3KPMA

Crystal structure of hla b*4402 in complex with eeylkawtf, a mimotope
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kpmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kpmA01
1K5NB 3CFBB 5EUOE 4PYHA 4CGTA 5C2UB 1MELA 4ZUTA 5EU4A 4U7MA 4WI4A 5FO9B 1I1AA 3WFDL 1OHQA 2YXFA 1NC2A 2NYYD 5JOPE 5D5MA 3MV11 4PJFB 4AT6B 3FCTB 3IJSB 1EEUA 3BO8A 4LLAA 5FYLD 1B2WH 1A3QA 4JKKA 2NY5L 4YBLC 4MNQD 3WNMA 2J8OA 2LAAA 5KS9A 1EA9C 3VD9A 3TVMA 3BQUD 3CUPA 4CBPA 4YFLI 4F58L 4WW1A 3I6GB 2A83B 4MA3B 3KLAA 1XR9B 1ADQL 2CKNA 2ITDA 4D2NA 2CXGA 4QXGL 5J1SC 3P0VL 2JELH 3ZKNC 5I0ZA 1WBYA 1Q8MA 4OZIF 1LK3L 4EI5A 3QUZC 1ADQA 1LO3L 2B4CH 2W65A 3HCVB 4ISVB 3RWDA 4MXQD 1J18A 2NR6C 5BV7B 5JW5B 2C4FU 2NX5D 4TUOB 2DLGA 4PGDB 4MD5B 4NZJA 3GMLB 3ZE1E 4LBEA 4HUVB 2Q7NA 5K9QG 1OB1A 2Z31C 1MCSA 2NXYB 2B0SL 1TENA 1KELL 1UXWA 4JPWH 1UXWB 4NQTA 1P7KB 4JGUA 2AGJH 2FO1A 3IDYB 5J12C 3ZO0A 5I8OL 4IOSD 4WWID 5T5NF 4OCYL 4R3SB 3NN8A 4ZPTB 2UVEA 3WHXA 4FN0A 3ISWA 1JF1B 4LOUD 5D7LD 1I8IA 4Z9KB 4LLWA 3VFGH 4OF0A 4J4PC 4L8CB 4OKVB 5KTEL 2VLRA 1V7NL 5HGDB 4MMZC 4E0RB 4NSKA 5E6IC 3F7RA 4QXTA 3MRPB 3MO1B 2R9HC 4OBSA 3I6GA 3QJHB 3EHBD 2AJXL 1Q72H 5FYJL 1CN4A 3BGAA 1Q1JL 2HTKD 4JDTH 5GGSB 2P8PA 3S88L 2B2XH 4X99B 1QLFB 4XNYH 5IMKB 3NFNB 1MCKA 3C5SB 3HUJA 4OJFH 1Q94B 5CZXC 5JLZA 2IANA 1E4KA 1IFHL 5EUOB 3HE6A 3DVFA 4PJ9B 1H0DA 2OS7A 1TZIA 3AS1A 1AGFB 4PJAB 3DECA 3PDGA 3OZ9H 4OZ4B 2VZOA 2WLZA 4YDKL 2MKWA 5GRUL 3VWJD 4D0CA 4ZODA 1CS6A 4Y1AE 4OLZL 1FVCA 5EUKA 3M8OL 5F96L 3S35X 1FZKB 1BFSA 1IKNA 1HXMB 3VXSE 2Q8BH 3ZLQC 1S9XA 4P3DA 4H1LG 3FOLB 5L6YH 4D9LH 3CK0H 3MV01 1K6QL 1X5XA 3O3DB 2NXZC 1EFXB 2ZG2A 2VN7A 5CILH 1FZOA 2XG4A 4HUUA 5F9OL 3V6FA 4O9HL 3Q6GH 3VFNA 3RPKA 1SHMA 2VJXA 4OCMC 1RUAH 3PP3H 4AK1A 1YEDB 1G7HB 1S8DA 3MRMB 4HWZA 4YE4L 3SKJH 4FTVA 4FQQB 4S1QH 1KEMH 3MR9A 4F33B 4UQ2A 1ZMYA 3W81A 5IB2A 