3KPLA

Crystal structure of hla b*4402 in complex with eeylqafty a self peptide from the abcd3 protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
total genus 73
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kplA01
2DQDH 4QRUB 1MCSA 4LDOB 1DQQB 1Z5LA 2GSGB 2LFGA 4WJ5B 5MEQB 3WNKA 3WEXA 2ZOKA 3DGGB 4PJXF 1IT9L 1OAYH 5MENB 3SE8H 1CR9L 4PY8I 2A1WL 3QDGB 5DQDL 4OFPA 3PQYB 4YHLH 5DHVH 3BZ4B 1HKFA 4MQ7A 3L6FB 2IQ9L 3L7FA 3RWCB 3BKJH 4HQQL 4P9MH 3W39A 1AIFB 4WWKA 1BECA 3CNKA 2KL6A 4PY7A 3U2SB 4S1DD 1JRHH 4JQVC 3SPVB 4U1GB 3NCJL 4LF3B 1F5WA 1NDGA 2AQ3A 3C9NB 5FGCB 4M9OA 4AL8L 1A0QH 1NFDF 1FVEB 2L7JA 4WO4A 4OZIA 4LHUG 4Q6IB 3MREB 1XF4A 5EUOE 3A6CL 1W72L 2KPNA 1ES0A 5DK3A 1YUHA 5L8KB 4CMHB 4QWWC 1IC5H 1A0QL 3KPPA 4PS4L 5MP6L 2Q6WA 2Y07H 4KKCC 1UH4A 4B7IA 4LIQE 1KB5H 5I1GH 1ZWIA 4KQ3H 3OKEB 3X12A 1T4KA 3HNTH 2QHRL 4GBXA 4XWOD 5T3ZL 2A83A 2A1WH 4GG8B 3GBMH 3RUGE 1UM4H 3MRJB 1QLFB 5INCA 5GRYA 4LRNL 4U3CA 3ZDXE 4NNPH 3T4AB 1BZ7A 1WCBA 3L3KB 1K4DB 5ESVB 4FABH 1AO7E 5DUPL 5FOBB 1R3LB 3UPAA 5I76A 4L4VD 3LOWA 2NY1D 1NQBA 3D0VB 3NIFE 2OCFD 4WGVB 3DMMD 2XV6B 5DVNA 1KIUA 5EPMA 4XNYL 3P77A 5LGHL 4I18B 5C0BA 2OI9B 4NKIH 1RK0A 4X5WB 1EEYA 1K2DB 5EB9A 1VKXB 4EBQL 3QXAB 4G8GD 5FB8A 5C0DB 1FYTA 3QB7C 2HJLB 4KVCH 4LBEA 2GTWA 3IDMB 4PLJD 1X5JA 4M48H 3S8WA 5D8JH 3N85H 3SO3B 5AZ2H 4YC2C 2V5MA 2CR6A 1YQVL 3MCLL 4I3RL 4QNPF 5BO1H 2CH8A 3CMOH 3QXDA 1CLOL 2VXSH 2VLKE 1DQTA 3DUUA 3ZHDA 1NDMA 5MENE 1RMFH 2V6HA 1HZHH 3TBWB 1NC4B 5F72S 1TQCB 2MCG1 2EIZA 4MAYD 4QF1A 4OGXL 2PTTA 1J12A 4PJ8B 1QRKA 1MCQA 4FQCH 1E6JL 3FFCE 3JTTB 4R4FH 2YD4A 4JVPA 1XGPA 1NCWL 2EE9A 1U58B 3M8OH 3OG4B 5LGJB 1S9VA 4PJIE 1NLBH 4MQXD 3WKNA 5GRUH 1F6AB 1MFCL 2CJUL 4G7YL 4ELKA 5KTEH 1TJIH 2R0WH 3ALWA 4N0UA 1ACYH 2VZTA 2KBGA 5DHYB 1E28A 4ZXBB 2H3NB 3O2VL 3P4NA 2OL3A 4BZ2H 4M3JA 2E9IA 1GHFH 5GZND 3KWWB 2D7TH 1FJ1A 2Z8RA 3RL1B 3IDIA 1EHLL 3X14B 5I1AB 3MLVL 1XIWB 4GUPB 2V5SA 1J1OL 4M43L 4NQEB 4LDEB 2GUOB 4KK6D 2AJUH 3RVVC 4QXWA 1G7PB 5C9JA 4FNLH 5D2LA 5L2JA 5I19H 1NBQA 5DEFB 3S4SG 5BRZD 2R1WA 5E2UL 1BD2B 4WUUB 4QGTA 2R23B 4N8VB 1CFBA 1W72A 1UGNA 1G7JB 4UI2A 4YNYB 4DKEH 3KYNB 1H8OA 2P43B 3OF6D 4HJGB 3OPZL 3S3PA 3D9AH 1T6VN 3P9WB 4XXCC 1MF2L 3OR7A 4BFIB 1Z2KA 5J7CC 4CU6A 3O4OC 4MS8D 1F4XL 4YHIB 1BVLA 1G7IB 1NEUA 4R97B 5F6HJ 2YKLH 3QFJE 4PRNB 1J5OL 4IIQC 3T3ME 2QSVA 1NMCC 3ARBB 4Z7VE 3UC0H 4DTGH 4WHDA 4RWYH 5SWZD 1PFCA 4AEIL 1MFAL 2EEAA 2H32A 3RP1A 4TOYH 4GKSB 3RGHA 3V52H 1G7LA 4MJ4A 4JFDA 5IMOB 5DFTA 4MXQA 3VXUE 4NQEE 1BF2A 3B9KB 3SE4C 3VA2C 3IDXH 2JIXA 4X9HA 3VDAA 3NBNA 5C6TL 2AJZB 3LIZL 1WBZB 3LEYL 2XQYG 3OJDB 1I8MB 5KANI 4MXVF 3HC0B 5T3ZE 4MXQD 4N5UA 4N5EC 1JYXA 5CCKL 5DC4B 5I15L 2WWMD 1GGIH 5EOCL 4HGKC 1SY6A 1QHOA 2CIKB 4PY7B 2GSIA 1ADQL 4WFFE 2BMKA 3QJFB 3H9SE 1HSAB 1MIEH 3KYAA 1OW0C 4LPTA 4F7PB 4OV5B 3GIVA 3WDIA 1L4IA 1I7TB 5A1AA 4Y19A 3D2UB 1YNTA 3PL6D 4WI2A 2V5RA 4U1IB 1A6VH 3RBGA 2PW1A 5CJ8A 3KPNA 4LSRL 1FN4B 2XTJB 1CE6A 1MHEB 1GAFH 1LHZA 4EN3C 5D7IE 5AUMB 3HRZB 4MJ2A 1N0XH 4KPHH 5I1LA 1LO5A 3AROA 5FUZH 3C8DA 5GS0C 1XCTB 1LP9B 1TZIB 1AR1D 1FGVH 1ZS8B 1AFVL 1NAMH 4MZ2A 3RPIA 1S7QA 2PYFB 3EO1A 1NKRA 1AP2B 2MQ3A 4MJ6B 5DJ6B 4FFYL 4K55A 4BQ8A 4Q9RL 5T1KD 1FIEA 3V0VA 1RK1B 4KMTL 3PWLB 4N0YL 3BH8A 4GBXD 1GGBL 4N68A 4IOIB 3O0RH 4WI6A 3ES6B 1UXWA 5I15H 3HPLB 2LU4A 4LSQH 3Q0HA 3MLTB 1DVFB 3G6DH 5F93C 1Z0MA 5ADOH 4H1LH 2GTWB 3BMVA 3IDMA 3RZCD 4K3JL 2D7OA 4WW1A 3ESUF 3DUSB 4V1DA 4JRYA 2NW3A 3BP6B 5E00A 3ZE1F 4JE4B 2F8VA 4RNRA 2F5AH 5SX5K 2P8PB 2VXVH 5KN5B 4GQ9L 5GIRA 3E6HA 1P7QB 4OD3L 4D9LL 4JFYA 4NDMB 1EGJH 4XP9H 3EIFA 4WI5A 4F7MB 4G9DB 4NCC2 3STLB 2GYSA 2AW2A 3RA7H 3D39B 1R5VB 2A6JA 3BPCB 3OKYA 4NRYA 1NFDA 4OZIF 2BNQB 4O58L 2A38A 5I30H 4FQ2H 3MLUH 2HVKB 4O2CA 1NMAL 3U9PH 1R3JB 1S7VB 3PNWA 4HFWB 4EUPB 2W9EH 3QJHA 1ODAA 4TUKH 1NAMA 1T1ZA 1WFOA 2WBJD 4IOSD 5IFHH 3RU8H 3H9HA 1F11A 5C7XH 4KK5D 5I9QB 1MUJA 1UKTA 5HYFA 1ZSDB 1ULVA 2BNUA 3EJJX 4Y5VA 3U7YH 5IBTH 3FT4B 3TYFB 1J18A 3KLHD 5BQ7B 1UH3A 3VFOA 4PJHE 1HYSC 2BFVH 3QUXC 2YPKB 2D9CA 2F19H 3MRHA 1AGBA 5JUEL 1ZTXL 3O8XB 3OAYH 5KN5A 1RZ7H 3S97C 4NZUH 3IVKA 1B0RA 3KGRA 4P2RA 5D7KD 2HLFD 4K9EC 4UTBL 5KSBA 3IXAB 5DQ9B 4B7LA 3VA6A 3TH4T 1F4AA 3BP5B 1L9MA 3VJ6B 1EJOH 3OXRA 2R1WB 4P4KB 5GGSB 3VWKC 4NN5B 3RJQB 2BVEA 4NQUA 1P6AB 5C0ND 3TC9A 3DVFA 5SWZE 1FL6A 1NGQL 4O2FB 4KVNH 1CDYA 3WS3B 3WE6A 3F58L 4OAWA 3IFPB 1YYMH 3TO2B 2CKBH 4NO3B 4BFGA 1PEWA 4ZUTA 4KFZC 5TQ0L 1QLRB 5TQ0H 4RAUB 1KGCE 4UV4L 3DYPA 4LHUA 3D69A 3HUJA 5IW6A 1XCQA 4U6VH 3MROB 4MCZA 4APQC 4LSUL 5L88H 4P59H 1T89C 2IALA 5D2LF 5DC0A 1ITCA 3HR5B 2Q6WB 4N8VG 3GMPA 1FC2D 4YDKH 5I30L 1A7OH 4UTBH 3ARFD 4DFHA 3N9GH 2F5BL 1N5YH 1F3RB 1UWXK 1RZ7L 4MB5A 5GS0H 5HYQA 4NQCB 3VXSA 5E1AB 5HGBA 4I4WA 1G7LB 1R3KA 4PBWD 3CMOL 4U1HA 4JO2H 1TTFA 5D7LD 3GBNL 3MUZ1 3GHBH 4JHWH 3K2MC 4K9EH 4N0CC 4XCCH 1E4XL 3MBEB 5K59F 3DWTA 4MD0B 3A67H 1TVDA 3F7YB 1JGVH 4GQ9H 2AK1L 5K9QI 2XQYK 4JANA 3N0PB 4PY8J 3T0EE 3VGHA 3IFPA 2CIKA 2ZG2A 4R2GB 2YWZA 4OSUL 3GSQB 3U9PL 1KTLA 2QSCL 