3KPLA

Crystal structure of hla b*4402 in complex with eeylqafty a self peptide from the abcd3 protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
total genus 73
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kplA01
1LP9A 4EQ3A 4CL7A 4LVNC 3CFDA 4R2GB 1E4XI 4AJ0A 4BUHA 1D9KB 1CLYH 3MRQB 2BXYA 5D7LA 4PJXF 3FHAA 5B3JE 3WIHL 3FFCD 1G9MH 4P2RD 1A7OL 3T4AB 4DK6A 3HE6A 3MBXH 4OQ1A 2NY6B 3CFJB 4NQDE 2BNQB 3RFZC 5SX4I 1TZGH 1E6JH 2VXUH 1DEEB 3L5WA 3QUZC 5C0AE 5I73B 3S35L 1TPXC 1FG2B 4RFEB 4BK5A 1FV1B 3D3VD 3F8UB 3V4VL 4LGRB 4PLJC 4JM2B 4PTUA 5JXAL 3IFNL 3A67H 5HDOA 2DQDH 3WDJA 4L5FL 4M48H 4ODBD 4KTYA 5T3ZD 1TETL 2VDOL 5C92A 2FBOJ 2FX8L 4QRPD 4BUGA 1PVHA 4JRXE 5LG1A 1HQ4A 2I27N 3NGBB 2HVKB 5DJXA 3V9FA 5D6CA 4D2NA 3I9GH 4X7SL 4APQB 3WCYA 1MJ8L 2MHAB 1PZ5B 1MLBA 5I8CA 4CVWA 1J5OL 2BVQB 1CDIA 1R6VA 4ELME 1C12A 3RVVC 1PQZB 2E27H 4FQLL 1YNLL 3CSYA 1OP5H 1WAAE 5HHMA 3QHFH 4KDTA 1VACA 3OR7A 1KULA 4AT6A 4FFZL 5LWYL 2AW2A 4PJBE 1K4DB 1C5DA 3NZ8B 3V6FB 5E5RB 5I1LB 1FNFA 3GSRB 4KK5D 1LNUA 4NQCA 1DDHB 2EDJA 5FYJE 4ETQA 1KJ2H 3MV8B 1AP2B 3BGAA 2XTJB 4XP4H 5C0AA 3PP3H 1AE6L 4YX2L 4AIZA 2ZG3A 3RDTC 5ERWB 5IV2A 5D7JB 4NZRH 4GXUM 1I7ZB 5C0RL 5DMGD 1NUFA 4MAYB 4PBWD 4KJQD 5JNYA 1LK3L 4I4WA 4K07A 4HHAB 1ZMYA 5H35B 3AAZB 4XNYH 4Y4FC 4U6VL 5EN2B 4JAMB 5DVNA 1B6DA 3P0VH 1R5WA 2G60H 3OKLB 4OM1H 4HJGB 2R69H 5IFAH 2M8XA 5JTWA 1OAQL 1VEPA 4LIQH 4F7EA 1K4DA 1CF8H 1U8MA 2X4SB 3CDFA 1EGJL 5TDOA 3E6FB 1KCUL 4GS7C 4ENEC 1ES0A 2DKUA 3AXLB 4NT6A 3T0EA 2O5XH 5KSUA 4D9QD 3U0PA 2A6IA 5JHDE 4ZTOL 3L5XH 3ALPA 2ADJA 2ZCHH 2X7LA 2BP3A 3TZVD 4HT1H 1UWXH 2IQ9L 3RIAK 1AGDB 3BJLA 4X8JB 5DEFA 3CUPB 5C0BD 1MLCA 4HWEH 4K55A 5D1ZA 5GS1C 1UA6L 4E0RA 1NGZB 3D3VE 3GSOA 3DVGA 4QHMB 5DURB 3X3GL 4F9LC 2FH8A 2GSGB 4BQ8A 1S3KL 3QIUC 1FSKB 2VWEC 1QQDB 5C0BA 4Z7OF 2BY2A 1WBYA 1T20A 3FB5A 2P8MA 1I3RA 2AEIT 2YD2A 4NHCL 4NKOA 4XVTH 5GSRA 3VG0H 4MCZA 4PRIE 3QPXH 1IC5L 2IWGA 5TFSH 1TQBB 4KDWA 5EC1A 3QDGE 5KVFL 3U0TA 2DM2A 4NQDB 5D1XD 1S7QA 4JG0L 1IGCH 4H20L 4K94C 4PJAA 2OI9C 4NYLB 4K7FA 1UFUA 2VH5L 3F12B 4DVRH 5IK3A 1I3GL 1JVKA 1S7TA 3HZVA 3FB6A 4ODXB 1S5IH 3RWGB 3BKYL 5FYLE 5TF0A 3QG7H 5K59F 1CDUA 5E8PB 1SJEB 1BQSA 1Y6NR 4JCMA 1FDLH 4FN0A 1WITA 3AS1A 3V95A 1NC4A 5SX4H 5J57B 3QEHA 3LKQA 4M7JL 5T1MA 2DLFH 3NACH 5IHZB 4NQCB 5FYKL 1EEZB 3GSNA 4QY8B 3GIVA 1YEGH 5EOCJ 1H3PL 2VLKD 4KRNA 5IFJA 3R4DA 3OJ2C 1RUKL 4NO0A 5E8NA 5IMOA 4XWGL 4XX1G 2GFBA 4N90E 2AABH 3EJYC 1IM3A 3LKSB 4Q6IC 2VLLA 5KTEH 3LSOA 3JTTA 1K3IA 2GCYA 1XGQB 5DO2D 1UM5H 1AY1L 2FB4H 3NCJH 4KZEL 3DSNA 4HKBB 1YY8A 2AK1L 5MEPA 3QCVL 4J3XA 2IAMA 1VCAA 2MWCA 1K5NB 4WHYH 3SO3C 5CJQH 1FIEA 3PP3K 1BQHB 4BJLA 4MDIB 1X5IA 1P9MC 4LAQL 4OCSL 4PB0L 2V5TA 3FN0H 4YO0B 3GRWL 4UTBH 7FABL 4QCIA 3REWB 3VXRE 5L8LB 4KRPD 4QRPA 3BT2L 3BSZH 5AEAA 4NWUL 3UXFA 1BECA 4N8VB 1YMHA 2HRPH 3D2UB 4GQPH 4PJ5D 3MGOB 1QSZA 3H9SE 3PDGA 2V5SA 3E1F1 4F7MB 4DKEL 3TJEH 3L3OB 3STZA 2QR0A 1JK8B 3SO3B 3A6CH 1G84A 2EDOA 1MHHB 5JDSB 4ZOAA 5IVZB 3GSXA 3ULUE 2EECA 3O9WB 2HFGL 2P7TA 1XIWB 3W5MA 2AJVL 2BOCA 2MPAH 2PW2B 4FFWD 2Q8AL 4NBXB 4IOFC 4AH2B 1DEEA 3L5WB 1HDMB 4WFEE 2Z31C 5HHPB 3RI5F 5IW1B 4JO1H 2W0PA 3C87A 5C08E 1SEQH 1UYWL 1I3RB 4GQ9L 2YRLA 1E4WL 2XQBL 2Y07L 4UTAH 1JBJA 2LU3A 3IXAB 4H1LH 1XGRA 1RIVH 1OGAA 4GS7B 5A1AA 5DZNA 1U8QA 4BQBA 3FMGL 5F8RC 1ZA6B 2R39A 5ALCH 4PREB 1RZIB 5ABDE 2ATKA 2GEEA 3V6OE 5FYLD 3OAUL 3DX8B 1UKSA 4XNMB 5B3JF 2JCCB 4BFIA 4YX2H 2AK4B 1I85C 3P4MA 1OCWH 5JXEA 1WZLA 3RUGF 1P69B 5JW4M 1AO7D 1I9EA 5DD3L 3LKNA 2DQJH 3R06B 5T1LA 2E9WA 3VJ6B 3RZCC 2ITDB 4XZUB 3IDJB 4KKLD 3BGMB 5I2IA 3M07A 4G6AC 4TTDC 2WBJB 3RIAF 3X11B 4Q0XH 4A2MA 1RZ8A 1JI2A 4K23L 2AV7B 3RNKA 4M3KB 3IDMB 1N8ZA 1XGUA 4MD4B 5ACMA 4Q9CA 2HVJB 2NY2B 3QZWG 5T5NF 3Q48A 2CH8A 3GHBH 3VFUB 3T3ME 5HPMA 4KXZI 1V7NL 4YO0A 4HH9B 2DQGH 2IBGA 4IHOA 3FRPG 2NW3A 1FL6B 2F19H 2ADFL 5HYJD 1BF8A 4XPTL 1FNEB 4LSSH 2VXTH 2Q20A 3D2UA 5C9JB 5I6XB 1U3HD 1U3JA 4RQQB 5C0AB 4XP9L 4KKAD 2PW1A 2CGRH 2VISB 1JK8A 4NQCE 5IHBA 1WCQA 5IIEB 3V4VH 2DD8L 1FNSH 3AMLA 3HC4L 5EUKA 2WBWB 3LZFL 35C8L 1S7WB 1MFBL 4U4BA 2OS7A 5TDOB 4OM1L 5FB8A 4WFFE 4Z7WB 1WUNT 3NVQA 3EYQD 4TN9A 3DX9A 2B0SL 1K9TA 2CO7B 3BW9A 2XZAH 2AQ1A 2DF3A 2H6PA 4IRZL 1DQQA 3O6FB 1T1ZA 3OQ3B 3MJ9A 5IHUL 1IAIH 5JIIA 2VLKB 3TNMA 3ARBA 3MCLH 5GS2D 1MCWM 1IQWL 5CLWA 4RQQA 4NNPH 1U8OA 3VXRB 1ONQB 5IHZA 1Q72H 2NX5A 1QZ1A 2VSCA 5TE6L 3KPTA 4MD5B 4HX1B 4NN6B 3MNVB 3TH3T 1BX2A 3QQ3B 1A1NB 4N0CD 1LNUB 1XH3A 1AJ7H 4XX1E 4DVBA 4MVBC 1BP3B 5CGYC 5T1DH 5FF6A 5E9DB 2BDNL 5BW7C 2F8XC 1QUNA 1RIUL 1DR9A 3R06A 5DD5H 5EUOB 5F89B 2XA8H 1WFNA 3O4LA 1IQDA 3MGTB 2MCPL 4ZFGH 2WBJD 4QTIL 3ARDB 3U0WL 3MLVL 1NCBL 4S11A 3MUY1 3GSWA 5I16A 3ARZA 3BP6A 2QLVB 2YMXH 3QWQB 2DWEA 4ODUA 1A14L 3TZVA 5FCUH 5D70H 1WWBX 1HCFX 1R3JB 4KJWC 5E4EB 1OGTB 1DBMH 2IQAA 4MXQD 1MPAL 1YEFL 2DQCH 3V0VA 4P4KC 1LO3H 3QNZB 3TPUB 3H9YA 3QWRD 3CPLA 1QFHA 2FL5A 2UUDH 3T2NH 3I3DA 5IBUG 3OHXB 4HGKC 4PP2B 1O0VA 2ESVE 4NO2B 3GGWA 5I76A 2APWA 1AD0B 4PTUB 3O0RH 5JQ6H 3M17A 3P4NB 