3KPLA

Crystal structure of hla b*4402 in complex with eeylqafty a self peptide from the abcd3 protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kplA01
1JPTH 4ZAKA 5L8LB 1I8KB 1ORQB 5D2NA 1KJMB 4TSBL 4PGCA 5IROC 4PJXF 4WHYG 4U3XA 4AY0A 3TVMA 4U6HB 1VFBB 3WNKA 3VFTA 2D03L 1FHGA 1CXIA 5F1SA 1IGML 1VADB 3V0WH 4BH8B 2X1QA 4KV5F 1F58H 2LU4A 3ZDXF 1ZSDB 1T0PB 3S4SA 3BPOC 3F7VA 4DQOL 3EYFA 4YXKH 1A2YA 1CF8L 3MCG1 2YRLA 2H9GA 2IPTH 1T0MB 2V5MA 3WL9A 4I4WA 4K94C 3QCUL 2KZ1B 2PW2B 1Q9WA 4M1CD 1UM6L 4E42A 5DT1L 1MIEL 5F9JA 4A6YL 1BQHG 2AV1B 3T77A 5KZCD 1IEAA 1CLYL 4PJHF 1UZ8A 1WZKA 2VDQL 3O3AA 4LEOB 5E94B 4I9WE 3HG1E 1TZIA 4YDVB 5ILTH 4OLVL 3IFLL 1S7VB 4CVXB 5EPMB 2Q86A 5EO1B 4LU5L 1MQ8A 4IRJD 4ELME 5T5NF 5HTSA 1KLUB 2E6PA 2WINB 4CNIA 2OTUB 4L4VB 1FFQA 4JHWH 5I16B 2EYRB 3MRKB 2GTWB 4RGMC 4ZUTB 5GJTL 2ZJSL 3U0PB 2OMNA 2CUIA 5DEFB 1NEZB 1MCDA 5D1QD 2NR6D 3KYKL 3QDGD 3BPOB 4KGJA 1LE9B 3JWOC 1AI1H 4OAWB 2VXSL 3QJFA 1I1AC 5DD0H 4ZODA 3BT2H 3HUJA 3NCMA 4QRTA 3MROA 3U2SA 3D48R 3H42L 1OAXL 1U3HA 5E0QA 5KAQF 3QIBA 3IXTB 3GMLA 4AIZA 1N6UA 5KN5A 1RULH 3QDHA 2HT3D 3EUUA 3RTQD 4J3TA 4V1DA 2DLFH 1IFHL 3OB0K 5TDPB 2WY3A 3T1WA 2XACC 3RA7L 2BVQA 4L4JA 1KB9K 1OB1A 4W4OC 2OZ4H 1YEFL 4JM2C 1MUJA 4RWYL 4RGMB 1IM3B 2J6EH 3IJHB 3K7UA 4PJEE 4NKIH 3RHWF 4BH7A 2GIYA 2VR9A 3HE7C 4RMQA 4S1RH 1IC4L 4HGMA 3BAEH 2DQGH 4E41D 2QHRL 2OMBA 2H6PA 1XMWA 3L1OL 3NIDF 4GKNB 3GMNB 3DRQB 5ACMA 3GRWA 4ZXBC 1ULVA 1N3NA 2VXQL 5J1TC 3QXUA 1J0HA 5DMKB 5E8EB 4EVNB 5D70L 1TVBA 3UEZA 5IVXA 2FBJH 3JWNC 4X0KA 3TYGL 1SJEB 4JEGB 2BNQE 1VEOA 3FO2B 3QUXA 5I1CL 1D5MB 4KK9C 2QADD 5J1AA 2DLEA 3Q3GB 4XVSH 4JFFE 2LABA 3E8UH 4IRZL 4GW4B 4QHKJ 3MYZA 4HXBL 3QUMB 3CX5K 3RZCD 2P8LB 3GMRA 4WGVB 2AV7B 2HFTA 4BELD 4LSUH 3KPTA 4NPYA 3EDJA 4JM2B 5IIEB 4LLMA 4OLUH 4OT1H 1R3IH 1ES0A 1P6FA 1OAYH 3HB3C 4HH9B 3HE7B 3VGDA 1XEDA 4YX2L 2L4OA 5C0EB 3P9MB 1YA5A 3SE4A 4QLRA 5J13C 3IRPX 2HT2D 3VFUB 3C6LA 4HK0A 1QSFB 3GB7B 5EBWA 4ZXBB 1BLNA 4PBVC 3BOVA 4XCEA 4YBLC 1QPPA 1TZGH 2ZOLA 2BFVL 4R0LA 4YGVA 3JZ7A 4NC1E 4ETYA 4ZNEA 4YHKL 1TJHL 2NW3B 4FXGB 1KPRA 2GJ6D 3QWRD 3L3DB 1DANU 3E2HC 2QSCL 1T89A 3QQ9D 4MXQC 3GK8L 3TN0A 1ZVSB 2ADFH 4NRXA 1CR9H 1WISA 3RY6C 3TBWB 4I3SL 5B22A 3NPZB 3QUKB 2AXFB 3VG0H 2M1KA 4ONFH 1SBSH 5DD1L 4B0MM 1MFBH 3GHEH 1QFWH 3TPKA 5JOPE 1DZBA 5CILL 2BVPA 4C54A 1RZFL 2RCSL 4MD0B 3BQUD 3AFLA 2E9JA 3L6FA 1NAMA 4ZUWA 2CLZB 5E7FA 1DUYB 5J13B 4JPVL 3QAZC 3QDGE 5B38G 3QIWA 3U7WL 2OTWA 5E99L 4RGNE 2ICWI 3NVQA 4F58H 4NHUA 4YBLB 2OCFD 4L5FH 1N5YL 1ETZB 5JQ6H 1N59B 5EZLA 3EYUH 1UH4A 1AC0A 3FB5A 1V5JA 5J4MA 2EO1A 1U8QB 3E2HB 3LS4L 3VFNA 1YEGH 1FFNB 3CLEH 4U1NB 1JZ7A 3C5ZC 4GG8B 1A6AB 2WQ8A 4TPRL 4LOUC 3F62A 4L8SC 1T1WA 5F96L 2EDDA 5C2BH 2OBGA 2UUDH 1S3KH 1G7IB 5E5UB 5CD3B 5A16B 3QDJE 4GSDH 3BUYA 1KPUB 3IDMB 5CEYA 1D5IH 2O5YH 2DI7A 2WIIA 3UYRL 2DF3A 3R0MA 3ARFA 5K9JH 4HUWB 3MV7B 4OCWL 3L3JA 1EDQA 3QAZB 1T5WB 2RFXB 3I6KA 4GXVH 5AD0A 4GUPB 3U9PH 3CVIL 5I1KL 3HA0A 2LAGB 3NOIA 3D2UA 3GGWB 4QKXB 2R2HA 4FQLL 5KVGH 5JMRA 4OF3A 1DQQB 3X13B 3WIHH 5F72S 3LPGA 5FYJL 2EEDA 4ONGL 5DUPH 3ABZA 3C5ZB 1IKNC 4RGOH 3BH9B 2VDNL 5E24E 1V8HA 1CFNA 4L8SB 1Y18B 4PJXB 2JK5B 4OQ1A 2FD6L 4NQXB 4U1SA 5HYIA 1ED3B 4IOFC 1D9KC 1V7ML 3SO5A 5ERWA 3SDXA 5DR5H 4LLYB 4RFNC 5EWIH 5JXEA 5I1DB 4XP1H 4LRIA 3HS0B 4TVPH 5BS0B 4HT1H 5D71L 5T3XL 4L4VD 1I7ZA 3E6FA 5D72L 1WIOA 2HLAA 5CD5C 3UBXA 3QG7L 5AUMA 1T2QL 1EJ6A 2YHGA 4HF5L 3NIGF 4HWEL 1G7JB 3OG4B 4YHMH 5I0DA 4X5XA 4MYWB 5GZNC 1CDGA 1MSPA 4Y5YA 5IV2B 3H3PL 4HXAL 3SDAC 2NCMA 4U1GC 2ICEB 1EHNA 3PIQB 3V4UL 4K9EL 1LNUB 4A6YA 1I9RL 4D3CH 4PJHB 1PY4A 4PG2C 1J0IA 5K59E 1IC7L 4Z7VB 2GAZB 3QFJE 5BVPH 2Y07L 4YXLL 2HP4A 2WWKT 5F6IC 4J12A 2ZUQC 2EDYA 3GSXA 2VKXA 1QFUH 4HPYH 5L6YH 3WFCL 4LAQL 1A6PA 1RUKH 4MXVF 4M61B 3H3BC 4MA7H 2IFGA 2DQIL 4KMTH 4PUBH 1BECA 4YBQC 2PF6A 3LH2H 1K3IA 1PG7H 3LVEA 2D7TL 2FL5B 4U2YA 4L3EA 1MAKA 5J0BA 4MVBA 2HN7B 4FRWA 4DAGH 4U1HA 3G04A 1DBKH 4GQ9H 4PJAF 2VITA 3MRGB 5JW5B 1UXWA 2VR5A 4AENB 3Q0HA 4Z0BH 3SDAB 4U1GB 5LWYL 4QTHA 1I1AD 5DS8B 1J0KA 3OAUH 4GRWH 3IVKB 4H25B 4WUUB 1BPVA 4Z5RB 2VZTA 4O2CB 5SWQB 5IVZA 1A3LH 5DJAA 1H5BC 3CZFB 1RPQA 5F6IB 2ZUQB 3P0YL 1DQJA 2GK2A 1G9EA 1G0YR 2BVTA 1ZT4B 5FKAB 1MRFH 5D5ME 1VKXB 5GIRA 3BKCH 4LP4A 5I15L 1ORSA 4LLVB 1BFOB 4NJAL 1DDHB 3HMXH 2XZAH 4JRXB 3ULVF 4WW1A 3TWCL 3CIQA 4XMPH 2E6JA 3FT4B 4YZFF 1SY6L 1Q9KA 1CLZH 4QHLB 1FVDB 4BKLB 1A5FL 4K8RH 3C2AH 3C9NB 5EOTA 4JM2D 2DKMA 3BN9C 1ZS8B 1QPXA 1DN0A 3HE7D 3MRLA 5D93C 2FJGB 2PYEE 4XI5C 4CADB 5BQ7B 3RIFK 2V2XA 3REWA 4FQ2L 1J5OL 3BD5A 4G8EB 1J10A 1UKQA 4XNXH 3BDXA 1BQHA 1SQ2N 4Y4FC 1QR1B 2W0PA 1CFVH 3O0RH 1GOGA 1H5BB 1UT9A 3OWEA 1P7HL 1QSFD 2PCPB 3CFBB 4XB8A 5BVJB 4YHNB 5IOPB 4ZXBD 4DK6A 4XPBL 3M07A 4NFCA 1J8HE 5F6HI 4ZD3L 1NBZA 1I3GH 4D9RD 4F80A 3D9AH 1NAKH 4KK9D 2Y72A 3CXDL 2GK0B 4RNRB 3DV6B 1QUNA 2Y5TA 4LLUB 4XNUH 3VW3L 3OKOA 1IMHC 1UWGH 4PJ8A 4DKAA 5IKCA 4JR9H 4JFPA 3VXOB 3O11B 5BZWB 5CIPB 1NFKA 3QB7C 5GPRA 2XFXB 3HUJF 4ISVB 1YUHA 4PJDA 4RA3A 4DFHA 