1L7IH 2N1KA 5J1AA 4W70A 3U30C 1EV2E 5DFWH 2IQAB 2EDNA 3L9RB 1MHHA 4WU7A 5TH2A 4N8CH 3U4AA 3PGCA 3BP7B 2BRQA 4BSJA 2GAZA 1JE6A 4XP1H 3P3YA 3PABB 1BBJB 1NBVH 3LZFH 5KSVB 2P46B 2ERJC 2ICWB 4U6YB 3KYNA 15C8L 4HT1L 1MCOH 2R69H 4MA7H 4PV8A 1R0AL 1CLZH 2Z9TA 1A1OB 1KJ3L 4BZ2L 3UJIL 4HMCA 5FA4B 1T21B 3RX5A 1QPXA 3U46A 5GHWH 3E3QA 1T22B 4R9HA 2VDLH 5IFAL 1FVDB 1KPVB 4TRPH 4WW2A 3OKOB 3VFWB 2EZ0C 3VXTB 2IPUK 5C3LD 1AC0A 1N2RB 3RVVD 3C8KA 3IT8D 3QI9D 4FABL 5L2JA 5JXAH 5SWQA 4MDJA 4QHMA 2CR6A 2Y7QB 2FIKA 4Z7VE 5J4MA 2VITB 1QLEH 1QSED 2J1KA 4JPIA 1QR1A 2P42B 4P9ML 4N0CD 2XQBL 1S7RB 1AQDB 1I8LC 4M6NH 4QHMB 4XNQA 5CZKA 1NJ9B 1OGAD 1J12A 1QKZL 5ADOH 5IGXH 3FZUC 2J8HA 4CVWA 5IB1A 4YHLL 4JRWA 2VLKE 4GSDL 5IF0B 4GLRH 4PD4K 3CFIC 1NDMB 4WJ5A 3ZKQD 3GB7A 2G75A 1EVUA 2FECL 2HLAB 3NPSB 5IEHA 3LHPH 4C58B 1XGRA 3L5WA 3IDXH 3DV6B 3P11H 1AKJA 1HYSC 4RA3A 4R4ND 5ANMA 5HHQA 3ZKXC 1X4YA 4PJCA 3D25B 5TQ2H 3LQAL 5ETUB 1M1SA 3O3UN 4KI5E 4P5TA 5E6IA 1WF5A 3BGMA 3PWPE 4L1DA 5IQ7H 3C09B 2IH1B 2C3GA 1BZ7B 1UCBL 4AENA 2HJLB 3GSUA 4N8VB 3OX8A 5SV4A 1MFEH 5K33A 3SHSA 1J8KA 1A6UH 1FSKC 2IALB 2GUOB 2Z4QA 4KRPD 5EPMB 1YNLH 4G8EB 1LE9A 1X5IA 4ZQKB 4QRPA 5HYSB 5E5RB 4EN3B 2ED7A 3D18A 4RGNE 3QWOB 5DJDB 3U36A 1RUQH 1KNOA 4WEBH 5SX4I 1R5VB 1BQLL 3ARXA 5E8EB 1P69B 1XH3A 3ARUA 3NABH 3QUMB 2ZUUA 4YGAB 1I1AC 4GW4B 2X4TB 3PHQB 3U9PL 4NT6A 5E99H 1N0XL 4F8QA 3HRPA 5DRZB 5DYOA 3TLRA 1VESA 2V7HA 3OKNA 2CK2A 3K8LA 2IPTH 4QCIB 5BS0D 3BFOA 3LN4A 4H1LH 4WU5A 1P1ZB 3MV9B 2W9DH 2FO4B 1U8OA 4AQ1B 4ODXB 4DZBA 5TE6L 5FECB 1HIML 1NC4D 3FQRA 4OF5A 2EYSA 2UY7A 2MPAL 4K3DL 3QDGE 5IFAH 4X6BB 1IGMH 1WCQA 5C6WH 4NNPH 3ARGD 4GFTB 4Z7WE 1E4XH 2VISB 3L3KA 2F5BH 2UYLA 4I13B 4FABH 1RD6A 1MCCA 4N0FA 1FIGL 1TQBB 1MAKA 3CZFB 5E56A 1GC1L 2HYMA 4OF8A 1J5OL 2VDKH 2Y07L 2ZSVA 4DUWA 4PRIA 4L9LC 5F7MC 4KROC 5DRNB 1R6VA 4NO3A 1NAMB 3NFNA 4X0KB 