3O4OC 1U58B 1MCPH 3DURA 4HUUB 5GGTL 1T2JA 4CVUA 1B0GB 1NFIB 3GKWH 1G9ML 1REIA 2BOCB 5F3BB 1T4KB 3G5YA 1KN2H 5CEYB 2CKBH 4XP6L 5TDPB 3PV7A 3I85A 3T0VA 5FV2A 1CFBA 4GBXB 4PJIE 2CR3A 1RY7B 1U92A 4PV9A 5IBTL 1NGXA 3LS4L 3VWKB 5D7JA 3FJTA 3I6LE 4UT6H 6FABH 1CIDA 1MNUL 4X7CC 3NPZB 2IFGA 3D25A 1UWXK 3QIBA 1BIIB 3IXTB 3PQYE 3L95A 3WE6B 2O93L 1JWMB 2ZG2A 4L4VA 3V5DA 1RMFH 5EBWA 1GPOH 4N0UE 3UTQB 3IETA 4P9ML 3HR5A 1RHHB 1RZGA 1XAUA 1S7UB 2DBLL 3PWNA 1CZ8H 2F58H 2F15A 5KZCB 2Z35B 5CD5D 3QP3A 3NCYP 2R0ZH 3JUZA 5DJ8B 2E8ZA 2NXZC 4JQIH 2P45B 3TIEB 2DQUH 3F7QA 2Q8BH 2O61A 3FFCB 4P2RB 3MYZA 1U8HA 5EZOL 1J05A 3MYJB 1UKTA 3NIDE 1XGYH 1KTLA 3L3DA 3EYUL 4G8EA 3HN3A 4PJ7E 4QRRE 3MRFA 2OL3H 4JHAL 4POZD 1FFQA 5ESVA 1FJ1A 5FOBA 3O8XD 2VL5B 4UILL 1QRNE 2F9BT 3MLZH 3TIDA 5E2VL 4HIXL 5C6WH 4YDVA 1AR1D 1UB5B 1D5ZA 4FQIH 2KBGA 3T77A 4X4MA 1WK0A 2Y7QB 1YMME 4IJ3B 4BZ1H 2C9AA 3FB6B 1CE1H 4OGAC 1DBJH 1HNFA 5GJTL 4S0UC 2EDEA 4HFWB 1G7PA 1Z0MA 3VRLF 2J5LB 3DGCR 5ACZB 1QSED 5ANMB 2VXVH 4H1LA 3EYOA 3DI3B 3SJVA 5LXGH 5T3XD 1ZEAL 3S97C 4U1MA 3MA7B 2DQFB 4JY6B 4N1EA 4TSBH 3HA0A 1QEWA 2GITB 2HP4A 4RGOH 3TN0B 4JDVB 5KSVB 4ENED 4OLXL 1J87A 3MRQA 1DL7H 5CBAA 3SDYH 1I8MA 4PV9B 5HDQL 5ID0A 4KVNL 1SVZA 2CMRH 4N8VA 2B4CC 4JVUA 1W72L 4X6CA 1H5BA 2XT1B 1JPSL 2QKIB 4X6FA 3TO2A 3E2HA 3O2VH 1UZ6E 3OJDB 5FHAH 4FHBD 1INDH 4WU7A 5CJXC 5AUMA 3QQ3A 1AFVH 3T4YA 1JHLL 4NQEB 4F3FB 4TOYH 3FO1B 4KVNH 3GSVB 2EH8H 4PG2C 3BXNB 3C60B 5EZLB 5FK9B 1PG7X 1KB9K 2ZPKH 4HF5H 3K74B 4UT7L 3B2UC 4M6NH 2ADJB 2HYMA 3BRFA 2BXZA 3LMJL 1I3VA 4OFDA 4JO3L 4KKLC 4XNXH 1E27B 1L0QA 4R4ND 2EIZA 3UTTB 2WIIB 4WV1C 3BP6B 5DDHA 2ESVA 3X3FH 5E56A 2XFXB 4KUZL 2VXVL 2CK0H 3EZJB 4R4FH 4XPAH 1CFVH 4DW2H 4WI7A 4AT6B 1CE1L 5E6IC 4NOBA 1QNZH 4PBXA 4JZJB 1NCDL 1HQRB 3E3QE 4FQHB 2AK4E 3KNBB 5ICXB 2PETA 3ZKND 3F58L 1URLA 2CJUH 4U7MA 1IARB 1CCZA 2JB6A 1BFSA 3D39A 5I1DB 3IKCA 3G9VA 4GAJH 2I9TA 5H2BA 1CFTA 4YEFA 4WV1A 4C57C 1U8LA 4U1LA 3LIZH 2UUDK 5A2KH 3QYCA 3MA9H 4MXVE 2WWKO 4P2QA 1XGYL 5FO8B 1NGWA 2BSSB 2VLJE 3WNLA 2XN9D 4YWGL 3VD7A 1QSEE 3RX7A 2XPGB 4J4PC 2HVJA 3QUZD 3WIFA 3IFPA 4XCYB 2J2ZA 3GSNL 4P23D 4YPGA 4OZFG 4LGSB 2DB8A 1YQVL 4QEGA 1OL0A 4WNQB 4CN6A 3VWJB 2YPKA 3V7AG 5E2UL 4OT1H 1CT8B 1I1RA 3BD3A 1B4JH 4HGMA 4OM0H 1EAPA 1GCFA 1FBIH 1JE6A 5DMJB 1BD2E 4XBGB 5DJCA 5I66B 2H32B 3V0VB 3QIWB 3QO1B 4P3WA 5I18H 3FB7A 4KK6D 3QJHA 4LAJH 1TMCA 3OHXA 5C0AD 1P7KB 4PDCE 1J1XL 1R3KA 4JPWH 1FYTD 3OB0K 3IJSB 4JPVL 2HLAB 5ANME 5F9WB 5E08H 2VZ3A 1AO7A 2IANE 4ODSH 3KG5A 2X40A 1MQKH 2LQRA 3OXSA 1I85A 4HG4K 1H5BB 4WUUA 1SBSH 4O4YH 1FFNB 1NKRA 4N0CC 1BZ9A 1YEHL 2EDFA 4DQOH 4WWKD 1PKOA 4EZMA 4OLEA 1NCCL 1CXEA 4P99A 3RWJA 1XR8B 3P4NA 5F97E 1RFDH 2A0LC 2X1QA 5DMYA 1WC7A 1DBBH 4RAUB 5FO7A 4LQFL 3VFWB 1X4XA 4ZFOA 2P47B 4PJDA 3VFNA 3QUMH 1M6OB 4NC0B 3TWCH 2QSCH 3BZ4A 3GSQA 4V1DE 3LV3B 2AK4D 3U82B 2YMXL 4BZ2H 4CDHA 2P7TB 2MOVA 5K93A 4FQQB 1KB5L 3E3QC 2A6DB 1HXMA 5J1SC 3SEPA 3MV7E 2VDQH 1JNNH 1G7MA 3HC0A 4KV5F 5DJ6A 3DUSB 4P5KB 1UM6L 2Y4SA 3S88H 2J3SA 4DN4L 1JNNL 3HZKA 4LLDA 4YQXL 1LK2B 1ND0A 4Y4HB 1CLCA 1BVKB 2OZ4L 4YGAB 3UTQA 4XXDB 1MFCL 2OX5A 1QQDA 1HSAA 3G6DH 3CZFB 5E00B 4OIAA 1U3HC 2B4CH 3BMVA 3LN4B 3TPUE 4KKCC 2P43B 4HAGA 3L5JA 5GJSH 3ULSB 4AH2A 5BOZG 3REVA 2CXGA 1LO4L 2QSQA 1FRGL 1CLOH 1DEDA 4HC1L 3EDDA 1NCWL 4CW1B 2FECI 2YPKB 4NPYB 1HYRC 1KTDB 3KWWA 5BW7A 1U8OB 3SKJH 3EHBC 4JRYB 1NBZB 1RI8A 4P57A 4OGZA 3SKNB 4J3OC 2F53B 4R7DB 4LARL 2EE6A 1OTUD 2XZCL 4YXKL 4PJFB 3T65B 4AYFA 4PJHE 2D9QB 1O7SA 4ZPVB 4WY7H 2OCFD 5DTFB 2I60H 3TT3L 5FM8A 1YEHH 3ZDXF 4JHWH 3BI9X 4LPVA 2XG4A 1JCKA 5BV7C 5C0ND 2A74B 4FTVE 4G9FA 3WNPA 4Z95H 2ARJQ 5F7DA 4KRPB 5HD8C 4WHYG 5C0CD 4NGHH 3SDAA 1KLGB 3JV4B 2EZ0D 3IDMA 2J4WL 2YXMA 2FSEA 3LKNB 2EDLA 2O26U 4WFED 1TQCC 1FGVH 4WW2F 4AM0A 3DIFA 4XP9H 4YHIA 1UGNA 3VH8A 5IMLA 3KNBA 2VXTL 4JO2L 3HB3D 2ICWI 1EHNA 1A3RL 3RWIA 4DCQB 2H45A 2JIXD 5T1KA 2P5ED 5J1TC 3WFEL 3BWAA 4KUCD 2IG2H 3O81A 4N0UA 2YA2A 2JJTA 1BZQK 1EZVX 2V2TB 2M2DA 1BWWA 3PV6B 1OF2A 3ULUC 4N0CA 3O4LB 1QFWM 5E2TH 2YPLA 3MROB 3WKMH 4GKNB 5GGUB 5EO0A 5BXFA 4U7SA 2NX5D 1QR1A 2P46B 5BQ7B 1QFWH 2D4DA 4PRPA 1X5KA 4PRPD 3DX6B 3KYMA 1RUQH 3X14A 1G6RH 1XR8A 3MLUL 3VFMA 5EA0H 1ZK9A 2IC2A 1PLGH 1SHMA 4GRLA 4RMQA 5J8OA 4L4TA 1MVUA 1IGYA 1XF3A 4U6HB 3QFJE 4X6EA 4WHTB 2L0DA 4FNLH 4WO4C 4S2SA 3VXNA 5A2IH 2BHYA 5SV3A 3RAJH 3NIGE 3IGAA 3VXPA 1BBDL 4I48B 4ODHL 4ZFOL 3BN9D 3IFOA 2COQA 5DWUL 3TEUA 3DMMB 4UOW1 1RZKC 3L1OH 4I0PA 4KJYA 4NFBA 3FB7B 2VUOA 3CSBA 3GHEL 2P8PB 1A64A 3I6KB 4K7PH 4ZAKA 5TH2A 5J0BA 5K9OB 2W65A 2AVGA 4EI5B 4QXUL 4HFUH 2XQBH 5FYLL 4C55A 4XCNA 1U3HA 4XVSL 4H26A 4XTRD 4ZUTA 1K6QL 3MLRL 5I30H 5JW4R 5B21A 4P4RB 5CJXA 1LO0L 4M7LH 1GAFH 1MRDH 1RK1A 3FOMB 1BFTA 2AEQH 4HWBH 4JM4H 4XAKD 4M61B 4N8VG 3W39A 5ACZA 2X44D 2IADA 3HNTL 5IVOA 1KJ2A 4FFWC 2PYED 1EMTH 3DTXA 4YZFE 4WV1B 3BKML 4LF3A 3HI5H 4PJFF 4YNYB 4C56E 1JHLH 4YHZL 1U8JA 4AM0B 2WINA 2UWEE 2E7LE 2EE2A 3QI9B 3NGBC 4JFZL 3C8DA 3DXAB 2H8PB 1F3JB 2VDML 2OQJA 5DTFA 1P84J 4MB5A 3BT2H 