6FABH 2YBRB 2IMMA 3HB3D 3QISA 3I75B 4L4VE 3T4AB 4O51A 3VXTB 5D93B 3PP4L 3AS2A 4QRRB 1RZGA 1QTYT 1KLGA 5BO1H 4G8FA 1HSAB 4P49A 4OLYL 5CJOL 4HW6A 4ZO6A 2R23A 2CKBB 1EX0A 5FCSH 1EHLH 2R69L 2YXMA 3S3SA 3H9SA 4Z8FH 5CJQH 3O2WH 3R06B 5IR1B 2LVCA 4OD2A 1PLGL 3GMQA 1RZJL 4LCCA 5DYOA 4MXQD 4UINL 5DDHB 4MJIA 4HG4K 5TPWH 5CP3A 3IU3A 5DK3A 5H94B 1QBLL 1KIQA 1NDGB 5BMFL 2FO1A 3P30L 2ARJA 2FATH 3MRDA 2GI7A 4RQQA 4KVCL 3HMWH 2M26A 1V7NL 1KENH 2NXYC 4DN3L 4IOSD 3KPMA 5IVXF 4HIXH 5BV7L 4QT5A 1EVUA 3MV7D 1XCQA 4ZPTA 3G5ZB 3P73A 1Q0XL 2DWDA 3LMJH 3QG6B 3OZ9L 4YPGB 2A6KA 3ZDZE 4WY7L 4NQCA 1KB5L 1A9BB 3TF7C 2B4CH 4RFOH 4QRPA 5HDBE 3O2VH 1RUMH 3CVHB 3QWOB 3VWKC 3Q2CA 1X6NA 1TFHA 3MLYL 3ZO0A 3FO9B 3L3IB 4Y88A 5ID0A 1B0GB 4P3DB 2DQJH 4Z95H 1OAUH 2EDQA 2OP4L 3QNXB 3KPSE 2KBGA 4IIQC 4U1KA 3FQNB 2DDQL 3C5ZD 1U36A 4PTTA 1OARL 1CZ8L 4LOUD 3TNNA 4AM0B 1OGAB 4KTDH 5I2IB 4J6RL 1IKFL 4R7DA 1KBGH 4I13B 4O4YL 1Q1JL 3S36X 3T0BA 5C0CB 2DMKA 2J12B 3MRFA 3V4VH 4MCYA 5KBNC 4PRIB 3V6ZB 1L7TH 1CFTA 2NXYB 3MGTA 3ARXA 4P4RB 5BS0D 1MLBB 3P3YA 5MENB 3MLZL 5C0RL 2R4SH 4J2XA 5F93C 4WO4C 1JMZA 3WNMA 3LRHA 3D18A 1MFCH 2XWJB 1NBYB 1KJ3H 3WIFA 4HGWB 4W68A 4YHYC 3DBXB 2D3VA 2IBZX 2Z8RA 1A14L 3QH3A 3LKRA 2APBA 3VWKB 4BSVA 1JE6A 1T22A 3ZE1F 2EZ0C 2FO4A 4G7VL 1AHWC 1RUQL 5HDQL 1X3DA 3NIFF 4IIQB 1NSNH 3KDMA 2XG4A 5C6PB 3ESUF 1MQKH 4D9RE 4RISL 2BJML 1S7QA 4XZUB 2VLRB 3NABH 4NKDB 4IOFD 2C3WA 1JYVA 1CI5A 1BOGB 1RZKC 5C7XH 4XRCB 1OPGH 2VL5B 1VGEL 3D39A 4JN2B 4LPCA 1A6UL 3K2UH 5B38A 2ESVE 2AJYH 4WEMB 2NY5L 4WO4B 5CD5D 5L8KB 5C0BB 3G6JE 35C8H 4ZAKC 5D2NC 1I1FA 3T3MF 3U30B 3UC0L 7FABL 3D87B 4LF3A 4K7FB 5GZND 5CZVL 4YHYB 4C4KO 1S5IL 4B7IA 2CIIA 3SDAD 3C6SA 12E8H 1Y6MR 3BPCA 3GSNB 4GMSL 4EQ2A 1YEEH 4WUUD 3FCTA 4KK5C 4TUJB 1AHWB 5EC1A 3VXRA 1H15A 2YZ8A 4MJ5A 3KPPA 4MWFB 3N9GL 4JFDA 2BC4A 4ZYKA 2IEPA 1N64H 1KB9J 4UV7L 4XBPA 3ULVC 4S1QH 1F4AA 5FKPB 3MCLL 2EDWA 3OR7B 4G80B 1XCTB 2C1OB 4JRXD 3AU1B 1CDBA 1XGRA 5EU5A 4QYOB 4YBQD 4G3YH 4NGHL 3EYOA 3UJJH 4U0RC 3VGFA 2N7BA 3UPRA 3WFEL 4WEBL 2ICCA 5T1MA 1WWBX 2FDBP 1TJIL 2HJFA 1X5AA 2E7LA 4R90H 5E03A 4N8VG 3C60A 2HVJB 3CU7A 3L5JA 1YEKH 3B6SB 3O41A 4P2QA 1NLDH 3CFEA 4KJPC 1F8TL 4ZAKB 3BKJL 4ZFGL 3TP4A 1ZGLM 5D2NB 3F58H 3G9VA 2D4DA 4J1UA 2C3GA 3W39A 3GKWL 3MV7E 3CAFA 3EYVA 4PGCB 3TVMB 3LKSA 5I73B 5FECA 1NUGA 3ULUL 3VFTB 3AS3A 2WM0A 3MOAL 4LQ1A 4PP2A 3MOQA 1ITBB 4NSKA 1GPOL 5ALCH 3CX5J 3S6CA 4URTB 4XWGH 3VRIA 1G6RL 1NCCL 1GH7A 4Z78B 1MRCH 4NC0B 3O6KH 1SY6A 3S4SB 1OAKH 4YHLL 3F7VB 3EYFB 5KSAA 3DMMA 4BZYA 5HYFA 1A2YB 3QQNA 4N1CA 5BXFA 5JHDA 3ME0A 3N1FC 2AQ3A 5MEQB 2H9GB 1UXSA 1YJDL 2Z4QA 3WL9B 3RGVA 4I4WB 4X98A 1H3PH 4U0RB 1L9NA 4MA1C 1Q9WB 4E42B 1N7ML 2OYPA 5F9JB 2K3TA 4G6KL 1U3HC 3CGTA 2BHZA 3QIBC 3T77B 2UYLA 4LPWA 1FLRH 4ZUVA 5IGXL 1UZ8B 2BXZA 3BN9D 4M93C 3O3AB 3HFML 3DECA 1IQWH 1TZIB 4TNWF 5BS0E 5C08D 1TQBC 2D0GA 4N0FA 5I19H 3ZDXE 1LK3H 5E2TL 3JV0A 4WV1A 1T7WA 1TCMA 2Q86B 4XI5D 1GOFA 1A1OA 4QRRD 4XVUC 2DB8A 2YD9A 5FM4A 1I9JL 4CNIB 5EULV 4YEFA 2EE2A 3GBMH 1KEML 4Y4FD 3T1FA 1LE5A 5F7EL 1HH9A 2HH0H 1JK8B 1A4KA 1U8IA 2DD8H 2MQ3A 4XP5H 1B4JL 1D6VL 2FYYB 5FGBA 3BMWA 1CD1A 3DVNA 1Z5LA 3PUCA 2ZUXA 4AEHL 3QJFB 4OFYD 5CJBA 1GGIL 2DBLH 2J1KA 3HUJB 4QRTB 3MROB 3U2SB 1T03H 4MA1B 5FGCE 1KCVL 1NMCB 2ZP0T 3BH8A 4ZTOL 1U3HB 4XPFL 1HQRA 3QIBB 1MCWW 3M8OH 1WZMA 3GMLB 4AIZB 5KN5B 4OZHA 5DRWA 3KJ6L 2E7BA 2XI9A 5LJYH 1IT9L 1W72L 3QUXC 2CDEB 3SKUD 4BUHA 2R2BA 1FYHB 2UZXB 1MJ8L 4V1DB 1PVHA 5IBUG 1LO4H 3PWUA 4P2OA 5T1LA 1U8MA 1F90H 1WTLA 1U8NA 2BVQB 4XAWL 3J7HA 1DBAL 1OB1B 1D3CA 2VDML 3FB6A 2B39A 3D69A 1MUJB 1WIUA 5HHOA 3UXFA 3GMMA 3V4PL 1NGWA 4UT6L 1U2CA 1I85A 3GI8L 5GHWH 3GNML 2GSIA 2WK2A 5HHXL 4BH7B 3H2WA 4LQFL 3W5MA 3B9KC 1J1OL 5E08L 3PGFL 3IT8D 3SE4C 4XNYH 4HJJL 2D7OA 1ZLVK 5IWLA 2H6PB 5D1XA 4LSVL 3WBDA 5MEPA 4LMQI 3C6LC 3DRTA 1CXFA 3SDYL 4KHTL 5I17A 1Q72H 1RUPH 4XP4L 3LSOA 4KDVA 1OTSC 5JO5A 1OGAD 3LPWA 1RFDH 1N3NB 4IEFB 1FORL 4QHUA 3RNQA 4D9QD 1FJ1A 1TVBB 4R0LC 4WI2A 5IVXB 5C0CD 4X0KB 5JNYA 3C5JA 2H26A 3S34L 5E2UL 3QUXB 3W81A 5D7SL 4PRID 5J1AB 3RIFF 1TITA 2J8UE 5CP7A 2NXYD 1T89C 1D5ZA 2BOCA 2CIKA 2XKSA 3QPXH 3TN0C 5MEND 1KB5A 3GMRB 3RBSA 5IJKA 5A3IC 1D5XA 1NCBL 3HTLX 5A2JH 1FNEB 2YD2A 4NPYB 4XPHH 4LLMB 2AERT 3B9EA 1ES0B 1IL1A 2EEBA 2VL4A 2EDEA 4G7YH 1A0QH 4FQHA 3MA9L 3EFFA 3SE9H 3VWKD 1X6LA 1P5VA 4PJDF 3SQOL 4X6BA 3BGAA 2Y9RT 4Z77A 5I6XC 1MF2L 3C6LB 1QFWI 3QIWC 4HK0B 3V6OA 4Y4HC 5EBWB 3KWWA 5DURB 4XCEB 4O02H 2ZOLB 2VLRD 4R0LB 4YGVB 2H41A 1DQML 1K6QH 2CDGA 4HIHA 2P4AB 1KPRB 1FL5A 1X5KA 2FWOA 5KVDL 1UVQA 4X4MA 1WGOA 3TN0B 1FNHA 4NRXB 4QRUA 5D6CA 5C08E 4WO4D 2H2PC 3DGGA 3DO7A 4CL7A 4QGTA 3I6GA 3MLVL 1KCRL 2XV6B 2SEBA 5E2WL 2BVPB 2X70A 4M48L 2X4SA 4KMLB 3MA7A 3ZTNL 1DEEB 4OGAC 1HKLL 3AC0A 4Q6IA 3WNLA 3L6FB 1NAMB 2EZ0D 4YAQA 4ZUWB 3WD5H 3ARFC 5J7CC 5TF1H 1NDMA 4CRPA 1VGKA 1KJ2L 1MCSA 4PGEA 3IDGA 5I6XB 4PRBA 4YDIL 4NWUH 1T1YA 4JKMA 5M94B 3QCTL 5E8OA 3QIWB 1EEUA 2OTWB 8FABA 5HGBA 4Z18A 1TETL 1F3DH 2YWZA 4FTVE 4NHUB 4Q9QH 1M71A 