4FMFA 3IJYA 2HRLA 4M1GH 4XTRC 2CLZB 4DUVA 1R3KA 1IGYB 3CH8A 2NZIA 5CGYD 3T04D 4FFZH 4RRPG 4ELMB 1KIQA 5FHBH 4XBEL 1KCVH 1JV5A 5C08D 4HQQL 3S35L 5GS0D 1H5BA 2BDNL 5IVZB 4FP8L 3V8CA 4PB9L 2HMIC 5I1GH 5DLMH 3TV3L 2GTWB 3DRQA 4NKMB 5IMMA 3X3GL 1KB5H 4Z0XB 2OL3L 3IDXL 3Q3GA 4ENED 3R1GH 2HFTA 5E9DE 3LRSA 2IAMD 1HK6A 4P57B 5ACLA 4L8SC 3TBWB 3BUTA 2D4FA 2H8PB 2H9GA 3T0AA 4PGBB 3L9RA 4GBXD 4YO0A 5JMOC 8FABB 5C9KA 1PQZB 3E6HA 1Q9OB 1V7NH 1MCFA 5KVDL 1P84J 5L2KA 5T1LA 3V52L 4N1HB 5DK2A 1K9TA 3BPLB 1FDLH 4G8GD 2A1WL 1ND0A 3BIKB 3BKML 2HFGL 2PYEE 5HYSG 2OQJB 4TVPD 1GGTA 1CDBA 4JHWL 1LP9A 2FWOA 5FK9A 3WBDA 3B6SB 2GT9B 1OF2A 2PYEA 3WIFA 1G9EA 3DBXA 4PRNA 3RPIA 4TN9A 5IMLA 2EKSA 4KDTC 3U4BL 5KSUB 3SBWC 1ODAA 3PWPD 4P4KC 2OX5A 4TVPH 1MIMH 5D7IA 4ZD3H 2C1PA 5C0BA 3H3KA 3GMOB 4X4XB 4UQ3B 3O9WB 1D5IH 5T1LD 1UZ8B 3UPAA 3DURA 5DFTA 4HT1H 1R0AH 1RVFH 4MB5A 1SJXA 5IJVA 4NUGH 4HXBL 3R8BB 1RIHH 4FXLA 4Y8DC 3HFML 3T0EB 4BSVB 4F9LA 5D1ZA 1NC4A 3EDDA 1AQDA 4Z7OE 4Y4HB 1YY8A 3TO2A 5F7DA 1I1AB 3SGKC 5BQ7B 4K9EL 5DJCB 2VKWA 2VDRL 5K9OA 1EBAA 2E7MA 5HYQA 2NZ9D 5TF1H 2CQVA 1FH5L 1I1CA 1KENH 3GFUA 1EJOH 5LAXB 1T80A 3IS1X 4U6TA 1KJ2B 2B5IB 5EU6D 3QIUD 5JIHA 3GSNA 3VGHA 3T0WA 4LPUA 1J87A 2BVYA 4S1SL 4F9PA 4B41A 2C5DC 5DK0A 3IDNA 1BFVH 1IM9A 3EFFA 3SDDB 1FZMB 2FX7L 5A3ID 2VAJA 1CI5A 3Q2CA 1AFVH 1S7QB 1PVHA 5DO2D 1MAMH 1IGFH 4PV9A 4ZUVB 5LGHH 1A7OH 3ARRA 3RHWF 2DMBA 3IFLH 1A1OA 1IC7H 2YBRB 2FEDC 3V7MA 1XGUA 4H25A 4U3CA 5CMAB 3CLEL 1D9KA 5A40E 2BVQA 5IVXF 5J3HD 4PREB 1ZANL 4OCXH 2DICA 5I1IH 2MQCA 1PKQE 2DQUL 1KIRA 3N0PB 4HUMB 5C0EA 4LSVH 3WLBB 4OCYH 3VG0H 3MODH 3EJYD 1A7RH 1MHCA 1G7PB 5E8OB 2ZP0T 2OXGA 2VLMD 1H3PH 3WUWB 4LARL 2W07A 2D7TL 3V4PL 1OOAA 1HSBA 2AXFB 3IKCA 3BDYH 4FQQA 4W4OC 1MHCB 5TDNB 3NIDE 3N9GH 3U9UA 2IALA 2BXYA 5H2BB 4AIXA 4JFQA 2MTPA 3RWFB 4JJ5A 3F7VA 1Q1JH 4JDTL 1FO0H 2B2XL 