2EDBA 4UT7L 2NXYD 5EU3A 2DWDB 3CVIH 3LKSA 4F3FB 1KCUL 5D5MB 4IIQB 5BXFA 2Q8BH 2Q86A 3Q3GA 5DHXB 1E4KC 4FABL 1QSZA 4XNUH 4N1CA 4QKXB 4X5LA 4XMLL 1R0AH 5DRZA 3E6FB 4BZYA 2DBLH 4YUEL 5E8NA 3RX5A 4PBXA 5ALBL 5IF0B 4PD4J 3IDGB 2HKHH 2NY4D 2K9UA 5F1IB 1RU9L 2VC2H 4XVSH 5TF0A 1R24A 1JYVA 3FO1B 4GBXC 2F15A 1T0NB 3ARGB 2YD8A 1Q9KA 2A77L 3MLYH 1Q9LB 3BI9X 3FRUB 5JHDE 4LU5L 1AQKH 2O61B 3JTTA 1LDSA 3WXVL 2DYPD 5FGBA 1DVFD 3MJ8B 4MMZC 1NCTA 2MMXA 4NN6B 5BVJA 1I9RL 3QXUA 1BF8A 4AL8H 4Q97A 5T1MA 4N0UB 1BLNA 4RFOL 3WLBA 1TTGA 3TBTA 2AV1B 5EBMB 3QWQB 4MDIA 1T83A 4MA3B 5I1IH 5FECB 1MH5B 4JN1L 3MMEA 1UM6H 5IM7A 1CK0H 1I8KA 4LPWA 2LV4A 4HPOH 2XZCH 2VLRB 4OZGA 3L3IA 2DMKA 4L8SA 3ARFB 3O2DA 5CJQL 5C0DA 1TXKA 3E3QA 3HB3D 4GAFB 1GGCH 2GITA 2IFGA 2X1QA 3C09C 3SDAC 4U1LB 1IFHL 4OCYH 1BD2A 4WUUA 4YX2L 1C5DB 1XGUB 2JJVA 5CLTA 4F7MA 1ZGLM 4IRZL 4F2MB 1F6LL 3EYOB 3B9DA 3BQUA 3PWJB 3V9FA 4LPUA 2YSSA 3C5SA 1JZ6A 3MV7D 1EBPA 1Z6JT 4ZO7A 1A6UL 2DJ4A 2YD6A 5B4MC 1JNLH 1NLDH 2HA1A 1V8HA 4OLUH 1Q72L 2Q20A 1ADQH 3STZA 3I6KA 1H3XA 1A2YB 5KSAA 1HSBB 3Q6FA 3BQUD 5FV2A 4P3DB 1BLNB 2WUCL 4I2XE 2JJUA 1MFDL 2R2HB 3UCRA 1JFMA 43CAA 3FHQA 3U0PB 2HT2C 2XKSA 4KJQD 1MQKH 2R4SH 4EOWH 2NR6C 2EDDA 7FABH 1NGWB 4M02A 1ZWIB 3K0WA 4M5ZL 1DBJH 3RGVB 1KJ3L 1EEZB 5J1AA 4QGYA 3NCBB 3RUGF 5DJCA 2CMRH 4K94L 2IF7A 3OPZH 1PW3A 3W5NA 3T8XA 4JFDB 1QLFA 4PLKD 5INCB 4B0MM 1TLKA 1TFHA 5TF1L 4LEOB 5CGYD 1Q94A 3PF2A 5I19L 3OXRB 3EOBB 2BP3A 3P30H 4ZSOB 5HHNA 5I75C 5EC1B 3CU1A 5GPRA 3O4LB 4H0HB 4PJIF 5IQ9A 1OAXL 3MRKB 4YHKH 1GC1H 1D5MB 4M43H 4XP1H 3F5WB 2NY4B 5FM5M 4MHHG 4U0RC 3T2NH 4ZXBC 2PR4L 1EHLH 3IKKA 1T03H 3EJYC 3QDGE 4EI6A 4G6AD 4RIRB 4N0FA 1ETZB 1UACL 4U1IA 1GGYA 4LLQA 5I17B 4H8WH 3G5ZA 1I9IL 4WHCA 3U0PA 2FL5B 2IG2L 5IBUB 1H8SA 3FRPG 3IU4H 3D85B 3DETC 2AXJA 2Z91A 4XP4H 5D1QC 3MV9A 4QRRB 4I48A 4EXPX 1KENL 4OLEA 4PJDB 1S7WA 5DJ2A 4G6ML 4W6YB 4Y1AB 3MRDB 4HC1H 4UNUA 5CBEA 1XIWD 1U8OA 4PGCB 3EDDA 2I26N 3F6IA 4IMKA 4PJBA 2P5WB 1LO3H 2BRRH 4L9LC 4ODXB 2FEDC 3SDYH 3BESR 3MUGA 4CMMA 1LD9A 3BDYH 1RIHH 1UJTA 4MD0A 1XGPB 4PJXE 4MQTB 4R4BB 5GJSH 4ZXBD 3GM8A 2CUHA 1MFEH 3ZKXB 2ITCA 3CDYA 3VMNA 1CD1B 1U3HC 4XBPA 5KTEL 4PRDA 5AZ2L 2SEBB 3D3VE 3U1SH 3ES6A 3L5WB 2AI0H 2DB8A 3MC0A 5E1HB 2VERN 1OSPH 5CWSB 4EI6B 1Z9MA 4JRXD 3VWJC 2B4CL 4OTXH 4HS8L 1IL1A 3MQIA 3P30L 1H3VA 1T0PB 1S7SA 1YY8A 4N9GB 1D9KA 4HUKB 4OGXH 2OJEA 5T5NF 3T0BA 1CZ8H 3QUKA 4U6YB 4U6XB 1WEJL 3MV9B 2DLHA 2ADFH 1N8ZB 3VFPA 4H1LB 4YLQT 3FTGB 1Z9SA 4RGOH 4PJAF 3OKOB 1DBJL 4KI5E 4NFBA 2AEPH 2EH7L 3PXJA 4G9DA 5C0FA 4WTZA 3O3EB 1SYVA 1P7HL 1KPUB 1JPFA 2W92A 1UM4L 3VD4A 2YZ1A 3B3IB 3DVNA 3IU3B 2EXYD 2IH3A 3RDTA 3MV8E 15C8L 3C5JA 5AUMA 2VTFA 4ZG1A 4O2CB 3R0NA 3MOAL 2VLRD 2CRZA 3PJSA 5C0GA 3GDBA 1CK0L 3QA3A 4ZNCD 2JB6A 1PSKH 1EEYB 1FBIH 4GAGH 4HT1L 3SKNB 4X9GA 3BSZH 2C1PB 2CO7B 4ONFH 1OT1A 3TN0B 1KTRL 4WI8A 1MRDL 4P9HC 5C0EB 5DURD 3QIUC 5DFVC 5EZOH 4JZJC 2JELH 2XTJE 4YXLH 3VXOA 3W81A 3OKKA 3WJJA 4AIOA 3AS3A 1C12A 3AC0A 1FAIL 1J10A 1QRND 5CZXD 1FVDB 3NIGE 2HTLC 3HNTL 4KRPB 3H6JA 2FGWH 3C2SA 4LCWE 3LH2H 5E5MA 4ORGA 1PLGH 4OI8A 1AH1A 4FTVE 3DX9A 1F6FB 3QG7L 3F12A 5HGAB 2P5ED 3BISA 4W6WB 4DOHB 1BJ1H 1A7RL 2UWEB 5EO0A 1C7TA 3KS0H 3HUJE 5HHMD 1VGEL 1WAAA 1TVHB 3EYQC 3G04B 1HH6A 3CMGA 3HZYA 1NCBL 4X5XB 1T80A 4LIQL 4HIXH 1J0YA 1F58H 3ZYJA 3VD3A 5EG6C 3KYMA 2IALB 4NFDA 5CJOH 4NJ9H 1OARH 3EJZC 4OD2A 3TO4A 5DHVB 5D6DC 2RIKA 4FQHA 3SJVD 5EDXA 1KEMH 5JOEA 1W0VA 4G6JL 3SDXE 3TF7A 4ODVL 3ARWA 4UV7L 5DD6B 1KJMB 1WC7A 5FHBL 2DBLL 4YUEH 1R3KB 2IAMC 5C07D 3C60A 2VISB 1YEIL 1WFTA 3NPZB 4MGXA 5C9JB 3GHBL 4JHWL 4Z6AT 5BQ7A 2ZP0T 4QY8A 1NUFA 2X4PB 5E8DL 3T1FA 3FO2B 5GGRB 2ORBL 5TPWL 3B43A 1JFQH 4E9LA 3INUH 5I8CB 1DSFL 1N5YL 1JNJA 4XC3H 4WTXA 3QWRD 3CFIC 4WHYG 3ZKQD 4C4KT 4FXLA 3V5DB 1QFPA 5MI0B 3U2SA 2EDQA 2VL5A 4OSUH 4LLDA 4NO2B 4UDTA 3O9WD 4MNHA 3VXPB 4OCSL 1YEGL 4Y4FB 2ED7A 2Y06H 3PIQB 1HWGB 2AK1H 3B8YA 3WFZA 1GPOH 1F4YH 1RV6X 1MCBA 1XF4B 3QWRA 1KF9B 1N7ML 4PBVC 1VA9A 4O2FA 3HCVB 4UV4H 2V9TA 4KK6C 1BZ9A 2NY3B 4NO3A 4OCLC 1R3IH 4JB9H 4LNRA 1VFAB 3QI9A 1IEAA 4CW1A 2FIKB 1HEZB 1OP5H 1R5WB 4ZOAA 5E5RB 1L7IL 4GS7C 4NWUL 4DUVA 4HLZG 1R6VA 5D7KE 1RIHL 5IW6B 3BIKB 3N9GL 5ACZB 4KKLD 1HOCB 2FB4H 4Z7WB 2D4DA 3DV4A 4E5XA 4L8CA 4PG9A 3HG1D 3VDCA 2O61A 3I75A 3DXAA 1G1YA 5MHSD 3MUY1 1J9CT 4LSUH 4PJGF 4YEEA 4LLUA 1Z9LA 1I8MA 3BT2H 1ZHLA 4FQIH 1Q9OB 1BQLH 2VWEC 4XNQA 5IMMA 2UWEF 2DLFH 5D70H 3WKML 1XGYL 3HE7A 4Y16D 5CHNB 1KCLA 4NO5B 3VFWB 4F7EB 4NZTH 2C1OA 2Y6SD 3EYSH 3L5WA 3MBEA 2YD5A 2EIDA 2BSSB 5IW3A 5C08A 4PJ9D 3O6LL 4H26A 4I13B 5GSRB 1AQDA 1RZGA 4CU8A 1JGEB 1SEBB 5D1XC 3ZDYF 3EBAA 3DXAE 4BFBD 5GS2D 5IFAH 3RY6C 4O58H 5CEXA 2FJFB 3FQUA 4NZUL 3SN6N 5LBSH 4NKDA 4JVWA 4MD5B 4WFHE 1A4KB 5KSVB 2YUWA 4OGZA 2W9DH 5C0NC 4UQ2B 4OCWL 1CLZL 4R0LC 1U8QA 4WHYH 3H8NA 4X4YB 2JK5B 2NZIA 2BXZA 2DIBA 1NPUA 4LSDA 5EOQH 1IQDB 4UZGA 2XKNA 3HZVB 4L8BA 1U8IA 2CLRA 3W9DA 2DWEB 1Q9OA 4XNQB 4RDQG 4RAUA 1R24B 4DAGL 1WISA 5ID1A 3MODH 1OM3L 3GSNH 3UP1A 5FCUL 3QRGL 1XR9B 