH 5BCAA 3QEQE 1WUNT 1QG3A 4OZGB 4C56B 3DVGB 4NP4L 1S9XB 1Q9OB 2VLRD 3BQUB 4PGEB 4W6WB 4XAWH 4FQ1H 1O7SA 3MROB 1QHOA 4XRCA 4PJAB 3KYOB 3FRUB 3D2UB 5E7BA 5LQBH 1CVRA 2VLLB 3LKNB 4PUBL 4F58L 4PRDA 2VWEE 4ZAKB 2Z92B 4R2GC 3VXMB 2AEQL 4O02H 3O41B 3RWHA 3SQOL 1A47A 1R5VB 1G7HB 3BDBA 2VJXA 2XTJB 1HE7A 1XH3B 3MBXL 3AUVA 4HS8H 3EYFA 5HHME 3V5HA 5KSBE 3QNYB 5CJBA 4LASL 4Z7WE 3G9AB 3MCKB 4XPFL 4WFFD 4ELKB 2H3NB 3QH3A 2X4RB 2MQ0A 5B21A 4M9PA 1P5UA 4EUPH 5D1XB 4UOW1 1JWUA 1U8LB 3VXUB 1L0QA 3F7VA 1U3JA 1RK1B 3DPBA 2FDBP 2CLVA 4DGIH 3O8XC 5EBWB 1C5BL 3MOBL 5IVNA 1MCDA 5DJCB 4P3DB 5I1AB 1D5MB 4YUEL 3TVMC 4DVBA 1RFDH 5T1LA 4F33B 2O26U 1I3GH 4U7KA 4Q2ZB 1K3ZA 3IFNH 5J56B 3RL2A 3GMLA 2ZPKH 3LSOA 4JQXC 4KKLC 1WAAE 4GQ9H 2F19L 4FQIH 1LEKB 3IXAA 5JNYA 2OBGA 1C5CH 5DK3A 3RY4A 1DBMH 2X10A 3IJHA 3D48R 4ZFGL 2BFVH 1F6FB 2NCMA 1R3LB 4RMVA 4DCQB 5FDYA 4NC1E 3EO9L 3KLAB 5DMYA 3WFDL 3V4UH 2HKHL 4JKLA 4M7ZC 4XXDA 2HVJA 1FSKC 3NZ8B 1U8QB 2AXJA 3A6CH 2W38A 4DEPC 3REVB 2DM7A 2SEBB 4D0DB 5JOPD 2HFGL 4NFCA 1R3IH 4MSWB 1ITBB 2XXMB 4JDTH 3T1FB 5FIEA 3VFMA 1MUJA 4GAGH 4XVSH 3QULB 3OR6A 1E4XI 2JELH 1AIFA 1RZIB 1T83A 2DQHH 4OFDA 4DZ8A 3G5ZB 3VXRA 4F15B 3CC5B 4RFOL 4FXLA 2I25N 3KVQA 2ZJSH 2CKBB 5EBMA 5AD0A 5JHDB 5EUOB 3D9AH 5DYOB 5HDQL 1LK2A 4HXBL 1MCKA 1I4FA 3TF7A 1H8SA 4GSDH 4YBQC 3FCTB 4GXVL 2UZIH 1Y18A 3BO8A 4FFZH 4MS8C 4Y19E 4RGMC 1MOEA 2GITA 5C1MB 3O6FA 2P1YA 3GI8H 5C9JB 4G80A 3O2DA 4JB9H 2DL2A 2DAVA 5FA4B 3QIWC 4M1GL 4OT1H 3TYGL 5EIIB 4WFHE 2CLZB 3QI9B 5F7EH 2RJMA 4GG6B 4PB9L 4C83A 3ULUE 1RVFH 2F58L 5J6HB 2WUBH 2PO6A 1ZOXA 4GRWB 4YDVA 1K8DB 4HCRH 5I8KH 2Y4SA 5IEKB 5E2UH 2A6KA 3DXAA 3IJYB 4I3SH 4P4KA 3TT1L 2ZSVA 2AEIT 3C08H 3SJVA 2FX9H 2FIRT 3R06A 1DEDA 5TF1L 1ZHBA 3FT4A 1RUAH 1GGTA 2ZCLH 2ZP0T 2CK2A 3L3KA 2XNAB 4FQ2H 4WTWA 1J8HB 2BDNL 3VFPA 1XF5A 4YPJA 3LS4H 5JIIA 1N5YH 5GSRA 4J12A 3OPZH 2G2RB 5C09D 4NQUA 3PUCA 4CMHC 5CILL 4OTXH 3U4EB 2I07B 4Q6IB 2IPTH 3KGRA 4KI5E 3MBEA 5FOBA 4MJIA 3RX7A 4P0DA 3RVVD 5TFSL 4MB3A 5GRXG 5AAWA 3X13A 3K2UL 5EZJA 5IMLB 5FUZL 2W9DH 1J1XH 3LEVH 1RZFL 5F1OB 3VWKA 3MYJB 1AHWB 1DDHB 3RVXC 2KKQA 2APVA 3GSQB 3K4AA 4AQOA 3QWRD 5GS1A 2P8MA 4CW1B 3DRQA 4YJZL 4LVOC 4YHKH 5I18L 3GSWA 1PY9A 1I7UB 3QA3B 4P3CH 5KVFL 4RQQB 3SHSA 1KCUL 3MRIA 2MCG1 4CJ1A 2J1KA 5IHUL 2R0ZH 2X4SA 1D3CA 4W68A 5CD5C 1PEZA 1TJIH 1QBBA 4LCWB 4Z7UE 1C8PA 3FB5A 3QDAA 4HQQH 3LB6D 1T03H 5HD8C 3GSNL 3P4LA 4PY8I 3SPVB 5B4MD 2PR4H 3CFKB 3IYLW 2EEDA 4KI1A 4M93C 1A7OH 4IOFD 3DETD 1E4KA 2ID5A 3VXSD 2VDMH 3QIBB 3JXAA 1XIWD 2GY5A 3MFFA 2D31B 3KAAA 1ZVHA 4Y5YB 3DX7A 4GFTB 5C08D 4WHCA 1QFWL 1A4KB 1MFAL 4OI7A 3C8KB 3VRLF 2P8PB 4XX1E 3J8F7 4KRLB 3L6FB 3TPUA 4BKLB 4MB4A 4JHZA 4KK5D 2WWKT 3MUGA 4Y1AB 1EHLL 4HGWA 1U8PB 5K9OB 3SDAD 4LLMA 1WT5C 1V5JA 1NAML 5EA0H 5HYJD 4FFWC 2BRRL 3MLYH 3T0EE 2AI0L 5KG9A 4PGZA 2W0PA 3MO1B 1OGAA 4ZD3L 5E8OB 2XV6B 3RL1A 5D96B 5D1ZB 1JPGB 3BT2L 4UDTB 3GI9H 2VXVL 3FQUB 1H5BB 2IADB 3QUYA 4LDLB 1LQSR 3PGDB 4I18C 1IILE 3P4NB 4D3CL 2H45A 5DQJB 2WUCH 2YUWA 4FZ8L 1YDPB 3RVTD 1I7TB 3X3GH 5AZ2H 4QRQA 4NSKA 1F58H 2A9NL 4MB5A 3G6DL 4QRTB 3KPSE 3ARSA 3VWJA 4WTZG 5D2NB 3VW3L 2IBBA 4LLWA 2CDFB 2FECL 3C5ZB 1UWEL 3GK8H 2AKRA 5E08L 3WLBA 3BPLB 5AZEH 1D9KB 3ARGB 3MUZ1 2IMMA 5IVXB 4OLYH 3GNMH 5IQ7H 2OMBA 3ZE1F 1KBGL 2B2XH 4UBDC 5CEXB 1MFBH 3QHZL 1HYRC 5CP3H 2DBLL 4FQPA 4DUXA 4LFHD 4WJ5B 2XQYG 4UIKL 5CIPB 2Z8RA 1N6QL 3VGFA 1RAMA 5I8OL 5JMOC 1U8OB 1RUMH 4D0BA 4HWBH 3B2UD 3MC0A 4JFXB 5CWSA 4YE4L 5ID0B 4OLZL 1HH9A 1H3PH 5SX4I 1KPUB 5FHBL 5F71A 1QO3B 3LKOB 2RCSH 3TO4B 1YUHA 1YPZE 3BQUD 5CD3B 3CMOH 5T3ZL 4W81A 1YY9D 2WMPA 1OPGL 5HVHB 4ZUUB 3D2UD 4XMPL 3EYVA 1PLGL 3DVNB 3SKNA 3IDIB 2DLGA 4JFFB 3RTQC 1SEQL 4ZAKD 2AW2A 5IT2H 4WV1C 3VXMD 4G59A 2EKJA 1CL7H 