3K1KC 4HKZA 2W1NA 1MJUH 3RRQA 4PRDA 5EZLB 3FB5B 3TJEL 1G1CA 1XGPA 3QT2A 5C3TA 4YHZL 5DZOA 5L2JA 3VFNB 3ILQC 4K7PL 4U6VH 1LDPH 1RVFL 2WSKA 4HS3A 1X4YA 3TBTA 2C5DC 3PNWA 1T1WB 1DQDL 4QEGA 2XQYG 4XX1G 3MLSH 4ZAKD 3L5XH 4OCYL 3MJ9L 1FFRA 1KPVB 5SWSE 5TQ0L 5KS9A 5GGTH 3MV9E 3B8YA 2OK0H 3BUYB 4DFIA 3MACH 5CEYB 2DICA 1AJ7L 4KJWC 3IAPA 4MD5A 3TVMD 4Y5VA 5JXEC 2WIIB 4OFDA 4LRIC 2XTLA 43CAA 1QP1A 1VENA 4KK5D 4RX4A 2ZSVA 1JBJA 3ARFB 5T3ZE 3MLTA 1PSKH 3L3JB 3MBXH 1MWAH 4OZGA 3GJFK 4GO6B 3I6KB 5AD0B 3ULVD 1R5VA 3E1F1 2A9MH 4M1DH 4NIKB 3D2UB 4Y5YC 5C0AA 1RJYA 1DCLA 4NQDA 2R2HB 3BP6A 4FP8L 3X3GH 5DJ0A 5I8CA 1MAMH 1ZKAA 3SDDC 4UOW1 5C3LD 3S8WA 3QR2A 3V7AE 5BOZG 3FOLA 4EIZC 2R0ZH 3NTCL 1CN4A 1SHMA 3W0WA 3VD7A 4D9QE 1WSST 1F42A 4NQEE 5C0CE 5E1AA 5C09D 1CFNB 2NMSA 4KC3B 3VI4E 4KJPD 5SWZD 2X1XR 4U1SB 43C9A 1UEMA 3ZL4L 2BX5A 3NBNA 1UCBL 2BXYA 2DI9A 1RMFH 3MV8B 2E5EA 5ERWB 1G6RA 4P9ML 4P5TC 4OM1L 1YMMD 2CK0H 3FT2A 4JDTH 1LGVA 4KKBC 2A38A 1E4JA 1GGYA 1I9IH 4MVBC 1I7ZB 3E6FB 1U41A 1OM3L 2HLAB 3KG5A 2CO6B 1IILE 4X9HA 1INEH 3UBXB 1A64A 1NBVL 5AUMB 4QRSA 3VFWA 4EI5A 1N0XH 2NY3B 1I7TA 3BDYL 1C5DA 1MFEH 4X5XB 4M00A 4XCFH 1B88A 1ZTXH 3O6ML 3Q48A 4Y5YB 4XC1L 2D9CA 4Y2OA 2Y36H 5FFLA 1KTDA 2XZZA 2UY7A 5IFJA 1G7LA 4PRNA 3Q1SL 4HFUH 3I9GH 2VLRE 1JWSA 4MD4A 1U3HD 4TSAH 3GSXB 3QIBD 3BXNA 3I50H 3PP3H 3BZDA 1KV3A 2NY6C 4DZ8A 4JGUA 2YOCA 1TVDA 4WUKH 2P8PA 2EYTA 2LQRA 5TE7H 1V3KA 4NO2A 4MS8C 4V1DD 4UIMA 5IQ7H 2GEEA 2YA1A 3F12A 1XH3A 5GISH 1DLFL 4KUCF 5KW9L 2GCYA 5H2BA 4XVUD 4PJIE 5EUKA 4YC2B 4HC1L 3A6CH 4L3EB 2OXHA 1PKQA 5EU6D 4CN1A 1U0QA 1X7QA 3PHQA 4HG4J 3ZT5A 2PETA 4U1HB 3G04B 4L4TE 5HHVL 5DJXA 2VITB 4PRPA 3GMPA 1F6LL 3V5HA 4LKCA 2DQEL 1W0YT 3L3KA 1FCCA 5AG9A 5JOFA 1UXWB 5BRZA 3N1PC 4YFLF 5IVOA 1GAFH 5F1NA 2BY3A 5LQBL 1G9MH 1EO8H 5DEZA 2E9IA 5IVZB 2FZ3A 5DJAB 3RAJL 1OAZH 1W72A 4P23A 3ECBB 4QXTA 1DQJB 4NM4H 1AXTH 5GIRB 5FK9A 3HE6A 2NY6B 1ORSB 3LIZH 4PJAE 3QUXD 4WW1B 1EGJH 1N4XH 1R24A 1FBIL 1MFNA 3VXPA 1JN6A 1BWMA 3GI9L 1Q9KB 4UT7L 2QQNH 4PRHE 5IJVA 5J9PA 1CTOA 4PJ7E 2AEQH 1R3JA 3IYLW 5EOTB 1RD6A 4K94H 2QBWA 4IJ3C 1MFAH 5IHUH 5ALBH 1KJVA 4PY8J 1DN0B 5LBSH 1XR8A 3MRLB 2IMNA 3B9KD 1LP9E 1OTTD 5FO9A 3TPUA 1YN7A 2V2XB 3REWB 2FX8H 1A7OH 3PWPA 5D2LE 5E00A 4NRYA 1BQHB 3C6LD 2MSPA 3LQZA 5GQBA 2AGJH 1E4KA 1OTSD 3O3EA 4M6AA 5DURD 3OTTA 1OSPL 1J0ZA 5F7WC 5C9JA 1Z0MA 1M1SA 4ZSOA 5FUCE 5JIHA 1NBZB 4YO0A 5C6TH 3UTPE 2B0SL 2HRLA 1OQXA 1C16A 1KTKE 5C09E 5DO2C 3G5VA 1Z9OA 3GM8A 2XICA 4LCCC 4L9LA 3S35H 4YUEH 2Y5TB 1A3RL 3CK0H 3OKOB 5SWZE 4UZGA 5F9AC 3TN0D 4PJ8B 4M5YL 5IKCB 4JFPB 5A3ID 3SDCA 4N9OB 1BEYL 3GSOA 4JRYE 3G6DH 1XIWA 1QFWM 1YUHB 3GSQA 4PJDB 1YMME 3M1BA 4PGJA 4IJ3B 4R8WL 5C1MB 2E7MA 1J1XH 5E8DH 4S0TD 1YYMH 2A83A 2PO6A 3WEXA 4XT1C 1DTUA 4OZHF 1XT5A 5DVNA 4AEIL 4UAOB 4ERSH 1RZGB 2UV3A 3BKYL 4QNPE 4XP9L 1KLGB 2N56A 4G8FB 5GS2D 3QIWD 4JO4H 4Y4HD 3HKFA 4DWHA 2R23B 4ODUB 3HUJE 3FHAA 4GMTH 3H9SB 3N85L 2Q7NA 1LWRA 1BBJA 5L88H 5TDOB 5SX5K 2MFNA 1CGXA 3TT1L 1AD0A 4F7PA 4OD2B 3GMQB 1B0RA 4LCCB 5DYOB 4MJIB 5CSBA 2RR3A 3LQAL 2H2PD 3EO9H 4V1DE 4OCRL 1QG3A 1KIQB 2IALA 3UTTA 1FSKB 1FNGA 2ARJB 3JUZA 4UOW0 1KJ2A 3MRDB 4OM0L 1NEUA 4X7SH 2D31A 4RQQB 5EU6E 4OGAD 4I3RH 1OTUC 3KPMB 4G6JL 4YE4H 3ARFD 2I25N 1EEYA 4QT5B 1XCQB 4ZPTB 2P24A 5FGRA 3P73B 2DWDB 1MCPL 5HHQA 2IANA 1INQA 4M6MH 4XBGA 2A6KB 2GFBA 1FV1A 4X7TA 4NQCB 3D2UD 4QRPB 2VABA 3MPCA 3VDBA 1ZVYA 5GSVA 2W91A 3OPZH 2HFGL 3U82B 2XG5A 4Z7NE 5TE4L 4H5SA 1J1PL 5ID0B 5D1ZA 3D25A 4M1GH 2BY1A 4V2BA 4U1KB 4LIQL 1EK3A 2R4RL 3MJ9A 3ILQD 5AG8A 5GGQH 5BW7A 1JV5A 4PTTB 5EZOL 3TNNB 4OI8A 5E95B 3W5NA 4WHTA 4X8JA 3OAYK 4NZTL 2BVEA 2C4FT 5TH2A 1LK2A 4R7DB 2R0LH 3WFZA 2NZIA 1NMBL 2KDGA 3THMH 2CR3A 1TLKA 3MRFB 3MV8D 4KI5F 4KJWD 5JXED 3HZMA 1CFTB 5DRXA 2QSTA 1GZPA 1HYRC 3V6BR 2AJVH 3MGTB 2R8SL 4PGDA 5IW3A 2FJFA 1FG2A 1UH3A 5DD5H 1YC8A 4K9EC 3EIFA 4WIQA 3D18B 5I8KH 2WW8A 4IM8A 3O4LA 4ZPVA 3WIFB 4W6YB 1MRDL 5FYKL 4N8CL 3RFZC 3QH3B 4KKCC 3LKRB 3ARGA 3SDDD 1MEXL 3RI5F 4BSVB 1IM9A 1T22B 1PW3A 3OKKA 3LEVH 2OL3L 4G42A 1KFAL 4UBDC 2YD3A 1GZQA 1WBZA 3KDMB 4F33A 5CUSH 3HI5H 1YNKH 2MCPL 3TV3L 1S7QB 4LSQH 4PJGF 4YXHH 1AR1C 3CD4A 1NGXB 3VXUA 1NGYA 4P5TD 3D39B 1L0YA 2E7LC 3AXLA 3ZE1E 4F57H 5B38B 4KKBD 4L3ED 3C60C 3EZ8A 4MVBD 3VFVA 2H2SC 4JVPA 3KXFE 2EDRA 2ZG1A 4RAHA 2ID5A 5CINH 3IRZA 3ALXA 3CFJA 1I1FB 1A6ZA 2O5ZL 1P5UA 4X7CC 3V8CA 4LF3B 4H88H 1QFPA 1UA6L 2CIIB 1VPOH 5F9WC 3C6SB 2V9TA 1YPZA 3BPCB 1RUAH 25C8L 4PY7A 3FCTB 1TQCC 4W70A 4PJCA 5KS9F 5EC1B 3VXRB 1BM3H 1CU4H 1H15B 4HMEA 4MJ5B 1KXQE 3KPPB 4JFDB 2BC4B 2HTKC 4ZYKB 1MIML 1I3VA 4XVJH 4XBPB 4MNQE 5DJ6A 4EBQH 4CDGC 1V3LA 5L7XH 2NY6D 5CKGA 2VR4A 3DMMC 3PHSA 4OZGF 5KSAC 3IB4A 4HQQH 4LSRH 5KVEH 4MS8D 2ZZUT 1XGRB 5EU5B 5ANMA 2Z8VC 3UPRB 3KPRA 5T1MB 2HJFB 3ZDYE 2XZQH 3KAAA 4HBCL 3C60B 5B4MC 3P40A 3O41B 4P2QB 4DVBA 3S7GA 3CFEB 2VWEE 1CICA 4R97C 3TM6A 2V9RA 5EIVA 1NMAL 4J1UB 4U3HA 3W39B 3U1SH 4WV1C 3EYVB 4JPWH 1F4WL 2IPUK 2P5WA 3LKSB 5FECB 3V52L 4I2XA 5EIQA 5F1OB 4PP2B 2I07A 