4S1SL 1B4JL 3NFPB 4BSWA 5EC2B 3E2HB 1AO7B 3H7LA 1UXWB 2WIMA 3P11L 5FM4A 1CFVL 4JM2D 4CVZB 4IRJB 2WP3O 2ZOLB 5H37H 2B2XH 3GJEB 4JZOA 3GMRB 2XG5A 1B9ZA 1UENA 3KYKL 3SGDI 5HVWA 4D9LH 3SDDD 3LEVH 4ISVB 2XRAL 2EEDA 4AT6B 4S2SB 1H5BA 1BOGA 1G7HB 1Y6NR 3LPGA 4OJFL 1OY3B 4X7SH 5GGQH 4DZ8B 4P46D 4RMUA 4NKMB 4Z18A 3GMLA 1Y6KR 4U6HA 4LQFH 3SGDH 3UTSA 1F3DJ 3K7UA 3O11A 5EBWB 1L0YA 2APTA 5JLZB 2LTQB 5A16A 2XZCL 2CXGA 1RJCA 4NHUE 1TDQA 3EW3B 2AEIT 4JN1H 3KPSB 4PP8C 5TE6H 3IDUA 2X89D 1BQHB 1I7UA 4N8CL 5CGYC 3PL6B 5EBLB 5T1KA 3U7WH 1BJMA 1WZKA 5BXFB 4GMTH 3WFBH 3RWFA 5JDSB 1QFWI 4Z77A 3V0WL 5JW3L 5D2NC 3CDFA 3V0WH 2I27N 2J7LA 1RHHA 3NA9L 1KC5H 4TVSa 4U2ZA 5TH2B 2RCSH 2A83B 4UU9A 1XZ0B 4M62L 4DN3L 3TM6A 2H6PA 2XRAH 3BPNB 4EDWH 5GISL 4JY6A 5HDLA 5IG7B 3MOBH 3QDJD 1A9BB 1U8JB 3LV3B 1XAUA 5CKAA 3QNXA 4YBHA 5B3JE 2XXMB 4EI5A 4HG4K 3OJDA 3MR9B 2XZQL 2NXZB 3QDGA 4UQ3B 3VFMB 1B6UA 3VGBA 5HVFB 4LLWB 5I0ZA 2XI9A 2XKUA 1B4RA 3GSXB 2BVQB 3SDXF 3DURB 3DX7B 4GRLA 4U7MA 4MAYC 3MV8A 3U46B 4XMPH 3LEVL 4TYUA 1LMKA 5IQ9B 3HNSH 4KXZI 4OQTH 4NJAL 5EUOF 1OM3H 3L5JA 2WBJA 1KNOB 1S8DB 1FH5L 4LHJB 1N0LA 3T0XA 1T20B 1N6VA 2NTFA 3DUUB 3G5VA 1FVEA 1EHXA 4HKJA 2D7MA 1DFBL 1HHIA 3MREA 5DD5L 25C8H 1LEIB 1A1NA 5LCVL 2VDLL 4APQB 2CO6B 2DKSA 3QULB 1T7ZA 3I75B 1JNHB 2PF6A 4QHNA 3H42L 5F7HA 2OR7A 3BGMB 4Q7DA 4W4OA 3C6LA 3MA7A 2CGRH 1JZ3A 2EC9T 2DIAA 1Y6MR 4HGWB 3IJHB 1CTOA 4JJHA 1EX0A 1FZMB 4FFEX 5D1XA 5LXGL 4X6BA 4BSJA 4PJ5D 3MLVH 4WFHD 3NH7H 1KPRA 3F7RA 4TSCH 5D6CB 3ILPA 4RMQA 1IRAY 4P4KC 5CGTA 4I0CC 3O2VH 4WEUD 5F3BB 5K59E 4JVUA 4XPGH 1P7KB 4DWHA 2HAZA 3UTOA 2IWGA 4MNQD 4V1DB 3AY4C 1C08B 4ELMF 3BKYL 4XCNB 1BHGA 4MQXC 5GSVB 4ALAL 1G7MB 1L7TL 4UT6H 3QDMB 1X5FA 4IHOB 4AEEA 5DZLA 5KSUA 3HZMA 3PDGA 3HI5L 3CX5J 3NCYS 3SQOL 2APXA 2J3SA 3I84A 4R90L 2AKRB 3QHFH 1Q9LA 1FFRA 2AEQH 4BZ2L 2R2EB 1RMFL 5T1LB 3KPRB 1SHMA 3BGMA 2UWEA 4G59A 1G6RH 1MWAA 1E0OB 4JRXA 4LPVA 4PJCB 1KCVH 4WI3A 4AY0A 4IM8A 3A0OA 4HUMB 2O5ZH 3GO1L 4N0FB 1M7XA 5HYSB 4M1GL 3F6LA 4GW4A 3L3JA 3FFCB 5DTFB 1QFOA 1T3FB 2X4QA 4R26L 2NY5C 5DHVA 4RGMB 4CVZA 3WD5L 5LGJA 1F8TL 1NMAH 3RNQA 3BZFA 3GK8H 4YIQA 1C5BL 2VLJB 1MPAL 3MGTB 1UADC 1QVOA 3NCEB 4LCIH 4GXVH 4NQVA 1ZGLA 3N1QC 1QZ1A 2GIYA 4J3OC 5AZEL 1NBVL 2ESVB 1M1SA 4QRQB 5ANMB 4UT9L 3WFDL 2FATL 3UTZB 2FSEA 1F3JB 1I1FA 5I1EL 3I3EA 4HJJL 3S36H 1BFSA 4KROD 4QHUA 4POZD 1AI1L 2Z35A 5DLMH 3CXHJ 3NIDE 4G6JH 4NBYB 1INEL 1FCGA 3C5SB 2VXVL 5A2JH 3P4OA 3MNWA 4HMDA 1DE4A 4I1NB 1IGJA 2MPAL 5J12C 3G6JB 1LP9F 2YK1L 1CE1L 2QR0B 3G6AA 3FN9A 1UT9A 2R56L 5E2VL 1I8LA 1A2YA 4I0KA 5GS0D 5ENWA 3OKNA 1NFIB 3DX9B 4ODTH 4PRID 5E4EC 3DX8A 4HIXL 1JF1A 2JTDA 4K23L 4XNMB 3S4SA 4KDTA 3QXVA 4PRPD 5EU5A 4HH8A 1KEML 3NCJH 5F1OB 3V7MA 3IFNH 4ZUSB 5HYJA 3C5ZA 5T1DL 5KS9A 1FNAA 3RUGB 4M93B 2IJ0C 2J8UA 4YFLI 3GSUB 2X4UB 4RFEB 1EEZA 1EO5A 5TDPB 3BN9C 4KROB 2FWOB 1DCLA 3RWHB 2CKBA 1F4WL 1TQBB 2EYTA 2VB5A 2PTTB 5HPOA 2BC4A 1UKQA 5KBNC 3JSSA 4Y2DC 1UQSB 3OJMB 1A7RH 3SY0B 3SDDC 5CKGA 1RUKH 1I7RA 1ZT4A 3F7YA 1P4IH 3L5XH 2LTQC 1I3GL 5E6YA 1H3PH 4HKXA 1I3RA 4JFFE 1IAIM 5DJ0B 1OAZH 3O3AB 2X70A 1T5XB 4Y8AA 1INQA 1IE5A 5JNYB 3MCKA 3IAPA 2NLJA 4RISL 3DRTA 3NCYP 3OQ3B 4PJHF 4GAGL 4JDZB 5C0IB 4FOMA 1ZV5A 5I1AA 3TNMA 4X99A 4YDIL 4JG0H 1V5JA 4GO6B 4KJPD 1L6ZA 4QOKD 4PJFF 1T20A 2ZUUA 4JGJA 4YK4B 1CXFA 5DR5H 3I50L 3PHQA 2NW2B 2PO6B 4YFEA 3LEYH 5DO2C 1A3RH 5GS1B 5T1LD 3T0WA 5C0CB 5C1MB 2R4RL 1YN7B 2ZPKL 2R56H 1MRCL 3ISWA 4UQ2A 3QFJD 4PJHA 4LKCA 3OKDA 4KTDL 32C2B 3D0LA 4Y4FD 4OLVH 4EI5D 1Q9KB 2YEZB 2VQ1A 2IC2A 3O9WB 1A7PH 4NC0B 2C3XA 3TIDA 1KN4L 5TE7L 3LSOA 5I73B 1B6DA 5ALCH 3L5HA 1X44A 3WL9B 1ZEAH 3H2WA 5CJBA 5H37G 3G04A 1BIIA 2C4FT 4OIBA 4PJGA 5E2WL 1RULL 3RVUD 1XCTA 4XNXL 3SKUD 3HMWH 3MJ6A 2LU7A 5IB4A 1HCFX 5FB8B 1CICB 5DMKA 2D31A 4L5FL 3VE0A 4X80L 4OD2B 1U3HA 3U1SL 1YEHL 2VDNL 1H5BC 1CZ8L 1X5YA 1OVZA 5D1QD 4LVOB 1IGFH 3H9SD 1CCZA 3L3DB 4M6NH 3ZMRA 3ZYIA 4JFXA 5AEAA 2Q87A 4LCCC 3RWDB 5F9JB 1DBBL 3NTCL 2AJSL 3HC4L 1YPZB 5CFHA 5KSBB 5HJ3A 4M61A 1QBLL 5D7IA 3HG1E 3B9VA 35C8H 4MNGB 1PD6A 3ZE0F 2O5ZL 3OKOA 4LLAA 4APQD 4YQXH 4P57A 3IU4L 3FB7B 3HHRB 1S3KH 5JPMA 2XYCA 4PYHA 3ARDC 1RZKC 2W0LA 4BH7B 1P7QA 4MD5A 4UIMA 4AG4H 1LO3L 3TCXA 3FQXB 4ORZC 1AGEA 4YXHL 4WUKH 1MHPL 2LU3A 4GRWF 4L4TD 5ETUB 1RHFA 2FEEL 2FRGP 4P3WA 2BOBB 5FUOL 1E6OL 5F3HB 4ZXBA 5HDOA 1CDHA 1URLA 3O41A 1AHWA 3WIFA 1L7TH 3SPVA 1ZT7A 3AVEA 5IMLB 1BIHA 3JV5A 4FMKA 1BFTA 1A21A 3MRBA 5T5FH 2H1PH 4GAYB 1FGNH 2Z92A 2E5EA 1T7XA 2ARJA 5SX5H 3T2QA 2ADJB 2NR6D 5F7NC 1GOFA 3ZDXF 2ADIA 1S7RB 2VITB 3MXVH 4BH8A 3Q1SH 3BXNB 3MBEC 5FDWB 2WNGA 5F9WB 3BGAA 4OZ4A 1MFDH 4MJIE 4OCMC 5L7XL 3HTLX 1A1OB 4G7VL 5GQBA 4LK4A 3THML 4Z76A 3B2UC 3UO1H 4JO1H 4DGIH 2NX5E 3RFZC 3G6JA 1AD0B 2NYYD 4F3FA 5IVXF 4FTVB 4QCIB 1NFDE 1LO4H 3TH2T 4HCRA 2AJVL 1JHLH 1LILA 1U91A 1KJ3H 3FO9B 1G9NH 4O4YH 4DZBA 2DDQL 2ATPA 4I3SH 4JDVA 1NBYB 1I3UA 1WIPA 2V2WB 3ARXA 3ZYOA 1T66C 4GKSA 5FF6A 1IJ9A 4N9OB 1G9MC 4TVPH 1KC5L 4C55A 1IFHH 1G6RA 4JPIB 3T4AA 3E3QC 1KIPB 1NCUA 4ELMB 1QR4A 