3TVMB 4HUUB 1FZOB 1X5HA 5IIEB 1KOAA 1GL4B 5D4QA 5ETUA 3M07A 2Q20A 5C0ND 1YMMA 4JVPA 3IDUA 2JJUA 4Z5RB 4F15B 1UB5B 4R7NA 2ADIB 3GM0A 2VL5A 3KPSA 4KVCH 5DFVC 4X8JB 2A9NH 4L8BB 1FZKA 3VXME 3O6LL 5MEOA 3JTTB 3QJFB 5DD0H 4Z7QE 1K4CA 1LO0H 2P7TB 4PFEA 3VU2A 5GS2H 3W9DB 1JFQL 2W1NA 4HFUL 3QIUC 4FQIL 3SKMB 1RIHL 5JO5A 1I3UA 3QDGD 4GMTH 4KGLA 2KZWA 4NQCD 1A9EA 2DDQL 4DK6A 2GY7B 1A2YA 1ZKAA 3K2UH 2OP4L 2QQKL 4Q9RH 1QLFA 3WMSA 5I0DA 1PKOA 5JPMB 1CIUA 1LEKA 4DKFL 2BOCA 4HG4J 5C0IB 2GTZB 4HCRH 1DBKL 3U7WL 3E8UL 4LKXA 3L3GA 3L3IA 2B4CC 1NQBA 4X7TA 2DKUA 2BJMH 5E8DH 2E5EA 3FB8A 5DMGD 4TUKL 5JW4N 1S7WA 4KJQC 1VACB 2VSDA 2Q6WB 4EUPH 3VH8G 4ODVH 1ZVSB 3IDIA 3CFCL 3MNZA 3N06B 4HUNB 1AGCB 4GMSH 4HGMA 1T83C 2X6MA 3I75A 4Z95H 4X9BA 1VFAA 3QZWA 4LRIA 1UWGL 1PSKH 3WNKA 5ESVB 3LIZL 3VXRA 3MV8E 1N5AA 2L7JA 1X4XA 5F72S 2F74A 2DYPD 3O6FD 2IPTL 5I1IL 1TPXB 1NAMH 3WFCL 4L9DA 3MV7E 5HYFA 2OL3H 3RVVC 3NZ8A 3HLAA 4UMGA 3H0TA 3D0VA 3H42H 2PTUA 5HGAB 3D3VB 4ZO9A 4BH7A 1ND0B 1T0MA 1EHAA 3BIKA 1B88A 1MHHB 3DETC 5LWYL 2NPLX 5DF0A 5F1SA 5B22A 4HUXA 2AK4B 3WS3B 4MJ4A 5K93A 2O93L 5F7LB 1JGDA 2UZIH 4L9LA 1JNNL 5I9QC 4TVPE 4HG4K 1J1OL 1HH6B 4YPJA 5I1DB 3H9SE 1CFNA 1NMBH 1MFAH 2YA2A 1HSAB 2MJWA 3MCKA 1JJUA 1CD1B 3O6KH 5FDYA 43CAB 5D2LA 4KKBD 4QXWA 1JIBA 3KNBA 2HFEA 4NO2B 2GFBA 3IFPA 3MRNA 4TSBH 3MYJB 4LAQH 3K4ZA 2PR4L 4X5XB 4FP8H 1NBYA 1I7RA 5DJXA 4EVNA 4UTAH 2NLJA 5DRWB 1NMAH 1IGYA 3OMZA 4FQ2H 4PJCF 5EC1B 4OF7A 5EU4B 2ENYA 1RZGA 4XB8A 3VDAA 4J2XA 1AXSA 3HC4L 1WISA 2NW2A 1YPZA 3QEGH 4NZTL 4PJXA 1AXTL 4NFCA 3QDGA 3TM6A 4NQEB 2XQYG 4ZS7L 1JGEB 5FOBB 1RULH 1CGTA 4Q9RL 1T5XA 3LQAH 2D9CA 5HHOB 3MX0A 3QH3B 3TT3H 3DO7A 4DKFH 2G5BA 3HPLB 4KDWA 1I3GH 2VDRH 1BQSA 3AREC 5GGRB 5DQ9B 4Y88A 3SKNB 1MCQA 1U8OB 4X7SH 5FYLL 1OTUD 3UC0L 3B9EA 4U1LB 3OBAA 3HZYB 1BREA 3FAWA 5ALCL 2DM2A 1RJZB 4EN3D 4MS8A 4NQVB 4OIBA 2ITCB 