2I60H 1TQCB 4NSKB 4R26H 2QV2A 4HKBA 2AJUL 3VRIB 1LILA 2VDOH 3WV0A 2DMBA 5FGBC 1T80A 2PUQT 1HHGA 3B9DA 4QOKE 4CJ1A 4BFBD 2D7MA 1AE6L 1WC7A 5KSAB 3DMMB 4QTIL 5BXFB 1J87A 4NUGL 5JHDB 5HI3C 4KZEH 2WV3A 1UXSB 2CSPA 2Z4QB 1S9KC 2A77H 4ZTPH 4XVTH 3RGVB 3NCYP 4X98B 4L3CA 2FNBA 1BQLL 2R0KL 4FZEH 1JPFA 4TULL 3MV8E 3WFBH 2UYLB 1RIUL 1S7UA 3FJTA 4DUVA 5KJRL 3QDAA 2APFA 4R97B 2GYSA 3QUZA 1RIVH 4N0FB 4XCCH 1JF5A 4X99A 3TH4T 4WV1B 2Z93A 2CD0A 1KEGL 4DKDC 1CBVL 4P2OC 4XMLH 5I74C 3ZE0E 2EKJA 2WZPD 4QXGH 2F54E 1MREL 1JHTA 1OF2A 4C55A 3I6LE 3QJHA 5DJDA 3T1FB 4NCDA 2ZSWA 1LE5B 1HHHA 1HH9B 1I1CA 1NGPL 3HC0A 3IF1A 1CVSC 1U8IB 3QXWA 2CMRH 1W2KT 2X41A 1WK0A 1I85C 4YBHA 4CN4A 1EO7A 1CD1B 3DVNB 3H9SD 1Z5LB 2XYCA 5I30L 1DSFH 4O5LL 5FOJA 5IWLC 5DO2D 3BKMH 5D1XC 5BZDA 5CS7A 1BIIA 4MJID 4YDLB 4XCYA 8CGTA 3BH8B 4Q9CA 2DIAA 1QRNA 2IBBA 1HQRB 1A6VL 1EA9C 2R15A 4OZHB 5DRWB 1P9MA 1BVZA 1E4XH 4JLRA 3FAXA 1KCSL 2R2BB 4PD4K 1QR4A 3C8HA 3PWUB 4IHOA 4P2OB 4XWOC 2X05A 5T1LB 2XTJE 1G7HA 9CGTA 1EUTA 5I74B 1U8MB 3VFMA 3OGOE 1U8NB 5IJKC 4BZ2H 3FB6B 3QUYC 3D69B 5HHOB 4JY5L 3GMMB 4G5ZL 1NGWB 5FDWA 4M62H 5HXMA 3GJEA 1MI5E 3MX0A 1OLLA 4QRPD 2GSIB 5CIPH 3UAJC 3WXWH 2VQ1A 1HINH 1EZVY 3TIDA 4EOWH 2IQAA 2VXVH 3L95A 4YQXL 4NZJA 5D1XB 3PHOA 5MEPB 1BAFH 3IFNH 2BRRL 3DRTB 5ICXA 5I17B 4NN7C 3MYJA 3V6OC 3LSOB 3MLXL 4OCSH 4WFFD 5F7MC 1QLFB 5JO5B 1Z3GL 2KQNA 4CBPA 4KI5C 2CLRA 4QHUB 1DL7H 3RNQB 1FJ1B 3H0TA 4TRPL 3NA9H 1YEJH 3D6GA 4DN4L 1MCJA 2MKLC 5JNYB 3C5JB 1WBXA 2H26B 4BK4A 4I48A 5I1EL 2APWA 4OV6F 4ALAH 1FNSH 2ZCKL 4UU9A 2J4WL 1R3KA 4RSVA 5CP7B 5JLZB 2CKBH 1D5ZB 1OTUD 2CIKB 4J3SA 1KB5B 1MHHA 2E6QA 3WFHA 5E1HB 5K9OA 1D5XB 2AJXL 3U9UA 3GSUA 4MCZA 5LVEA 1ZT7A 3QUYB 2C3HA 5AZ2H 2EDBA 5B3JF 1T83A 1IL1B 5TFSL 5FYJD 3INUH 2H1PH 4FQHB 4UIKL 2KZWA 4GKZA 3EFFB 4E9LA 4HKXA 5GGVL 1LMKA 1FGVL 2IJ0C 4J3WA 5CEZH 4CVUA 1FCGA 3QNZA 1PFCA 4X6BB 4O00A 3R1GL 4Z77B 1CYGA 2YUWA 3U36A 3WE6A 2BDNL 4M7LT 4DTGL 1XR9A 5FCUH 2BCKA 3KWWB 4JG0L 1FPTH 2R56H 4IDJH 1M7XA 3CMOH 2NY5C 4U6TA 1DQLL 2CDGB 4HIHB 1FL5B 2V17L 2YKLL 3D39D 4DKEH 5L9DH 2R29L 3CXHJ 2FWOB 2PW1A 3DWTA 1UVQB 4PJDE 4WDIA 1ZHKA 1FG9C 2APTA 3CVHH 4LSPH 4QRUB 5D6CB 3U4BH 2QQKH 4JCMA 1IGJA 5F1IA 3DO7B 4JVWA 2VLKA 4ODWA 2XN9D 2D0HA 1RV6X 4Y19A 2X4OA 5J11C 2SEBB 1IJ9A 5IW6A 1P1ZA 2DLHA 2DQUH 2X70B 4JQVC 4KK6C 4PIRF 1JP5A 2NX5A 4OI9A 5CCKL 2X4SB 4Y5VC 4KKCD 1SYVA 3P77A 3MA7B 1HXYB 4LSTH 4Q6IB 3J8F7 4YAQB 4WW2A 3VXRD 5ISZA 1NDMB 1VGKB 5KTEL 4UBDD 4PGEB 3T0EE 3IDGB 4JFDD 4PRBB 3PWNA 4PJGB 2I26N 4Z7WE 1T1YB 5GS0C 5E8OB 4H26A 5K33A 5GGSA 4E0RA 2IG2L 5HGBB 2AI0H 4KUCD 1M71B 2OR9H 5FGSA 4HKZB 4PJFA 1AR1D 5HVGB 3S9DB 4PRDB 2CLVA 2VDLH 1XGPB 1JRHI 5DD3L 4ODTH 2IGFL 4HMDA 5L2JB 3L5WA 3OB8A 4BJLA 2BNRE 5C07A 4HS3B 2KKQA 3LOWA 3C60D 3TBTB 2JJTA 2H2SD 4P2QD 3PNWB 4ZS7H 4Q9BA 5I71C 3P11H 4JDVA 4M7KL 5J11B 1NLBH 1JGUL 5KS9B 3HC4L 5JW4N 3GM0A 4KTYA 4BM7A 4MD5B 4LARL 4Y5VB 1FH5H 4IOIA 4Y1AE 3RWGA 1KCUH 1TXKA 4Q0XL 5HJ3A 43CAB 4KRNA 5I8EA 2VAJA 3MLTB 2OXGA 5GSRA 1Z6JT 5DK2A 4OZGB 5ITBL 3O2DH 2HTKD 1QSZA 1ZLUH 4EI5C 1YJDC 4TTDC 1R5VB 3K80A 4UB0L 4LCIH 4JGMA 1MOEA 5C0AB 1RJYB 4NQDB 3BP6B 3CNKA 5KSAD 3DMMD 5DJ0B 5I8CB 3OGCA 5EOCL 4OSUL 5JHDD 3GDBA 1QBAA 3FOLB 4WFFE 4ODSL 3SCMA 3GFUA 5DVKA 5EA0H 4OBRA 2AJSH 4JO2L 2HT4C 5IVNA 1A7PH 2F5BH 1YN6A 3CFKA 3O9WA 1MCKA 2XZCL 3SKJL 3UPCA 4N8PA 3WKMH 3GSNH 5E1AB 5B4MD 3ZYIA 5EFIA 3X14A 1A6TA 3KHOA 5I71B 43C9B 1BZ7A 4NFBA 5IEKA 3EFDH 3RNKA 4CDHA 1GIGL 3DXAE 4ZNCD 3QXAA 2ICWJ 1F02I 1G6RB 4NBXB 4UT9H 1EHAA 3FT2B 3MJ7A 3OSKA 5FYLL 1EJOL 1IAOA 1JPST 1B6DA 1IGFL 1RZKH 5CJXC 3VGGA 4K3JH 3VFWB 4QRSB 1FAIL 2JF1A 2YK1L 4EI5B 3GHBH 1I7TB 5EZJA 4K8RC 4KGLA 2VZVA 3VGAC 1C5DB 2DQDH 5DLMH 4QWWC 3ZHKA 1R3LA 3D85A 4KVNH 4L8BA 1N8ZA 4X9BA 1CT8A 5CGMA 5GZOC 1KTDB 4GKOA 3KS0J 1CDCA 3OAZH 5IFJB 1ZXQA 1G7LB 4PRNB 2A6DA 1WAAF 3L3OA 1PJ9A 2V6HA 4P23C 1YPZF 1JWSB 5M95B 4PV9A 4YIQA 3S88H 3SE3C 4PJCF 3FFCA 1ZLWK 4KPHL 3BXNB 4GXUM 3HE6C 3D39E 4JFEA 4DZ8B 4ZO7A 1K2DA 3MXWH 3NMEA 4CAGA 2EYTB 4P2RE 4NO2B 3KR3L 3ULVH 4UIMB 5DUMH 5FV1L 4QF1A 3F12B 1YMHA 3H9HA 3DSNA 4P2OD 1XH3B 5T1LD 4OF0A 3V2AR 2XN9E 1QSED 2GCYB 5H2BB 3C08H 3U0WH 5EUKB 3MNWA 4YFDB 1HNGA 2F19H 1PKQB 2CUHA 2HFEA 4ORGA 1Y0LA 1X7QB 3PHQB 1JGVH 5HHOD 4MXWH 2A6JA 3VGHA 1LO2L 3IS0X 1C08A 5L2KA 4PRPB 3GMPB 3VXRE 3V5HB 3VGAB 3BRDA 3FB8A 3L3KB 4LKCB 3OBAA 2CO7B 4KZDL 2HAZA 4QCIA 1LO5A 5JOFB 1I7RA 5ACLA 5BRZB 5F1NB 1B3JA 3BHBA 1CDYA 3D3VA 4LPUA 5D1XD 5F9OH 4Y4KA 2HG5A 3SQBA 2FZ3B 1W72B 5I1IL 4G6MH 3SOBL 1E4KC 3MODH 4P23B 1XGYL 1KSRA 1A6WH 4BSWA 4OGZA 3O6LL 1BX2A 2HRPL 1U8PA 5FK9B 3HE6B 4APQA 4U33A 2MPAH 2E8ZA 4N68A 1FNFA 3FO0H 1BMGA 1R24B 2Q7YA 4HZLA 3WJJC 4FQ1H 4XWOD 3VXPB 2B2XL 1JN6B 3NN8A 3JV6A 3MSPA 3EDFA 3JTSA 5IJVB 5J9PB 2I24N 3EOYG 1R3JB 3SDCC 1XIWC 3QUYD 1H3VA 2YD7A 5E8PA 4OD1L 1U8LA 4R9HA 3H7BB 1KJVB 5HYJE 3UAJD 2FGZA 3NACH 4CW1A 5FO9B 1CFQA 1CXEA 3TPUB 1YN7B 4DKFL 1E6OL 3ZT6A 4HUNB 3PWPB 3EYSH 3T2OA 3LDBC 1S7SA 5E00B 1U6AH 4NRYB 5MERA 4NFDA 2VQUA 5JHLL 