2VQUA 4H1LG 3VD3A 3WFZA 1DBKH 3NA4A 3GRWH 1KCSH 1PY9A 1HI6A 1S8DB 1ZT1B 1BREA 4GAGL 4G6ML 2RJMA 1C12B 4XZUA 1HIML 1DQMH 3UTTE 2NY0D 3T0WA 2NY7L 4K8RC 3RIFF 3DUSA 4P5KA 3AAZA 3QUXB 3PWUA 3N1QC 2NY6C 5F7EH 4JFEE 2CDEB 1UH2A 3QO0A 5DVMA 3VMPA 1LEKB 2YUWA 5F70A 1JGDB 2ORBL 2IBBA 5EZLA 4S1QL 3LRHA 4N0YH 4ZS7L 1A7NL 3SBWA 4Y2DB 2EH7H 4NKMA 4G8FA 1QBBA 2ZSVB 5C09B 1F3JA 3MXVL 4NNYB 1CGTA 5ISZD 3KDMB 2L7JA 1U92B 4OB5H 4LRNH 4L4VD 4X9GA 3KR3L 1A6VH 4HS8H 4GW4B 2FO4A 2APXA 1G9NC 1YEDB 1L7IH 1T7ZA 4QRTA 1M7IB 2VIRA 3DVNA 2UWEA 5AUMB 5DD0H 1XF2B 3EYSL 3QJFB 2NY5C 3QXDA 1BZ7A 2G75A 4QXTB 1ETZB 4LSUL 1QFWI 4ZUUA 3CD4A 4H0GA 2YD6A 1FVCA 2XN9B 5JW5B 2J88H 1WC7B 5EZOH 1U8IB 5IW3A 4HFUL 4P23C 1ZXQA 1EH9A 4JHZA 1ZLUH 5KS9A 4K7PL 1LD9A 1KJ3L 5JZ7C 2B7DT 4RMTA 1ZS8A 3RWFA 1KCLA 5IW6B 3ZMRA 2P42B 4WENB 2XNAB 3EOAA 5DWUH 2DIBA 5DS8B 3T3PF 1YJDC 3QULA 3ZE0E 1FN4A 4ODHH 5DJCB 5LGJB 1EZVY 3ZKXC 3VFOB 3RWDB 2UZYB 1RJCA 3HC3H 5KVDL 2D0FA 4XMPL 3I6LD 1XF2A 1NGYB 1G7JA 1ZLWH 4G7YL 4WUUD 1PEZA 3PQYD 4P23A 4XXCC 2AXJA 1AGCB 3KJ6H 5HSFA 4E41B 3V4UH 2EDBA 1KN4L 1XCQB 4EDWL 2IANB 2X10A 3D85D 4M4RA 3VI4E 3B83A 3VMNA 3ES6B 4EEEA 3WKML 2R9HC 5K9KA 1MHHA 1SVCP 3BP4A 5HVHB 1U8MB 2Q7YB 2VLRE 4RWHA 2GYSA 1CXHA 2VXSH 1QKZH 3CC5A 3GKWL 2NZIA 4OZFB 4I18A 1DBAL 2NW2B 2X4TB 1PBYA 4ZXBD 5BV7L 4CJ1A 3W0WE 1A3RH 4RMVA 5F9AC 4EN3D 2FSEB 1OAQH 4U7KA 2JELL 4G80B 5T3ZE 1ERNA 4X98B 3KDMA 3MOBL 5D1XA 3MRCB 4APQA 2E7MA 1YEFH 2DQCL 1YUHA 4H88L 8FABB 3HRPA 4CKVX 1I1FA 4QHUA 3JV4A 1VGEH 4Q9QH 3CAFA 3FQUB 2VDMH 1X5GA 5GSVA 3DX9B 3ZDXE 2N1KA 4F15B 4R6UA 4YR6B 1C5DB 4WI4A 3MUZ1 5KVEH 3GUTB 4K71B 3VRIA 1QHOA 4ZFGL 3CVHB 1WZ1H 4TSCL 1FO0A 5FGCE 3FO2B 3RDTD 3VXME 1J11A 4ODTH 4JFQB 4YGVB 3U4BL 5ESQB 4LHUB 5CAYB 1UZ8A 5T1DL 4HWBL 2AEQL 4JM4L 4KKCD 4J23A 4OCXL 3T8XA 4FFZH 1IZJA 5E1HB 3SKJL 4BH7A 1MRDL 4UT9L 3QHFL 3T0EE 4FXGA 4EN3B 1T4KA 3G5YB 2ATPB 2B5IC 2ZUXA 5FAAA 3IETB 1EHLH 3ARGD 4O9HL 2OR7A 2NXYC 1R3LA 4NO3B 1G9MC 1J86A 1JRHH 4NNPL 4ZDHB 4PJHB 1KPUB 2AGJH 3UYPA 5F9DC 3RVWD 5CEZE 4FG6D 1S7VA 3CX5K 3QRGH 4FP8H 2JK5A 4PRNB 1X5JA 4N5EC 4PRAB 4LMQI 5D5MB 3EO0A 4WW2C 5A43C 1LD9B 4MNQE 5JO5B 4ZAKB 5TH2B 1FG2A 2C1PB 2R0KL 4NC1E 1DN0B 2YSSB 1HXMB 2DQEH 2APVA 4XBPA 4EKXA 1FZMB 3BDYH 1AGEA 3NIGF 1DQLL 1NCAH 2MCG1 3ROLB 4LASL 5MENA 2D03L 2OJZH 4GBXC 1MJ7H 5TE4L 5HHVL 4G6FD 5L7XL 3KLAA 4PG9A 3TH4T 1KENH 3HRZA 4HPYL 1MFBH 4PJXE 4YHPA 4OGXH 1RK0A 2C3XA 2IH1B 1KCVL 3I6KA 1H3TA 3LEYH 3VXMA 3KPPB 3CFBA 3H3BC 3GGWB 4FXKB 3AY4C 2HG5A 2Y7QA 2VLRD 5E5UB 4PJGB 3BFOA 5SWSB 3W9DA 5J6HB 3V0AC 1HYSC 1FPTH 3O8XA 3QDJD 1TVHA 4Y2DC 4WIQA 1G9NH 2VZVA 3L3DB 1ZGLP 1JI1A 3H3PH 4DOHB 1EBAA 4KZDH 5DA0B 5F96H 1SYSB 4RNRB 5DT1L 3MRFB 3V5KA 3DX8A 3MA7A 1S9XB 5E4EC 2IBZY 4ZOEA 4H25A 3U4EA 1N5YL 2L4OA 3CSGA 1IGFL 2ADGA 5FIEA 3RQ3A 2VITB 2GY7B 2H32A 5IMMA 2XWJB 1OGAD 4OQTH 5HDBE 1CBVL 4NRYB 3DJ9A 4HUMB 2P5WB 4OLZH 4JLRB 4K3GA 2J4WH 5SV4A 3C6SA 3SPVB 3PGCB 4KHXL 2ZJSH 4OFVA 4L4VB 2YPLB 3V5DB 5DMKA 4NJ9L 2PTTA 2IFFL 2YD8A 4LRIA 1H9VA 4M6AA 4BSVA 1JPFB 4OCWH 2CRZA 3M8OH 1OCWL 1NFDE 1S7UA 2W07A 5DMIH 5AD0B 3QXAA 3OWEA 1HQ4B 4DN3L 3RZCB 5HYQB 3GSRA 2W1NA 3BH8A 4OLWH 5DJ8A 1FORH 4LQ1A 1E4XL 1FQ9C 2FX7L 2R4SH 4JN1L 2GCYB 2ITCB 3RVTC 4J3TA 1WFTA 1QRNA 1LP9E 3OGOE 1P9MA 1WV7T 3DVFA 4YWGH 5A3IC 4UU9B 4GQ9H 1G7HA 1A3QA 3NFNA 3OPZL 2WUCL 4ODWA 4PJEE 1WZKA 1RZFL 3B8SA 2OZ4H 3B2UD 3HNVL 4JFDA 4GAJL 3VWKD 1NFIA 3MRIA 1QA9A 5CSZB 3G04A 1NLDH 4ZNEA 1JPTH 5J1AB 3U9PH 4UAOC 2BSRA 5D7SH 3LD8B 5DJ0A 3SE3A 4R90L 2QQLL 3P11H 1W8OA 2LTQB 5DJ2A 3SKUD 4Y5XC 4WO4B 2ICES 1NC4D 2Z91A 5IB2A 5D71H 2CUIA 2WY3A 5EOQL 3MBEA 2XFXA 3U9UB 1KC5H 1PJ9A 1RZJH 3MCKB 2WWKT 4H5SA 2AEPL 1V05A 3V6OA 5E94A 1SYSA 4I0PD 2QJDA 4XMLL 5ISZB 4GW5A 4L1DA 1MVUB 4YFLI 1A0QL 5DRNA 4M43H 4JANA 5TQ0L 3UPRB 2ZSWB 1N59A 3K8KA 4WTZG 1AO7E 2IANA 1XGRB 2IQAB 2XRAL 4KZEH 5F3HB 1XEDA 3DVIA 2IF7A 4UDTB 2HG5B 4Y1AE 3FB5B 3WJLA 2QKIA 3SKOB 4WW1B 3IFOB 2UZXB 3MBEC 1NC2B 4CU8A 3X17A 1N2RB 5E08L 3L3IA 4AENA 2ENSA 5DJ2B 5CBEA 5GRZA 4JPVH 4ODUB 1I8KB 2G2RA 1ZA6A 1NGQH 2WUBL 3MUHL 1P1ZA 4AEEA 3VI4F 5IQ7H 2FX9H 2X89A 3DECA 3CFIC 5DC4B 4NP4H 5DK0A 5JA8B 1WAAF 2ICWB 1S5IL 4P4KB 5GGSB 3KJ4C 2G5BB 3DO7B 2KQMA 1V8HA 1BGXL 2NY6D 3VFSB 3ZE1F 3WEXB 2PYEB 2BFVL 3PGDB 4PJBF 3UC0L 1HKLH 4RWYL 2ADIA 2ZOKA 4HJGA 3LN9A 4QYOB 1KELH 2J1KA 5EO9A 5K9JL 5DR5L 1QLFA 4PUBL 1DBJL 2R1WB 2JB5L 2VTFA 1TMCB 5GRJH 3C08L 2VL4A 4P46C 2YPLE 3G04B 1MFEH 1NGPH 1HCVA 4HIXH 4ZO8A 5IF0B 3S35X 5T3XL 3BZEB 4UILH 3CCHB 2J8UE 2Y6SC 3MNZB 1JNJA 1WWAX 5BJTA 4Z8FH 2IALB 2IPTH 2X4NB 3FTGB 4OUUB 2NY0C 4NKQB 1PGRB 2IBZX 4U1NB 4X9FA 4NN6C 3FO0H 4KQ3L 1A5FL 1Q9WB 1Q0XL 3WSQH 1QFUL 2E7BA 1CU4H 4L8CA 1JNHB 2MKWA 1BLNA 1DUYA 4MXWL 1RURH 5FDWA 3Q6FA 4LLQB 1ZA3A 1ZLVH 3QDJB 5C0FB 2V9QA 3OXRA 5D1XC 5EIVA 4JFFA 4OZHB 1NL0H 3C6SB 4GKOA 1MY7A 1YDPB 5EH1A 4HPOL 1AD9B 2C7UA 5A2FA 5JXED 1CZ8L 4DGYL 3SCMD 4MQ7B 3QZWB 4OLVL 1ZTXL 2O5ZL 3T09A 1F6FB 4R8WL 4U1KB 4X4XB 1CK0L 1AGFA 4G6FB 1CF8L 1D5XA 2VDNH 4OF5A 3QULB 1PDKA 