3DIFB 4AH2B 2VZOA 3WIIL 4K3EL 2BJML 4GKZB 4HIIA 4U33A 3H3KA 4OD1L 1D5BA 2RFXA 1FDLH 1CDIA 3CVHA 3NZ8B 3WUWB 1RVFH 4Y88A 4CJ0A 4G8GE 5SWSD 4JG1H 5E2JA 5ID1B 1JZ4A 1UM6L 3MLSL 2V5YA 3EFFB 1W0WB 5C0CD 2X9XA 4PRBA 4QRPB 5F9OH 2Z93B 3RKDD 1J87A 5FA4A 2X4OA 3V6FA 4P2QD 4RWHA 3GJEA 5I8OL 4DGVL 1F4WH 1JPSL 5F7UA 3U0WH 4BFEA 4LKXA 3QG6B 1NCDH 4HJ0C 4XMLH 5CZXC 5D6DA 3KYKH 1VACA 2Q7YA 1UWXH 1ZHKA 4UT9H 2QADB 3ECBB 4ZFGH 3CC5B 2QKIB 5SX4I 3SEPA 1P4LB 2P24A 5DQDH 3TJHC 1VFBB 3LD8C 1MHHA 2A0LD 2DOCA 1E4KA 4HLZH 4WW2F 3WXVH 4OB5H 1HE7A 3S35H 4G8GA 1MELA 1CDBA 2YUZA 4ZYKA 1ORQA 2BK8A 2CRYA 4PJ9C 4BELD 2WAHA 1XF2B 3D3VA 4DEPC 4NQDD 2VO5A 4PJ8C 5L2KA 2IANB 2EIBA 1I7ZA 5C0BE 1OAUL 5D9SA 3P0VL 4XNZC 2UZYB 2H2PC 5ALBH 3OWEA 4JM4H 4YR6B 2I9TA 3TN0A 3T0ED 1E4XH 5BVJB 3V6OA 1A4JB 2B39A 2NY6B 1MJ8H 2YMXH 1QBMH 3WFDH 1KB5A 2E27H 3BPOB 5IQ7L 5D7JA 5DDHB 4DKFH 4OCNC 4LCIL 4WFEE 3QIUA 1DUZA 2VR9A 3QQ3A 4KKAC 4LVNC 3I6GA 2ILLA 1AD9A 1A47A 4B5EA 5F8QC 3QDAA 1LO0L 4PLOB 3CC5A 3E1F1 1KJ2A 1YNKL 4Q0XH 5KVGH 5KJRH 3BPCA 3CGTA 4J7RA 4U2YA 3LKNB 2BVQA 4ZAKC 3V8OA 4S10A 1DN2A 5IB3A 2NMSA 5ENWB 5D1XD 5FYJL 3GMQB 4EUPH 1I7ZB 2BVOB 2ZUSA 4M7JL 4TSCL 2NY2C 4QXGH 5FKPB 4XC1L 1T5WA 5ESAA 3CFEA 2YA0A 3L3GB 1RJLB 5D7LA 1DP0A 1MEXL 3RZWA 3RUGA 4PR5B 5LXGH 3T0DA 3HI5H 5KANG 5IEHB 5HHOA 3VXUD 4Z9KB 5HGHA 3LQAL 3L3HA 4PGEB 5AYUH 4JPKH 4L3EB 5IB5B 1JGLL 2OK0L 5F89B 3BPLB 4E41A 3P0YH 3LDBC 3I02A 1MJUL 3MUGB 4P5MB 5T3ZD 5CP7A 4HPYL 5CSGA 4ZAKA 3FO2A 3VRLF 5JDJA 3CU7A 3QUXA 4QO1A 5E2TH 4POUB 4J3TA 3PQYA 4HSQA 3NH7L 1FH5H 1V7NL 4Y5VC 2XZAL 4D3CH 3MRFA 3ZTJH 1SVCP 3HNSL 4LHQB 2A9ML 4XC3L 3ARGD 2JCCF 4CVUA 3PP4H 2I07B 4AEHL 3CSGA 2ATKA 3QO0A 3GKWL 3IRPX 4JFHE 4X9IA 1K3ZA 2VZUA 2YA1A 3MLUL 2VDLH 4NN7C 4Z77B 1VFAA 4YXKH 1K8DA 5EZLB 4JM4L 2EH8H 5GGUB 3P0VH 1DBKH 5EZIL 2E27L 3QEGL 3BP6A 1C5CH 1A9BA 4X4MA 3LB6D 4P2QE 5EU5B 4OKVB 4PJ8A 5IHUH 4OZGE 3S35L 1ORSA 3J7HA 1IM3B 3OSKA 2CDFB 4HUXA 5GRWA 1AXIB 3GJFA 4JPVH 2YUVA 3DVGB 1DQJB 1CL7H 3VGDA 4HG4J 2PYEB 4Z95H 3PV7A 4RSVA 3BWAB 5HHPA 3V0VB 2AXGB 5SV3A 3WNLA 4WWKD 1S7UA 4HLJA 2X9YA 2HTKD 3TPUA 3FN0L 3DJ9A 3C5ZD 2MQ0A 3BH9B 3KR3L 2H45A 1AFVH 2D7NA 4NOBA 1KJ2L 1A6PA 2FGWL 3KPOB 1WWWX 4K3JH 4XAKE 4Y5VB 3TA3A 1QPPA 4NKDB 2DQIL 5HYJD 1BREA 3K46A 4P5TB 5ACLA 1UA6H 1NGYB 2VDRL 1GGBH 5F88A 3TO4D 1OF2A 3RWJA 3OAYK 1FFNA 1T1WB 2D4FA 3EOTL 5JW4M 2NXZD 5DT1L 1ORSB 5D1QB 3RAJL 4ONFL 2EDNA 3LDBB 2G60H 2CLVB 5ITFB 1S5IH 1IEHA 3IXAA 4JFFA 4HUVB 2Q8AL 1PZ5A 5D71H 5KOVC 5E4EB 2VJXA 2HVKA 1CICD 4S1QH 2FECI 1A6VL 3Q5OA 5FUZL 5EOCH 1A9EA 5JA9A 1JJUA 5D6CA 1JZ8A 3DX8B 4DKDC 4M1CC 4B50A 4X9BA 3PGDA 4IDJL 4TNVK 5DVKA 4U05A 3LSOB 1CFQB 1SQ2N 4NUGH 1S9VB 1NBZA 4OJFH 5F8RC 4NNYA 1TJHH 1NCAH 3PWPA 2COQA 2R29H 3IJYB 4RGOL 4G9FA 5DD6A 3O8XA 5EU6B 2AK4B 4IHOA 1U93A 5DMGC 1FNSH 5IB2B 1KSRA 1KCRL 1DLFH 1Q0XH 3TYGL 4DUWA 1F3DH 2UY7A 3F8UB 3UC0L 4DTGL 3X13B 4XWGH 4HHAA 3RVXD 1MVFA 5E08L 2XOTA 3VXRB 1PQZA 3VD7A 4YDJB 3GMLB 5FYLH 4TOYL 3MNVA 1N3NB 4ZDHB 4QRRD 1NJ9A 5DJ0A 4RQQA 3K2UH 3TIEA 5L2JB 1B3JA 4DGIL 5DVOA 4ZNEE 5JNYA 3D39D 3BIAX 3NFSL 3T65B 1U8LA 5KSAB 4ZMAT 2J5LB 2LAAA 2VRAA 4K7PX 2L7UA 3WBDA 2IPKA 5C8JB 4GW4B 3CFDB 4HH9B 5EOQL 2A6DA 4IRSB 3BUTA 1U91B 4PLNC 3Q5YA 1JRHI 3QI9B 4K8RH 5I8KH 3JVGA 5EU7E 1RHHB 4PR5A 4Z7OF 1OGTA 3HZYB 1J5OH 1S78D 2ZOKB 3RIFK 4G9FE 4P2RD 4WV1B 1IEBA 4MVBC 3W11C 1AO7D 2NNAB 4NZDA 5D7LE 3RWEA 4HDIB 3C8KA 3ZKND 3DV4B 4XB7A 4E5XB 32C2A 3BYTA 5KAQF 5DK0A 4WUKL 2VLLB 4QRQA 2P7TB 5L0QB 4HV8B 1JUFA 1S7QB 2PYFA 3EO1B 3ROLB 3GEWB 1II4E 1RZIA 3QUMH 4NRZA 1HXMB 3WUWA 4XTRD 4N1EA 2ARJB 5IJKC 4ZDHA 5FO8B 4MAYA 3T04D 1RURH 3U4EB 3BP7B 2OR9H 2HRPH 5CD3B 1N4XL 3MO1A 2QSQA 1F4YL 1U8HB 4XP5L 1RZGB 2P5EE 5H2BB 4ZPVB 5SV4A 1P84J 5GZOD 1QACA 3ARED 5CIPB 3K4ZA 1KOAA 2GQHA 2IMNA 1XGQA 4Y4HB 3SO5A 1X5HA 1JTOA 2H8PA 3IS0X 5E9DE 1DN0A 2Z91B 4KZEH 3WN5C 5GGVH 4F7PA 4OV5A 3INUL 5TE7H 1K8DB 3QXWA 2Q76B 4K3HA 4OLWH 3F62A 2PXYD 2H26B 4WFGD 2UYLB 3NFSH 3AGVA 4WWID 4LGRB 3RWHA 4APQA 5E6IB 3KPNB 2P24B 1QQDB 2G5BB 4P9HH 4K7PL 4V1DE 2YRPA 4NN7B 1G7QA 1I1AC 1HQRB 3W2DL 1JBJA 5IB1A 4XNXH 1Y0LA 3ULUL 4OCRH 3LD8B 4XWGL 2XG4A 3HLAB 4HWBL 1FIGL 3E2HA 1KB9J 4RISH 4DVRL 3TPUB 1KN4H 2DLIA 3B9KD 1MHCB 3TYFA 3BZDA 3MMEB 4R9HA 3T77A 5K33A 4CVXA 3KPRD 1KB5B 2NY3D 1N2RB 1GOGA 1HXYA 1IM9B 2DKMA 1JGDB 4LOUC 5IMOA 2DYPB 4P2OD 3MLRL 5IHZA 1N8ZA 5CJQH 5MEPB 2HH0H 3HE6B 5FYJU 1DDHA 3I6GB 4UINH 4PRPA 5BVPL 2Y07L 3BPNC 4LRNH 4R7NA 2GHWB 2J8UF 3RWIB 3GBML 3B5TA 4MWFA 3JWOH 2HFFA 3QUYB 4JO4H 4X9FA 3ZZ1A 5DJAB 3ARPA 3EO0B 3QZWB 4KQ3L 1NCBH 3DLQR 3GIZL 2R69H 1YEEH 1KLFA 4GW1B 1MCDA 5FDYA 3O3BA 6FABL 4E42B 3S3JA 1V3LA 1W72H 3D2UA 4WO4C 5C07B 5DMIL 3SKNA 3VG9C 5F44A 3QG7H 1R5VA 4PJ5B 3PHOB 4C56D 2DQGH 1D5ZA 2NXYB 3LRSA 1NUNB 2A77H 3JBG7 2IFFL 3SJVB 3SKMB 4WWKC 3NOIA 1QSFA 2XTJC 5MP6H 1HHJB 2HH0L 3QUZB 1KELL 2BOCB 5L2KB 3PDOB 5DLML 4NQEA 1HNFA 4HQQH 1IT9H 4Z7WA 2F54B 1TCRA 2CQVA 4HIHA 1A4JA 1I8LC 5MEOB 2GJZA 4ENED 1A14L 4WU7A 4M7KL 3EOBA 3UEZA 4ODTL 3QFJA 3CVHB 