3KHQA 1OWRM 3LQZB 3DPBA 1GYAA 4GJTB 3BI9X 3O3EB 4DVRH 5HVHC 4KI5D 3MMEA 1UADC 2FLBT 4K23H 2B4CL 5IP4A 5C9JB 1KYOJ 5LGHL 4ZSOB 4YO0B 1HHKA 4JM4L 1XFPA 1C16B 3G5VB 4XBEH 2ZCHH 4FZ8L 4UV4L 4PB9L 2GKIA 5J12C 1AXIB 4JCLA 4K2UH 2IC2A 3BESR 2R1WA 1DBBH 3SDCB 2AK4A 3GSOB 1XIWB 2LTQB 3GSQB 4FQJL 3ARDC 3M1BB 4YHOL 1CGVA 3PXHA 1PG7W 2EDXA 4M5ZH 3GRWH 2A83B 3WEXB 3SGDH 1S7WA 4Q97A 4HKJA 2Y25A 4P3CL 5CKAA 3OKLA 4X6FA 1JTTA 2C3VA 2IPKA 3MQIA 3K8MA 4FA8A 2IFFL 5HVHB 3DGCR 2EDOA 1ZHNA 4N0RA 4C58B 4O58H 1K85A 3CJJA 5IBUB 4KRMB 2R0WH 1XAUA 1BBJB 2UVFA 3GO1H 4NBYB 5JR1H 1CGSH 1AD0B 3F5WA 4Z7UA 4OQTL 4F7PB 2X9XA 4MQTB 1B0RB 4OZHE 3CLFH 4FFWC 1WJ3A 1UZ6F 1BWWA 4N0UA 4X6DE 5BW7C 4F9PA 5JUEH 1YY8A 1E27A 1MQKL 1FIGL 5DMGC 5DFTA 4NKOA 3NCJL 1QSEE 2IALB 3UTTB 2VC2H 1FNGB 3ARDB 1F45A 4UTAH 1MHEA 3TT3L 1KJ2B 1JNNL 4KK6D 3DX6A 3RVXC 4FXLA 2D31B 2BNUA 3K74B 1OPGL 5HHOE 4DW2L 2WUBL 4AT6A 1VERA 4HIEA 5T5FL 1NCWH 4KQ3H 3K2UL 4LCUA 1EEYB 3FQWA 4P9HL 2P24B 4LMQE 5AEAA 4TVPD 3R8BB 3UMTA 2IANB 5GS0D 4K7PX 4XBGB 5IB2A 2GFBB 1FV1B 4JKKA 4X7TB 3TBVA 2CJUL 1OCWH 2I9LA 3SJVE 1MCOL 3UZVB 1Q9LA 5C0AD 1GOHA 4HBQA 4NQDD 2VABB 5DMIL 5B39G 5GSVB 4HPOH 4C4KT 3DLQR 2CUMA 2ZG3A 3BP7A 3EOTL 4H5SB 5DZNA 3BE1H 4GG6F 5D1ZB 3D25B 4MDIA 1LEGA 2IADA 4ODXA 3DX9A 4OLZH 5EBLB 1QLRA 2XA8H 1JV5B 3S37H 1LEIA 1N64L 3VXME 4UQ3A 3UJTH 3OXSB 1EXUA 2JELL 4WHTB 4X8JB 5TH2B 4ETQA 1LK2B 3DVFA 3E0GA 3FQRA 1MH5A 3OXRA 1E4WL 1S9WB 3VMOA 5FUZL 3JWDL 4WENB 2EH7H 3DVIA 4XH2A 1I75A 1GGCL 3WXVL 2F8VA 3HZMB 4Z9KB 3WFDL 5DRXB 4FFYL 1GZPB 3S36L 4PGDB 3A6BL 4OLEA 2FJFB 1FG2B 3CDFA 1B2WH 1UACH 2OQJA 3LQMA 4EI5D 4TTDD 2FX7H 4DGIL 1RZ8A 5LXGL 2I27N 3H7LA 3O4LB 4KY1L 4JKPH 3EDKA 4ZPVB 2O5XL 4OZFG 2VRAA 5EOQL 1R5IA 3ARGB 3TGXA 3ARZA 4TNVK 1IM9B 1OD7A 1TDQA 3V6OE 3WDHA 3OKKB 5HPOA 4G9FA 4DUXA 2HT4D 1U42A 4XMKL 2OSLA 4PJBE 4UMGA 1GZQB 3PWLA 4WNQA 1NFIA 4F33B 4WW2F 5JA8B 1IAII 2FBOJ 3SPVA 4XNZC 3VH8G 4JN1L 3BIKA 1GC1H 4QHKI 2W92A 4MX7B 1UB6A 1S9VA 5CMAA 3VD9A 4U6YA 2NY7L 3A67H 4OJFL 3VXUB 1NGYB 2VN4A 1FGNL 3AXLB 3IS1X 4PJFF 4XPAH 1KIPA 3CU1A 3VFVB 1CDIA 4LEXL 4CMMB 1JNHA 4MB3A 1CICC 1IGCL 3CFJB 1I8MA 1A6ZB 4JPKL 4M7JL 5E9DA 4PRPD 4U1LA 3VXSA 2P44B 4TSBH 1LK3L 4QWWD 5H37H 4NM8L 4PRAA 4GW1A 4PJGE 5BRZD 5GZOD 1YPZB 3BPLB 1KUMA 2D03H 4PY7B 4PJCB 1IGMH 3DV4A 4P23D 2AK1L 4MGXA 3SKNB 5DJ6B 2X42A 1DUZA 1WQVT 3WHXA 3HE6D 1FDLL 1QEWA 4QHNA 4DQOH 1J12A 1CF8H 2VH5L 3QHZL 3BW9A 3CUPA 3WUZA 3MOBL 5ANMB 1QNZL 3QCUH 3ZKSD 1YEHL 3KPRB 3NFSL 1UM6H 5DT1H 4OGYL 1MIEH 4LCWA 2AQ1A 3WSQL 4A6YH 1KACB 2WBKA 4DVBB 1CLYH 2VDQH 4YJZL 1OVZA 4MNGA 1CICB 1KXVC 3QUZC 4Y8DC 5JDSA 4OLVH 3X17A 4XGZA 4YR6A 2NW2A 3IFLH 5D7IE 5F88A 3P9LA 1OT2A 4LU5H 2EC9T 2P5WB 2VLJD 4KWUA 4TVPE 4I2XB 2JB5L 3FQXA 3N06B 3PWPD 2I07B 3QEQA 1LDSA 4HKBB 2DIJA 4WTZG 5GJTH 2ZJSH 4M9PA 5EU7C 1HHGB 2Y06L 5FHAL 2FHFA 2BSSA 3KYKH 1WC7B 2COQA 3C8KA 4OZ4A 2VXSH 3SE8L 4F37K 3BO8A 2KPNA 4W6XB 2NXZC 4FHBD 3MREA 2OJZL 3H42H 4FQXA 3HLAA 3QCVL 1MFDH 5C70A 3SDCD 1JPFB 4AL8L 1XIWD 1RFDL 1EAJA 4ZO9A 5F7YC 1IZJA 4XHQA 3QUZB 4JQIL 4X99B 2Y1VA 3UJIL 3PL6C 2Z93B 1IFHH 2FECI 3PDOA 5ICZA 4B53A 3RA7H 1FYTA 4LRNL 4D9LL 2MKWA 5JW3L 1JHTB 2QR0A 2P48B 1NCUA 1OF2B 3QJHB 5DJDB 1E4XI 1YEFH 1T3FA 1RU9L 2ZSWB 4RWYH 3LEYL 1G9NL 3U83A 2A74A 1CXKA 1HHHB 3IF1B 2ARJQ 4PJ5A 4X7DC 3I3DA 2W9DL 3QXVA 3IDXL 2YWYA 2DLTA 1IC4H 4G8IA 5IT2L 3LQAC 4JDZA 3MFGB 4GRWE 4RMTA 2F53E 3ARQA 2BY0A 4OZIA 2QHRH 1O5DT 4N1HB 5BZDB 3L1OH 3LHPL 2X7LA 1BIIB 2NXZB 5SX4H 2A6IA 4XCYB 1F3RB 1QRNB 2VXQH 3GKZA 1YQVL 5D70H 4CVZA 1EFXA 2RBLA 4XB7A 5CEXA 3ARDD 3B2UC 2VAAA 3C09C 1K6QL 5I1CH 3PL6B 1NL0L 4IHOB 4IRZH 4HXBH 1G7HB 1UGNA 3VFMB 2Q8BL 5AWNL 1ERNA 2IAND 4BQ9A 1I8LA 2ZKHL 5FDWB 3WIIL 3GJEB 4OQTA 5MP6L 3EJYC 3NPSC 1AGEA 2VQ1B 4YX2H 3TIDB 1SM3L 3P4MA 2IQAB 1GVIA 3L95B 3RX8A 4WFHD 3GMOA 7CGTA 3PHOB 1KN2L 5ICXB 4FFWD 3MYJB 4I0PC 3KPLA 4FOMA 5FOBA 1KIRA 2CLRB 4UILL 4WVRA 2EDNA 3JV5A 5DMGD 1A02N 3BYYA 2A1WH 3H0TB 2BFVH 5CGTA 3BRGC 4WEUD 1QKZL 3F7YA 1WBXB 4I48B 4YHKH 1TJHH 3C09B 1AGFA 3NCFB 3RVXD 4UU9B 1R3KB 2OR7A 1ZHBA 2QSCH 1JCKA 1TVHA 3GK8H 1MHHB 3WFHB 4JQXA 5K9OB 4I3SH 5FUOH 1M7IA 3RPKA 3U9UB 5DGRA 3VA2C 3GSUB 5EZIL 4MCZB 1ZT7B 1J0JA 2VLJE 5DD1H 4GG6B 5GRYA 3O4LD 4WU5A 3FONA 5E2VL 4JB9L 3GZKA 5H8DA 3NPSB 3PWPE 2F9BT 1U91A 5CP3H 2OK0L 4GKZB 2ITCA 4HKXB 4DZBA 1RZFH 2RCSH 1IM9D 3IDUA 3WS3A 2R1XA 5C71A 3NA4A 3QNZB 4WW2C 2K7QA 3HG1A 5DVMA 4PLJC 1ZK9A 2G5BA 2V7NA 5FV2A 4JPVH 4S1DC 4ZFZA 3VG9C 2NLJA 1JRHL 4ZSOE 1XR9B 3U7WH 5FXCH 4ELMA 2DRUA 3O3DA 4I0PB 5E99H 2BCKB 2AXHA 5E6IC 1NFDE 2VDKL 4PTUA 5B3JE 2VE6A 1N5YH 1HHIA 2APXA 2J8OA 1T0NA 4K7PY 3U79A 2EDKA 4LVNC 3VXUD 4HK3J 2PW1B 3LS4H 5HGHA 4WDIB 1ZHKB 4M43L 5H37G 2B1HH 5IF0A 1IGJB 1IQDA 5I1GL 5F96H 4Z7UF 4HS8L 5F1IB 4ODWB 2VLKB 3WDJA 4WU7A 2VOTA 4O9HL 4Y19B 3HZKA 2UWEF 2X4OB 5IW6B 1IAIM 1P1ZB 1JZ5A 4EDWH 1RMFL 2NX5B 1EUUA 4PP1C 5FA4A 1SYVB 2X1OA 3BZEA 3UYRH 4X80L 1AIFA 4WW2B 5ISZB 5ENWA 4OCWH 3ZSTA 1ACYL 3UBXG 1JWUA 3PWNB 3RWJA 3UTSE 3VG9B 3CVIH 