2J8HA 4RAVB 3OHXA 4OIIL 1L9MA 2XTJD 3NAAH 5EOCJ 1GIGL 2DKSA 1IEBA 1KG0B 2FGWL 4MJ5A 3V8OA 1YMME 3L5WA 2PTTA 5GQBA 1UXSB 4G8EA 2O5XH 3JTTA 3MRGB 2DM3A 5D1XD 5IKCA 2X89A 3VXUD 4TSAH 4ZFOA 2JJSA 3DGGA 3DO7B 2P43B 2YPKB 4MQ7B 3I3DA 3FQWB 1UYWH 2VDPH 3C5SA 2KQNA 3K4DA 5IBUB 3P9MA 5GRYA 1KV3A 2AEPL 3BD4A 2W0FB 5DRNB 4YDJA 1DQQB 5DVOA 4NDMA 4N0RA 4V1DE 1NGPH 2JCCE 2WANA 1II4E 4WENB 1RMFH 1FVEA 5KVDH 3AREA 3KXFE 2XPGB 1ZAGA 4U4BA 3UX9B 1MJUL 2D4FA 3OKOA 5J1TC 3DLQR 4HXAL 4N9GA 3WFCL 1HIMH 4EUPA 1MCOH 1UXWA 1F02I 2PKDA 4PJXB 1CGXA 1ZS8A 4LQFL 3U9PH 4AIOA 1TPXC 4Y5VC 4MA3A 4OZFB 5KSAB 5GS0D 1AP2B 3DSFL 1IRAY 4JO4L 1GGCH 4G6JH 3NH7H 2P5WE 2CRIA 1ETZB 2ATKA 1C1EH 4QHUA 3D3VB 2E6JA 4TTGA 3DUUB 2DICA 3T2QA 5EO9A 5E24E 5F1KC 2XZQH 2GUOA 3IJSA 2OZ4H 3SKMB 1G9ML 4BZYA 4HPYH 1J0HA 1MVUA 1IKFH 4H8WL 1NLBL 1T89A 4H5SA 3WHXB 5JHDD 4EVNB 1Y0LA 4RAUA 5FEBA 2A1WH 4NRXB 2FATH 4PR5B 2F5BH 3DTXA 1UEYA 4Z7QF 4XMLH 1BAFL 2O93L 3T08A 3VFWB 3NTCH 1JNHB 1ADQL 43C9A 1FGNH 1IC4H 1KIPB 1FYTA 3CPLA 3P77B 3WN5A 3EYQC 3MXWH 5IF0A 1Q9KB 3MV7A 2VLKB 2YBRA 3CDFA 4LLAA 4R4BA 1B0WA 3QI9D 2ZOLA 3HZMA 1Q1JL 5E2VH 1YEKH 3C6LA 4OF6A 2IPKB 5I1CL 4JM4L 2CIIA 4K94L 4FTVB 4XVJH 4I77L 3Q1SL 3UPAA 1QNZH 3WD5H 4EKXA 3T0AA 3HC4H 3QAZC 4P5KA 2N7BA 5IW6B 1G9MC 2WWMC 5HDBF 5E9DB 4H8WC 3H7BB 4FZEL 3L5IA 4I4WA 4L5FH 1FFRA 4PYHA 3U7AA 1KCVH 1UWGH 1J8HD 4TRPH 3BXNA 4ZS7H 1DN0A 3BGFB 2VZTA 2VLRA 1LO3L 4JCLA 2GKIA 1JGVH 3VFOB 4DZBB 4OCMC 4X4ZA 1K85A 3T1WA 4APQB 2EYRB 2GK0A 4U1MA 1NKRA 4Z7VE 1HXYB 2E6QA 3MV9E 4FXKB 4F7PA 1N0XH 3IXTA 4GRLC 1CGSH 1N59B 2BHYA 3AROA 1INEH 2G60L 3B83A 4NQXB 2OM5A 4QOKB 3RWEA 1KNOB 4D8PA 3GMMA 1Z5LB 2BVQA 4TTDD 4NKMB 3VFVA 3T2NH 3BZDA 3VJ6B 4K94C 4NKDA 5I1EH 1NCTA 2Y72A 1RU9H 4J3VA 5IWLA 2Z8WC 4MAUH 3DI2B 1A4JB 1P4LA 2JIXB 2DOCA 4X4MA 4EOWH 5DEGB 3CCHB 3OKNB 5FYLE 1V7NH 4JVPA 5IB1B 3D1MC 5E5MB 1RJZB 3EYOA 1MCEA 2FJHA 3NFNB 3TBVA 1EBAA 4KDTC 2C5DC 2NMSA 2VABB 1NEZA 4LCWD 3HNVH 5IQ9A 1J05B 2D9CA 3VXNB 2H32B 1HN1A 2E3VA 1JYWA 1OW0A 3U9UB 2R9HC 4JM2B 4PJ9B 2Q7YA 4OKVB 4RMSA 3B5TA 3QQNA 3QIBD 5CP7A 1LO0H 2NY5L 4JGJA 4NZRH 3WIIH 2F54A 1EEYA 3FFCB 3RWFA 1UH3A 3RWGB 4P9MH 4UINH 2MCPH 1T04A 4D9RD 3T3MF 4NWUH 4XNYL 4XCYA 4M6NH 2O5ZH 2OL3L 1S7VA 3MRDA 2VLJB 2V7NA 1KJ3L 4OI8A 5H2BA 4WW1A 3MRFB 4Y1AD 3MJ9L 3DRTA 4NBXB 2VAJA 3KR3H 5A16A 3NABL 3MUY1 4MMZC 3EJZD 4X9BA 1L0YA 2GT9B 5L7XL 2O5YH 4F3FA 1UVQA 3WLWC 1Q94B 2MKWA 3EOAA 2XKSA 4KU1A 2XKUA 1S78C 5KW9L 4LSTH 5D1ZD 1HI6A 3ARFA 5D7LE 3FO1A 1I1YA 4JFPB 3P30H 3RP1A 3H9SB 3SBWA 2E9JA 4UIMB 5GGRY 2ZUXA 2H1PH 4FFVD 3O4OB 4GUPA 4L4JA 5D70L 1MFCL 5E70A 4P23B 2J8UB 4R4FH 1KJMB 3AXLB 2D7TH 5F7YC 1FLRL 2CXKA 4WFGE 2NY5C 3STZB 5F6IB 1A0QL 1LILA 3TO2B 1YEDA 3QXDA 4O5LH 3ARBB 4BK4A 4ETQB 2UV3A 3WFZA 1KJ2L 1OSPL 1JRHI 2F9BT 4MCYA 4AENA 4G5ZH 4JPKH 4WY7H 4D0CB 1ND0B 1OCWL 3C5ZD 4PG9A 5GGUB 1AGEB 1IEAA 5DUPL 2E7MA 2DWDB 4TSBH 5I74C 2CDGA 1D9KD 5ALCL 5DGRA 3VXOA 1EGJH 3ARGD 3D6GA 2Q1EA 5I1DA 3JV4A 3NA4A 1YQVL 1G7PA 4PJGF 3OG4B 5E2JA 1VADA 4ZXBB 3GRWH 3EO1A 4OCWH 3FN0H 3GM8A 3S5LG 4WFED 4IRSB 4S1RH 2XFXA 3U2SA 3MR9A 2GJ6B 4YK4C 2MJWA 4NKIL 4OZHF 2K9UA 4K3EL 2ZUQC 5BZDB 1EJOL 4MJ6B 3SDYH 4OLUH 1JPTL 1A6ZB 1IC7L 3GB7A 1TZHA 4JO2H 2EYSA 1AXSB 1MHHA 1UWXH 4G7VL 3L1OH 3GMRA 3TO4D 3L3DA 4PJGA 2DLHA 1T2QL 4M7LH 2VSCA 1XGTA 2YZ8A 3HR5A 3V6OE 4LEXH 5FCUL 4UMGA 2NXZB 3PWNB 2OK0L 4P57B 4Q9RL 1I8LA 1RZ7L 1FAKT 3TA3C 1W72L 2IANE 1WZ1H 5ILTL 4RGOH 4A6YB 5T33L 3BHBB 2C3VB 4OZHA 3OB8A 4JFFD 3G6JE 3RFZC 1AXIB 3RBSA 4IMKC 4OD1H 5FO8A 1KIRA 1NC4A 3QWRA 2C1PA 4JJ5B 4PJDB 5DK0A 1BMGA 3VD5A 2ZNXA 5LKNA 5INDB 5IHLB 5I66B 3ARDB 3OKYA 1NLDH 1GZQA 3CAFA 4G6ML 3HC0A 1I85A 1GGBL 3V5DA 4N5UA 3QCTL 1KLFA 4L3CB 5GISL 5FGCB 1Y6KR 1CFVH 