1ZHNA 1RQ5A 5HI4D 3ZO0A 1N3NA 2ID5A 3MJ7A 3GM0A 4HJJH 3HE7B 3MTRA 2J4WH 1S7TA 1BZ7B 2WP3T 3RKDC 1X5LA 3UTSE 5J57B 2B4CH 4OTXL 4OQ1A 4LSSH 3UBXI 1KLUB 4P2OB 4UUJB 1AI1H 3GHEL 3MBXH 2JF1A 4W81A 3QIBD 4A2LA 2W9LA 4XBPB 3BVNA 1MPAH 4OZHA 1CQKA 3LN4B 2W65B 2HJKA 1FNHA 4GLRI 2ADFL 3TBYB 3PP4L 1RUQL 4D8PB 3ARRA 4PJAE 1J05A 1VDGA 3QDJB 4P4KD 3C60B 1EJ6A 3B5GA 4HEPG 3AUVA 3WD5H 3T1WA 5FOBA 3B2UD 3H0TB 4HUXB 5I2IB 4WEBH 3VFRA 3DYOA 1KENH 4UT6L 3W9DB 4YHPB 3JTSB 1U42A 3HAEB 1JP5A 4U3HA 3W0WA 3S37L 1DQML 5LWYH 1RUPL 5F89A 2GSIB 2LABA 3VCLA 1HHKA 2B8OT 1A6ZA 2DM7A 5AYUL 1IC7H 1SJVA 4M7ZB 5HDBF 3LAFA 5IM7B 5J11B 1LNUA 2ICES 5ERWB 5JTWA 4DUXA 4GSDL 3FMGL 1BPVA 3KPOA 3B6SA 3A6BH 1U8KA 4OF0A 4ISVA 2CGRL 1EZVX 1PX3A 5FK9A 2MKLC 1GZPB 4LRIA 4M7JH 1HIMH 1H5BB 4KI5D 1SJXA 1RFDL 2V2WA 4A2MA 1JZ5A 3X3GH 5IFJB 2H32H 4TRPH 5BZWA 4OGAC 3TF7C 4M4RA 4EN3B 4GS7B 2IG2H 5ICXA 2OM5A 5C08E 5JA8B 5CSZA 1RAMA 1B88A 4ELMA 2AGJL 2YEZA 5EO1B 2P8LA 3DBXA 2OQJA 3IS1X 5DO2D 3OTTA 4OAWB 2X4NB 5DJ6A 3RDTB 3KLAA 2JJSA 5F1IA 5L9DH 4M5ZH 2FJGB 2JCCA 2AP2A 3BEVA 3PWLA 4V3EB 4NJAH 3BW9B 3VW3H 3MLWL 4HUUB 3FHAA 3MROA 4MCZB 4HGMA 1MCRA 2I25N 1IAMA 3C6LB 3P4MB 3UYRL 3RA7L 4HZLA 5A2LH 1NSNH 4WW1B 5ERWA 4XPFH 3U4BH 1DEEA 4WU5B 3TP4A 3IJYA 5TF1H 1L0XA 2WLYA 4R4ND 1FNSL 3B6SB 3T0VA 4Z7WE 4M1DH 1OTUD 2VYRE 1PAMA 3SO3C 3IKCB 5EULV 3RU8L 1TNMA 4P5KB 3MRPB 1TJHL 3B83A 5I1KH 4KKBD 3EHBD 5EUOB 3MZTA 2AJXL 1G9MH 3K2UL 4DVBA 1GGCL 1IKFH 2H32B 4OQTL 3O4LA 1CBVL 3QT2A 1KGCD 2BVPA 5E8PA 4PB9H 3K8MA 4ZTOH 3R06B 4W4NA 3PGCB 4RQQB 2OL3L 3ZTNH 6CGTA 1W0YT 4OLZL 1TPXC 1KTLB 1NANH 4OZIE 2H2PD 4KMTH 4D9QE 3TYGH 4UDUA 5JR1H 4LGPB 4KV5E 1T1ZB 3GKZA 1S5IL 3ALPA 5D93B 4JFDD 4ESKA 2AK4D 4MB3A 3H9HB 2ZG3A 1DBAH 3RDTC 4NOFA 1BFOB 3O41B 3JWDL 4PRHB 2B0SH 2ERJC 4OLXL 3ARDB 1JN6B 3MSPA 4HZLB 2QL1A 1G6VK 5J13C 3TT3H 5JOFB 4X6DE 4X6CF 3UMTA 1K5NB 2BVUA 5LKNA 5J6GB 1CXIA 1X6LA 2M8XA 1JHTB 1QTYT 5DD1L 3U7WL 5HYJE 5KS9E 4J8RA 5FO7A 3ARYA 4QNPE 4X7SL 5FYKD 3SKOB 1TZGL 4UOW1 1KLGB 4M8VA 1U6AH 1AD9B 2JIXB 3PG2A 4Z7QF 1OB1B 4F58H 4QOKA 2M2DA 3QH3B 5DJCB 3MV7B 4NUJA 1WWAX 2NY4C 3IXTB 4RDQF 4NO0D 5KVFL 1IAOA 3AS0A 4HKXB 4D0BB 4D9RD 1K2DA 4MA7L 1U3YA 4NKOA 4MQ7B 4OLZH 3FB6B 3GSWB 4EVNB 2Z4QB 2HTLD 1T7WA 4K2UH 2HG5A 2WQ8A 3QNZA 2YXMA 2WV3A 1SEQL 4J1UA 4MXWL 4PJCF 1GAFL 1YNLH 5DRNB 3C6SB 3GSNL 5TDOB 3TNMB 3ZDYE 1DL7H 5IVZA 1F02I 3RWFB 5FKPA 3PWVB 1J88A 4Y5YA 1C5CL 3FB8A 4R7DB 3VFNA 2A6IA 1FVCA 3MRIA 2HLAA 3P11H 3QEQE 1UZ8B 4XX1E 3EDKA 1NBYA 3PWPE 2ICWJ 4K9EL 1ZLVH 1MCOL 5GZOC 3QRGH 5E00B 3DV6B 1BD2D 4WUUD 5BRZB 4LLMB 5E9DA 4M5YH 3D85A 5IV2B 3DI2B 4Z8FH 4LSVL 2AERT 5B39B 2Q8BL 3KXFE 5D1QA 1CFSA 2Y6SC 5FYKL 2AABL 3H0TA 1PY4A 3GSUA 2GKIA 2P5EA 3QIWA 2DTSA 3QIUD 1MOEA 4JRYD 3QP3A 3MODL 3MRDA 4Y4KA 4KU1A 1CLZH 2WW8A 1KACB 3R1GL 2IPTH 2E8ZA 1U8MB 1Q9WA 4F33A 5DMKB 3NPSC 1MI5A 1UQSA 3V52L 3QIWD 1AC6A 2Z93A 2OP4H 1EK3A 1FJ1B 4S1DC 1CFNA 4R3SA 5EPMB 4EN3D 1QKZL 2OXGA 3VGEA 4TRPL 5KSAD 5D2NE 4YH6A 2CIIA 1EPFA 5DMJB 4L3EE 2ICWA 4HULB 3E6FA 4LLVB 1J0JA 4IS6B 1JV5B 1UZ6F 2VE6B 1QRNB 5J6HB 1CXKA 3RWIA 3DECA 2BNRD 4Z7UF 1A6WH 5L9DL 1XGQB 4LLMA 2JK5A 5E9DB 5IV2A 3ORJA 2LVCA 3CCHA 3O6LH 5JPMB 4WEMB 4L8DA 3MA9H 5KG9A 1JWUB 4CMHC 4HGWA 4YFDB 2LQRA 1XGYH 3GI9L 4WDIB 4CN6A 1HH6B 5E2UH 3VXQB 1BBDL 4L3AA 3HNVH 3D3VB 4HKBA 5E0QA 3EZJB 3M8OL 4JY4A 4YHIA 5EC2A 1R5IA 2V7HB 4PJBE 5A2FA 5I1DB 4TUKL 4WTZG 4Z7UB 1RPQA 1NC2B 4XPBH 2VLME 3X12B 5BV7H 4FQ2L 3RKPA 1KCSL 1W0VB 8CGTA 2RGSA 1YEHH 4YAQA 1GHFL 1YECH 5GSVA 2NNAA 4Z5RA 3QQ4B 4NCC1 5E8DH 3GSNB 4PUBH 2ADIB 4LCUA 3O6ML 2A73A 5HPMB 1OF2B 3GSRB 5D8JL 4XVJL 4F2MA 4LNVA 4UAOC 3PABA 1GRWA 1DSFH 2X09A 3OKKB 4WEBL 1YEJH 1T04A 3KJ4C 4Z76B 5FO8A 2F5AL 2EDEA 2OSLA 1B2WH 2W9EL 1I8IB 3VGAB 4JRXB 4ZUTB 4OIAA 3QIWC 4NYLA 3JV4B 1X5IA 2QLVB 5K93A 3GGWB 3BRFA 4ORGB 3WNPA 3EO9L 4RGNC 2XZZA 3UXFA 4EDXA 5DJYA 1J0IA 1LEKB 2V7HA 2F58H 2W60A 4OM0L 4JREC 3LPWA 4E41E 1BZ9B 4U1JA 1QBML 1VGEH 4HK3N 4ZUWA 1MJ8L 1I4FB 1DQQA 1Z5LB 4S0UC 4OZIB 3GHEH 2CDEB 5C0CA 3TO4C 4Y5YC 3MRRA 1NAML 1HYRC 2WBJB 3W9EA 4AK1A 5ANMA 4Z7OE 4KV5F 3SQBA 5LGHH 3WNNA 4U1NA 1IC5L 2HJFA 5HHXL 1H3PL 4I2XA 3L7FB 3KG5A 1M7DA 1SEQH 2E8YA 3PDOA 2V7NA 1FO0H 1LEIA 4G3YL 2XWBA 3ZYZA 1A14H 4JRXE 2YZ8A 4N0YH 1FYHB 4NKOB 1T66D 1QR1B 3QCUL 1I85A 1RIVH 1CICA 1K6QL 3VWKB 4M7LT 4ZOEA 4GH7B 1KJVA 5CJXC 5FA4B 1J8HE 5F1NA 1UWEH 1Q1JL 3H3PL 5JMOC 1KELH 3UAJD 3G5ZB 3QFDA 2VDQL 3V5DA 5T1MB 4I18A 3L3DA 5FA3A 3FB8B 1JGDA 3T4YA 1CGWA 1UB5A 5DD1H 1FORL 5F7KC 2IH1A 2J6EA 4MA3A 1KLUA 4P2OA 3SE8L 3FOMB 2HVJA 2CLZA 2VUOA 4ZO8A 1IM9D 3E0GA 2AEPL 2EH7H 5FKAB 4MDJA 5CBEB 5EIIA 1AGFA 3W9EB 2DQDL 5FO9B 5GRZA 3AXLA 3QQNA 1JNHA 1HQ4B 2GCYB 4OLYL 1LO4L 3MFGB 2CDFA 3K1DA 1T89A 1RJYA 2X42A 3MJ8A 4K3EH 4L3ED 4M6ML 4PGBB 3ZSTA 2CUIA 1MIEL 3P77B 4YZFE 2AXGA 5CEZD 3WDJA 4MAUL 3IDYC 4G7VH 3ULVF 4AH2A 2KQMA 2W91A 4J4PA 1YJDC 2C3VA 3FAWA 1CBVH 4MNQE 3UBXG 1GOHA 3LIZH 1OAYL 2XTJD 5F1SA 5F97E 5I74C 2YD3A 3FONA 4ODUA 1FFQA 3VFVB 5GGVY 5I1JH 3MXVL 5CINL 3NFNA 