5I1KH 4H26B 5GGSB 4E0RB 1XF5A 4LVOC 2VZUA 2P43B 4B7LA 1ZTXL 4FQLH 2X4PA 3BN3B 1J18A 4PJFB 5DC9B 4P46A 2CLVB 4LVNB 1VCAA 3KPRD 4PJEA 4FQIL 5FYJH 4XAKE 3L5WB 3BRFA 4PG9A 5C07B 4WFGE 5KSBE 4PREA 5HGAA 2VDNH 2ADIA 2H32A 1PDKA 2FD6H 2OR8A 5B39A 1CICD 3QHTC 4U1MA 1ZT1A 4U1JA 1BGXL 4BQ6A 4JDVB 5GGUA 4OF5A 1ZEAL 4PR5A 1LQSR 2P5WD 1M7DA 1P4BH 1S5HA 4IOIB 3RWGB 1U93B 2P5ED 5HJ3B 4DEPB 5GXBB 2VXTL 5I8EB 5D71H 3GIVA 5T3XH 5ADOL 2BNQA 1AXSA 5D72H 5GSRB 1M4KA 2QQQA 5DK2B 4JFFA 4G8GA 1JI1A 3QG7H 3QNYA 3O3BA 1T2QH 3HAEA 1X5XA 1DN2A 4HF5H 4HWEH 1V05A 4LVOB 4G59A 3MNZA 4WFHE 3SBWA 3H3PH 4HXAH 3OGCB 4QRQA 3V4UH 4K9EH 4BFIA 1N26A 1I9RH 3IFOA 3SCMB 2W9EL 1IC7H 2WLZA 2WWKO 5IFHL 1YN6B 3CFKB 5EO0A 2Y07H 3O9WB 4YXLH 2VISA 4JO3L 1G9MC 5A2LH 1IGTB 3CDGA 1FIEA 3WFCH 4LAQH 5EFIB 5KOMC 3X14B 5I18L 1A6TB 3ZMRA 1AXTL 3H9YA 4OZFA 1AQDA 3QUZD 2DQIH 1BZ7B 2BP3A 5IEKB 3RNKB 1FO0L 3QXAB 1C12A 2YPLA 2D7TH 3MJ7B 4GBXA 4ZUSA 1MNUL 1IAOB 3VH8A 2FEEI 3N50A 1FE8H 2BY2A 3U6RA 3SEPA 3UROR 5EZJB 3NFPA 5DQDL 3QDME 3F8UB 3VJ6A 1RAMA 4JVUA 2VYRE 1R3LB 3B9AA 3D85B 4L8BB 1N8ZB 5EN2A 4Z7QE 1CT8B 4NZUL 5LWYH 5C0ND 4XP6L 2LV4A 1A7OL 3T2NL 2A6DB 2NXZD 3L3OB 3V0AC 3BPNC 4Z7VF 3P0YH 1QRND 3PJSA 4PV9B 4YIQB 3FFCB 2YD1A 4JFEB 4APQC 5A2FA 5I15H 1K2DB 4NJAH 3QDGA 5DHYA 1FQ9C 3TWCH 3PL6D 4BZ1L 4QF1B 3H9HB 1YMHB 2D0FA 3RKPA 1SY6H 4PLKC 3S35L 3NAAL 3MNWB 3F6IA 3JWOL 2HFEB 4ORGB 3CPLA 1WAAE 4AH2A 1Y0LB 2VNCA 2N4IA 1X9QA 4NCC2 3ARTA 2A6JB 1CK0L 4NZRL 1H9VA 3CCHA 5LCVL 1HQ4A 5L2KB 1C08B 5TJWK 1U8OA 4ZOBA 3FB8B 2CDFA 4QCIB 1LO5B 1I7RB 2YMXL 4GAJL 5HHMD 3KYOA 1ODAA 4FQ2H 3I02A 3V0VA 1J5OH 3PQYD 4NO3A 3BHBB 3QDJA 5CBAA 3D3VB 4Y4KB 4HIIA 2HG5B 5DD6A 5FHBL 2EXYC 5JIKA 3BPNB 1K4CA 4BSWB 3QUML 3P0VH 4JANA 4XPBH 1K9TA 1BX2B 1U8PB 4APQB 4EI6A 4ZD3H 3ZKXC 1T1ZA 3B2UD 3HPLA 5KVFL 2X10A 2Q7YB 3CXDH 3U4EA 1JFMA 1WVZA 4HZLB 3NN8B 5ABDE 3JV6B 1BD2E 3JTSB 1E28A 1RY7B 4WTZA 1N0LA 2O93L 2P5WE 5E8PB 3BWAA 2Q8AL 5DF0A 1QA9A 3VRLE 1U8LB 4H8WC 3WS6A 4F8TA 1L8JA 1G7PA 2P5EE 3EJYD 5TDNA 1H8OA 1MHPL 2H8PA 1CVRA 1FZKA 1CDHA 3BMVA 2DQTL 4CW1B 5EOCJ 1CFQB 3PP4H 1AO7E 5T33L 1NC2A 3LY6A 2VZ3A 1FFOB 5TQ2L 2V9QA 4KROB 1S7SB 1ZWIA 2VMFA 5MERB 2CR6A 5D7KE 3VU2A 4JGJA 3CSPA 5I1HL 5KANG 5SV3A 2HA1A 4OLYH 3PG2A 4I0PD 5CJOH 1PX3A 2VLME 5F70A 3X3FL 3MMEB 3WDIA 1BVKA 3SGDI 4JFZL 3PXJA 2A9NH 2R69H 4BK5A 4HEME 3MRBA 3BSZH 3ZKXB 1EFQA 1HHKB 4U2ZA 3WLBA 1PLGH 4KK8C 4JZJA 1KT2A 1RZJH 1HWHB 4UINH 4TN9A 2R1WB 4JY6A 2VLKD 2AK4B 1QBLH 1WCBA 5BMFH 4JZOA 2IF7A 4Y19D 3AUVA 4IMKC 3QFJA 1R6VA 3U7YL 5HGGS 4IBLT 3THML 3ZE2E 3HNSL 4KDTA 2NX5D 3IETA 4KVCH 3S3JA 1V7NH 1S7WB 4DN3H 1JL8A 4HKJB 2Z92A 5BV7H 5ISZD 4PLJD 2ENYA 5E5MA 4S1DD 2G60L 3OKLB 1Q0XH 4X6FB 3P4OB 5IUSA 1Q38A 2C3VB 1OY3B 3OZ9H 2IPKB 3B83A 5I1LA 4WY7H 3HR6A 1KB5H 1ZHNB 5C86A 4MLIA 5E6ID 1U8JA 2GITA 3FAWA 1RHHA 4XXCA 3BWUC 3MLYH 5L0QB 3FZUC 3BEVA 4HX1A 2GT9A 4NRZA 3F5WB 2OP4H 4Z7UB 3VI3F 4GW5A 3ZKQD 5C07D 2Z31C 2DDQH 4ODHL 2Z9TA 2JTDA 2UWEB 4N0UB 5GGRA 4WTWA 1OARH 1CZ8H 4XPTL 1YY8B 1E27B 5CUSL 2GY7B 4OKVA 4J6RH 1IKFH 3LAFA 4NKOB 1CLOL 4O4YH 1Q1JH 2MHAA 2VZSA 3NH7L 3BJLA 4FNLL 1MHEB 3DX6B 1FRGL 4PP1D 2BNUB 1JFQL 5D5MA 1G7QA 4S1SL 1ACZA 4HIEB 3MLZH 5C0RH 4P3WA 4LCUB 4NJ9L 3FQWB 1CGWA 3E3QE 3DETC 1UJTA 5IB5A 3VFGL 1MCWM 4K3GA 1JNLL 5HHME 1XF3A 5IB2B 3TBVB 3PQYE 5D8JH 2V7HA 5C6WH 1CGUA 2I9LB 1Q9LB 1IAIL 4MA3A 1IBGL 3BP7B 2CRIA 3CFIC 3KLHC 4G7VH 1RZ7H 1JUFA 5E4IA 1RUQH 5HDQH 4MDIB 1LEGB 2IADB 4ODXB 3DX9B 4HGKC 3O9WD 5J57B 2Z31B 1QLRB 2PYEA 1PG7X 1LEIB 1KULA 5EBGA 4LPTA 4RISH 2BJMH 3MJGX 4UQ3B 4BUGA 5GGSY 1EXUB 2NYYC 4ETQB 3UDWA 3FQRB 1MH5B 3OXRB 4P5MA 1IE5A 4ELMF 4XH2B 4QXWA 2JIXA 1VGEH 1J8HA 3G08A 5IESL 1A6UH 4R2GC 3RIAK 4GG6E 4XNMA 3QRFM 4E41E 1I1YA 3O8XA 4DGVL 2NY5H 4MB4A 2C7UB 2OQJB 4HIJA 2ATPA 2EH8H 5EU3B 3UC0H 4RFEA 7FABH 1RZ8B 3V7MA 3U0TA 4PV8A 1S5IH 5CJ8A 1H3WM 1R5WA 2YUZA 1AY1L 5EO1A 4GMSH 3QO1A 4CU7A 5IW1A 1X5YA 4G9FB 1HH6A 3V8OA 4WFED 3QO0A 3BEWA 1RJCA 5LAXA 2DTML 5I1JL 3PWLB 2GSGA 4UV7H 2AQ2A 4WNQB 1FO0A 1NFIB 1XF4A 1F4HA 2W0FA 3FFCD 4ZFFA 3MCLH 3SPVB 2O61A 4JFED 4HHAA 4YNYA 4W81A 3BIKB 1KC5L 5EH1A 3DHMA 3S96A 3WO3B 2E7HA 1UB6B 3DI3B 1S9VB 4HD9A 5CMAB 4U6YB 5GS0H 2X5PA 4NGHH 1BZ9A 2VLKE 4J4PC 1N6VA 4NO5A 1TJIH 4R2GB 1W0WA 1KIPB 1WEJL 1SMAA 5INCA 2BZDA 3GJFH 1YECH 2F58L 4PJEF 1JNHB 4OIIL 4KTEL 1F8TH 4ZFGH 3BKJH 3UBXI 3EBAA 4HMCA 2XRAL 1I8MB 5L2KD 5E9DB 4I5BB 4U1LB 3VXSB 3GKWH 3DIFA 2YC1A 5E8NA 1NCAL 4PRAB 3PWVB 4GW1B 1ADQL 3ULUH 2AEPL 1U92B 3MOAH 2KUTA 3D3VD 3DV4B 4Y4KD 1C5BL 1GPOH 1F3JA 2GJ6E 1BVLA 1MVFA 1G6RH 1NCCH 3RWIA 2DMCA 2Y23A 2Q6WA 3ETBF 1P6AB 1DUZB 4GLRH 4TVSa 3WHXB 4W4NA 4YHLH 4APQD 1PYWA 1QEWB 4QHNB 5CGYC 3B43A 5H35A 4X6CE 3TO2A 5I75B 3BW9B 1YJDH 3CUPB 1I1AA 3LKNA 1BJ8A 2R1YA 1MCQA 4PLKD 4NN6B 1N7MH 4FQXC 4GKNA 4LCWB 4G6KH 3ZYJA 2WBWB 5IGXH 2ZUUA 3KPSA 3Q6GH 1A7BA 2ZCLL 3HFMH 1U9KA 4MNGB 3QEUA 4JHAL 3HNTL 5JDSB 4XGZB 2NW2B 5E2TH 2PR4L 5F88B 5HD8C 3P9LB 2ED9A 5D7JA 3T3PF 4JZNA 3QUMA 3FQXB 2BHYA 2YRPA 4KROD 1I9JH 3QEQB 