1BHGA 1QR4A 2MHAA 2NY2B 1CDIA 4PLOB 2NNAB 5C6PB 4MQSB 4LLDB 3EUUA 1L0XA 3RX8A 1JFQL 1V7ML 5TE6H 5AYQA 3VXSA 4Y4KD 3PDOA 4TYUA 4ELME 1IC5H 3K8MA 2C3XA 1CFNB 4R4ND 3CSYA 4N0UE 5GRVL 1BEYL 5IMKB 4NUGL 4YZFF 2CDEA 3GMOB 4MNGA 3RKDD 3VG9C 4LKXB 3MX0A 4HLZG 4ACPA 5CJXC 4UZGA 4X5LA 1D6EB 3HN3A 1Z0NA 2YMXH 2AJYL 5KSAD 3R0MA 4LLYB 4JZNB 2HAZA 3AM8A 1A6TB 1INQB 4Z7OE 4OD2B 1P4IL 3ARQA 3FB8A 5ENWB 5HYJA 2XA3A 4ZSOB 4GBXC 3D3VD 1IM9A 4L8BA 1NBYA 2HFTA 5I1LA 1W0WB 3WFHB 4DKEL 4HUWB 1W8NA 5IHZB 1VERA 2JB6A 5I2IA 3E1F1 3ES6A 2ADGB 3VDCA 1VGEH 3O6MH 1E4WL 4HJ0D 1WJ3A 3W82A 2HKFL 5K59F 1NGQL 4M48L 4Z95L 4ODWA 2ICEB 4ZUWB 4FFEX 5GGSA 4ZUTB 1N64H 3BP4B 4IOIA 2Y9RT 5FGSA 4ODUA 1U8KB 2FX8L 3N85L 5DEFA 3D25A 3LPWA 4RMQA 3ROOA 1FO0A 2R69H 3QG6A 1FVDA 4Z0XA 4Y4FC 2EKSB 1CGYA 4PS4H 3MJ7A 4NJAH 3ZE2E 1KT2B 4BA8A 2VLKD 4X8JB 2YZ1A 5JPMB 4M03A 4O9HH 3TFKD 4M61A 4OV6F 5A1AA 2FYYB 1RZKL 3THMH 3RWJB 2DQEL 3G5VA 3PG2A 4FTVD 5IB4B 2Z0BA 2Q8AH 5GJSL 5HHMB 5KSBB 2ATPB 3O6KH 4Z7WB 1NCDH 4S0TD 4NRZA 3LRSB 1A7RH 2V9RA 5E9DD 1T1WB 4QHMA 3PWLA 5GZOC 2QSCL 1J12A 1FORH 5IVZB 3HE7B 1MJ8L 2YD1A 3B5HA 2W9EL 3OJ2C 4QRSB 1VFUA 2D2OA 5GGQL 1S9XA 3QEUB 1Q9OA 4S1SL 3BQUA 4HIHB 4XNUL 5DJ2A 3DX6B 4APQD 3MROA 3KYOA 3FRUA 5DMIL 5F1NB 2NW2B 3D2UA 2VLLA 2QL1A 5IBTH 3PGFL 4ERSH 3STLB 4QOKD 1M7IB 3LZFH 1ZHLB 2Z92A 4L3EA 1R5IB 5I8EB 3HC3L 1R5VA 1G7HA 1P84K 4I0PC 5CAYB 1V3MA 1DQJB 1RZKC 5HPMB 1XH3A 2NZIA 4PV8B 1H0DA 4OM1L 1MRDH 5JW5B 3VD9A 4NUJA 3V79C 5EOQH 1JGLH 4DQOL 3TJHC 3MCKA 4OFIA 5FV2A 1J88A 1QBAA 4JQIH 2JJVA 2ZSWB 4Y0GA 5HHOA 2JIXD 3QDJA 4YDLC 2BSTB 3OX8B 1U8LA 3VXUA 2HJLA 5TDOA 5KVEH 1RK1A 2GFBB 3EOYG 3EYUH 2HFFA 2BRQA 4OZFH 3LKQB 5D2LE 5SV3A 5SWZE 5B8CC 2ADIB 5DJCA 1XF3B 4P3DA 5I1AA 1D5MA 1MFEH 4QT5A 4JO1H 4IM8A 5BZWA 4F33A 2H2PC 4Q2ZA 3PP3H 1DLFH 1OAZH 5LXGH 15C8L 2KBGA 5TJWK 2Z9TA 1WF5A 1GOGA 1WZLA 2FGZA 5FUCC 1U2CA 4MNQD 4Y19B 3VI4E 1A2YB 1LEKA 1MIEL 2R4SL 4JM2D 4PJ9D 3QJFB 2AV7B 1IGMH 5CEYA 5F3HB 4PGDB 1R3LA 4DCQA 2CSPA 3RNKB 5J1SC 3FO9B 5EUOF 1QACA 1DBBL 3PABB 3FFCD 3K7UA 3UROR 3KLAA 2BNQD 5IG7B 1IGFL 4JZOB 1TETL 1O0VA 1B2WL 1JNLL 4QNPE 2EZ0D 2HFEA 3RDTC 1PDKA 1NGYA 2VLJD 3QQ3B 3BPNC 3KHOA 1XGUB 3REVA 2XZCH 5AYUL 4D0DA 1K4CB 2BY0A 4TSCL 2V5SA 4MSWA 3T1FA 5MP6H 2E7HA 3QRFM 3PQYE 1U92B 3P11L 4FP8L 3QULA 3QXUA 3HUJE 3IF1B 3STBA 2IF7A 2Q8BH 1RZIA 5HGAB 4XI5C 4GG6F 3G5ZA 3I50L 3PV6B 3CC5A 1WCBA 2CKBA 3KPOB 4GRWF 2AABL 5GGTL 5JHDA 2AGJH 5EUOA 4ALAL 5DYOA 1Z0MA 1IQWH 1BZ7B 3P2TA 5DQ9B 2YUXA 3KYNB 3EZJB 3FCTA 5F21B 1QSZA 3H9SD 3ULUL 3TIEB 4ISVB 1IZKA 4QRRE 1PFCA 4UQ2B 3HPLA 4HMDA 2HRPL 1P7QB 4P23D 5I9QC 3HI1B 5C9JA 2NYYC 1XCQA 1LO2L 3G5XB 4HIEB 5FA4A 3ARBD 4FQXB 5EIIA 1JUFB 2YD8A 5E8PB 3V6BR 2CLZA 1L7TL 1VPOH 1WFOA 4GG6A 4MZ2A 4S1QL 1CDUA 4I3GA 5FUOH 3BH8B 3MJGX 1K8DA 1RUPH 3VG0L 3SE3A 1PKQE 4JHAL 5JXED 1G6RB 2GAZB 4DEPB 5I6XB 1LDSA 3AMKA 5KSVB 3HS0A 3DECA 1OP3K 4ZXBD 1DL7L 4HH9A 4NM4H 3T0DA 4N5EC 2G75B 4U49A 3RU8L 2ADFH 1YEHL 4RZCA 4XB7A 4IRSD 2X70B 3S37L 1G7MB 2GJ6D 3O4LE 1N26A 5EU5A 1J8HA 2Q7NA 3ULUC 3FAXA 3S4SB 1MCPH 3VFNB 5J9PB 3CDYA 3HAEB 5J6GA 4R26H 2APFA 5DVKA 1Q9LB 3CDGB 4KRPB 1T7YA 3U4EA 5EZIH 1CLYL 4Q6IA 1OP5H 4HWZB 5TQ0L 1D5XB 3UTZB 1LO4L 4DKFH 3GHBL 1KOAA 3Q6GH 5L2KE 1J9CT 2NXZD 5FK9B 4PIRF 4CKVX 3PXHA 3MLZH 3PE9A 3QIWB 4BUGA 5D7IE 5LBSL 4Y4HC 4HKBB 3FO2B 5LGHH 3A67H 3QG7H 2UY7A 3MYJA 1AHWA 1DDHA 5KJRH 2BY1A 3GSQA 4WI5A 4NJ9L 4MNHB 5HBBA 2H2SC 2CK0H 4CW1A 2DQDH 4Y5XB 1I7UA 3QA3A 2XN9E 3ARDD 4DUWA 4RQQA 1TDQA 2NLJB 2RR3A 3CJJA 3WKML 4BFGA 5CBEB 5F96L 3IDNB 4LHUB 1A6UL 5GXBB 4I3RH 4LVNB 2NY2D 4KJYB 5JIPA 3DNKA 1YEIL 4JREC 3SPVA 3S8WA 1BD2B 2XWTB 4ODTL 3CFKA 1CTOA 3U36A 4A2MA 1KJVA 2Q3ZA 3EZ8A 4LP5A 4PJBE 3PDDA 1UWXK 3TPKA 4RWYH 