1QRNE 5TDNB 2ZWLT 2FYYB 3D9AL 3G08B 1MFEL 4PJBF 5HDQH 3FFDA 2H3NA 3SDYL 2CRIA 2VH5L 4YDLB 4AEIH 4IS6A 1IC4H 5IGXL 4LLYA 2NY2D 4XPFL 3U4BL 2R8SL 2AI0L 4C59B 1BFVL 4P5TA 5EA0H 4MX7A 4QHMA 4CADB 3MCG1 3CH1B 2EDTA 3O2DH 4LVHC 1SYVB 5FYKU 1YYLH 2GUOA 1OGAA 3W2DH 4U49A 3F7VA 5EOCJ 5D7JD 4ZUUB 4PD4K 3ARVA 1BGXH 2JJSC 1CLYH 4JGMA 2PTVA 2IBBA 1OTTD 4PLJC 4C57C 2X4SB 4ZSOA 4NHUA 1YNTB 3BIBX 4IMKC 5EN2A 4WWKB 4FFZH 5GJSL 1R5IB 2NY6D 3BOVA 4PLKC 2C3VB 1TMCB 3SGEH 1IAIL 1D5IL 1AXTL 1JNNL 3C08L 2IADB 5C3LD 4XPHL 2B5IB 5GRVL 1EGJA 3RHWF 4WO4B 1WZ1L 4FNLL 5IJVB 4YHKL 2G2RA 5HI5C 3FAXA 1I1YB 2X2YA 1PG7W 3P4MA 3V5HA 3EFDL 2VMFA 4WY7L 3SGEI 4U4BA 5DJ8A 3C08H 3ARBA 1VGKA 1CG9A 2R23A 5F7LB 4HKZA 3IXTA 1ZHLB 1WUNT 5JOPD 2H41A 5MI0C 4C54A 1WCQA 3HMWL 3H42H 2YN3A 4NC2B 1VCAA 3VCLB 1BQSA 1WCBB 2Y1VA 3L3KA 5I9QC 3CDGA 3N85L 2Z4QA 1SYSB 2C3GA 4GLRH 5DVMA 5DQJB 2YA2A 1NCWH 4TULL 2ATKB 1J8KA 1QFUL 4JLRA 4LSTL 4LLQB 4M6NL 5HBBA 1X7QA 3P9MB 2OI9A 3QEUB 1AHWB 3WIFB 1MIML 1BFVH 4PJEF 1Q0XL 3UTTD 4KH2A 2ZCLH 2DLGA 1OAKH 1A6UH 1ONQA 5D96C 4L5FH 4QRSA 1ITBB 3ARQA 5C0IA 3FQNA 1B0GA 2EZ0D 2NY1C 2HT4C 4L29B 4WNQB 3B5HA 2VN7A 5C9KA 1RIUL 5KSAC 1KN2L 1JNLL 3S36X 3GB7A 3HKFA 5HHOB 3CSYB 5K9JL 1RZIB 3LKQB 5HGHB 3WNOA 5I8CA 3MJ9H 4JKMA 4XHJD 3WFEL 1DVFC 1T6WA 2IANE 3I6LD 3S5LB 4EQ2A 3NVQA 1OW0A 5CILL 2E9BA 1KLGA 3S34L 2WINA 3TIDB 3HPJA 5AD0B 1ZSDA 3UPRB 4BK5A 3AS2A 1S9KC 4KJYA 5B38G 2PO6D 3B8SA 3N1FC 1J1XL 4RMWA 4FQXD 4G8IA 4LCWA 3UJJH 5DWUH 3SE9L 3QFDB 2DJSA 3C2AH 3KJ6H 2HMIC 3NACH 1BX2B 4JZJB 4HZAA 3SE4A 4UNTA 4PRAA 12E8L 3R4DA 4XXDB 1U8NA 1L0QA 2I9LA 4LCYB 2VKXA 4WENB 5ICYA 1UWGL 1BEYL 3LS4L 1JK8A 2XNAB 2VXUH 5IR1A 1BAFL 5E6IA 3T0AA 4H5SA 2GTZB 2VQ1B 3DMMB 5IWLC 4X83A 1HHGB 4BQBA 3PGCA 1UB6B 4YJZL 3OB0H 4ZO9A 1YEFH 1JMXA 3EJZD 2DD8H 2YK1H 4FQQB 3ULVL 2OTUB 1FPTL 3DSFL 3PL6C 4AM0B 5E8OB 3REWA 3DV6A 3G6JE 4K71C 3HLAA 4PJDF 5E24E 2ICWI 5IHBA 4WO4D 1PYWA 1HHKB 5JW4R 1INEH 3PWNA 3HPLA 3TH3T 3UPRA 1QHPA 4JM2C 2BSRB 4QRTA 4E0RA 2DQCH 4ODSH 2MWCA 2GFBB 2O5XH 4KHTH 4X6DF 3IFNL 2VOTA 2BX5A 3T77B 2FHCA 1PJ9A 5HHPB 5ETUA 5C0EA 5J6GA 2X89A 4G6KL 3O81A 1LP9E 5EWIH 3SDCC 5IT2L 2YPLB 2J6EH 3B9KC 4LEXH 2FO1A 4PGZA 2GT9B 3LKOB 1U8NB 4LCUB 5ICYB 1QFWL 1O0VA 4YZFF 2FDBP 3BD4A 1JPTH 1WBXA 3FT3A 2EECA 4GKNA 5ID0B 4P57B 5EORH 3L7EA 3QNYB 3ZL4H 3STBA 1AIFA 1W72B 1RZJL 4PJFA 1G9EA 4YHZH 4DVRH 3I9GH 4P2YA 3DMMA 4KJWD 3HS0A 2YPLE 5D4QA 4NO0A 2FJHB 1IGJB 3TIEB 3UZEA 5EIVA 2WWKO 4OI9A 1X4XA 4DQOH 1BBJB 3JUZA 5DJXA 3MGOA 1I1AA 1M6OB 4HFWA 1S7VA 4PUBL 1AGDA 3H9SB 3X11A 5K9KA 4OM0H 4KGJA 1F11B 3MV8D 1KULA 5MEND 5FM8A 3EDJA 3BDXA 4XCCL 5I1HH 5D7SL 2YUXA 2BMKB 1RZKH 2DN7A 1I1AD 4G80B 1J1PL 5CMAA 4QRRA 3G5XA 1VFOA 4NKQB 4JPKL 4KVNL 3VRJB 2VDPL 2R0ZL 5J9PA 2QQKH 4JFZH 3TEUA 3VXUB 4G8EA 4KZEL 5BV7L 4YDKL 4NZTL 1MREL 5EFIA 5I18H 1RZJC 1CFQA 4I9WD 2XZAH 2B1AL 2Y23A 4QRUA 1NGWA 4GKNB 3O6MH 4MJID 3DRQB 3KPQA 5IROC 3RGVA 5E2TL 4FQIL 1K85A 4K7FB 1NGQH 2ITCB 3ILQC 4PIRF 3QFJB 4PG2A 1RZ8A 2NX5D 5D1XB 1MJJA 3UTSB 3S7GA 1CD1A 2ZJSH 4JEGB 1A1OA 4D0DA 1RY7B 1Q8MA 3IDJA 1S7UB 2B1AH 1ZT1A 2XFXA 3VWKA 3U7YL 4FTVA 3I3DA 1EFQA 1S7XA 4JDZA 4NWUH 1FZKA 43C9A 3CZFA 1YY8B 2XN9A 2F19L 1MEXH 1OPGH 4XCNA 4NT6A 5DGQA 3VWKD 3O6FD 3AM8C 3GI9H 4RRPA 4PFEA 4LARH 2GAZA 1UZ6E 2O5YL 4MNGE 5JOFA 2XPGA 1WZLA 3WSQL 1CL7I 5IQ7H 1Z0NA 2P47B 4KUCD 1BVZA 4OZFB 1CXLA 5FO9A 5IEKB 1FFNB 4ZUVA 4U1MB 2FZ3A 4EUPG 3VU2A 4OD3H 1I4FA 1V7ML 3U0TA 5SWSE 5L8JB 3FO0L 2X4UA 3FQWA 5TQ2H 4D0CA 4X7EC 4C58B 4Z78B 1IMHC 4YHPA 1DBML 5IWLA 4X98A 2PXYA 4WHTB 3P4LA 1QKZH 3P9LA 4HWEL 4DCQA 3QRFM 4TNVF 1M7IA 3UBXA 2XIDA 1EUUA 4NRYB 2FR4B 2DJUA 1JPGB 4MJ5A 4JQIL 5DS8A 4CDGC 1LNUB 4NNYB 3IYLW 5HD8C 2QADD 3BKCL 5F9WC 2XN9B 1N2RA 1RK0B 4XZUA 1RZFL 1BWMA 3VFUB 1EERB 2MNUA 2NTFB 3CLEH 1PDKA 3K74B 5T3XH 2VXQL 2NY6C 1JWMA 1CF8L 4C56A 1O5DT 2IAMB 1QLEH 3GRWA 1UXSA 4TPRL 4WFFD 4N8PA 3QUZC 3PE9A 4XWOC 1UC6A 3KNBA 1X4YA 4XP6H 2B1HL 1JGUL 2ZCKL 4HS3A 5DF0A 5KZCB 1VPOL 3ME0A 1E4WL 3WIHA 3QZWA 1MRFL 5K9OA 4F58L 3KLAB 5FUCE 4HK3J 2XY2A 3A6OA 1ZLUK 2F53E 4R8WH 4HFUH 3K8LA 4WW2A 4CN1A 3U79A 3VGFA 4NQXA 5AG8A 4IJ3B 4J3VA 4HH9A 2W60B 4ZFOA 3UBXB 4Q9QH 4K2UL 4ZS6D 1JPSH 3AB0B 3KJ6L 4I3GA 1WTGT 3D18A 4QTIH 5FYJE 1CFNB 4KRLB 1T4KB 4R3SB 4F37F 4WFED 1MAKA 5I6XB 4PJGB 4MA7H 4NNXA 3TWCH 2CDEA 3UJIL 5JXED 4N8CH 3QQ3B 3PDDA 5ESAB 4YGVA 1JV5A 3UTTB 4F9PA 4YPGA 4NQSA 1BAFH 2O93L 2ED9A 4KQ4L 5C6PB 1GJIA 1T0MB 1QYGL 4PTTA 4JG1L 3QO1A 3TVMD 4WI7A 5E9DD 4X6FB 4BQ9A 1UVQA 4FXKB 1ZHNB 4PJFB 1LK3L 1QA9B 3GMOB 3NAAH 1Z9OA 4S1SH 1HILB 5KVEH 4LVNB 4U1HB 2B7DT 3I85A 3JWNC 5JLZA 2EKSB 1IZKA 3MO1B 2Y5TB 1EIBA 4JR9H 4HX1B 2L0DA 4X7FC 4I9WE 5TQ2L 1X5GA 4JPVL 5FCSH 4Q9BA 3QUXB 1AJ7L 5F7DB 3IF1A 3LMJH 1G9NL 4RWYL 2AJ3B 2RB8A 4LAQH 4DKAA 4E42A 1BZQK 2YKLL 3TBWA 4IIQA 5JQHC 4TULH 1QVOB 3OV6A 5F3HA 3O45B 4QF1B 1G9ML 1QFHA 4JKKA 4J6RH 4YFLF 4GRLD 4X0KB 1MF2H 4PTTB 2HFGL 1L8JA 4J3UA 1U58A 1MCJA 2OZ4L 4XXCA 3U6RA 3MYZA 5F1KC 1HILA 4D0DB 2R2CA 1FNEA 4PRIB 2DLFL 5D70L 3WKMH 