3DSFL 2AV7A 1KEMH 2EXYD 3PDDA 1WFUA 5F7EH 2X4TA 3P4NA 3V7AG 1B4JH 5IHZA 3ERYA 1L9MA 1YYLL 3OJVC 4JFHD 1OGTA 2BSSB 4M4RA 3C8KB 4XCNA 4OZ4B 4AEHH 1UWEL 5IBTL 3BO8B 1MLCA 4AG4L 1J11A 1KG0A 1RK0A 3GBLA 3GSRA 1EH9A 3MREB 1KCVH 4FQXB 2VXUL 4FXKA 3TBSA 4ZTOH 4XPFH 2AK4D 3TJHC 4ZXBA 1AKJA 4NQSA 5F3BA 3KJ6H 5DJCA 4XC3L 2I5YL 3NA9L 1OW0A 1IT9H 1W72H 4KXZH 5JIPA 4PLOB 1MJ8H 5SX4I 3MBEA 5HYSA 3PDOB 3RVVC 1BJMA 1FYTB 4XAWH 1DBAH 1CE1H 5HHNA 2QR0B 2VDMH 3CX2A 1T3FB 3SGKA 5AZEL 2A74B 4PJ5B 3V4PH 5FAAA 4UT6H 1WWCA 3KYNA 4ZUUA 2ESVA 3GI8H 3GNMH 4LQFH 2XWBB 1TMCA 4WFEE 4G8IB 1J1OH 3G6JA 4JDZB 4Z6AT 4R4NC 5E08H 3PGFH 4OZIB 2XOTA 1CL7L 4HJJH 3KJ4C 3WLWC 4KK8D 4LSVH 1JIBA 2X7LB 5JOEA 3SDYH 3JV4A 4KHTH 2A6IB 1TCRA 4XP4H 3IU4L 1FORH 5EDXA 2NY0C 1H3UA 5EIIB 4CVZB 5CEXB 4FMKA 2Y5EA 1TJGL 5J1SC 2VAAB 4KHXL 3S34H 1IGYA 2A2QT 3B2VL 4ODVL 1UQSA 4OLWL 1W8OA 4TSCL 4POUB 5L9DL 5T3ZL 2BHUA 4YFEA 5J89A 4JQXC 4AQ1B 3PWJA 4LSPL 3JXAA 1NCBH 2QTEA 4LASL 5GGVY 2NY2C 1ZANH 4GS7C 1HCVA 1YEIL 2ATKA 5FM5M 3MA9H 1AGEB 2DQUL 1FAKT 1VACA 3F7RA 1L6ZA 3FZUD 3P4MB 4LSTL 3RU8L 1L7IL 3SQOH 5DVLA 1C1EL 1ZLSH 3KJ4B 3MV7A 1F4YL 2Z31D 3C5SA 3JWDC 3T0XA 4JPIA 4X8XA 4F9LC 3A0OA 3KNBA 5FOBB 1KIRB 2BMKA 1RSFA 4RCAA 2NY0B 1XGUA 1JGDA 3IDNA 1P4LA 3P9WB 4AIXA 3F7YB 1HOCA 1DQMH 4S2SA 5HY9A 1VA9A 4FQCL 2DM3A 3KS0H 1AGFB 5SV4A 4DOHB 1ZHBB 5DMYA 5KVDH 1TVHB 5CHNA 4EUPG 3DYPA 5BCAA 1M7IB 1YNLL 3DETD 3K81A 2BK8A 3A6OA 3O3UN 5HYQA 1WBYA 2FX9L 4NQXA 5CFHA 2NY2B 1KCRH 4MSWA 4D8PA 4WU5B 3FONB 4GS7B 5E2WH 4LAJH 1U91B 3UCRA 4HFWA 3BIBX 2ITCB 4DZBB 3ZTNH 5K59F 1HKLH 3WS3B 2R1XB 3KLHD 1U3ZA 2JLLA 2OTPA 3HG1B 4G9FD 4L1HA 5BS0A 2V7NB 1FVCA 2G5BB 2CRZA 1KJ2H 4ZFZB 3QHFL 3K4ZA 1T6WA 4MJ6A 2NLJB 1WZ1L 4GH7B 3QCTH 4ELMB 3O3DB 1TETH 3FO1A 2NYYD 1Q8MA 3QXDA 4P5KA 4NN5C 2LU3A 4PTUB 3ZYZA 2VE6B 1HHIB 3RWHA 3X11A 1T0NB 4P46C 4OB5L 3TJEH 2DLGA 3TZVA 4FABL 4YHZH 3L5HA 4HS6A 5HGHB 4R2GD 4K7PH 1RVFH 3BP5A 3U30C 2UVEA 4PY8I 4U49A 5IF0B 1IQDB 5ADPL 1JYNA 1DQDH 1T04A 2A0LC 2DLIA 4J7RA 4WU7B 3W2DL 2NZ9C 1WFNA 3UTQA 4OCYH 3HZKB 3MJ9H 4P99A 5E9DD 4LGPB 5TQ0H 4LDEB 1QSFE 3VXSD 2J88L 1DBML 1D9KA 1AJ7H 3IJSA 4XPGL 5FA4B 3F65A 4HEPG 4RMVA 3ELAT 3BZEB 3GBNL 5I9QC 1AIFB 3EYQC 1A22B 1JWUB 3RWJB 2XKNA 5D5MF 1KF9B 4K3JL 1XF5B 3ZTJH 2K9UA 3T8XA 4OLXL 3OAYH 3SBWC 2DQDL 2AW2A 4Y7MA 2X4PB 4NN5B 1GHFL 2UWEE 4P46B 3PGCA 5DRNA 4W6WB 3NTCH 2HVKA 4J4PD 4PJEB 5K93A 1UC6A 4UOJA 4PG2A 4PG9B 4LCWD 3RZWA 5KVMC 3STLA 4J8RA 4PREB 5HGAB 2F5AL 2ADIB 2H32B 1ADQA 3HI6L 4C56B 4ESKA 5B39B 3TVMC 4U1MB 3TCXA 5I73C 1SVCP 4MDJA 4U1JB 1UCBH 1NPUA 3RHWK 4JFQA 3MFFA 4X9GA 5GGUB 3VGBA 5LGKA 4PR5B 4P9MH 4CKVX 1M7DB 1S5HB 3RWFA 1CIDA 4GBXC 5I9QB 3GIVB 5ECJE 1S7XA 5KSUA 1NGQL 2BNQB 1OAQL 2VDPL 1AXSB 1OM3H 4IS6A 2ADJA 2J8UA 4JFFB 4G8GB 3QNYB 1NBVH 3O3BB 3HAEB 4MXWL 2XT1B 3FN0L 3BDYH 1HSBA 1LHZA 3IDYC 1F3DJ 3O6MH 3MNZB 4KAQL 4XC1H 1PZUB 5CGYD 2KQMA 4QRQB 2CKNA 4BFIB 2MNUA 1WWAX 3IFOB 5TGBA 1PEZA 2ZPKL 5F9OL 3Q1SH 4H1LG 5EO0B 4FQXD 4XHJC 2VISB 4OBSA 4K3HA 2PCPA 3CDGB 3MODL 4YHNA 1A6WL 2Z8SA 1JHKL 4HDIA 4OZFB 1VB9A 4NNPL 1I7UA 1AQDB 4JFOA 3AREA 4YFLI 1JGEA 1HILA 4RGNC 5HD8D 1G9NC 3MV01 1C12B 1CGTA 1Q0YL 3QWQB 1DLFH 3SDXF 5KW9H 2YPLB 2EXWC 4HC1H 1FYTD 1LO3L 4GBXB 1WF5A 4ZUSB 1UM4L 4QHMA 2KL6A 3VH8B 1DBJL 4PJ5D 5KZCB 1JTPA 1KCLA 3U6RB 4OF8A 5HHVH 1MPAL 2FH6A 3NFPB 5C08A 3IDYB 2MTPA 2DQEH 3VJ6B 3V95A 4PJXE 5EN2B 2IBGA 5EUOA 1KXTB 1NMCC 5LQBH 3MLUL 4OCXL 4D0CA 3MUHL 1IEAB 1EIBA 1G6VK 3RAJH 2HKFL 4Y4FA 4KV5E 1GGBL 3E6HA 1EMTL 4L29A 4B50A 5JPNA 3PJSB 3TJHD 2D7NA 1WWWX 4H0GA 2WIMA 1D6EA 4YWGL 4RGNB 1FBIH 4X7EC 3FHQA 3RJDA 4FTVA 1UKTA 3GI9H 4UTBL 3RVVD 5F7UA 3U4AA 4UT7H 4NHCL 5F8RC 1LD9A 2MQ0A 3ZDZF 3CPLB 4AH2B 4PJHE 4Z7VE 2AEWA 5H94A 2P1YA 3GUTA 3WS6C 3FRUA 3CCHB 1HQ4B 3AAZA 1UKSA 1U8OB 4OD3L 4NP4L 2DQHL 4M5ZL 2CDFB 3N0PB 5ICYA 4LKXA 3BJ91 4R4ND 5AAWA 3KYOB 3OKEA 3I02B 3V0VB 4NO3B 5SWSA 3QDJB 5CBAB 3VWJA 3WLWD 3MV9A 4L9DA 4HIIB 5DD6B 5CEZD 1H8NA 3BD3A 1TTFA 3MXVL 4L1DA 2C1PA 1K4CB 2EE6A 5F3HA 3ZSSA 5T1DL 1FNLA 4JANB 1OSPH 2NY0D 1GCFA 1A9BA 4J3OC 2R39A 4M4PA 4MAUH 4YHIA 1UCTA 4EI6B 1RZIA 1MCBA 1T1ZB 3HPLB 2B0SH 4OGXL 3GO1L 4GKSA 5EORL 1RQ5A 4XXDA 3U4EB 1MJ7L 3JUYA 4JZJC 5F71A 1QOKA 1A3RH 2AJZA 4M5YH 3VFPA 1E28B 4V3EB 1QACA 4NOFA 3MRRA 4WUUE 1BEYH 2BVOA 5ESQA 3BWAB 1C5CL 2VTFA 1QA9B 1OTTC 2L0DA 2NY2D 1ZOXA 3MRMA 4PFEA 4V2CB 3UPAA 4R8WH 1INDL 1G7PB 4NQEA 4KDTC 2XIDA 5TDNB 2H8PB 3OKMA 1FZKB 2VKWA 1RIHL 1G0XA 2OM5A 3V6ZA 5C0FA 4AEIH 1NC2B 4I9WD 3HG1D 4JRXE 3BKYH 2ORBL 4XP9H 4BFGA 1EO5A 3FRPG 1ZWIB 1M6OA 4FS0A 3W9DA 2XXMB 1XF2A 1BVKB 3TF7A 3NCBB 4ELKA 1T4KA 3MRBB 4XXCC 3N85H 1GGUA 1IGIL 2DL2A 3QYCA 1RI8A 4UI2A 3TT1H 4FMFA 3WLBB 3WUWG 5I0ZA 3D1MC 4JZJB 1KT2B 4AMKL 3NIDE 1WFOA 3HI1A 2VN7A 3G6JF 1PEWA 5GRJL 3LQAH 4JY6B 2HYMA 1NAML 4OCRH 4JZOB 4F7TA 3IXAA 3L3HA 3QFJB 1K8IA 2VLRA 1LEKA 3MR9A 4OM0H 3IETB 3WJLA 1PQZA 3ZTJG 1AP2A 2AABL 1GXEA 4G6JH 2Z92B 2IQ9L 1WV7T 4NWTL 4X83A 1BLNB 5E5MB 1B2WL 1MCPH 4HK3N 4M8QA 3VFRA 2RB8A 4PJIA 