3V7AE 4LCCC 4LLDB 4MYWB 4KK6C 3I50L 1FVDB 4MLIA 2I25N 4F9LA 1MH5B 4M5YH 1U8NA 5GXBB 2H32H 4NM4H 5LBSL 3UJTH 1EJ6A 1INDL 5INDB 1OB1B 4MMXC 3ARGC 3PHSA 4PB9H 1NBVH 3BHBB 3TJHD 2X4PB 3BUTA 1JPSH 3VXMB 4P4KA 5GGSA 5EPMB 3OV6A 1U8QB 3ARFB 3HAEB 1DFBH 3SGJA 1WF5A 1JNLH 1YEKH 2A1WH 5GZND 4KJYB 2GITA 5D7IF 1MCWW 3T2NL 3F7PC 4LEXL 3ILQC 2F5AH 2VQTA 1J88A 1MSPA 4PJ8C 1P4BH 3C9NA 3WHXA 4P5TC 1LO5B 1M7IA 2IAMB 3PL6C 2PXYC 2I5YL 2X9WA 3MLTB 9CGTA 2BHZA 3KPMA 1FSKC 1A6TA 1FVEA 1KV3A 1D9KA 2QTEA 4U2ZA 3EFFB 2RB8A 4PRHB 3VD4A 3ZDYF 1CD8A 1NPUA 3UPRA 1Q0YL 1N4XL 2VXQH 5I15L 4WTWA 1DUYB 1P6AB 4GW4A 2NMSA 3SQOH 4L5FH 1U8PA 1X7QB 4OD3L 2WAHA 3T77B 3FQTA 4NQDD 4MCYB 3TVMD 1F3DJ 3MOQA 1SEBA 3WFCL 5DD1H 3FCTA 4OLUL 2VLMD 4MQ7A 4PJGE 4KU1A 4XP1H 4PJHF 3VWJD 2FBJH 5EZJB 3MBXL 3TJHC 2W9DH 3MLPA 3QNYA 1ZVHA 1JFMA 4WW2A 4JZNA 1ULVA 5L8KB 2R0ZL 4TUKH 3QDMB 3Q6FB 4HEME 5FB8B 5HHQB 3QUZB 1IGJB 1A1OA 3IRPX 4I3RL 1TTUA 2D7MA 1CWVA 3RX5A 1D5BB 4OZ4A 1F13A 4E42B 1WIPA 2BERA 2Z35A 3H9SA 4AMKL 3MJGX 2F54D 4LLMA 2GK0A 3ALWA 4LVNB 3HC4H 4OZFH 3RPIB 1QVOB 2NY0B 1QBLL 2XXMB 4UV4L 1FHGA 4U6XA 4XPFL 4KPHH 5B4MD 5D72L 1YNKL 4XCCL 1I75A 5E2WH 5IBTH 3TA3B 4S1DC 5HHNB 1M4KA 1JWSA 3FFDA 4JKPL 4ZXBA 1XCTA 1U93A 1KXQE 3NTCH 4J3SA 2X4RB 3S8WA 4AQ1B 4FQ1L 4WUKH 1QYGL 3RBSA 5CS7A 2Q7YA 2P8MB 4F58H 1S7TB 3HZVB 3P4LA 2QQNL 1EPFA 5J56B 3QEQE 1MAML 1G0XA 2LU7A 2P24A 3W2DH 3EO1A 5BO1L 5HGDB 3TBSB 3RKDC 4U1JB 1P7QB 3PHOB 2IPUK 4NQXB 1KIPB 4JREC 2CRYA 2EIEA 2A1WL 4P46B 1OPGH 1HHIA 3VXUE 4NQED 4U1GC 2ERJB 3QNZA 4B5EA 3JVGA 2GJ6B 2A0LD 4WUKL 3SGEH 1TVHB 4OF0A 1IAOA 1AI1L 2NY5L 4C56D 4FQCL 5LJYH 4HSQA 1AGDA 4PLKC 2HJLA 4X8JA 4CADB 1RIUH 3MMEB 3OKYA 2A73A 1Z9LA 5ID0B 5IR1B 1E4KA 3VFVA 4R4BB 1FH5H 5L2KD 1GSMA 1AR2A 1CDCA 4IDJL 3DVNB 4U3HA 1U8NB 4MJ4A 3P0GB 3MR9A 1X3DA 2BNUB 5EBMB 1UYWH 4GW5B 1IEAA 4AMKH 1AGBB 5C08A 3TO4A 4XNQA 2ZUUA 4XB8A 3T04D 1J0IA 1A1MB 4U1NA 4NNYA 1LDPH 5C2UB 1DN0A 3EDEA 3L3GB 2VWEE 1S5HA 2MJWA 3CU1A 3HUJF 4FZ8L 3LS5H 1EO8L 5FKPA 4OLVH 5I1KH 4UU9A 1UEYA 5D2NE 4PJ9A 5FYKE 1U95B 4N90D 4AEFA 1VKXA 4FS0A 4RIRB 5INCA 3MBEB 4IRZH 3U9UA 3HG1E 2NCMA 4QRRD 1FCGA 4GJTB 5I74C 3OSKA 4EOWH 1PYWB 5AAWA 4JRYA 4JRXD 3BIKB 5I1GL 3MRIB 4Z7UF 2R0WL 2AERT 5ESVB 3W0WA 3V6BR 4ERSH 1INEL 2BVUA 3MO1A 4WCYL 1LO2H 3G5VB 1Q0XH 4J4PD 4OZGA 2YD5A 3B5TA 3LZFH 1FAKT 1TNMA 4MD0A 4NCC2 5EU6B 1OAKH 1L0XA 1ZOXA 5T5NG 3CMOH 3WUZA 3ECBB 5HHXH 5DVOA 5HVGB 3MX0A 3ZKQD 3GK8H 4LSSL 4U0QB 4NZUH 3K2UL 3KLDA 4XPTH 1ZSDB 1RJYA 4R97B 2H41A 4FABL 1UM5L 2ADGB 4LOUD 2ADIB 5C0IB 3TZVC 4LLWA 5C6PB 2A38A 4FXLA 1TJIH 3WHE0 1IGIH 3D87B 5E8OB 4G5ZL 4M8VA 1MEXH 5B39G 1ZV5A 1UXWA 4RRPG 1BIHA 3RGVC 1JYNA 1CDBA 2HVKA 2R2BB 32C2B 1H3PH 1MHCA 4JR9H 2B2XL 4MLSA 5E6ID 3VXSD 2R56L 1A7RH 3RDTB 2BFVH 1MRCL 1FZJA 4BSVB 4NZDA 1I8IB 2A9ML 2VLJB 2LABA 5C0GB 3SOBL 1QSEB 3GMOA 4JM2D 4ZNCD 3LQAC 5F9OL 4A6YH 2DQJL 4F80A 3TF7C 5DJ6B 5GGRA 8CGTA 3KVQA 1CFQB 4UV7L 3Q5TA 4TRPH 4L9LA 1MJUH 4CNIA 3OJMB 1I8KA 2G2RB 5GGSY 2PTVA 3B8YA 2XN9A 3GO1L 1HHIB 1F8TL 1A4KA 3SDCD 3GBNL 3EDKA 3QDJE 2WNGA 3E8UH 5DVLA 4U0RB 2DN7A 1FIGL 4XPBH 1F42A 1JN6B 2VR4A 4PJ9D 2RCSL 3SY0A 1JWUA 3LKRA 1MCEA 5BS0B 3U30B 2Y36L 4JGUA 2XRAH 4ZUVA 5TFSL 1IC5H 3MV7D 5FGRA 4YXLH 3OXSB 1AGFB 5E03A 4PJIF 2I07B 1UQSA 1AXTL 4K2UH 1I9RL 4PD4J 1D6EB 3PWLB 3RPKA 2R2EB 3NMEA 4B53A 2HFGH 1S3KH 1BVLA 1IGTA 5ETUB 3CGTA 1KLUB 3G6AB 3GMLA 1UA6H 4P59H 1IFHH 2X4UB 5KS9E 4OCLC 4DTGL 2K9UA 3O6FA 3EO1B 2E6PA 3U7YH 3AUVA 3HE7A 5D7SL 1IFHL 4G42A 3M45A 3P77A 4RMRA 1KIPA 3C8HA 1NLDL 3VH8B 4P2QB 5FYKU 1D5MB 3FO0L 3O41A 4KQ3H 4XBGA 3NCCB 5IB5A 3HNVH 5FDWB 5DQDH 5F71A 5KSBF 2EXWC 3Q3GA 4JFHE 4V1DD 3K80A 2WUCH 4GBXD 3WIFB 3NPSB 1KJMB 2FEEL 4HFWA 3RGVB 2XY1A 5F9JA 2CLVB 1MOEA 2Z8WC 4H0HB 3VXRD 4MS8D 2VJXA 1IM9D 2IPUG 5DMGC 2FB4L 3NCJL 1NBZA 4HJJH 5JZ7D 1MIML 2IADB 3QXUA 3QQ4A 4PJ7F 3O6FD 2AABL 4MXVF 2R4SL 4JN1H 2EO1A 5K9JH 5KJRL 2YRZA 1S9KC 1A2YA 1F58L 1FIGH 4S0SD 1FORL 2DKSA 3S37L 1HKLL 1PFCA 1EDQA 5F7KC 4U6XB 3BPLC 2DLFL 4AQOA 3EW3B 1NDGB 3GIZL 4IMLA 4OCWL 4IRJC 1R24B 2IAND 3CXDH 4NJ9H 4G9DA 4LCCA 1T83C 2BVTA 2PW1B 1AHWC 3QG7L 5HGAB 5LWYH 4HIIA 4WTXA 3RWHB 4XGZB 1CBVH 5F1OB 3FQNB 5I1HL 2BRQA 2HT3D 3BIKA 4L3EE 1XIWC 4HEPG 4Y4KB 4DVRL 3ARUA 5C2BL 1PQZA 2E8YA 1G7LA 2P4AB 1MJ8H 4HJ0D 4NRXB 4JZOB 5AYQA 1I8LC 3MRPB 3Q5OA 1X7QA 1RJLB 1X5ZA 1N6VA 5C71A 4BELD 2NNAB 1NANH 3DV6A 1G9NL 2Y5TA 1FG9C 3L3HA 1EJOH 1Z6JT 3CC5B 4MJIA 1JPGB 3S37X 4DGVH 1IBGH 4XVJL 2WSKA 2WQ8A 3KYMB 3DX6A 3BDXA 1INQA 1TETH 4IRJD 4PV8A 1F5WA 2OTWA 3C5JB 2V2WB 5C0CA 4HLZG 1UZ6F 2H26B 2MTPA 2FD6H 4Q74A 1OAKL 2EICA 2CKBA 5DI8B 3DBXA 4J3UA 5TGBB 4PRHA 1RK0B 2OL3B 3LQZB 3MV9A 4H1LB 1W72B 1YZZA 5D93B 2X1WL 2VZ1A 1BMGA 5JPMB 4GLRI 1NAMA 1QG3A 4X7TA 3B43A 4U6YB 1A7OH 1T1YA 3B9KC 1JRHI 4KY1L 4HT1L 3FQWA 4Z7WE 1NFKA 4LSQH 4LVHB 3BE1L 1EX0A 1EO8H 3LS5L 5I1KL 3PIQA 3UYRH 1RZJC 3WLBB 4OZIF 2KUTA 2Q76A 3CFEB 3RWEB 3WS3B 2X7LB 5CEZH 3WD5L 4W6YB 2DYPD 4U1KA 4X4XA 2PW2A 4EI6B 2ATPA 3TJHA 3W11C 3P30H 5CD3B 4UT9H 4AEIH 