3T65B 3RL1A 3PHQA 5HHXL 3U2SB 2UWEB 5BJTA 2O5ZH 3HA0A 4FNLH 3ZKMD 3VI4F 3LEXB 5CFHA 1QD0A 4XXDA 2AABL 1EFQA 5T5FH 1BFTA 1JUFA 4NJ9H 1ZT4B 3MRLB 3PGDA 3JXAA 5GIRB 3VDBA 3MLWH 3KPQB 4X4MA 3MRDA 2EE3A 3M1BA 3ECBA 5E7BA 2ZUTA 1RVFL 3VFVB 5HHNB 3ARTA 5IM7A 3WD5H 2DQDH 4JKMA 3MFGB 3LPGA 4RIRB 4TUOA 5E5MA 4OF3A 3B9KD 4LP5A 5IK3B 3QXUA 3DGCR 4K9EH 2Z8RA 1K4DB 3LS4H 1IAKB 1ZLUH 4U31A 5ADPH 1MWAL 4MB3A 4LNRB 1P4BL 1F90H 1UH2A 3LN5B 1W8OA 3HS0A 4XNMA 3QUZD 5IFHH 3WFZA 1A4KA 1YEFL 3KYKL 3O3BB 1RPQA 4IJ3B 1W0WB 4IMLB 4U1NA 4XPFH 1JPFA 4PRIE 5DMGC 3CDFA 5SWZB 1MHPH 2FHBA 4LHUA 3EYOB 4XBGA 1K8DB 4HKBA 1MCPH 3QO1B 4GKOA 4WTZA 3QUYD 4EUPG 2P8LA 2HH0L 5FM8A 2EIBA 4OFKA 1UH4A 3SO3B 3HPJA 3GSNH 3BH8A 2YUVA 2P24A 4OFVA 4I0KA 3ILQC 4KTEL 1K8DA 3MJ7B 4JHAH 2V5YA 1DANT 1PLGL 1MQ8A 2G9HB 3MUY1 5I15H 4N0YL 4UAOC 1GPOH 3BH8B 3RWHB 4F7EA 3Q1SL 2IJ0C 2NY1D 4L8SB 5FEBA 3EJZD 1FYTD 3E3QE 5C0AA 2CSPA 4MLIA 1OCWL 3LN5A 4JCLA 1MFCH 4PJ9D 4C55A 3ULVL 3MRCA 3S4SA 4QHNB 5F89B 2D7TH 3OGCA 2AAVA 4V1DD 1GZQB 4PLNC 5DURB 4K94L 4N5UA 1OAUL 1TNNA 2JJVA 3R0MA 1DN0B 3GO1L 4DKDC 3OKOA 1F00I 3CPLA 2DAVA 3AVEA 4NN7B 5MEND 2QR0B 1I7TA 5DJ6B 1P84K 1CXIA 4N8PA 4O5LL 3WO4B 3H6JA 3W0WE 5C0RH 3U9UB 1XGYH 4U1MA 3MRIA 5I71B 2M1KA 4ZTOL 2YSSB 5AYQA 1AO7B 4IRSB 5IP4A 2R0LH 2YD3A 3FO9A 3MLTA 9CGTA 1FVEA 2FL5B 1URLA 4PJ7E 2NY3B 4KU1A 2VDOL 4M6AA 3QEHB 3DMMB 1QA9A 4X98A 3U0PB 5TH2B 1XGTA 4JRYD 5DD3L 3RZCB 1N3NB 1LO0L 1YEEL 3RVTD 1JYXA 2OL3B 3ULVD 4BSWA 3VMOA 4GG6F 1JCKA 1C16B 4UQ2B 4F33A 5F9DC 4RFNB 3PWJB 2GJ6D 4AZ8A 4G9DB 1XFPA 7CGTA 2J7LA 3GBNL 3SQOL 1MWAB 1MCRA 4KAQH 3EOBA 1QBBA 3A6CH 4ZUVA 3VGBA 2G5BB 2V2TB 1ZA3A 5F97E 1OAKL 3MBXL 1CLCA 2AQ3A 3JVGA 2AXJA 3GRWA 1FH5H 3H7LA 1U8MB 2X4OB 4LDEB 1CGXA 4NWTH 1F3JB 2KZ1B 1QLEL 1YPZB 4XBPA 4P0DA 1QPPA 1OY3B 4HW6A 3PIQA 1F4XL 1X6LA 3BQUB 2XQBH 2FX7H 3I6LD 3QNXA 4L3ED 