5I1LB 2F74A 1U8JB 2GITB 1RHHB 2VQTA 2MQCA 4M3JA 1DE4A 2HFGH 3GIZL 4FG6C 1G0DA 4GAGL 4X4ZA 4DCQA 5TE4H 4P46D 4QXUL 3BEVB 1J1PH 4L4TA 5EC2A 4HX1B 2GT9B 4NRZB 1X44A 4GW5B 5C0BD 2C4XA 5LGJA 4LIQH 2R4RH 1NCDL 5GGRB 3VD4A 4MWFA 4F3FA 2G5RA 4I3GA 4QRRE 5EZOH 5KOVC 3RL1A 2A0LD 3RVWC 4OKVB 4C56D 4NZTH 3ROOA 2NZ9D 1NMBH 2MHAB 4TQEL 5JXAL 5GRVK 5HHPA 2O26U 2G9HA 5MHSD 1GC1C 5JPMA 1FN4A 3CDCA 3OAZK 3VGEA 5GJSL 5D5MB 2R8SH 1G7QB 2DQCL 4P2YA 2CQVA 2XQBL 3MLWL 4PJAA 2BNQD 4KQ4L 3O8XC 4DJMA 3VI3E 3EYQD 1CD9B 2W9LA 4I77L 5IFAL 4JFFD 4G8GD 5IB5B 1T2XA 1XF3B 4NBZB 2V7HB 4PRHA 4PBWD 4PJ7A 1MRDH 4M6NL 5FYKH 4N8CH 5CEZE 4MA3B 1OP3K 2IBZY 1MEXH 2QQLL 2DWEA 4LL9A 3MCKA 2OL3H 3GEWB 1JUFB 3I2CL 1KFAH 1MCIA 4N9GA 1ZGLP 4EUPA 3H8NA 3QQ3A 3BFOA 3PF2A 1BFVL 1LP9A 2PYEB 2QL1A 4G6AC 3SKMA 3NZHH 3MV11 4Z78A 1BJ1J 5JA9A 1TIUA 2MCPH 1A7RL 3TV3H 4DOHE 1BIHA 5D2LA 1QFHA 1KN4L 4P5MB 5CSZA 4PS4L 5MEQA 1RURL 2JIXB 1AGBA 2YPLD 1EHXA 3QZWG 1J8HB 3G08B 1AGDA 4MAYA 2PTUA 4GBXD 1DLHA 2NY3C 3LRSA 4XNMB 2X9WA 1I1YB 3O8XB 1YEDA 1MCRA 3FQUA 4RAUA 4Q9RL 5C09A 3UO1L 1CE6A 4HIJB 2ATPB 2P49B 1E6JL 1G84A 3IKKA 5SWZA 1UENA 4RFEB 2O5ZH 4K3EL 4LHUG 2X44D 3GJFA 3U0TB 4PV8B 1OGAE 1UA6H 1R5WB 4JRYA 2HFFA 2G2RA 4Q74A 25C8H 3QO1B 1YMMA 5JOPD 2L7JA 5DWUL 5IW1B 1HH6B 3BVNA 1JPGA 1UM5L 4PRIE 4LNVA 3G9AB 3QO0B 3BEWB 5LAXB 4PB0L 4XHJD 1MIMH 2GSGB 1FO0B 2IPUG 1NKOA 1JK8A 1XF4B 1BFTA 5MENE 2W0FB 4ZFFB 2FYYA 2J7LA 1GSMA 2O61B 3SDXB 4M6OL 4HHAB 4YNYB 2FB4H 3LZFL 3S96B 2BOBA 4YC2C 2AAVA 5DUBA 1HWGB 4RGND 5IMOA 1F6AA 1BZ9B 4KUZL 4MQ7A 2EXWD 4NO5B 1YQ2A 3ARUA 4LSSL 1Z2KA 1W0WB 4MA8L 4Y16A 4GLRI 4HBCH 5INCB 1MFDL 4D94A 4MJ2A 3AS1A 2Q76A 3D5OF 4CVWA 1NMAH 3SGEH 2GJJA 4A6YB 1HYSC 1U8KA 2CDEA 3DIFB 2YC1B 5E8NB 1F4WH 1C8PA 5D7JC 3L7EA 3V52H 1FC2D 3T08A 4LCYA 3UZEA 3QDJD 4M3KB 1L4IA 4HCRL 1F3JB 5EU6A 1BVLB 2AJUH 1F5WA 3S35X 3RWIB 4F2MA 4UNVA 4NKQB 3L3GA 3NIGE 2WUCL 2E27L 2DI8A 4G9DA 2Q6WB 3RX5A 5F7LB 4WCYL 1AE6H 5C0BE 1PYWB 2J8UF 3EOBA 4QTIH 4NKMA 5H35B 1KLFA 4NUGH 1DFBL 3TO2B 4N1EA 4WWID 1I1AB 3LKNB 3OHXA 1OLZA 3VXNA 4U1IA 4C56E 2R1YB 3DHJA 1BQLH 2R0KH 4TUKL 1A7QH 1ZMYA 1A9EA 4TULH 5IB4A 3DUSA 4MXVE 4BQBA 1CDUA 1RIUH 3KPSB 5MHSE 4F7CA 5KJRH 3QEUB 4ZOCA 1OW0C 4QTHB 2WQRA 4OF6A 4AJ0A 2GW5A 1KEGH 4LLQA 3MBEC 1QYGH 1CBVH 4G8GE 5D7JB 1NC2D 15C8L 2EKSA 4UUJA 4H1LA 4JZNB 1MVUA 2YD4A 1P53A 1MREH 3MNVA 3LCYA 4PJ9A 3SGKC 3ULSA 1FNEA 2X4TB 4JG1L 4RWHA 1NGPH 1HZHL 3P4NB 4KXZI 3HC3L 5IHZB 4J23A 1ZLWH 4LVHC 4H20L 1OGTB 4MHHG 1AQKL 4R7NA 4XCNB 4PJ8C 3B9KA 3VMNA 5I30H 4O5LH 5D2NE 1MLCB 3H6JA 1UYWL 1D5BA 3RDTA 3K8LA 1KG0B 1HIML 1RK0B 3GSRB 3T3PE 3G5YA 2HKHL 4Y2DA 5EUOF 3TBSB 4FXKB 2APVA 3M45A 2IH1A 1N5AA 5DXWA 1MJJA 4TUOA 1A6VH 4JFYA 1IC5L 1AKJB 4NQSB 1X5IA 2BSTA 2YPVL 5F3BB 4PDCE 3QFJD 2YPLE 2A1WL 5DJCB 4G43A 1VFUA 1A7NL 4UAOC 5DC0A 4P59L 3ULVE 1A4JA 1P4IL 1QLEH 1KCSH 2Q1EA 1QBML 4CGTA 1GL4B 3NCEB 3MBEB 4M7LL 4YZFE 5HYSB 5C92A 4C83A 5HHNB 5F7FA 2UY6A 5FUOL 2NNAA 4JY5H 5FIEA 5DJYA 4G5ZH 3KYNB 4ZUUB 1A3QA 2ESVB 4R4FL 4LVHB 5CLWA 2FHBA 1TMCB 3KXFA 2CGRL 4WHDA 3G6JB 3H9ZA 1DEEA 4YQXH 1U2HA 4JHZA 5I8OL 3MRHA 2ICWA 4HWBL 5K9KA 2BRRH 3JV4B 3OR6A 4F7MA 1BHGA 1FSKC 1TCRB 3MLXH 2FGWL 1Z3GH 3WNNA 1T5XA 1J8KA 3GSVA 3MUJA 4Y4HA 4O51B 4TRPH 1JWMA 2HLFC 3QRGL 4DN4H 5DC4B 3CSYA 5I1EH 4OCLC 1IGYB 3HNVH 4MNQA 1UQSB 2ZCKH 2J4WH 3AB0C 2NY4C 3V5KA 4K55A 3MLRL 3X12A 3PWJB 2B1HL 2AJXH 4MNHA 1ZAGA 3BZ4A 4JY4A 3ZZ1A 5JDJA 5JTWA 1KPVA 1CG9A 2MWCA 5D4QA 5TFSH 1OOAA 2ATKB 1KELL 3OKDA 1JJUA 4UIKH 5FO7A 4EDWL 3SY0A 1VACB 5GGVH 4FFZL 4FG6D 1FGVH 1TENA 2WANA 1OP5K 4YDJA 2Z8WC 1AFVL 3HCVA 4H8WH 3IU3B 1J9CT 3FMGL 3R1GH 4LNRA 2DN7A 2VDRL 1CXLA 2PYED 3VI4F 3C5SB 2BDNH 3VMPA 4DTGH 4K3DL 4JPIB 5GS3A 3KNBB 4JG0H 3RVWD 2BMKB 4ONOA 5F89A 4P4KA 1CFSA 1JGDB 1XGUB 3IDNB 4S10A 1P4LB 3OJMB 4L8CA 1HOCB 4S2SB 5HY9B 1DQLH 1SEQL 1V3JA 1LO0L 3TZVC 4WI4A 2JIXD 2V17H 2YKLH 4QOKA 2R29H 1J8HD 1YC7A 1F4XL 5DEGA 3AB0B 2NY4B 3FRPA 2XY2A 1HNFA 3CSBA 1NANH 1BQUA 3FFDA 5CHNB 3LS5L 2VUOA 3O8XD 4QY8A 5GGRY 1JF1A 4JREC 3MUY1 1JGLL 5J3HC 1A1NA 1GGTA 1WBYB 5HYQB 4MSWB 3VFOA 4D8PB 5HSFA 2JCCA 3OV6A 1KNOA 4IRSA 4KKAC 3WN5A 2XWTA 3MV8A 4HFWB 5CCKH 3QEGL 3WUWA 5IVXE 1P4BL 3TESA 3RKDC 1N6QH 3CFCL 1FVCB 1OSZA 5KTEH 1D7FA 5C0IA 4OCNC 4MJ6B 2V5SA 3KLAA 4G6AD 1ZHLA 1O7SA 2IG2H 3WKNA 5B8CA 1JHLL 3FO1B 2F54A 4MCYB 4TNWK 3QXDB 4LPYA 4P5KB 1P2CA 4OKDA 4YDKL 3RWHB 3X11B 4LK4A 3SDDA 4PJIF 3LV3A 3MRIA 1BBDL 1JPSL 3TZVB 4JO1L 1QHOA 2VZ1A 5DD3H 2IGFH 4RBPH 4HS6B 3BP5B 2NY3D 2P7TA 2C9AA 1JPTL 2GUOA 1T04B 3OF6A 2VSDA 3AMKA 4JREB 4RDQF 3UTQB 3T0WA 3OX8A 5DHVA 4M7KH 5FGCB 1JGUH 3HC4H 2FO4B 1D9KB 2WP3O 2ZG2A 2EDTA 3IJSB 4LARH 2LVEA 3V0WL 1DP0A 4RFNB 4P5TA 4Q0XH 1HHJA 4ZNEE 2W38A 4LHQB 1F58L 2YPKA 5ITBH 2XKNB 3MUGA 2J3SA 1F13A 1FE8L 4UB0H 4YXKL 3T8XB 1AGCA 2IPTL 1HEZA 5EOCH 4OSUH 3EO1A 4ODSH 1ZGLA 3PGCB 5DRNB 1MI5A 4JO2H 2HVKB 4OIAA 5J6HA 3NIFE 4PJ7F 1QQDA 4R96A 4ACPA 4OCMC 32C2A 2XZCH 3SKJH 3STLB 2HTLC 4J8RB 1NGZA 3ECBA 5ILTL 1T66C 1Z0NA 3KPSD 5T1KA 4N0YH