4WNQA 3QIUD 4W6WB 4U6VH 4XNYL 5MHSE 3F7VB 1M7DB 3P9MB 3VDCA 2XWBA 2AKRA 2AAVA 3MRKB 3QNXA 2DLHA 2F74A 4GW1B 5H37G 1LK3H 1RPQA 3KYNB 2OI9B 1WZ1L 4NPYA 3ZE1E 5DRZA 3S36H 4S1SH 1AE6H 3PWVA 4P9HH 1FO0H 4XP4L 5DVKA 1XZ0B 5IWLA 2C26A 5I1EL 1G7LB 1JYWA 5I1LA 1C8PA 3ARVA 2DLTA 1R5WB 3CU7A 3VFPA 3PJSA 5HGGS 1GZPB 4I9WE 2W9LA 4JDTL 3MV8A 5JPNA 1P7HL 3LDBC 4PGCB 3UZQA 1JGUH 3ME0A 4NO0D 1F2XK 2ITDA 3TO4D 4HKXB 3QHZH 1SMOA 1I7ZA 2Y06L 4N8CL 3CH1B 4M4PA 3TBTA 2BSTA 5BS0D 1DVFC 1VACB 4F58L 4CMMA 3JWDL 5E8EB 3UYRL 2X41A 2J12B 4FQ1H 2FJHB 2ZKHL 2XIDA 3VE0B 4BSJA 2C3VB 2XI9A 2DI7A 2YKLL 5C08B 1K8DB 2AJZA 2FX8H 5D9SA 3OAYH 1LQVA 3KPNA 4QTHA 5J9PB 3LPWA 1YNKH 4XCCH 5C3LD 1PX4A 1T7XA 4LCWE 4JHBA 1NAKH 2NXZD 4M1GL 4CVXB 1T3FA 1WT5C 2EDHA 5CZXD 2VDPH 4TTGA 3SGKA 5SWQB 2HH0H 4JG1L 1R3HA 1TZGL 3JWOH 3IAQA 2D03H 2OJZL 2Q6WA 2F53D 2WK2A 4WU7B 5ESAB 2DKMA 5JHLH 4PJ5B 2IAMC 4U6TA 1H15A 2NY2C 2R0KH 4HWBA 4P2CG 5D8JL 3KLAB 4PG9B 1L0YA 1CLYL 3HMXH 3U0TB 2H3NA 3T08A 4GMSL 4ZUTB 2B1HH 2W9DL 3ARRA 3U79A 2FBJL 2A9NL 5DLMH 1NAML 4FQXC 3EYOB 3N9GH 4ZS6D 4FQJL 4O9HH 4Y4HD 1IQDB 5SWZD 5I1HH 5L2JB 5JUEH 1N5AB 4IDLA 1JGLL 3G6JE 4HLZH 2Z93B 5AZEH 4HH8A 1MCOL 4C83A 4NUGH 3KPQA 1AKJB 5DURD 1A1NA 1VFUA 4S2SB 3VXNB 2V2XB 4NKDA 3ARED 3RY4A 1MHCB 3IRZA 1J0KA 3WJJC 2A6JA 2ESVD 4X7FC 1OTTD 4PJCA 5C0CB 4LCYB 4O2FB 3BN9C 2C3HA 3V52L 1AXIB 2VLJA 1I9JH 5FM5O 5HHPA 1LWRA 1X5HA 4JY4B 4BKLA 1FFOB 3IDGA 1LEGB 2VDLH 5EORL 1GHFH 3TNNB 1K85A 1A6WL 5F7EL 5E8OA 3QDGD 4XBEH 3QJHB 5T1MB 3RL2B 1UJ3A 3GRWA 4IOSD 5J6GB 1OP9A 4MD0B 2JELH 1KIQA 5D2LF 1HXYA 5HYJA 1AH1A 5D1XB 5D7IA 3KPQB 3QQ9C 5ADOH 3AGVA 3ECBA 4HHAA 3HNSH 2XQYK 1TZHA 3LN4A 4MNGB 3N85L 3D25B 3QIBB 4LF3B 5LVEA 5MI0C 4W70A 5DC9B 3VG9C 1T0NA 4M1CD 4D9QE 4LPWA 3ZHLA 5JHDD 3NCEB 2C3GA 1D5MA 2F8VA 1F97A 1YNTB 1T6WA 3L3GA 3H0TA 4CU6A 4Y19B 1K8IA 1VA9A 1TVBB 1U91A 4KJPD 4KK9D 2C4FU 4WO4D 3TCLB 1CLZL 15C8H 5I1CL 3WHXB 4EUPB 1IEAB 3ZT7A 1QBMH 3PWPA 2BNRA 4RFNB 2A83A 3HI1A 3ULVC 3LVEA 5K9OA 3RVXC 2FHCA 2G5BA 3QDAA 4YXLL 3P77B 4HPOH 5IBUB 3LKQB 3ZE2E 3MO1B 2DQIL 1U3HB 2IPKB 5JOPE 4K9EL 2H26A 5C1MB 1JFQL 5HPOA 5F21B 2XWJA 3MLWL 4Y4FD 4I1NB 1R5IB 3FQWB 1MHEB 2P48B 1BOGB 1GGBL 4MXWH 5GGQL 4I3SL 5DEFB 4GXVH 2WQRA 2AK4A 1J8HE 3DYOA 4TVSa 4LCUA 5MEND 3UTPD 4C4KT 2NY4B 1IKNC 1RZ7L 1WAAA 5TQ2H 2C5DC 4OI9A 2OZ4A 5JHDA 4PJ5E 3RAJL 1I4FB 4KTEH 4BK4A 1IE5A 1MJUL 4O51A 3TYFB 5HGBA 4KQ4H 2A6DA 1B0WA 2VIRB 4G8GD 4K3DL 5D5MA 4Z7UA 4M93C 2BZDA 3RA7H 3VMOA 2APTA 3O6ML 1CICD 3HCVB 1OARL 2OSLA 2VAAA 5GRJL 1OVZA 1JIBA 3BD5A 4M9PA 4OB5L 2XTJD 1EHAA 1G6RL 1AKJA 1KLFA 2D7TH 4QT5B 1F4XH 4GAYA 1HDMA 3ELAT 5HHOE 5DQ9B 4NQVA 4Z7VA 1S9VB 3GSUB 6CGTA 5HYSA 1Q9LB 1T7YA 4WEUD 2ORBH 2P5WD 3FO9A 1YDPA 3HE6C 1IGIL 5FUCC 2MMXA 3BGFB 5ESQA 4B0MM 4KTDH 4MA3B 5IB3B 1A4KB 4N0FB 4H8WC 5D7LD 2VDRH 3L5IA 3BPOC 3JTSB 4OBRA 2YUZA 1BFVH 3M1BB 4NQSB 2WUBH 5FA4B 1IC4L 3LQAH 3SDCB 1NGWB 5D2NC 1R5VB 2BVEA 4EDXB 4DGIH 4DOHE 5HHME 1P5UA 5TDNB 3BW9B 3MNZA 2WM0A 4W4OC 1MI5D 3GMPA 1MCSA 2R0WH 2BC4A 5E6ZA 5DSCB 2BHUA 4JPIB 4X0KA 4JZNB 3KPSB 4IOFD 5EUOF 2NY2D 5TE7H 2P44B 5J12C 4UDUB 4Z7QE 1LK2A 1ND0B 4LPXA 5C9KA 2R1YB 3ARGA 4NC1C 3QH3B 5DA4A 2VL5A 4F7TB 1KOAA 3BPCB 1OWRM 1BQUA 1YY8B 4I18B 4K8RD 2GI7A 4D9RE 1YJDH 1F6LL 4OKDA 3RTQD 3M1BA 5L88L 1SY6H 1EXUA 4M7LL 1UXSA 4U6YA 4MNGE 4ZAKD 3SE8L 3VE0A 5TDPA 1TVDA 3RPIA 4QHKJ 1TIUA 1CR9L 2R15A 5EOQH 3UAJD 1MF2L 3U6RB 1E27A 3TLRA 1X4ZA 2XZQH 5D7JC 5HYJE 1P4IL 2I9TB 5FYLH 3MNWB 3IT8D 3O8XB 4IDJH 4M7ZB 4XC1H 3P73B 2HMID 5DI8A 3GMPB 3BPLB 1RULH 2BJML 5F1KC 4HUVB 1FH5L 4X6CE 1MCDA 3MOAL 4Y16C 4NDMA 3S88L 4TUJA 1QP1A 3T1FB 4FQCH 1KIQB 5CMAB 5A16A 4ZOCA 5KSAB 1WCBA 4U33A 5I1AA 3K46A 4HS6B 4OZIB 4L3CA 3DV6B 3L3HB 4Y8DC 1R3JA 4NWTH 5ICXA 1IKNA 3OTTA 2HT3C 1DP0A 2CDFA 1Z3GH 2W59A 4XC3L 3R8BB 5DRWA 4PJCE 5HYSB 4U1SA 2QSCL 4MHHG 1G7JB 2RFXA 3FZUC 1LMKA 4X6DE 3UJIL 1AQDA 3QPQD 3SN6N 1RIHH 4U1JA 2YD3A 3PABA 1YEEL 1T5XA 5EA0L 3U2SA 5BRZE 3VFRA 3O3AA 5BO1H 2YHGA 1WIOA 2R2HB 3QHTC 4UDTA 1ZHNB 3C6LA 1FNGB 3QIWA 3IU4L 1CYGA 1KG0B 2GK2A 4PY8I 3LRSB 1UWEH 3P0YL 1P6FA 1V3MA 4KI1A 4PGDB 3U7WL 5DEGA 2IG2L 4XC1L 4FA8A 2HJLB 3HG1D 5EO0B 4JKPH 5I73C 4MA7L 1MCLA 1NCTA 3ARBB 4X9IA 4PJXA 3BP5B 4XAKE 1T2XA 2ZCLH 3UP1A 4KPHL 3CLFL 4G9FD 5KSVA 4M6MH 1QBLH 1QSFB 5GPRA 4D94A 4JCLA 5DYOB 2GAZB 2GJ6D 2VMFA 2LV4A 4G8IA 4TVPD 3U30C 1MFNA 3E6HA 3OF6D 5KSUB 4G8FB 2VYRE 5GS1A 1XCTB 4FFYH 3DBXB 3QIBD 4BFGA 3C09B 4F2MA 1YPZB 4ZFZA 1L4IA 2Y72A 1W0WA 4I13B 4UIKH 1PG7H 4AY0A 2VR5A 5IVXB 5SWQA 4EN3C 1DN2A 3QFDB 1M71B 5DJZA 4DGIL 5I8EA 3PWUB 5DGRA 1A8JH 4TVPH 5B39A 4N9GA 4C4KO 4G3YH 3MRLB 4XP1L 5HHMB 1OSPH 3PJSB 3KPLA 1T2QL 3G6JB 4RGNC 4YHML 2ZCKH 4JPKL 2X4QA 4LSVL 3WNOA 1MJ7L 1UXSB 4ONHA 2B4CL 1C08A 1TITA 1DQLH 5DK3A 3TIDB 4C54A 1FE8L 3PGCA 1MIEL 4LNRB 4NWTL 3X13A 4ONGH 3SQOL 4L8SC 3QEGH 3SDDC 1BD2B 3BZEA 1NC2D 5MEPB 3KPOB 3DETD 3MJ7A 1U8JB 1BEYL 4PGEB 5ADPH 3A6BL 3C5SA 4S1RH 1HQRA 4FQHA 3JVGC 1QO3B 3O6LL 3QDMA 1GL4B 4HIEA 4WFGE 3LN5B 4HCRA 1EHLL 2YD4A 2EDXA 