2BVYA 4A6YH 4Y8DC 5ESQB 1IM3A 5IMKA 1S5HA 4NYLB 1HK6A 4EVNA 4RGNE 4JFHD 2QEJA 1YJDH 1H8NA 1WK0A 2JJTC 2AGJH 5DFWH 1A1MA 1NFIA 1TJIL 2DMBA 1ES0B 2WUBL 5C0BB 4V3DB 5I18L 1PY9A 4N0RA 2FJFA 5IW1A 1KXQE 4HWUA 3TT1L 1ZXQA 5DJDA 1CT8A 4LBEB 1A6TA 1HHIB 1J1OH 3HZKA 1I1RA 3M17A 4KDWA 3K3QA 4J4PC 3QEUA 4FRWA 3ULUC 1KV3A 2PR4H 2QKIA 4ETQA 5GRUL 2QV2A 3U83A 3MXWL 3T2NL 2ZJSL 5E7BA 5DSCA 2IBGA 4NWTH 1NLBL 2IQAB 1IC7L 5GGTH 2BZDA 2HJKB 4CMMB 1JZ7A 4PP1C 1CLOH 1A3LL 2VXSL 3BWUC 3N06B 1INDL 1YQVH 4KUZH 2F53B 5EZJA 1IZJA 3RWJB 1CWVA 3JV6A 2J5LC 1FNEB 3AAZA 5CD3A 1IC4L 2J1KA 4KAQL 1P2CA 5IGXH 5JQ6L 4QXTA 3V79C 5KVGL 3K81A 3KXFA 2BSRA 4TTGA 3PV6B 1GSMA 1XFPA 4FQCL 5JW5B 5IMLA 2E7LE 3KJ4B 2MJWA 1U9KA 4ZPVA 3DTXB 5BO1L 5ICZB 5DA4A 1RZKL 1EO8H 1QFWH 1DUYA 7FABL 2P1YA 2R4RH 2ZUTA 3ARFA 4LEXL 5TJWK 2R2HA 4NSKA 3FZUC 4RZCA 1A3RL 2BVTA 4UV7H 1YEDB 2VIRB 1MLCB 1T21B 2Y06L 4TUJA 4OCSH 1CFTB 5HI3D 2XN9E 4PGDA 1MNUH 4KHTL 1CICC 4F9LA 1ZEAL 4O5LH 3I2CH 5FYJD 2AK4A 2IQAA 3DHMA 4HS3B 3IT8D 1CGSH 5LQBL 4NM4H 1GZPA 4PRAB 3V4PL 3KDMA 4PB0H 5E8EA 3WL9A 4DW2H 5IB1B 3DSFH 3F65A 4PREA 4OM1L 2Q7YB 3SDCB 3L95A 4MA1C 3KPSA 1A7NH 2DQFA 3TJHA 3V8CA 5E5MB 2VDOL 1I3GH 3AAZB 3PGFH 1A5FH 3FQTB 4ZS7L 4PTUA 4QTHA 5BW7A 3MNZB 1VFBA 3WHE0 3OGCA 5F6IB 2NXYC 5IK3A 2X4NA 4MAUH 3LPFA 4KTEL 3MRCB 1JYNA 3WYRA 4YDIH 2AEWA 1UWGH 2GK0B 5BS0A 4ZFFA 4GUPA 1NAKH 4P48A 1H3GA 5CJOL 12E8H 4HUUA 5ACZA 5BZDB 3FQRA 5T3XE 4FFVD 3CK0L 3NACL 3SCMC 3TFKD 4M7KH 2FX8H 3LEXB 1HKLL 1FNGA 5HHMB 4LMQE 1D7FA 2HKFL 2ZCHH 5B3NA 3DRQA 3FKUS 4U1SA 1X5XA 4MWFB 4JQVA 5F7EL 3P4OB 1RK1A 2G9HA 3S35X 1B0RB 4HAGA 1U8OB 4DN4L 4BH7A 1HDMB 2ADGB 3NCFB 4TUOB 3MOAH 3JXAA 2ZSVA 1NDGB 3C9NA 4MXVE 4GRLB 1EXUB 4OFDA 1T2XA 1YC8A 2DQGL 3EKCA 1AQDB 2ITDA 5BJTB 3QHTC 5FEBA 3G9VA 2WZPD 4Y5YB 4NT6B 3IF1B 4JQXA 4XNUL 4G9FD 4P2RE 5KVDH 4RRPG 3MRCA 3BP4A 3EYFA 5CZVH 5CZKA 3TN0D 3DRTB 3IDGA 4NDMA 3W82A 5E2VH 2VDOH 5DJ2B 4IRSC 5CILH 1FIGH 3B9EA 5ISZB 3TVMA 5ICXB 1MIMH 4XBGA 5LAXA 4HS6A 1MNUL 4PJ7E 5FOJA 1N26A 4HV8A 3O9WC 5I8EB 5E6IC 4GG6E 3MLRH 1MJ7H 4KAQH 1U92A 1JIBA 3BIKA 1D5XA 2OTUA 1YPZE 3CJJA 5I1LB 3JWDC 4JO1L 2G9HB 4WHTA 5HYSG 3ULUH 1JPFB 2JKXA 5GZNC 4YK4C 3TBTB 3LS5L 2F58L 3OXSA 1C1EL 4GXVL 1I7TA 1T2QL 1VFMA 4K7PH 3TBSB 5GS0L 3BDYL 2VKWA 2ITDB 4AZ8A 4UIKH 4HIJA 1K8IA 1UYWL 2P5WE 1X4ZA 3QUMB 4Q74A 2FD6L 2OJEB 1J0KA 1B2WL 1X3DA 4LSTH 1QNZL 5EUKA 5I16B 3WO4C 1CE6B 1FGNL 1EDQA 5INDA 5GGVL 5T33L 5FIEA 2HVJB 2VZSA 5E94B 2F74B 2W38A 4CVXB 3SDDB 1IAIH 3IFLH 5M7QA 3L1OH 2Y4SA 4KJWC 1KIQB 2C3WA 1ZS8A 4HXAL 3RPIB 5L0QC 3QZWG 2ZUXA 1FZJB 1N4XH 1PZ5B 1U92B 3BGFC 2IMMA 1VADB 4MNGA 1CQYA 4AG4L 3MRMA 4N8VA 5FYKE 5K9KB 4FXGA 1G7JA 3NABH 5JO5A 1WFUA 3AREA 1GYAA 1BFOA 5FHAH 5JDSA 1PGRB 3OR7B 3OF6A 1JGEA 1FO0A 1SM3L 3DGGA 4NN5C 1QEWB 4XX1G 5DUBA 3IGAB 4RNRB 1BX2A 3SE3C 3VXUA 3DETD 3PHOA 5D1ZA 2AQ2A 3DPBA 3BEWA 3G9AB 2FR4A 1UJ3A 4XCFL 3MX0A 4K8RL 5I8KL 1A6WL 4QOKE 4YHNB 1OB1A 4EOWL 1ZLVK 3MRQA 1AGCB 4Y19E 3PABB 1ZA3B 4MS8A 2P8LB 3ARBC 3VMPA 2V9RA 3HE6C 1H15A 3GUTB 1MHHB 5TFSL 5LG1A 4O02H 5DQ9A 2D0HA 1Q72H 1TVBA 3DYMA 2I60H 2CUMA 3QNZB 4OF6A 1S9WA 3ULVC 4RX4A 1G0XA 3OKNB 2QQNH 4FXGB 3S88L 3DI3B 2HWZH 1AJ7H 5IESL 1JPST 1JF1B 3V5KA 2A6KB 3N1GC 5I74B 4OLVL 3R1GH 2JIXD 3W5MA 4YX2H 2IADA 3BE1H 3OZ9L 1QLRA 3MRLB 3CFBA 1OGTB 1DEDA 1KPVA 4YBQD 5D7JB 1TIUA 4PYGA 2BOCA 4WV1A 4JAMB 4EDWL 5ADOL 5IJVA 4JY4B 5CP3H 1KJMA 1WC7B 2WMPA 3ZT7A 1VEMA 3ET9F 3WFHB 4PDCE 4HPOL 4FQ1H 1JUFB 2VLRE 1DTUA 4PRHD 4DFIA 5A2KH 1D3CA 4U1SB 3WFBL 2ICCA 4YBLC 5GGRA 5E6ID 2H6PB 4GRMB 4OLYH 1R3HA 3N50A 1K6QH 5B22A 4P5TC 3UTSD 3S37X 4PRIA 2NX5B 2PXYB 1LP9A 4XAWL 4KI1A 2X70B 5JXEC 4TUOA 5JIPA 4G3YH 4OF8A 2A73B 2FEDD 1MRFH 1QP1A 2LVEA 1OGAE 5DD0L 4JFQA 5DT1H 3RAJH 2L4OA 2WIIA 5H94A 3BPLC 4HJ0D 5IVOA 2BSTB 2EO9A 1QSFD 5IOPB 5JHDB 5JW3H 4L4TE 3FJTA 4U6YA 4G80A 3MLTA 5I1IL 5GS2H 1NDMB 5TH2A 1EH9A 3AMKA 4JDVB 1HINL 3CLEL 1W8OA 3C5ZC 4HBQA 5D2NB 1E4WH 1QRNA 5J6HA 2VLKD 5E1AA 5HGBB 1FL5A 1MCKA 2RJMA 3N1PC 4Y4KD 1U6AL 3RWGA 5IBLC 3WFHA 4TPRH 1I9EA 1KTDA 4AIZA 3TJEL 4FQ1L 4Z95L 2VR4A 1NGPL 3BAEH 1QLEL 5ILTH 5GIRB 4K94C 3TA3D 1MCFA 5I8EA 1JGUH 2ZCKH 4G6FB 4H1LG 1FYTD 1TPXB 2VR5A 1IKFL 4Y1AD 1IGCH 1TNNA 2R1YB 3MRJA 3OAUH 5I66A 1OWRM 3BKCH 1MFNA 5C0JA 1IKNA 5CHNA 3VFWA 1CF8H 4QXTB 1P9MA 1N5AA 1TTUA 2FCBA 2XKNB 4QHNB 5I76B 2HWZL 4I18C 1GGTA 5I1EH 3O3UN 1PG7X 2MSPA 3CZFB 3RNQB 4XAKD 4CUCA 4RAVA 2I60L 4K07A 1IBGH 2XWBB 5IVZB 3QEQB 3U4EA 5CJXA 2D03H 2HYMA 3SBWC 5MENA 1T2JA 2CR3A 1FLRH 5CEXB 3QPXH 4NQVB 3VWJD 4F15B 1LK2A 1KJVB 4R2GC 4UILL 1FQ9C 3QPQC 3HE6A 2F8XC 3SDAD 3VW3L 3OJVC 3P73B 1N64H 2EYRA 2J8OA 3DO3A 3MRHB 1D6VH 1J8HA 1KTDB 4AIZB 2F54E 5BRZE 3IB4A 2ICEB 4PJ9B 4M1GH 2RR3A 4DKEL 2W59A 1AXSB 3BDBA 1JL8A 4Y16B 4CVWA 5HGGS 3SE3A 5EU6D 4OKDA 1JHKH 2PNDA 1NAMB 3ULVD 2DQEH 4ODHH 5I6XC 3RGVD 2BVPB 5H8DA 1N5AB 4KRNA 1YECL 1TETH 1MI5B 3KPPB 1HQRA 1EAJA 4OFKA 2UY6A 1QSED 3EDFA 4IRJA 1LE9B 2KZ1B 1AY1L 3GMRA 4RAVB 4Y0GA 1V7NH 4K3GA 4Z7VF 5C0CE 2HRLA 5D7IF 3U4AA 4GKOA 