3FL7A 2D31A 2VC2H 4Y5YA 1CLOH 3GKWL 5TQ2H 3S9DB 3GJFB 1A4KA 2P8PA 1OOAA 1TVDA 3L3IB 1R6VA 3KPSB 3L6FA 2PYFB 4BKLA 4R7DB 4ENEC 3M17A 3VCLB 5GIRA 5H37G 3GFUA 3WIHH 2P44B 4WGVB 1OF2B 3O2WH 1MIMH 4Y1AA 1NFDB 4M43L 3UTSB 3BFOA 2JK5B 2P7TB 5IEHB 4Y8AA 1HINH 2Y06L 5KOVC 3RWDB 2LV4A 4MXWH 4K23H 1JHKH 1PGRB 1CE6B 4XNXL 1MWAL 3R4DA 1WBZB 4RFNC 1U93A 1VFMA 4WUUE 1M1SA 2DQTH 2FEEL 2C26A 1MNUH 3HNTL 3MO1A 2VLMD 5D1ZA 1BFSA 3KYAA 2QQNL 1JPGA 4QRUB 4UDTA 4WGWB 3RTQA 3MA9H 4QCIB 3U7WH 1H5BA 2IADA 4NOFA 3NCBB 2OS7A 1E6OL 1PAMA 2VSDA 1SJHB 3PGDA 5DRXB 2XA8H 1X5YA 3BN3B 5DQJA 3GBNL 1QRNE 2CMRL 1I7TA 3QEQD 2OR9H 4DFHA 3SDCC 3UBXA 4QRTA 3ZTNL 1YPZB 4M93B 3ZO0A 3SCMA 1A9EB 5HYQB 4YHYB 2GJZB 4XNMA 4AMKH 3BP7B 3T0EC 2CDFA 1AD9B 4KUZL 5DJ8A 4K71B 5J06A 3IAGC 1DBAH 1D9KA 4XCEB 1CIDA 4GKSB 5E1AB 3BMVA 3MMEB 4UT6H 5CINH 2C7UB 1DFBH 4ZTOH 4M7KL 4NN5B 4OIBA 4D9LL 2FZ3B 4LKCB 5DD3L 1BECA 1YMMB 4WJ5A 4XBGA 5HHMD 4XMKH 4IMLB 5F88A 1UZ8A 5CIPA 5JXAL 5F7DB 4A6YH 2CKNA 3LPFA 1N2RB 3VA2C 1U8OA 5DZNA 3HCVA 1EDQA 3O9WC 4HFWA 3RY6C 5A40E 1ED3B 5E8DH 1UCBL 3IT8D 3GBMH 3LD8C 1AI1H 5BVJB 1UM4L 4LIQH 1MFDL 1KPUA 4V2BA 4X5WB 1NMCC 1IQDA 1QO3A 3WNKA 1EZVY 3Q6FB 3TO4A 4NHCL 2YPLE 3L5XL 5DJXB 2H8PA 3FQRB 4HAFA 4FQCL 5CD3A 4V1DB 5C0DB 4JFZH 2JCCB 4EUPG 1YA5A 3KXFB 3T2PA 1GAFH 3DVNA 3MRNB 2HJKA 2I27N 3AS0A 2ICWB 4JFFA 3IU3A 2FR4B 3NIDF 4IDJL 2YUZA 1EZVX 4OQTH 4G6KL 1NGZB 1F4WH 3T2OA 3UYRL 5F44A 2CQVA 1AR2A 1AD0A 1QSEE 2OTUB 5I1KL 1IAIH 1KG0A 4GXUM 4YO0B 2UWEB 4I2XE 4U0RB 2AXFB 4NIKB 1ZLWK 2W60B 2P5WB 3NACL 1OVZA 1ZANL 4DTGL 1XF2A 2V5MA 4N1HB 6CGTA 3SKJH 2DIAA 3ZSTA 4YBLB 3DO7A 1CWVA 3T0WA 2B0SH 2VH5L 3PGCB 3CXHJ 4MQ7A 4ZODA 3TV3L 1FL5B 5JA9A 5SV4A 4OJFH 1JWMB 3N9GL 4C58B 4QHNB 3X12B 4Y4KA 2DMKA 4YHNB 4GW1B 3VGEA 1F6LL 3HNSH 1CD0A 5FYKH 1AY1H 3PP4L 4H1LA 4QHKI 4B7LA 4Y19D 4LEOB 1NGWA 3QR2A 1RUQH 1MLBA 1EXUB 4ONHB 1J5OH 4OV5B 5EIVA 4YHLH 5C0CA 3ZLQC 5JZ7D 3SY0B 5T1DL 1S7QB 1N4XH 1GVIA 3T0BA 5KSAA 1YYLH 1AP2A 3L7FA 4WV1B 3OGCB 5C0FB 3B5GA 2DKUA 1ETZA 2VDOH 1A6PA 3O3EA 5ESAA 1ADQA 4NT6B 1N8ZB 2APXA 2V5RA 1KUMA 2X6MA 1PQZB 1MCWM 4XP1H 3MSPA 3DUUA 5HHNB 2GTWB 5DO2D 2HT4C 4PRAB 1U8JB 3P9LB 4NOBA 3M8OH 3SKMA 1JI1A 4B53A 3A6BL 4JZJB 1E0OB 4PGCA 2FX7H 1SJXA 1AR1D 3AU1A 5F9WC 3WHXA 4JVUA 1OGTB 1SMAA 3TLRA 4NRXA 4NN7C 3ILQC 3WEXB 3CFEB 1SBSL 3X3FH 4OCSL 1ZEAL 4L8CB 5JOFB 1JK8B 2BHZA 2EH7H 3LPGA 3VFWA 4E41A 1JNHA 5TGBB 4LLVB 2NY1C 4Z7VB 1P7QD 4HS3B 1RZJL 3MV9B 1R24B 2BCKB 4C54A 3S35X 2DDQH 2DQJL 3P77A 4KI5D 3JTSA 1OQOA 1Q9KA 2VLKA 4MXQC 4IHOB 4FQXD 5ICXB 1MJ7L 4XC1L 4ZUSB 2DQIL 4NO0B 2IPKA 3MRKB 4Y5VB 5JDJA 1E28B 2MMXA 3S36X 2EIZB 2PTUA 4NC0B 1C12B 4C57C 1TQCB 1Q9WB 3W11C 1CK0H 3MLXL 3PL6B 2BXYA 4PREB 3ZHKA 5E9DA 3H7BA 5AUMB 1QPPA 1KB5B 3PJSB 1FL6B 3MLWL 1NEZG 3ETBF 4LAQH 1FGVL 3DARA 3OXSB 1JP5A 4HJJH 4TUJA 4UAOC 1UZ6F 5J89A 2BMKB 3RPKA 3VFOA 4DZBA 4APQA 2EYRA 1T2JA 1NJ9B 4ZYKB 1HXYA 2V17H 5I15H 1QUNA 1RZJC 4FXKA 4KRPD 5T1KB 4LSVL 4MMXC 2YC1B 3DMMC 5K9JL 1N59A 4NQXA 2LU3A 3RVWD 3SGKA 1QP1A 2A6IB 2Z8SA 3L5HA 1KNOA 3QQ4B 3PV7A 4QY8A 1QVOB 1JNJA 3OKEB 4JEGB 1Z5LA 4NKMA 4AEIL 3NPSB 2AK4A 4LCUB 5E6YA 1U6AL 3VJ6A 1NMAL 4WI2A 2W0LA 5TH2B 4E0RA 4U1LB 2QJDA 2E7BA 2QQKL 1JPST 4TQEH 1NH6A 4LLQB 2JIXA 1BF2A 4XP4L 2J12B 5DEGA 3CCHA 5C8JB 5F1IA 2IFFL 2JE8A 3ZKMD 2R2CA 2YN5A 3NOIA 5IB1A 5E5MA 3VI3F 1BQHB 3O0RL 3UBXI 3NFNA 4RIRA 2NXYB 4PB0H 4AZ8A 4BSVB 5HPOA 4KJQC 4D94A 4LHUD 5DVLA 1GOHA 2VABA 1OAUL 5D7LB 3RKPA 5GRUH 4J7RA 4BFIA 3DHMA 3WFEL 3E2HB 4MNQA 2H32A 5C3TA 1BD2D 3D39E 4PJ9A 4CGTA 3OAUL 4LRIA 5I19L 2D7QA 5DFVC 4H20L 4ZPTB 2X4TA 3W5NA 1GGIL 4KMTL 3FFCA 3KLHC 3RWGA 3SE8L 1OHQA 2BNQA 3L5JA 3U46B 3SN6N 3KPSD 4OCYL 1LDPL 4P5MB 2VLJA 3S3PA 3RAJL 3MRFA 3ULSB 4U1KB 