3FOLA 4WFHE 3RWGA 4JQVC 43C9A 3IVKB 2XKNA 3PDOA 4C58B 1Q1JL 2Q87A 1RZKL 3WS6C 1NMCB 2YK1H 1CFQA 3ZKMC 3EFFA 5DJDA 1YEKL 4U05A 2QL1A 4TSCH 3W9DB 2DAVA 3VWKC 1UACH 3K2MC 2XV6B 3VGHA 1A7QL 3GI9L 4NQVB 5CD5C 1BJ8A 3KXFA 4I5BB 1QLFB 5BMFH 4GRWF 3NBNA 4GG6B 2AJYL 4PTTB 5ICYA 4PGDA 5DK2A 4Q9QL 2VAAB 4PB9L 3GSOB 3E6HB 1F4YL 4OD2B 4OV6F 1P4LA 1QD0A 4I77L 5CGTA 4XT1C 5C0JB 4NHUA 1S7VB 3FQXA 3RUGE 2NYYD 3QUKB 5FKAB 1UB6B 3RUGA 3VJ6A 3O3EA 4KROD 4Y5VB 1UEMA 3BHBA 3MROA 1MAJA 3WN5A 3CPLB 3MCKA 4N0RA 1TJHH 3FONA 4X99B 3WJJA 3TBSA 2EKJA 2ID5A 1FBIL 4PRPB 5IKCB 3SDDD 5CJOL 1FJ1B 4BFIB 2H2SC 4MWFA 1BVLB 1IGTB 3LQMA 4ALAH 5D7KE 5T5FL 1MCNA 2ZWLT 1MWAA 2VNCA 5IM7B 1EUUA 3B6SA 5LAXA 4TSAL 3NN8A 4IIQA 3R1GH 1OAXL 3V4PL 2FHBA 3BDBA 3GSNH 3N85H 4R2GD 1G7PB 5GJTH 5GS3A 3JV6B 2PKDA 3MLSL 3ZE0F 2NLJB 1NMAH 1SJHA 1Y0LB 2KZWA 2NY4C 2NY3C 5BXFB 3WFDL 3C5ZC 4QXWA 3N06B 2DM7A 1HHKA 4LK4A 3MGTA 3T3MF 1B2WH 2YN3A 1JWSB 3FQUA 4PJFE 1OSZA 3THML 3F5WA 3WFBL 4NNXB 4NO5B 1OTSD 1CVSC 4XH2A 2YOCA 2QHLA 3EYUH 5T33H 4M9OA 4QOKE 4UMGA 3EOTL 3L7FA 5DC0A 3DUUA 5ICZA 1OLZA 1SY6A 2GIYA 1NCDH 1YC8A 5JPNB 5CCKH 3MLSH 3KPRD 3V52H 2JB5H 5DFVD 1OP5K 4HIHA 5IVNA 5DR5H 5DJ0B 3WL9B 4GRMA 4PGEA 3TNMB 4KDVA 4UQ2A 2UVFA 1L9MA 3G9AB 4TSAH 3S3SA 2I24N 2AXFA 3S5LG 2OJEB 5HI4C 5GRVL 5I1IL 1KEMH 1FL5B 1BGXH 1NUDA 3SGJC 5F88B 5FCSH 5F1NB 5GRUH 3KPRB 1NEUA 5IESL 3JUYA 1R5VA 3UAJC 2UVEA 1W0VA 3WIIL 4HF5L 4PP1C 1M7DA 1HH9B 4UT6L 3AU1B 4U1HB 3KR3H 1S9YA 4V3EB 5TDNA 5I19L 4ZODA 3QUYC 3VWKA 3H8NA 3WFHA 3FT2A 3RRQA 3SDAC 4I18C 1I1CA 4DKFH 2X09A 2X4UA 1F4YH 4O00A 4O2FA 4PRDA 5E6IA 2ENYA 2JJWA 3D0LA 1A7NH 3S34L 1D7FA 2Y25A 3JTSA 1GGTA 1FC1A 4JM2A 5GRVK 3C5ZD 2C1OB 1RHFA 4HK3N 5CBEB 4P2OD 3CFBB 1QRND 4R4NC 1S7XA 1YC7A 3PGDA 4HMDA 1VGKB 3RTQB 3SPVA 4PP2A 3LKPB 3PG2A 4QHLA 4NN7C 2AP2A 1FFNA 4FTVB 1P2CB 1J18A 1T89C 4RX4A 4P3CL 1MJJB 4I2XA 5I6XC 1G7QB 4FFVC 1WTGT 5D70L 4H25B 3U4EB 2MQ3A 4O58L 4ORGB 5D7IE 3NH7L 5EOTA 4LBEB 1OOAA 4TUJB 2GJJA 2P8LA 3ZDZF 2PXYB 1S9VA 3GSUA 3VCLA 2NY1D 3JWDH 1G7IA 3HI5L 2G5RA 4OZIA 3U1SL 1EMTL 1D5IH 2DIAA 1OP3K 2YR3A 3W0WD 2HWZL 4X80H 3MV9D 1OTTC 4NUGL 4L8CB 4X6DB 2X9YA 4PJ7A 4JHAH 2DDQH 4QRRA 4J8RA 3P73A 1IAII 3O4LE 4QXGL 4YIQA 5BRZB 4O2EA 5IOPA 2ZCKL 4LFHD 4D3CH 4OLYH 1N0LA 1CGSL 3GBMH 2DQUL 3UDWC 3WUWB 4G3YL 5B39B 2W9EH 5JR1L 3RWCB 3NFPB 1EXUB 4OUOA 2LFGA 3JXAA 4WHDA 2BSRB 1EEYA 1PG7L 5CP7B 4RBPK 4UINL 4IMKA 1DLHB 4QWWD 4TQEH 5BCAA 1F02I 1MFDH 2ZNWA 4ODWB 4CJ0A 2DM3A 3IKCB 5HYFA 4MNGA 1A3LH 4FMFA 2FHFA 1GOGA 2LAGB 1CD1B 1S7SB 2EIBA 3Q3GB 5CEZL 1YECL 5C0EA 3JZ7A 4I0CC 1ADQA 1ORQB 1NCUA 1J1OH 1HZHL 1T1YB 3MRBA 4LSQL 1EFXA 4XCYA 2AXGA 1TPXB 3CFCH 3HHRB 2FECL 2ZKHH 3GB7A 5DT1H 4NO5A 4NNXA 1UQSB 3RJQB 4KZDL 3B2VH 5D4QA 3UTPE 2Y06H 2XN9E 1MWAH 2BCKB 4ZTPH 3U4AA 5ILTH 1VSCA 5F3HA 4C56B 1QPXA 1RV6X 5ELIA 2YPVL 2Z4QA 4MA8L 3B5HA 5E8PA 3UZEA 4X99A 4GOSA 3EIFA 3FN3A 5GQBA 5DD3H 4GKNA 5GGUA 1OAUL 1CIUA 1A14H 4LASH 3TNNA 2QSTA 1TJGL 4Z18A 4S0TD 4E5XB 4RZCA 3E2HB 5DUPL 3TO2B 4YHLL 4S1SL 1I7UA 3S36L 4TQEL 1BFOB 2EDDA 3FONB 4NHUE 3ZYZA 2XA8L 5JPMA 1XF3B 2EEDA 4LRIC 1CS6A 3BZ4B 3QRGL 5F8QC 2AGJL 4GAYB 3MPCA 4OTXL 1RIVL 1NMCC 3O45A 4XPHH 2A2QT 1OF2B 3U36A 3ZTNH 5J11B 1H3WM 1A7PH 1L8JA 4Y5YC 2PR4H 1U6AL 4H5SB 4S1DD 1G1YA 3L3KB 5GJSL 1E6OH 2WW8A 3EGSA 4JO4H 2DWDB 2VLRB 1J0JA 2D7PA 3DRTB 3MCLL 2R2CA 1YJDL 2EYTA 2CIKA 4YDVB 1PKQA 5IHUH 4E0RB 4DN4H 5DRWB 4Y7MA 3DWTA 4RFOH 5D6DA 4IS6B 2UZIH 1M1SA 3UTZA 3JWOC 3A6CL 3RWFB 3GMNB 4O5LH 4L8BB 5KSAA 3VRJB 5AAMA 2R8SH 1A6ZA 1L7TL 2DRUA 3U0PB 3NH7H 3ZSTA 3AB0C 2K3TA 5H37H 1YEJL 3IJHA 2IEPA 4TUOA 3ULSA 3TESA 4BH8A 4FMKA 4LLWB 3VWJC 1XGPA 4NUJA 2CGRL 4RA3A 4ZXBC 2EXYD 3HZYA 1KACB 4JZJA 3VXOB 1P53A 1FO0B 5FGCB 4QF1A 3H9ZA 2EE9A 3LH2H 4X4ME 5IFJB 4YPGB 3UPAA 4LHUA 3NPSC 1I1AA 4KJWD 4P2QE 1S78D 1VKXB 1SBSL 3K4AA 4U1LB 4TULL 1T0NB 3G5XA 2XACC 4WI6A 5DUBA 1AC6A 2O61B 4U1IB 1YEGL 1QFOA 2CLZB 3WLWC 1HHKB 2K1MA 2R4RL 3MREB 1I9RH 5D2LB 3QXAB 4OI8A 4MZ2A 1DVFD 3TYGH 3OF6A 4JN2A 4J12A 3VU2A 4HZAA 1PAMA 3DNKA 3LEXA 4S10A 5IK3B 4ZQKB 4MNQB 3BUYA 2ZSWA 3MUGA 2F8OA 1JN6A 3CXHJ 4K94L 3BZDA 5E99L 3S36X 1V5JA 3BYYA 5E2UH 4JFYA 5BVPL 1NCNA 3P9LB 1SJHB 1Y0LA 5I1IH 3AREB 1AGEB 4MA3A 2XYCA 5D1QA 4APQC 2YN5A 4MJID 2OR9L 3FMGH 4Y16B 1HINL 1VFAB 2CUHA 3UJJH 5DJYB 1D6EA 3PWLA 3HE6D 4RAUA 5FO7B 3HPLA 3I2CL 4HUWA 5MP6L 3IS0X 1SEQL 4X5LA 5J1AA 4U0RC 5F9OH 1VHPA 4A6YL 4OGYL 3MA9L 4ODVL 1KB5B 3GJFA 2GUOA 4L8BA 4TPRH 3BPNC 4R3SA 1JZ2A 1A21A 2QEJA 1T83A 1YYMH 5D1ZB 2FZ3A 1B2WL 2VQ1A 3BIBX 4NBZB 1YEIH 1NAMB 2O5YH 1ACZA 3ZL4H 2D31A 3F58H 1FGNL 3NAAH 5IGXL 4TULH 4KJQC 2H9GB 3CFKA 3PQYB 5E0QA 3I6GB 1NKOA 1QNZL 5LGJA 1XIWA 3MACL 3MJ6A 1NQBA 4X4YA 5SWZA 3SDXB 4LVHC 1G6VK 2W91A 1TTFA 1Q9OB 3P40A 5IT2L 3L6FA 5C6TH 2QADB 4N0YL 4ZS7H 4N5UA 1GC1C 4ZTOH 1C5CL 1ZGLM 3ARFA 3FOLB 3QDHA 4OZGB 3CMOL 1LVEA 3IF1A 1AQDB 4K2UL 4LLMB 1AXTH 4JFOB 4R96A 3HNSL 2CUMA 3G5XB 3KXFB 2XKNB 3PDOB 1LE9B 1LE5B 4ZUWA 1Q9KB 3FFCE 4P2RE 1CXLA 4TTDD 1DQML 1JTPA 5F7YC 3MREA 5F6IB 