3O6KH 1C16A 3VH8B 1I1CA 1EVTC 4PJDE 2Y9RT 3L1OL 5BMFH 3WXWH 3BP5A 5BMFL 2CJUH 2WANA 1WBXB 3FT3B 2A0LC 3MV9D 1I9JL 2GSGA 1JCKA 1K5NA 4JKLA 3QIBB 1YMMD 2HN7B 1S78C 1N6QL 4LHUD 4OZ4B 3S3SA 4AENA 5I71B 3O6KL 3RWDA 4BYHA 1BOYA 1FL6B 4D9QD 4XMKL 4KJQC 5IHZB 1LO0H 3U36B 1B90A 4LEOA 4OCXL 3ROOA 5HHOD 5B3JF 3HE7D 4Y16A 3HRPA 3MCKB 1TVBB 4J2XA 5CP7B 5JXAL 2HLFC 2D7PA 2H2SD 4ZFOL 4G6AC 4MB4A 2BNQE 5KVMC 1HZHL 4JANB 2Y36L 1C1EH 5DTFA 5FYJH 3V5KB 1XF3A 3MNWB 2RAMA 3B9AA 1H3UA 4NBXB 1VEPA 4ZSOE 3UYOD 4XCYA 3OG6B 3K1KC 5FFLA 4YHZL 4JY6B 3E3QE 2WBJC 3KYMB 1YUHB 4X6EA 1NCCH 2FX7H 2ZSWB 2DQCL 1N64L 3SKOA 4E41B 1FFOA 4ZUSA 5HPMA 4MXWH 4YC2B 4D9RE 1RZJH 2X4RB 4XTRC 1FLRL 5F71A 4QRPE 1TZHB 3JTSA 4HXBH 1RI8A 4HWZA 3VI3E 4CRPA 5LJYH 3TJHD 1BM3H 3V5HB 3STLA 4NO5A 4NNPL 4Q9RH 1P2CB 4EI5C 2BC4B 3TBVA 4N90E 2E7CA 4JHAL 2FH6A 4P3CL 1CXEA 3MPCA 1MCWW 3U0WL 3DX6B 5E95B 2X6MA 1SMAA 2H9GB 3LH2L 2FGZA 5I71C 3LS4H 1DL7L 3RTQA 3ULVH 3QIBC 1H3WM 3L5IA 1C12B 1YNLL 5EUKB 1YEDA 5GISH 1OQOA 1FYTB 2B5IC 4F57L 5MEPA 5F9OL 5D2NA 4NRXB 2AQ1A 3KHQA 1OP3K 3EYUH 4Z7UE 4TTDC 3L3IB 1MRDH 4ZFGL 1EAPA 5DWUL 3VG9B 3JWDH 3LHPH 4RFNC 2LE9A 5FGSA 1ZHBB 4S11A 5C0AA 2OZ4A 3ZT5A 4QXUH 1UB6A 1LO2H 4XI5C 3SCMA 3BGFB 3KLHC 1NAKL 1YN7A 2PYEA 1WAAF 1FNLA 2V2TB 2VQUA 1YZZA 3MJ9L 5EN2B 1TZIA 3BQUB 3PWJA 3CCHB 1T5XA 2PUQT 5F9AC 4PTUB 4QTHB 4PJ7B 4TSBH 1FAIH 2NCMA 4ZS7H 1IGYB 3WV0A 1FLTX 5DMGD 4X4ME 4I3SL 2DDQH 5ISZE 1WWBX 1OOAA 5EZOL 4LSRH 3B4NA 3U82B 2R15A 3STZB 4LHUB 3WN5A 3UJJL 3QEQA 2EXWC 4RCAA 3FB5A 1JMZA 1HH9B 1UB5B 3QDME 1T22B 2QQNL 3RIAF 3WNMA 2Q76A 3S34H 3WIIH 1CDJA 1PSKL 4FG6D 4U1LA 2HT3C 3KPLA 1CDCA 4F9LC 2OBGA 3LY6A 5F9DC 2AJVH 3UTTE 3IDYB 3VGGA 5BV7C 5L8LB 3ABZA 1F4XH 2YBRA 3BZEB 1OSPL 3QG6A 4R96B 1MWAB 1KN2H 2Z8WC 2E7BA 5C6TH 3EOAA 1DQDL 5I73C 4NHCL 1QPXA 2V2TA 4XCFH 1PQZB 4NQXB 5LVEA 2X1WL 2VSCA 3L3JB 1M4KA 3HZVA 3S96B 4HK0B 3VE0B 2IEPA 1S9YB 3BD3A 2BCKA 2P5WD 3EFDH 4WY7H 3ARBD 4F7CB 5ICZA 2ATPB 1P4BL 2IAND 3I6LE 3JVGC 4HUNB 5B39G 1FSKC 2VLJA 3RY6A 5HHOE 5B21A 2OMNA 5C8JA 3EYVB 5KSBE 2HT3D 3HRZA 1QUNA 3NABL 3C09B 4KUCF 3SDAB 5EFIB 1ZGLB 1LDPH 5HI3C 4U7KA 2BNQD 4NZRL 1MLBB 2CK2A 3BZ4A 3MLZH 1JNNH 3QI9D 1IAKB 3D85D 3KPQB 3TNNA 2YPKA 5E8NB 1S7WB 4HCRH 4HCRL 2XXCB 4OLWL 2Z35B 3QUML 2JB5H 5HGDA 4AENB 2GJ6D 2DM2A 5D1ZB 1ACYL 4OFVA 3BZEA 3CFKB 1UJ3B 3KDMB 3OL2A 5GHWL 1W0WA 1BQLL 4OF5A 5T33H 1RFDH 2NY0C 3C6LD 3T65A 3QCVL 4PJIB 4E41D 3H3BC 4XVTH 4KK8D 1ETZA 1DBBH 1E6JH 3TESA 3BYYA 4UMGA 4Z7NF 4XHQA 5DRXA 4XPHH 1H15B 4U1JB 1J11A 4QRPD 2FB4L 2FECL 1INQB 4CN4A 3MBED 1M6OA 2AV1A 2PYEE 1OLZA 5INDB 3QI9C 5ACMA 4BK4A 4KK9C 2GY7B 5T1KB 5SWSB 4GG8A 3MJ9A 4JREB 2W0KA 1JWSA 5CINH 3C87A 1KIQA 3U7AA 4Z0XB 1S7RA 2OJZH 5C2UB 2FO4A 3HA0A 1QBLH 4WU7B 4FS0A 1MHEA 3CX5K 5FYLE 4FZEL 4YHOH 1OAQL 1TQCC 1D9KD 2CK0H 4ZTPL 3UAJC 4ZFZB 4MAYB 5HXMA 3AU1B 5GS1C 3EYOA 2VL5B 3ILPB 4PRDB 5I75B 4DGYL 1UFUA 4YDVA 2VH5H 2GJJA 5A40E 2YPVL 1F4HA 4KWUA 1P5UA 2HJLA 3WS6C 1YPZF 2XA8L 3LN5B 4X8JA 3SOBL 4GRMA 4JZOB 3TA3C 3PJSB 3TPUE 3QCTH 3D39E 4X99B 1U3JA 5DYOB 3RTQB 3MRFB 1FG9C 1KT2B 3LQZB 2DWDA 1NC2D 1MHCA 4KVCL 1QSEB 3D48R 1S7XB 2WIIB 1EMTL 2H26A 4KTYA 4H88L 2MHAB 4AIXA 1ROWA 2IFFH 1C5DA 1XGUA 2VDQH 4X8XA 2J4WL 3ARUA 2UZIH 5ISZD 2AS5M 2FYYA 4ETQB 3H3PH 4HUWB 1WICA 1UWEL 3IDNA 2OLDA 3R06A 4LKXB 4YO0A 4L4VB 1KCGC 1DDHB 3I50H 3QCUH 4W70A 1OAZL 3HAEA 3T3MF 2YOCA 3GIZH 5C09E 2EE3A 2UUDK 1IAII 3QA3B 1T0NA 1QO3A 1OGAB 3O3DA 1GVIA 3OKLA 2ZUQB 5JZ7D 4IDJH 1D5MA 3JWOL 4F7TB 1T3FA 4UIMB 3BKJL 4MA8H 3GI8H 3IETA 3KVQA 4EUPA 4ENEC 3WJLC 2BSED 2QQLL 3QUMA 4UU9B 5DYOA 3VG0L 2HKHL 3P9LB 5C0JB 3UJTL 1FO0L 3A6CH 2VLKA 5B8CB 1U8MA 5DMIH 1U95A 3D87B 1CIUA 4M61B 3VD9A 4YPGB 3AFLA 1P7KA 4GT7A 2MHAA 2CPCA 4JFFD 4B53A 2R69L 4X7TA 2MPAH 4BQ6A 1I9RH 5J0BA 1MCNA 4H25A 4HWBA 4PJDA 2GTZA 1EZVY 2BXYA 1FYTE 3DBXB 4P9ML 2XWTB 5HHXH 1AQKL 4U7SA 2DAVA 2DS4A 5MEOA 3E8UL 4J3SA 4R2GD 3ULUD 3QEGH 3MRMB 4JFQB 1WV7T 5D5MA 5C07A 2AV7A 3QDGD 2X1OA 1AO7A 4KI5C 4WI4A 1FRGH 3MNZA 4YHYB 1UM5H 4ONOA 2QHLA 1LWRA 3T3PF 2DBJA 3GSVA 3OHXA 2HMID 4HF5L 4PJAB 5HVHC 2J88H 3G5VB 1CL7L 2H2SC 4N1HB 4Y19B 7CGTA 4NQCD 2A9NH 1DQLH 3OKMA 4Z7NE 1MAMH 5JQ6H 2GT9A 5IEKA 1OCWL 3QBTB 4ACPA 3EOYG 1Z3GL 3HI1B 3VWJA 5D96B 4WI9A 3QR2A 5EUOA 2EDHA 3HE6D 1H0DB 4KHXH 5CUSH 5IEHA 3HMXA 3SY0A 1G6RL 5IP4A 1A22B 4M6OH 4U6HB 5HGDB 1C16B 2VABA 4R90H 1SBSL 1MCIA 1PX4A 5EU6E 1ED3B 3UTQA 2EDJA 3LN9A 4AMKL 1JGLH 5KSBF 2FBOJ 1DLHB 1S9WB 3V6OE 4PJIA 1WFNA 4JPWL 4FMFA 4GMSL 4JLRB 5F70A 3MRKA 4PGJA 3HG1A 2A6KA 1NGZB 3GSXA 3QXDB 1IEAB 4CW1B 2DQJL 2CXKA 1T1XA 4XPGL 1MI5D 4KJYB 5EU3B 1PEZA 1ONQB 4JDTL 4PJEA 1ZMYA 1NC4A 3KXFD 4GXUM 2EE2A 3IAQA 3OKMB 1IGTB 3S98A 1WQVT 4PG2C 1BBDH 4J8RB 5FO7B 2DTML 2EDOA 3MXWH 3KPMA 4ELME 3D0LB 3P0YL 4L8CB 1AR2A 5J06A 5CEZL 3VXOB 3LV3A 3T2PA 4ODWB 2ARJQ 1L9NA 1IARB 1ZHBA 3SKJL 4PJ9A 2FX9H 5CLWA 1HYSD 1LGVA 1TQBC 4XCYB 3TT1H 5GJTH 4N0CD 3CZJA 4F37K 1U8QB 1A1NB 4TQEH 4HKBB 4L4TA 4XP1L 4Y5XB 2R0LL 5DD5H 3OB0K 1TETL 5HYIA 5FAAA 1PKQA 3KYOA <