4XBPB 3X14B 2AJVL 3G6AB 3UTSD 2B1AH 3RIFF 3Q5OA 1M7DB 2VKXA 3A6OA 4LMQE 4PUBH 2GT9A 4L8SB 4F58H 2HTLD 3K3QA 1BVLB 3U0TB 1LEGB 3GZKA 1CXIA 4JJHA 1WWWX 4YR6A 1DANU 2Y23A 1J0KA 3SQOH 5DLML 3MRRA 4ONFL 3C09B 4X7SL 2HRLA 4UIMA 3QPQD 4IMKA 2FO1A 4XPFH 1U8MB 3WS3B 2ERJC 3QJHA 2X42A 4P23A 5MERA 1KJMA 3AXLA 1BX2B 3CDCA 3STZA 5HD8D 1KTDB 5IM7B 3TO2A 1NMBL 4IEFB 3UZVB 4ETQA 1F3JB 3ARBA 4XT1C 1M71A 2WLZA 2J6EL 1C5BH 3MOBH 1Z6JT 1ZXQA 3I2CH 1YYML 1F2QA 2NY4B 4D0CA 2M8XA 3T4YA 1ND0A 3OL2A 3WFBL 5GGUA 1AGEA 4ZS6D 2IANB 3HAEH 2C3HA 4QXTB 3NCJL 2DWDA 3L3OB 1OAKL 2ICCA 1EV2E 3G6JB 4YEFA 2V2WB 3VFSB 4JDZB 5FYJL 1TVBB 3RIFK 5FHAH 3WS6A 1YMMD 1X7QB 4IRSA 3QBTB 3SE9H 1W72A 3C2AH 2GJ6A 4XB8A 2V2XA 1A7QL 1U36A 3MGTB 3C5JB 2RFXB 5HHXH 4HC1L 5DS8B 5I30L 4O00A 3F7PC 5HGDA 4LPTA 1EUUA 4PJDF 1KLUB 3CUPA 5DWUL 4P46B 1AXSA 2WK2A 2Z4QB 4AM0B 1JF5A 1MREL 3E6FB 3IRZA 3QSKB 4OSUL 3R1GL 5J1AB 4GBXA 4LPUA 4QGTA 2W65B 4RFOH 4V1DD 2XY2A 4S0SD 1FN4B 3PWNA 4L4TE 2FD6H 4P57A 5F9JB 3KXFD 4N0UB 2R4RH 4F7MA 2HG5B 5I1IL 3BHBA 5H35B 3HB3C 4KRMB 5ECJE 5C0JB 5CGYD 3KG5A 5IB2A 2E9IA 1NAKL 2LU4A 1KN2H 3BN9D 4JJ5A 4PJDA 4KKCD 5EN2B 1FC2D 3QCVL 5INDA 2CJUH 3L3JB 3ARDA 5I66A 9CGTA 3CNKA 4KXZH 3AS3A 1P7KB 3ZZ1A 2P5WD 4UBDD 3GJFH 4F80A 2EH8L 1IGYA 4NKQB 4M1GH 1EMTH 1ZA6B 1AE6L 1R5WB 4QLRA 2X40A 4PB9H 1HZHL 3QUML 4Y4FA 5CJQL 4DKAA 4WCYL 2F58H 3P73B 4KQ3H 5ADOL 2RGSA 3TZVB 3O11B 2DM2A 2H41A 2NNAA 4KGJA 4LF3B 5CEZL 2ZUQB 1AQKH 3BZEB 5DHYB 5HHQB 3TT1H 3UTTA 2E7LA 2BNUB 2AP2A 1FVCB 1AGDB 2HMID 3JWOL 1Q38A 2R1WA 4OCRL 4ODVL 5I1JH 3BP6B 1CFNA 5GRVK 4JR9H 3ZKND 3GMOA 1RY7B 4XWOC 4M1CD 5DGQA 3VGHA 1URLA 2ZCHL 5T3XE 1OAYH 2D0HA 1BJMA 1D6EA 1AFVL 1IBGL 4LLYA 4JZNA 1HWHB 4LFHG 2ENYA 5EBGA 1B0GB 5L6YL 4OD2A 1MF2L 5EC2A 4ZSOA 4PPTA 1A5FL 1MHCB 4GMTL 3MV8B 5C08E 4KHXL 3BEWB 1W0WA 4K3JL 3WFHA 1DSFL 2IPUK 4HUWA 1HQ4B 3V7AG 5IHZA 1FBIL 4MD5A 4QF1B 3WNLA 1TJHL 1MEXL 4KRNA 2ADGA 4WW2B 1H3XA 1MELA 4L9DA 3U1SL 5FO7B 3S88L 3TWCL 3OTTA 3JWOC 2XG5A 2ICEA 4K3DL 4ZUWA 3CX5J 1IL1A 3QEQA 4ZUTA 3BP4A 4Z7WF 5EULV 5IK3B 3LMJL 1U8KA 5EU6A 3DVFA 5CCKH 5LWYL 1KCUH 4NFDA 3E6HA 2VUOA 5IHUH 4ZFZB 1FC1A 3MV9D 3EFDH 4JFEE 2EKSA 3VMNA 1KT2A 1VFBA 5D72H 2ZUYA 1ZWIA 3LN5B 4X8JA 2OSLB 2CXGA 4IRZH 2XZZA 4Q74A 5B38B 5JPMA 1JZ5A 1G7JB 4NO0D 4M5YH 2FYYA 3RWJA 5DF0A 5IB4A 3V52H 1EX0A 5HHMA 4FG6D 1WAAF 5KSBA 2ATPA 2VZSA 4Z7WA 5KOMC 4JAMB 2YK1L 4N1CA 4OBRA 1HEZA 3PL6D 1FIGL 1N6VA 4NZTL 4U1GB 2OR7A 3BKJH 3O3DB 1FH5L 5D93C 1U0QA 1I9RL 3WDHA 5FYLD 1EHLH 3HMWH 2A83A 2ZUWA 1IGCL 1A1OB 5IVZA 5E2TL 5DR5L 5CBAB 4PJHB 4RGNC 3GDBA 3QEUA 5EOTA 1NAMH 4HIHA 2BRRH 5C0NC 3DX6A 1A3RH 3UC0H 3JV6B 3FZUC 5T1KD 5I17A 3GHEL 1WAAA 3FO0L 5F1NA 4YWGH 4ZD3H 3C60C 4XNZB 1S7XB 4GAYB 4MCZA 4QO1A 3QHFL 3HI5H 2BOBB 2X41A 3STLA 4RA3A 8FABB 1M7IA 5JUEL 1FFQA 3QXTA 4F9LA 2VDKL 5T5FH 4G6AC 5HPMA 5I75B 4PV8A 4P4RB 4HMCA 4I1NB 5I0ZA 1N0LA 4C56E 1QFUH 2NW3B 3ZKXC 2A9NH 4F57L 4HD9A 5F7WC 1T66D 2ZSWA 5GJTL 4PJAE 3MJ8B 5ISZE 4JLRA 3VW3H 3PHOB 4I48B 5DURB 5C6TH 2BSTA 3OX8A 3PQYB 4HIXL 1UWEH 2ITDA 2GFBA 1KIUA 5E08H 3HUJB 5I1GH 5DHXB 3VXME 3X17A 2NXYD 3LKQA 4TUOB 3I75B 4RNRB 4XH2B 7FABH 3ULUF 2ADIA 4HEME 3MNZB 4Q9QL 4Z0BL 1S7WB 3HRZB 4LSQH 2HTKC 5D7LD 1X5AA 3QHZH 5CLWA 4F8TA 2NR6D 3SKUD 1ERNA 1ZT4B 4W4OA 5DMKB 1XGPB 2CIKB 4W6YB 1TQBC 3RGHA 1JCKA 3V8CA 4Y19A 4PLJD 1A2YA 1MFNA 1YEGH 5AAMA 1N6QH 4PG2A 4KKNA 2OI9B 4U7SA 5SWSE 1ZLSL 5F3HA 4PGDA 3CFBA 4WFGD 3RNKA 4OLZH 1DQLL 5IG7A 4JZOA 5FHBH 4U1IB 2P5EE 1B4JL 4NQSB 3MGOB 3QQ3A 1P7HL 1MCQA 1T20B 1GC1L 2Z31B 1XGUA 1XGYH 5INCB 1NBZA 2ZG3A 1KFAL 1PKQB 1OPGH 1ZGLP 4KI5F 5GGVH 1U92A 4XMPH 1FDLH 5IBLC 3IF1A 3QUXB 1SEQH 5H94B 4TVPL 1BQSA 5LGKA 4RA0C 1BZ7A 2X4QB 3O4LB 3KYMA 3MOQA 3GKZA 2FGWH 3KYNA 