3L5HA 5C70A 3DGGB 1N59B 2WP3O 3PXHA 4ZXBB 5CHNA 3IDYB 3GJEA 5EUOA 5F89A 4EOWL 1OQXA 5FHAL 5AWNH 4WJ5B 1CI5A 5KSBE 1C08B 3NFNB 3FO2A 1MHPH 3MGAA 3EJYD 1ADQH 4OI7A 3NACL 2CMRL 2WBJC 3SE4C 1M05A 4L29B 3BPCA 5KAQF 4UV7H 5FGSA 1FFRA 2PR4L 2ZUSA 4L1HA 1MCOH 3K1DA 1RZKH 1NBYB 2E3VA 3VFUA 3FO1A 4PGZA 2HFFA 2Y5EA 1AHWB 3ZZ1A 3DGGA 4FQLH 1FL3B 1FL6A 5DFVC 4JR9L 2YS4A 2NQCA 1NAMH 5DLML 4QOKA 3O6LH 1ZKAA 1XT5A 4HS3A 3P4OA 3JTCA 3GHEH 3ES6A 3ARTA 4XH2B 1T04A 2DMKA 2F54B 2AV7A 4YFDB 1OAUH 4N9GB 3NA9L 5FGBC 1MCHA 4M8QA 3WO4B 1T22A 3QXVA 3HMXL 3HS0A 3PQYA 2CD0A 3QEGL 4XCEA 4LSPH 4XVTL 4YNYA 2Y6SD 5BVJA 5HPMB 1OQOA 3O3BA 1MIEH 2DICA 1ZHBA 2AI0L 4FNLL 4WW1A 3R0MA 4NQEE 4MGXA 1T5WB 2ERJC 4JG1H 3OKEB 1Z9MA 1IGMH 4YXHL 4OAWB 1LO2L 4WCYH 1INEH 4W81A 1OSPL 1MUJB 2OR8A 5DQJB 2VQ1B 4J8RB 2CKBB 3B2VL 5D7KD 1CDJA 1ZHNA 2X4OB 5JXEC 3PIQB 5JORB 1KTRL 4F37K 3MSPA 2YKLH 4BYHA 4ZO6A 2W65B 1MY5A 5L6YH 4CDGC 3ET9F 2Q86A 4HK0B 2CDGB 3P9LA 3TPUA 1ZHBB 1ZVYA 1DSFH 3N1GC 2GQHA 5I0ZA 4EUPG 6FABL 3RKDD 5EPMA 3P0VL 4WEBL 4PRIB 5C8JA 3IJYB 2EDYA 1WT5A 3SDXE 4Z7WF 4HKZB 5TF1H 4PD4K 1IT9H 3QDGB 3MJ8A 1KSRA 4HUVA 5EU4B 4G9DB 2CKBL 2QSVA 1HYSD 2B8OT 4NZRL 3QCUH 3MFGB 1DLFH 1HHHA 1GXEA 4UBDD 5D9SB 2HA1A 3OAZH 5E9DA 1T7VA 5SWZE 3P0YH 4OF8A 4KKAC 1I8IA 3KYNA 1AO7B 1O7VA 2GKIA 2YSSA 4POUB 4OLYL 5JW4N 4OSUL 4ZPTA 4LSRL 4RAVA 4Z77A 4QXGH 3IFLH 3TGXA 3OKOB 4ELMF 4XPGL 2DDQL 3VXMD 1IVLA 1F11B 3HTLX 4HIIB 4PFEA 3RWHA 4QRSA 4NOFA 5CIPH 3PL6B 1KCRL 1HILA 2E27L 4F8TA 3HZMA 1N4XH 5KSBB 3HUJE 3BH8B 1EEZA 1D5IL 4LPUA 4XC3H 4N5ED 4LCWD 4GKZA 4Y16D 4XVUC 2GT9A 4DUVA 4NO0B 5GHWL 4KI5E 4HWUA 5IIEA 4YIQB 3VRJA 5IJVA 1ZE3C 2EDNA 5DD5L 1I1YB 3AREC 3PWVB 2V5RA 1CE6A 4K7PX 4KY1H 1S78C 4Z6AT 1S9XA 1RULL 2BJMH 5I17B 4G6KH 3WUWA 1U42A 3IFNH 1MFAH 4L8DA 3V8OA 4UV4H 3QUXC 1CFSA 1VB9A 4QGTA 2EIDA 4P5MA 4PJDF 3TN0D 5TPWL 1U8PB 2Z93A 3TWCL 4X7EC 1QPPA 2EXYC 2VLJD 5MENE 1X5XA 5KN5B 5EG6C 3HPJB 1A6UL 4PJ8B 5L88H 3IDIB 5ITBL 2F54E 1C5BL 4CUCA 1A6ZB 1JPFA 2CO6B 4MJ5A 3S34H 3I6GA 5CUSH 2GJZA 1EJOL 2HRLA 5GZOC 5ITFB 5LBSH 4CADA 4M00A 5L2JA 4PRBA 4M5YL 4KC3B 1PKQB 1H3XA 1HOCB 4OLUH 2EC8A 3MV7B 5DRNB 3S96A 1I7RB 4FG6C 4YE4L 2E9JA 1RVFH 2VR9A 3TO4B 4R8WH 2X70A 5DEGB 2BNQE 1JGVL 1IAMA 5A2JH 2O5ZH 2OXHA 5MEOA 1XH3B 3H42H 4HBQA 2X89D 3JBG7 3KLHD 3BMWA 1PSKH 3BOVA 4Q2ZB 5GGVL 4FOMA 4PJGA 4ZFFB 4N68A 2ZZUT 5BV7B 1P7QA 2DQFA 3PHOA 4JY6A 3D18B 2E7LA 4LPYA 3GHBL 3VGFA 4TNWF 1NGYA 2P5EA 2XTJC 4OCYH 1ZHKB 5KVGL 1QTYT 3LKOA 4LLVA 1BPVA 4Z0XA 3ULVH 4ONFH 4IMLB 3OKEA 1NGZA 3EOTH 3NCYS 5KJRH 1YN6A 4Q0XL 3UTSE 3UTSA 4IEFB 4WWKC 3PHQB 2OM5A 4Y1AD 2ARJB 4TPRL 2JIXA 4IMKC 1JHKL 5T3XH 2VZSA 2HKFL 5HYQA 2AXHA 4MDJB 3FQNA 3RZCA 3D69A 4MMZC 3QDME 5HHOB 3LIZL 4QYOA 4WU5A 1JZ5A 1QEWB 5JIPA 5DQDL 4Z76A 1GZQB 1RZ7H 1YNTA 2AV1A 5HYSG 5I66A 4UNTA 1Y6MR 4UUJB 4LLQA 5DSCA 3RJDA 1CFNB 2BVPA 3MV8E 2CJUL 4W4NA 3QG6A 4NQSA 2ZP0T 4JFFB 1FZOA 3BUYB 3MUGB 2ZUVA 5IFHL 1HHGB 1GGBH 5GGQH 4RBPH 4WDIA 3DYMA 5HJ3B 1F6AA 4MQSB 4XPAL 3SJVD 1ITBB 3MXWL 3T8XB 2F74B 4KKBD 3QFDA 2WMPA 3HUJB 1UH4A 3MRGB 3WIHA 4RISL 4KUZH 5DDHB 3UMTA 3KXFE 2YC1A 1Y18A 4YBLC 4N1CA 1JL8A 1QBAA 4Q6IB 4JY5H 2BNUA 1JGVH 2Q8AH 3OX8B 1K2DA 3LMJH 3QXTA 3RWCA 5LKNA 1KCKA 4LKXA 4V2CB 1J05B 3X13B 4Z7VB 2AJYH 1IL1B 1ZGLA 3DROA 2V7NB 4XMKL 4XI5C 1OP3H 5B8CB 3GI9H 1KEGL 4I8DA 4M61A 3TYFA 2ILLA 4W4OA 5IFHH 4J4PA 3O2VL 3RIFK 4G7VH 3S3PA 2HMIC 3NZ8A 3ILPA 1MCFA 1NBQA 3MTRA 1Q9KA 1HKFA 5MENB 2Z8VC 4HK0A 3S4SB 3FN0L 3KLHC 1ODAA 3D3VB 2LTQC 4RRPA 4Y4KD 4DEPB 2A6KB 4GXUN 4ZMAT 1DL7L 2CLRA 4HMEA 4F2MB 4PRNA 4Q97A 2R2EA 5HBBA 5E9DE 2HFEA 3IYLW 5TPWH 3QCVH 2GTWB 5FA3A 1KF9B 4PGBA 3JSSA 5F7FA 3SOBH 5IROA 3AMKA 2G9HB 4LHUG 5JA9A 4PJAE 4NKDB 5HD8D 1TXKA 4PG2A 1C1EH 5AYUH 1TQBC 4G9FE 4P46D 1A7RL 5JIKA 1BEYH 5ADPL 3EYFB 1RUKH 3MLTA 5EORH 4HJ0C 1CGYA 4RWYH 1RJLA 4IIQC 1MEXL 4QRUB 1OTUC 1I9JL 2IH1A 1WBZB 3SJVB 3TA3A 1H15B 1H8OA 4M1DL 1FE8H 1NMBH 3Q1SH 4BA8A 3D3VA 4JO4L 4N9OB 1S9WB 5E70A 3FFDB 3K2UH 1V7MH 3MFFB 2HN7B 2GW5A 1WJ3A 3H42L 4JFFD 2YD7A 5IQ7L 5EBGA 1EA9C 1ZT4B 2ZOLA 43CAA 1GGIH 4YHNA 1A9BB 5CBAB 5CZVL 4TVPL 3AS3A 3IFLL 4K3JH 2FEDD 2Y1VA 3HAEA 4L3EA 3UYOD 1XR9B 1HH6A 4JB9H 2FX7H 4OSUH 4RZCB 3HPLB 3FT3B 4FQJH 4F9PC 2C3VA 1IGCL 4JG0H 4LHJB 1HHJB 2VUYA 4JZJC 3SGDI 3RY6C 5DUPH 5KVFH 2B1HL 4PJIB 1SYVB 1DLFL 1GIGL 4HS6A 3QCUL 1CXKA 1T1ZB 4BSWB 3H7BB 1JMZA 5ICZB 3CH1A 5D8JH 4XCFH 3TBTB 3NCMA 2KL6A 2XY2A 2GJ6E 2GT9B 3UTOA 1C5BH 1N3NA 4P3DB 4M6ML 1K4CA 3OKLA 2YPVH 4WEBH 1YPZA 4HUXA 1IGFH 5DUBB 4ISVA 4NDMB 3VFTB 4PJ8A 1YUHB 2Z8RA 1NGXB 5F6HJ 3C60D 4JFPA 5J6HA 4R90H 5H94A 1KPRB 2D7QA 3BP7B 1OT1A 1U8LB 3U6RA 3GI8L 1HXYB 5SWZB 5HI5D 1FPTL 5D96B 4PJEF 2H1PH 3RL1A 3L5XL 4MDJA 3DO3A 1IEBB 1J1OL 1HZHH 4JDZA 3TVMB 1ZWIA 4D0DB 1RZFH 5ECJE 1X44A 4PJDE 4Z76B 3BPNB 3OPZH 4NKIH 4PJ7B 4QRRB 3WNMA 3PWNB 4MAYC 5IMMB 2EEBA 4OKVB 1A6AB 4LIQL 1KENL 1KCRH 4Y4HA 3NN8B 3CX2A 5EUKB 2G60L 4PJFA 3T65A 5KZCD 3KHOA 1PG7W 1LHZA 4G8IB 2E9BA 3C60A 4KK9C 1YMMB 3B3IA 4GG6F 3EFDH 1KPUA 4IRSC 4DUWA 