5EUKB 2CIIA 4OTXH 4QLRA 4DGIH 1UKTA 3X11B 5JOEA 5C07A 3QHZL 5L2KD 2AJ3A 1DVFC 2VZUA 5IROA 4G8FB 4U6XA 5CP7A 4Z7WB 1LO5A 1AJ7H 1DBAL 5EN2B 3MGOA 3EO1A 1ULVA 1G1CA 1FAIH 2NY2B 4M1DH 2APBA 3MMEB 2CLVA 2JK5A 3KYAA 1UJ3C 3MYJA 1EBPA 5C6PB 3GMNB 3VFSB 4MJ6B 2HN7B 4KJWC 3KYOA 3ULVH 4P46D 3E6FB 5CSBA 43CAA 1OWRM 1SYSA 2COQA 5F7YC 1JMXA 2G2RA 4P4KD 3L3OB 4ZAKC 3CZJA 3C5ZA 43C9B 5L88L 3TT3L 2UWEE 4AEIL 3GSQB 2XTJE 5D9SA 2Q76A 1KT2A 4UDUB 1DUZB 4K7FB 3OHXA 3TPUE 3Q5OA 5INDB 1A1NB 3D3VA 4OZIA 1HKLH 4IMKA 1C08A 4L9LB 1YNLL 4YBLB 3AREA 5IHBA 2VDQH 1RJLB 2JJTA 4LLYB 4HIXH 2HAZA 4G9FD 5GRYA 2DIBA 2CXKA 4GQ9H 1SY6L 1KEGH 3N1PC 2NNAA 1XIWC 1M7IB 5ID1B 2H8PA 1NCAH 5I8CA 4QRRD 1OAZH 4LVNB 4JZOB 5J06A 3I9GL 1CLOH 4PRHD 5B8CA 3FO2A 1QACA 5FYKU 4HBCH 3KPLA 3CSGA 1NFDF 4AIZA 2DF3A 5HSFA 1U2HA 3IJHB 5CINL 3MFFA 3SDAA 4D9LL 1K3ZA 1CGVA 1FL3B 3THMH 1UKQA 4HX1A 5KW9H 3UTOA 1ZVSA 3IDIB 2R4SH 5E2UL 4OQTL 1JZ6A 4PGEB 2V2WB 3LKQB 3RIFK 4NFDA 3LKOB 4ELMA 4BZ1L 3IS0X 1OTUC 1M7DB 3L7FB 5KS9B 3K4AA 2QQKH 1AGEA 1RUAL 4HIIB 4WW2C 4ELMF 4LKXB 1S5HB 4YE4H 5ALBH 3O2DA 1P4BH 4YBQC 3SKJL 3AXLB 5IOPB 3KPNA 4PJEE 1P53A 4OSUH 3TBTB 2HT4C 3P4OA 4YFDB 2JELL 4ELME 2XZCH 4O58L 5GGTL 2DQCL 2NY2D 3VXSA 4GO6B 4XPHL 3MJ7A 2VWEC 2P5ED 3K80A 4NC1E 1A2YB 2VERN 4HXAH 4AEHH 1DQJA 4U0RC 5C2BL 3RVWD 3TH3T 4MX7B 1XZ0A 4Q6IA 5B38A 4ODXA 2R0ZH 3MOAH 3NTCL 1HEZB 3RY5A 2HJKB 2JJWA 4LMQI 4GMSL 3PE9A 3VWKA 3I02B 3QUZB 4M5ZL 5F70A 1MUJB 4PJ5B 5CEYA 2F58H 1UWGH 5F21B 3RUGA 5CIPB 3VRLE 3VRIB 5BO1L 1KIPB 4U3HA 1KSRA 1GPOL 1AHWA 3Q1SH 5INCA 3CFDA 4R96A 2HTLD 1P7QA 5IVXE 3IETA 2ADGA 1SMOA 1GHFL 4NZUH 3FB5A 5L88H 4JFEE 1EGJL 3MLXH 4PJGA 4APQB 3G6AB 1I3RB 1JRHL 5KTEH 1MLCB 4GAJL 4OGAC 3GK8L 2NY2C 1FLRL 2WBJD 1ONQB 4KK8D 2DIAA 4PS4H 2IGFL 3DGGA 2NY1B 4IEFB 1DP0A 1NMCC 4APQA 1HE7A 5CSZB 3C60D 4UNUA 3VE0B 4YZFE 2A2QT 3MCLH 5TQ0H 1OARL 