4GW5B 2B39A 3VD3A 5F7LB 3WCYA 2L4OA 5D7JB 1QFOA 4UQ2A 4JRXE 4KJWC 1P7QA 3BIKB 3ZSSA 1QLFB 3IU4L 5F1SA 3CFJB 3G5XA 1ORSB 4FQQB 4HIEA 1LQVA 2R9HD 4FQXA 3QXWA 5GGSY 5E4IA 4CVXB 3QUZB 3MRMB 3MZTA 2NY4D 2AEPH 2VDRL 1PZ5B 3BH8A 1BOYA 4Z7UF 3CIQA 1GC1C 2VB5A 5D7IB 2IAND 5ERWB 4JANA 5B39B 2Q76B 4P5TB 3RDTB 4YC2C 1G6RA 1MJUH 4M8QB 4XC3H 1DBJL 4FQHB 5DT1H 4NZUL 4OLXH 4XHJD 5F7MC 2XN9B 4XVTL 2X70A 1B0RB 3NVQA 1T83C 1M7XA 2BVEA 3DSFH 4JO4H 1ZA3B 3S4SA 5F3BA 1EUTA 1BBJA 5J9PA 3HAEA 3F7YB 5HYSA 4LOUC 4Z7UA 5E2WH 3CDGA 3K46A 4Z5RB 1PG7L 1JZ2A 4P46D 1YECL 2N1KA 4K7PL 3BISA 4HWZA 1D5XA 2DN7A 5TE4H 3UTZA 5GRJL 3SOBL 3KLSA 3DV4B 1XCTB 1G9MH 4Q9CA 3V0WL 1FV1B 4PJBB 2A0LC 3SGJC 3BD3A 4XTRD 1MHPH 3C8DA 4HIIB 1Q0YH 2EXYD 5FK9A 5FYKU 4M6MH 1NCWL 2C3GA 1BPVA 4PJEE 2R8SH 4BJLA 1S5IH 4JN1H 3V95A 1LEIB 1L8JA 4HKBA 1X5GA 3FO2A 4OZIE 3QDGB 1BAFH 2VO5A 2DBJA 2R23A 4HGMA 1P4BH 1CYGA 2C4XA 2E5EA 4Y5XA 4EEEA 3CLEH 3D87B 5FDWA 1CZ8H 5T5NF 3MLSL 1WLHA 4WUUB 1KN4L 4FFYH 3ARUA 4XCFL 1UT9A 3T0EA 3IDNA 4WWKA 1TCRB 4PDCE 1VEOA 4LHUA 2EDXA 2COQA 3TZVD 1H3VA 1J87A 1MJJB 4KJYA 4OUUB 5CUSL 5F89B 3Q1SH 5TE7H 4CU7A 2YWYA 1KCSH 2EYTB 3FT2A 5HI4C 1K2DB 1S7RB 1JYNA 1SM3L 2XWTA 3SQBA 4H88L 5I8CB 3UBXG 4UT7L 3INUL 3C9NA 2DJ4A 1QRNB 1X5ZA 32C2B 4AH2B 4NM8L 5EO1B 3MBEC 4KTDH 3EJYD 5EUKB 1NGXB 3HMXL 5MEPB 3KWWA 3MRPA 5C71A 4R6UA 1MI5E 3RY6A 2VN7A 4R7DA 5ESVB 2EEAA 4YX2L 4GMSL 1OF2A 4LCWE 5I76B 4M5ZH 4R3SB 1NBQA 2JK5A 2P7TA 5IEHA 5IMMA 2UYLA 4L4VB 3VWKC 1CE6A 3CX2A 1M4KA 3FMGL 1YPZF 5GS1C 1WEJL 4LP4A 3WO3B 3GJFK 4QRUA 3S35L 5ACLA 2ENSA 4QCIA 4KTEL 1X4ZA 2VDQL 4EDWL 1JGUL 3GMNB 4PLNC 1OTSD 1SJHA 5DRXA 4RRPA 3TBSB 1QLRA 2PTVA 3VXPB 4HJGB 1HHKA 3HHRB 5DI8B 2DQFB 3OB0H 1NBVL 1A22B 1D5IL 4ZFFB 2YPLB 2NY7L 1DTUA 3FB6A 3M1BB 1NCNA 3H42L 1YPZA 4DGYH 3GJEB 5HYQA 3H3PH 3QIUB 3TBYA 2PW1A 3BJLA 1CR9H 1AD9A 4PJ8D 4DOHE 2QKIB 4AG4H 4K8RL 3O3AB 5E1AA 4B41A 4J8RA 3IKCB 4R0LB 1FNAA 2EDFA 3MMEA 4E9LA 2ZNWA 3RGVB 1I9IL 4YXHH 2C7UA 1LE5B 4X6DB 4GAJH 3DXAE 4PP2B 5K9QI 5GZND 3QYCA 2JCCF 4LKCA 2L7UA 4I2XB 2NY5H 4U1HA 3BWUC 4RFNB 1EEZA 1VA9A 5F7DA 1IGIH 1LD9A 5D2NE 4XNYH 1N2RA 2OL3H 4PBXA 1IT9L 3QXAB 1MRFL 4ESKA 2J88L 3D0VB 5J13C 5IBUG 4PRNB 1ED3A 3RA7L 1UACL 2EC9U 4Y8DC 3MLRL 5BVJA 5IVXE 2YD4A 1KC5H 5SWZD 2FJGB 3Q6FA 3NABH 1QKZL 4HDIA 4H1LG 1G9EA 4TNWF 5DJXA 5L7XH 3FQRA 2YD2A 1P5VA 3LRHA 3R0NA 4JE4B 2HP4A 4V1DA 4G6FB 5C0DA 5IB3A 2JCCA 3BW9B 3OMZA 5EWIL 1ZLVH 3MRNA 1Q0XL 2ICWA 3VWJC 4K8RC 1EFQA 3MREB 2FR4A 4MLSA 2DS4A 2W0KA 5BJTB 1NGZA 3KJ6L 1XMWA 2WINB 5D70H 2OTUA 5I16A 2ZWLT 4Y16B 2AXFA 2FLRT 1ES0A 4IRJB 1A0QH 4M6OH 2EIBA 4XGZB 3EDDA 2X05A 5DURD 2RAMA 1J0YA 1OCWH 3PWVB 4EI6A 1LO5B 4R8WL 2MQ3A 3PGCA 3PQYD 3LKPA 4FQ1L 3I3BA 4EI5B 4XCCH 1T4KB 3AAZB 1JWMA 3OAZH 4PJ7B 4F9PA 1YQVH 3CFCH 1JF1B 4QHNA 3X12A 3LD8B 1WZKA 3VE0B 4YHNA 4GW1A 3WNMA 2VISB 2WSKA 1IMHC 1I75A 5CZKA 4O02L 4NO3B 4OB5H 5E1HB 4LEOA 1IM3B 4X0KA 1WK0A 3ULVE 3G5YB 3IGAB 1EXUA 3QNZA 4ONHA 4OV5A 1S5HB 5ITFA 3B6SB 1RK0B 1S7QA 4OGZA 5DTFA 3TPUE 1MAML 3S98A 4M9OA 1TZGH 4FXGA 4PTTB 4LPVA 1YEJH 4S2SA 1QBMH 3FQTB 3BH9B 4DGIL 1NCBL 4OCXL 1T2QH 2Z31D 3B43A 4Z7VF 1E4JA 1EERB 1N8ZA 1PYWB 3O45B 3OXRB 5F9AC 1PQZA 2NY0C 4U6YB 1RFDL 3BD5A 1RZ7H 5HHNA 5LGJB 1QQDA 1I3GL 2GTWA 4PRAA 1U8JA 4YXLL 3IFNL 3T04D 5ILTH 3IRPX 3P9LA 5JR1L 5T33H 1S9YB 4JZJA 3QUXD 1X4YA 4KH2A 4PJXE 4UQ3B 2OCFD 2J5LB 4FQIL 4GQ9L 4HEPG 1CGVA 4H0GA 4RISH 4UOJA 3OF6A 4C4KO 2BFVL 3O4LD 4IBLT 1T0NB 3WEXA 3CFEA 1CXLA 3EDEA 5GRWA 1Y6NR 5DRZB 4L8CA 1R3KB 3ZYZA 3D3VE 5D7JD 4K3GA 5JOFA 3DYOA 3V4UL 3L95B 1BIIA 4LLVA 4Z7VA 4HS3A 3MV9A 5GISH 3AREC 4DW2L 1A1NB 2BCKA 4BSWB 1D5BB 4I5BB 2E27L 1M6OB 1CG9A 25C8H 4IHOA 4JDTL 5ICXA 1A6AB 5MEOA 3QUZD 2DD8H 3ERYA 4ZUSA 1JFQH 