5F7MC 4UINH 3LB6D 3NA9H 4X8XA 3FHQA 5F3BA 1EEYB 1EERB 2X4PA 2FDBP 1N64H 1A9BA 3K0WA 1YQ2A 2W60A 3O2DA 4E41E 3QXDB 3LKOB 4LLVB 4R7NA 5KBNC 3FO9B 3NTCL 3VWJA 1A9EA 1CGSH 4XNMA 2KZ1B 1FNGA 4L9LC 1P4LB 4CMHC 1XGUB 4MD4A 3UBXG 1UG9A 4JFEA 4MJ2A 1MF2H 4X4ZA 3T1WA 2EYRA 1U8KA 4KHXH 1UB5A 2VDKH 3HRZB 1T1WA 5TF1L 4CVXA 1KNOA 1R5IA 4TYUA 3D18A 3WN5B 4I5BA 2V7NA 2Y5TB 2W0LA 2V2TA 1SM3L 1B0RA 1VADA 1YNLH 3E6FA 3IDIA 5MHSD 1VFBB 2HWZH 4X80L 5B3NA 3VFRB 3QFJA 4FRWA 3GSXB 3RBGA 3GJFH 2CDEA 2XICA 4NQUA 5HGDA 4F37F 1NDMB 4O51B 1CD9B 2JKXA 3BE1H 4J3WA 1CICB 1ZHLB 4HUXB 2JJTC 3W9EA 2FJGA 1YY9C 4NQCD 5T1LD 3WXVL 1IGYB 3MBED 5MEQB 5C0NC 3MV7A 4H88H 1WVZA 1XF1A 5DGQA 4MS8C 4ZDHA 5F7DB 5C7XH 1MREL 5J7CC 5ERWA 5IV2B 3OL2A 1YEDA 5EU3B 3LQAL 4A2LA 2IALA 1BFVL 4WW2B 5DD1L 5JNYB 1I1YA 3H9HB 3MRMA 3V6ZA 2AI0H 2PCPA 5BS0E 3H7LA 4L29A 3PWPD 3WIHH 5CJBA 3OKMA 1C5CH 2EDQA 4LL9A 2DM4A 4ESKA 1JV5A 1Q0YH 4YAQA 5L2KB 2MQCA 1IBGL 2X4QB 2ADFH 4EJ1C 4OIIL 2GTZB 3MRDA 4OD1H 1BAFH 2D7TL 2K7QA 5BZDB 4P49A 3MRCA 3FAWA 3MRBB 4U1GB 3KJ6L 2OTUA 5EU3A 3VXSA 4G7YH 5DZOA 2YD9A 2CQVA 1IRAY 4K71C 4QOKB 3CFEA 3RWEA 3WS3A 2EDWA 5GRUL 3H9HA 2DLIA 3L3KA 3KPLB 4KK8C 3WL9A 1AGBA 4WU5B 1YN7B 1CL7H 5IJKA 1YA5A 3VDAA 1WBXA 4ORZC 2EYTB 2H2PD 4X6DF 2D0HA 2VITA 4B7IA 1S5HB 2LU4A 5FKPB 5HDLA 3VXPB 5EU4A 4GXVL 4PJXB 4U31A 3F7VA 4PJDB 1KJMA 3DMMA 5CCKL 2GFBB 1L9NA 4K9EH 3GMRB 4KI5C 3MV9B 3UJTL 5T33L 4QRTB 12E8H 3OG4B 3MOBH 3NCBB 1GVIA 1UCBH 1QR4A 2PXYD 3HB3C 3HMWL 3EYSH 1LEIB 4PREA 4NFCA 4XWOC 1IAOB 4KMTH 3VA6A 2FO1A 3BEVA 2Z4QB 2HTKD 1RSFA 4CBPA 3QWOA 3V7MA 1X5LA 3ULVD 1CK0H 5JMRA 3TYGL 1DBAH 3EYVB 3LAFA 5EIIA 2AJUL 2ESVB 5GS0H 3LRGA 1VESA 2P5WE 3MXVH 3VXRA 3TPKA 1J0ZA 2X1OA 3O4LD 3PV6A 1J9CT 1ZS8B 3QIWD 5C07D 2NR6D 1MHEA 3DHJA 5C0FA 4LVOC 3A0OA 4X6BA 1H0DB 2PYFA 1P7KA 4QOKD 1FP5A 1AD9A 2C7UB 5HHNA 3RI5K 5CIPA 1FGNH 3NAAL 4GT7A 4X7DC 5FF6B 3ZL4L 1FVCB 4NWUH 1HI6B 4MJ5B 4LEOA 1TJHL 1A5FH 2J7LA 4GRWH 5MI0B 4EI5D 5ID1B 3QIBC 3AC0A 3MGOA 4Y19E 2OMBA 3GB7B 4XMPH 3D0VA 3RU8L 4G6MH 3QQ9D 3QA3A 4MNQA 3ARBD 2PO6A 4XHJD 4JJHA 1MI5A 1F4HA 1MI5E 4QHKI 3DETC 4ODVH 4ACPA 2FO4B 4YBQC 4NJAH 4NM8L 3VXQB 4L9LB 5IEKA 1MRFH 4JFPB 1A2YB 4Q6IA 2UY7A 1BM3H 1A02N 4PBVC 1JGDA 3NIFF 3UJJL 2VC2H 1OAYH 3OZ9L 5HHQA 1DQQB 4KI5D 5EO9B 5CP7A 1HINH 3J8F7 1KELL 5IMLB 4ISVB 1J8HA 5E2JA 3DV4B 2BRRH 1UC6A 3DX7A 4LNVA 5DJYA 4RFOL 1IC1A 2CLRB 1BJ1H 5HJ3A 4NO3A 5DJDB 3UC0H 1B88A 3G5VA 5BVPH 4M7ZC 4AIZB 4F7PA 3HE7B 5I71B 4K94H 1GGUA 4YDIH 5D7LE 4BH8B 4LPTA 5IHLB 3SDCA 1IAKB 4MXQC 1IEHA 3KYOB 1EEQA 3FQRA 4PS4H 1BVKA 2A9NH 1CGVA 4Q2ZA 4LCWB 1QRNB 3ARFD 5T3XE 3L1OL 3O6FC 1SYVA 4FFEX 4ONHB 2MHAA 1ED3A 1XF4B 2B20A 4DJMA 4LU5L 4YHLH 3VXTB 4HD9A 5JHLL 3L3IB 4AENB 3LH2L 5J13C 4QKXB 3ULVE 1XR9A 4HXBH 4YK4C 1MJJA 4GRWE 3GSNB 1CD0A 4JPKH 4QY8A 1T1WB 3DSFL 3G08B 2VDPL 1KPVB 5JLZB 4NHCH 1J1PL 5C3TA 1EIBA 2Z9TA 4MA8H 2PYFB 3EJJX 2P8LB 3ARFC 2CSPA 1FNAA 3LKRB 5H8DA 1C16A 1E28B 1KC5L 3GSQB 5I9QB 4CNIB 2VAJA 5AG8A 2AEWA 3MV9E 1NDMA 1B0GA 3T2OA 1WBYB 1TFHA 1L7TH 4TUOB 4HWNA 1GOFA 4QRPE 5IBLD 4HWEL 3KAAA 3MRHB 3D0LB 4JKLA 3BKMH 4QLRA 3DIFB 3U9PL 3FT4A 4RGNE 4JJ5B 3UZVB 2V17H 3T0AA 4O2CB 4YHYB 1U8IA 1RUAL 1F00I 2Z8SA 4BFBD 4X9BA 4R0LB 4DAGL 4WHTA 3GJFK 2VDKL 5FEBA 2FYYB 3BZFA 4MDIA 1RUML 3ZDZE 2R69L 4MA7H 4G8GE 4WGVB 3RL1B 4QXUH 4JKMA 4NHUB 2DQHL 3QEQA 2I60L 1I1AD 3TT3H 3CSPA 4HQQL 5EU6D 4AL8L 1T66C 2GTZA 3MRDB 3LQZA 3LRSA 3STZB 3WXWL 4HIHB 4OLWL 4BFEA 4MSWB 2NY5H 2W92A 1ACYL 1BBDH 3VRIB 5F93C 3OAZK 2NW3B 4YHOL 4J3VA 5DMIL 3FFCA 4P2RA 5DD6B 5FO9A 1RAMA 3BP7A 4LHUD 3M8OL 1LEKA 2E5EA 3QXWA 4ZG1A 1TZHB 5GS0C 5F7UA 4P4KD 1NCWH 1J8KA 2RBLA 5F1NA 4D3CL 5F1SA 4JLRA 2GY5A 4RIRA 3VFGH 1Z3GL 3G6DL 4DAGH 2NY4D 1TDQA 3VXOA 5KSBA 1Y6KR 4UNUA 4EXKA 4OZFA 5C0IA 3KYOA 5E8DL 2OTUB 3L3JA 1QLEH 2HTKC 3AY4A 3AROA 2XPGA 1BX2B 3DXAE 4WFGD 3GKZA 3U1SH 2HLFC 5B8CC 1FFOA 4WRLA 5I8KH 3IAGC 4HCRL 3ULUD 2WIIA 3ILQD 1I7TB 3SCMA 2VLKA 1OAZL 4NN5C 3S9DB 3FT3A 4P3CH 3UROR 3REVB 3MR9B 1V3LA 3NIDF 3A67L 4X6CF 5JXAH 4RFNC 2NYYC 2FD6L 1FVEB 4RGMC 2Y23A 5DZLA 4J6RH 1ZHKA 1J8HB 4JFEB 2FLRT 3DSFH 4HPYH 1FN4B 1JF6A 1BF2A 1JZ4A 4Z7NE 1X5YA 3DO7A 1YN6B 3BYTA 1N8ZB 3MRJB 4DWHA 3WMSA 4I9WD 3GEWB 5TE7L 1MFDL 4HXAL 4YDLB 2ZOKB 2AQ2A 4NN7B 4WY7L 5EB9A 5D6DC 3U36B 1HHJA 3F7RA 1KT2B 2DLEA 1T7WA 1AD0A 4YXKH 4NZJA 1FNEA 4MJ6B 2DWEB 4APQD 1INQB 3OKDB 4AK1A 3V5HB 5I19H 5JQHC 2QADD 4H8WH 2RHEA 3WFCH 1FRGH 1TCRA 4BM7A 1U36A 3SHSA 1CDHA 5DYOA 2X70B 4FXGB 5DFTA 3ZLQC 4EN3A 2FGZA 3K7UA 4U3XA 1T66D 4QRPB 4YDIL 2PO6B 4X6BB 3O3DB 4KTDL 5JOEA 3ALXA 2VERN 1MFCH 4OCXH 1D5ZB 5DO2C 1KEML 1U58A 2Y9RT 3BRDA 3AS0A 4PJAF 4HV8A 2L7UA 5F72S 5KOMC 5IW6A 4HBCL 1KPVA 5JLZA 4R0LC 1NEZG 4ELKA 2Q7NA 1KB5H 1BM3L 3CFDB 2EKSB 3OX8A 1RUPH 4MJ6A 4BZ2L 5DUML 1MRFL 3KPNB 5E7FA 3B9KD 1CFSB 5JW5A 2DTML 4KKBC 3WHE1 2EE3A 1KJVB 4XAWH 3KGRA 2CDFB 2X9XA 4I0KA 1I1AB 3KPSE 5SX5K 1QSFD 4JFDE 5IB2B 4Y2DD 1UM4L 1OGAB 4BQ9A 1VEMA 3QQ4B 1NEZB 1FVDA 2IH3B 2R1YA 3ARGB 2E6JA 4OCNC 1A22B 1PD6A 3WFDH 5BZWB