3FB5B 4H26B 4EOWL 2K7PA 4H0GA 4BQ6A 4IIQB 4FZ8H 4NHUE 4P46B 5JNYB 1JWMA 4UUJA 3O6KL 4HWUA 5E6IB 4HK0B 4WO4C 2FH8A 3QA3A 4KGJA 5ADOL 3D69B 4NBYB 1CVRA 2F8VA 5ICXA 4DVBB 3MGAA 1LE5B 5IB5B 1EZVY 5AWNL 4X6FB 3BIBX 4Y4FB 5J6GB 3GI9H 3VGAC 1UT9A 2CDGA 2JB5H 1RJZA 4IJ3C 3GB7B 1YEEH 3NCJH 3RWIB 3I02A 2YPVL 3T3MF 2FX9H 5CEZE 4ZSOE 3W39A 1CFQA 3FN9A 1F02I 3GSNB 3HC4H 5B4MD 1CDJA 1TQCC 5K59F 1JTPA 5D1XB 1VPOL 4CAGA 3QFJA 1SVZA 1LO4H 3HPLA 2VLKB 4MAUL 4PJDE 3VCLB 5F7DB 1J10A 3G6JE 2R8SL 3MBXH 4JY4B 2NY6D 5D1ZB 4HZLB 4Y4KB 4FFWC 2BY2A 5FKAA 1A5FL 5T1KA 2E7LE 5LAXA 3ROLA 5CHNA 4A6YB 5JXEA 3VFRB 4NN6B 5FGCE 2XZCL 4TNVK 3T0BA 2DQCH 2EDEA 5C0DA 2PXYB 1YA5A 4HGWA 5KVFL 3ZKXB 4ZYKB 3T0ED 3VFWA 2VMFA 3HNTL 1IM3A 2ESVB 2P5EA 2X7LB 4KI5F 3S9DB 1HOCA 4I1NB 1DUYB 3TIEA 2CR3A 2FSEB 5KJRL 3I50H 2DM7A 5C1MB 5IR1A 5HVFB 4ZO6A 4PRPA 3PDOB 3TBYB 2X4PB 2Y06L 4N90D 3I84A 2VC2H 3STZA 4E42B 5DHVB 4PY8J 1YMHB 2APTA 2W9DL 2Y6SD 1ERNA 1OAQH 1WZMA 1CDIA 1J05A 5DS8B 3VG0L 1Z9SA 1P7QD 4R97C 1EAPA 1D5ZA 4NZUL 5CD3A 3CAFA 2XWBA 4QY8A 2KL6A 4HAGA 1CDCA 4WIQA 3GIZH 1OAKH 1SEQL 2CGRH 2GT9A 2XIDA 3KPPB 3JWOC 2VR5A 3QEUB 2WSKA 1YC7A 5DD5L 1AIFA 2EDLA 2IAMC 3EYVA 3C5ZC 4XZUB 4LHQB 3I6KB 4YBQD 3GSRB 1E28A 1EHXA 3FQXB 5EULV 2BVPB 1A6ZA 1CFVL 4QRUB 3E3QC 1PKQB 5L0QC 5TPWL 4U1GB 2FATL 3IAPA 43C9A 4TYUA 5MP6H 2OM5A 3C6LC 4B7IA 4RAHA 3MROA 2BVEA 2ZUQC 4KK5C 4N90E 1XGPB 2K9UA 1BQUA 1SVCP 3GJFB 1ITCA 3RJQB 3O4LE 1A14L 4Q9CA 2Q6WA 2JTDA 4G6KH 3EO0A 2AK4E 2A6DA 5DD0L 4K3HA 1OAYL 1NUFA 1ZXQA 4GSDH 5IQ9A 2FR4A 4HGWB 3C9NA 4HLZG 4MXQA 2F53E 3JBG7 2LTQC 1A4JA 4X0KA 4WHTB 1FLTX 4J3VA 3SE9H 3QCVL 5DA0B 3UROR 3TIDB 5F7EL 3RVTC 3ULVC 2PUQT 1KBGH 1WT5A 4HC1H 4PJAA 2BVOB 4WRLA 1A7NH 2VXVH 2V5RA 1HCVA 4JO1H 2OI9A 4XVJL 1MFCL 3MZTA 1KJ2L 4OZGE 1JHTB 4LFHG 3OKEB 2ATKA 1U91A 3WKMH 3L5HA 2R8SH 1UCBH 1RUKH 2OR9L 1JGLL 4WHCA 