2Q20A 4NO0A 3MRKA 4TULH 2DQHL 1NFKA 3VDAA 4M8VA 2EIZA 2ZJSL 5DMGD 4P5TD 1C12A 3D9AL 3U0PB 3RDTD 5DD0L 2E9WA 1Q9WA 1FFOB 5C3LD 1BEYH 4PREA 4OKDA 4WVRA 1SY6A 1EK3A 5AUMA 5F97E 2YA2A 1KB5A 3PJSA 2XN9D 1FL6A 1MQKH 4EIZC 2AXGB 3EW3B 1F00I 1T89C 1TNNA 3OXSA 3MRCB 4LHJB 2BMKA 5IHBA 4FTVE 1QFHA 1P4IH 5L2JA 1NDMB 1AO7E 1NJ9A 4ZYKA 5SWQB 4NQEE 4HCRL 5I8KL 3D39B 5E2UL 2A6IA 5BVPH 1HWGB 3QQ4A 3CZJA 4I3SL 1QVOA 4WUKH 3DYPA 3U0WL 1E4WH 3C08L 2FX9L 2J3SA 3HE6B 4LCUA 3WN5C 3WYRA 2DLEA 2HKFH 1J10A 4M48H 4Z95H 1MCJA 5TH2A 4U1LA 1ZV5A 4XVUD 1U3ZA 3C6LC 3QDGD 3T4AB 2FX8H 5EO0B 1K8IA 4Z77B 4LLQA 4YFLF 4FQ2L 1FG9C 2GTZB 1HKLH 3LS4L 2NY6C 3WV0A 1NCUA 5EZOL 3OKMA 4X5XB 2FB4H 4HFUH 4QOKE 4FN0A 4X4XA 1YJDL 4WUUD 1EHAA 5C2BL 2IPTL 4KZEL 4NO5B 3PWPE 2FHFA 2IALB 5D7LA 1RZKH 2WIIB 3GSUA 1QLEH 2DQEH 1PVHA 3LEXA 1HK6A 4EN3B 5GJSH 3E2HA 4Y2DB 3FONA 1QA9A 3V0VA 4M1DH 1I7ZB 4MQXD 4O58L 2ESVE 4X6CB 1TITA 1QRND 4ZPTA 4OF7A 4M00A 5ID1A 1HCVA 2QSCH 1AC0A 3SDXE 1UCTA 4PJ5E 5DJYB 2FIKB 4X4YB 5IESL 4P3CL 4P5MA 3LDBB 2YHGA 1UQSB 3ULSA 4XBPA 3X14A 3SDDB 3L3HB 1F42A 2R0ZL 5IMOB 1AQDA 5IWLC 1M7DA 4PJFE 5DMIH 7CGTA 1MLCB 5C86A 4M7LT 2EDQA 3NA9H 4L8SA 4NQDE 3U0TA 4HQQL 1YJDC 3CLFL 1EPFA 2PXYB 4KK8C 5I73C 1EEUA 3VGAB 1I8IB 3HC3H 4TUKL 1A7OL 3U82B 5CJ5A 2Z35B 4ODHL 2I9TB 4OM1H 2ICWI 3G6JF 4CADB 4DQOH 2PYEE 3WXVL 1U8MA 3WS3A 4P2OB 5SX5H 4HK0B 2DQCH 1KTDA 3O3UN 3OQ3B 5FECB 5IM7A 1OW0C 3BZ4B 2YPLD 1X5XA 1FCGA 1HHIA 5JDSA 5D7KD 5F6HJ 3V6OA 3QIUD 1WFTA 4HC1A 4L4TB 1CQYA 3PNWA 5EA0L 5DHVB 2IANA 3MV7E 3MLYL 4QXTA 1L4IA 3H9SE 15C8H 1GJIA 3C6SA 4HIJB 3G6JA 2WBJB 3TCXA 3VFSA 4X6FB 3KS0H 3GI9L 1YN6B 1FRGH 3RGVD 2R4SH 4IJ3C 2LTQC 4WI6A 3SE4A 1QSED 2DTML 5CSZA 4ELMF 2VQUA 1T3FB 1X7QA 2ZKHL 3LKRB 3REWB 2WUCL 4K2UH 1IGFH 2HA1A 1TETH 5AZ2L 3C5JA 1JNLH 1F58L 2BVPB 2OJEB 2RFXA 4UNVA 4UV4H 2QQLH 5AYUH 2EDEA 3SBWC 1KLUA 4P46A 4Z78B 2Z4QA 4AM0A 5D5ME 1CFQA 3E6FA 4Z7OF 1VGKB 3GK8L 4YDIL 4XNQB 3UCRA 5J7CC 5AZEL 5L8JB 3FHAA 2DQGH 2Q87A 5DSCB 4YIQA 5IQ7L 2W65A 2WAHA 4ELMA 2IBZX 3FOLB 3OB0K 4G6FD 1FN4A 1TZIB 5GGTH 4N0UA 4R97B 2HG5A 2OXGA 5H35A 2VXQH 3OAYH 4N8CH 5C0JA 1BLNB 3SGEH 4HUVB 3MACL 5KS9F 3Q0HA 1SJEB 2MQCA 1CCZA 4U0QB 4Y16D 3L3JA 3OZ9L 4IRJD 1HDMA 2HT2D 1DJSA 1H3PL 1P7KA 4L9LB 4Q97A 3PWJB 3RWIB 2XI9A 3RUGE 5I71B 1ZA6A 2XKNB 4U1JA 1R5WA 4G8IB 4J3OC 2VZOA 2RCSL 2FHCA 3P73A 1FZJA 3TZVA 3O11A 3ZE2F 5MI0C 4OUOA 3CMOL 1N7ML 4EI5D 4QWWC 5DA4A 4S0UC 3VFUA 3BZEA 5DHYA 5E5UB 3VG0H 3S3JA 3TNNB 1FVCA 1F2XK 2VOTA 4LIQE 3HG1E 3CZFB 2EO1A 5IT2L 1DANT 1DL7H 4CVWA 1MCHA 2DYPB 2ZZUT 3BP6A 4QXWA 1YEHH 1LP9E 2P48B 1XR8A 4JGUA 2DKMA 1RJYB 4YQXL 4RBPK 3RVVC 5L0QB 3U4BH 2F54E 4JFEB 2F74B 1WWCA 4KHTH 1DUYB 4GKNB 1DEEB 3MOAL 4HBCL 5B3NA 2CR6A 5CGTA 5ACMA 4TSAL 1R3JB 1B0GA 4QRPA 1NCAH 1V05A 4S1DD 2VDPL 1UB5B 5J3HC 3GHBH 1MHCA 4OGAD 5HGBB 4DWHA 1JN6A 3BEWA 3FB7A 2AAVA 1KXVC 1AC6A 4QF1A 1KEGL 1RMFL 35C8L 3E8UH 4WW2A 4FHBD 2FBJL 5FO7A 3RWCA 3KPRE 4X7EC 1MCOL 3WJLA 3P0YH 3LEYH 3NCMA 2YPVH 3U9PL 5B4MC 5IK3A 3MUHL 3EKCA 1JVKA 3DETC 2WQRA 1XZ0B 5FYKE 1GGCL 4G6JL 5F96H 4YHPB 3NN8B 3DX9B 4J4PD 2VR4A 4PJ8A 2FWOB 1A6UH 1C1EL 3BRGC 3P0VH 1FO0L 4C55A 5D2LF 2BSSB 2CR3A 3LN5A 4KK5C 5B38A 5BV7L 1L7IL 2D7OA 3BKCH 3MPCA 2IAMB 3MNWB 4ODTH 4POZD 1QBLL 3EHBD 3SDAC 4HPYL 2OX5A 2Y36H 4KTYA 1IKFL 5CKGA 4U1SB 3AM8C 1YMHA 1PJ9A 1P84J 3IVKB 3GKWH 4JAMA 2R39A 4LLUB 1U3HB 2A1WL 2VXSL 4FQJL 4YFLI 4JPWH 4AEEA 5ISZB 5DJZA 2X1QA 3K74B 2YXFA 1JMXA 2KDGA 4M43H 4AEHH 3RVUD 5D2LA 5SWZA 5K9QG 1A1OA 4JGMA 4F7EB 2Y06H 1M05B 2R2HB 3KJ4C 4PTUB 1MWAH 3MXWL 3RVTC 4NNXB 3JV6A 5E2VL 1YEKL 1WCQA 2PW2A 4GAYA 2QQNH 3D39D 3HUJF 2YSSA 8FABA 1WBXB 4G9DA 2VDNH 1DUZB 4YHZH 4LQ1A 2KPNA 2DRUA 5SWSB 5BV7C 4HBQA 3QB7C 3HE6D 1CD8A 4WU5B 3BP5B 1RIHL 4P4RA 1OSZB 4FABL 1H9VA 2P5EB 4L5FL 1ZVSB 2NW3A 3SO3C 1WZMA 3HZKB 4OLVH 1GZPB 3P4OA 3FFDA 4ZS7L 3RJQB 2QBWA 3PHOA 4I48A 3AVEA 3TNMB 4X6BB 1JGVL 3PQYA 2BC4B 2XRAL 5JHLL 1QHPA 5DUBB 2X1PA 3HUJA 4F7TA 1C7SA 2JJWA 4TUOA 4XH2A 3I75A 4JRYE 3B2UC 3MNZA 3UPRB 3HRZA 1INEL 3FQNA 4KWUA 2R0KH 3KNBB 3QPXL 1CLZL 3VFGH 1U95B 4J3UA 4POUB 4M7KH 4P2YA 2YEZA 4U05A 5DD3H 4EN3D 3MCG1 2ED7A 1XGPA 2CIKA 2BOCB 3T2NL 3BQUC 4Y2DD 5JXAH 4QRRA 4OF8A 5I1EL 4JRXB 1EAPB 2AQ3A 1FL3B 1D5ZB 1YY9C 2OI9A 3TCLB 1P1ZA 1CICB 1RJLB 2EDYA 3HLAA 1CDGA 4EOWL 2QEJA 4U1IA 5L8KB 3QDME 1X6NA 4NQSA 1EBPA 2HLFD 1U2HA 3MGOA 4P2RB 4G8GB 1SEBB 3L5XH 2XTJC 1T20A 5GS0L 3SDDD 2APTA 2I24N 4LU5H 3RZCA 3C2SA 4UDUB 1KCLA 1PKQA 3LCYA 2QHRH 1S7UA 3HNVL 3QUXA 3SGJA 4IDJH 5D1XC 1VB9A 1YNTA 5FM8A 2PXYD 4KROB 3ZHLA 3S4SG 4IIQA 3L9RB 5D7IF 2JB5L 3G9VA 2D7NA 3HAEG 3O4LA 5HYSG 3TGXA 3AGVA 4J1UB 1BWWA 1LO0L 4GW5A 4NZRL 2CKBL 4RDQF 5DJ6B 4P9ML 3VH8A 4UINL 5D7JA 3GUTB 2MCPL 3UXFA 4NWUL 3NACH 4M6NL 4P2OD 4DTGH 5D1QA 2FSEA 2IMNA 3W39B 3BIKA 1QLFA 3BPOB 4OF3A 2V9QA 1X5JA 1ORSA 1A7PH 4FQQA 3TV3H 4QHKJ 3CVIH 3KR3L 3AFLA 4XX1G 5L2KA 4OAWB 1U9KA 2O5YL 4U3XA 5E6ZA 1PZ5A 4L4TD 5EZLB 4PJEB 3N9GH 1A1MA 4PRDB 5D7IA 5GS0C 1JWSB 2Q76A 4GLRI 4HKXB 5IFHH 2YS4A 4OZIB 2UVFA 3PP4H 2WBJD 2YD7A 3I84A 5J11B 3MLVH 5C0BE 3P30L 4FQHA 3V5HB 2AV1B 2H1PL 1LVEA 2XN9A 3O3BA 1C7TA 3IS0X 1MH5B 3QH3B 4LHUG 4R4FL 4XBEL 4J3WA 4OGXL 1B0RA 2D7TL 2IH1A 4F15C 2A73A 2IQ9H 1JWUB 5CZVH 4JKMA 4JFYB 1JL8A 1I8MB 1ZA3A 4XCNB 3P4MB 2FRGP 2HJFB 3LHPL 4G5ZL 4JPKL 4WY7L 4Z5RA 5B3JE 2X44D 4DVBB 4KQ4L 3BUYA 4LCCB 2KQMA 2GJJA 4NNPL 1XCTA 3LSOB 1EGJL 5T5NG 8CGTA 1ACYH 4UNUA 4DAGH 4HIIA 5JNYB 4XHQA 4CN4A 1BQLL 3TH3T 4ZUVB 1KELL 3GRWL 4OCWL 3QI9C 3FN0L 1LEIA 1DE4B 1MI5B 5ITBH 4S1RL 1OP9A 4KVCH 3MRBB 43CAB 5AG8A 5T3XD 3QFJE 4XXDB 1RZJH 3SE3C 5HI5D 4WDIB 3LQZB 4Z76B 2KL6A 1GSMA 3HMXA 4JO2L 4WUUA 2DWEB 2VXUH 4O51B 1TCRA 4CN1A 4NO2A 1HSBA 2DQIH 2HVKA 3OR6B 1YEFL 1MJJA 4DZ8B 5F89A 4LEXL 4RRPG 5K9KB 4Z8FH 1XF1A 1FLTX 4NHUE 3JBG7 5AD0B 4P59H 1K2DA 4RGOL 2LFGA 2OXHA 4LGRB 3CH1B 1QRNA 4XPAL 1CF8H 32C2A 4OD1L 4Q6IC 1TVHB 5GRZA 4AH2A 2DYPD 5C0EB 3ILPB 5M94B 3S6CA 3TBTB 2XY1A 3O6FB 4BELD 5CKAA 3MLWH 1NGXA 3I6LE 5MEPA 4TTDC 5ESVA 1NLDL 1FGVH 4JFED 2E8YA 2J2ZA 5DD6B 1JF6A 4DOHB 4U6VL 3IB4A 5I76A 1SHMA 4R3SA 3HFMH 4QGYA 5IROC 3EFFA 2PO6B 1BD2E 4LSVH 4YDVB 1AHWC 5K9JH 3B9DA 4N0CD 5A2FA 2VE6A 3DXAB 4U6TA 4P4KB 5ETUB 2Y6SD 5DD5L 4AEIH 5TE6L 5E6IB 5DHVH 1YZZA 1NMAH 3FT4B 1IC5L 5FO9B 5T1MA 2QQKH 3GMNA 1DR9A 1NFDE 3UTSE 1S7TB 3L3KB 1TENA 3TBSA 3HKFA 3VXPA 2N56A 4HJGA 1XF5B 4XP4H 2XXCB 3GEWB 1DQML 5GSRB 3O2VH 3V6FA 1DQDL 2IFFH 4KJPD 4ZFFA 3Q2CA 3M1BA 4P2QE 4S10A 3GJEA 3QIBC 3QIUA 1H8OA 1A14H 3MJ6A 1U8HB 2J4WH 1N3NA 1OLZA 3QO0A 4Y5YC 1I1CA 3MBEB 5FOBB 2W92A 3QP3A 4KKBD 4CVZB 4U6XB 4UTBH 1OAUH 4BSJA 4BZ2L 3BGMB 4BK5A 3O3AA 3WFEH 3IKCA 1EEQA 4R0LA 2V9TA 3RGVA 2Z91B 5C0AE 1LE5A 2IAMD 5EZJB 1QSEA 3OAUH 2C1OB 1VGEL 4KAQL 4PP2A 3RIAF 3SGDI 2OJZH 4YAQB 4K07A 3EJZC 3LOWA 3TEUA 4C56D 2VMFA 1CDJA 2VAAB 4UV7H 1HNGA 1U3HD 5BRZA 2P8MB 2P24B 4FNLH 3MA7A 3OKLA 4MVBD 4OCYH 3I6GA 3QXAA 5ISZD 3E3QE 2AJZA 3D0VA 5D96C 3S37X 4PRNA 5D1ZC 2WW8A 4BUHA 3RAJH 3MUJA 5T3XH 5HHVL 2AJVH 4MA1B 3VMOA 3U30B 1H5BC 2QR0A 2X4SB 2ZCKH 4WO4B 4PS4L 3BOVA 1TJGL 3JVGA 5L9DH 1SYSA 4WEMB 3BW9A 3K1DA 4ZOEA 1A8JH 1T7WA 5DLMH 5LAXA 3SCMC 4ONFH 4URTB 2Q8AL 3MREA 2BY3A 1T2XA 2YOCA 3O6KL 5BJTA 5SWSD 1NCDL 1Z2KA 3WHE0 2WINA 3WBDA 1AJ7H 1A7RL 3BPLC 4HF5H 1D9KC 5EOCL 3TPUB 1RZ8A 3ARGC 2IG2H 4ZQKA 4AL8H 4Y16A 5JORA 2P5ED 4IRJA 1NMBH 1F4AA 3O6LL 1JNNL 4E42A 2J6EH 1H3WM 2O61A 2F8XC 1YYMH 3RIAK 1NDGB 2X9WA 2F15A 1CTNA 1LO5A 4H0HB 3BE1L 4HG4J 3W0WE 1OAKH 5K33A 3RL1B 1T4KA 3CH8A