1A9EB 3U6RB 1UEMA 3QJHA 3GMPB 1ZSDA 2JJSC 1RIVH 1IL1A 5HVHC 4LCCC 1MJ7H 2RIKA 3F7QA 2VISA 2AQ1A 2DQFA 2Z93A 1T0PB 3FOMA 1AY1L 1VKXA 1GJIA 4R7DA 1XGYL 3QISA 4I3RL 1SY6H 5LKNA 4OLVH 5FUCC 1P5UA 4NQCA 2WV3A 5IQ9B 4UT9H 5AYUL 4PYGA 3S34H 1D6VL 4CMHC 5BW7A 1G7IA 5B8CC 5FECA 3V0VA 4E41B 2IBZY 4NKDB 5C92A 2X4TA 1CE1H 2EICA 2R0ZL 3U1SH 4OB5H 4PJ7B 3WFEH 3X13B 3MJ9L 1C5BH 1FORL 4YDVB 1ZLUK 3MYZA 3OKDA 3BRGC 4ODTH 3FT4A 3RZWA 1CZ8H 4HIEA 4UBDC 1EEYB 3RWEB 4NUGL 3DSFL 3WHE1 3H42L 3LV3B 5F7UA 5EORL 3ABZA 2AW2A 1K8IB 4GQPH 1A7PL 3QIBB 2FGZA 3RNQA 1XEDA 4F7TB 3GIZL 2ZOLA 4XTRD 5JIIA 1G9MH 2VR4A 2VB5A 3CU7A 5L8KB 4WI9A 3EGSB 1MVUB 3NFSL 1M4KA 3MLXL 1WCBA 2ADGB 2HWZL 2P48B 4LPVA 4GAYA 1HYRC 4JFEB 4NM4L 4X4ME 1YPZF 4D94A 1MOEA 2ITDB 2VTFA 4H8WC 4KK6D 5GGUB 1U3HC 1BFVL 4JRYE 1FFQA 4M6MH 1FCCA 2E6QA 1G7LB 3H7BA 2NX5B 1KXTB 2ARJA 3EBAA 1MAML 3T0EC 2Q3AA 3IAGC 2H26B 3HR5B 1ETZA 1LQSR 3UZVB 4P5TB 1YYMH 1IGCH 2C7UA 2DWDB 4MXWL 4WO4D 2EXYD 1ZEAH 4LMQE 1ORQB 1FBIL 3PP4L 3QUML 4ZUUA 4NUJB 5F7NC 1XZ0B 2XA3A 1T7YA 4HMDA 2IG2L 4UOW1 3BQUC 1BGXH 2IEPA 4HKJB 5AWNH 4FS0A 4ZOCA 5DMKA 3L5JA 4H1LB 2AEIT 3VXSB 4WJ5B 1IGIL 1PX4A 4FFYL 1FZMA 3NA9H 2PXYA 2BOBA 4PJEF 5JQ6L 2X4RB 5IBLC 2J2ZA 3QPXL 5DHVH 4P5TD 1XF4B 1KBGL 3UYRL 4WY7L 1AXTH 4YXLH 2Z8SA 5EOCH 4OFYA 1MRDH 12E8L 5F9AC 4M7JH 4OCNC 4HFWB 4X7EC 3NFPB 5DJ2B 1RUML 4ZFZA 2QEJA 2ZUVA 3PQYB 1FZJB 4UNTA 2SEBA 3S36X 3ZE1F 4LSPL 1KPVA 2FH6A 1S7TB 5KZCB 3OKYA 1BJ1J 4I2XB 2O5YH 3N1FC 4ZXBA 3T1FB 2BNRD 2OTWA 3ARQA 1NKRA 3HI5L 5JUEH 3HE6C 4UBDD 3ZE0E 4JHWH 3BSZH 3T2QA 1V7ML 2W9LA 1UZ8A 4ERSH 4X6DE 1S9YB 3VXTA 1NDGB 4U05A 5DJ0A 1ZS8B 2W0FA 4ZFOL 5KSVA 1UM5H 1HHGB 5HHXH 5DTFA 2FHFA 1XMWA 1NCAL 4UOW0 3SKOA 4P3CH 2DQTH 3DPBA 4PRPD 1ZK9A 1CLOL 1L7TH 1L6XA 2PETA 1AGBA 5ESAB 5IMLB 1K2DB 4L5FL 3KDMA 3U4EA 1FG2B 4JKPH 1WT5C 3MRQA 3ELAT 3RBGA 1S7XB 4LVHB 2FJHB 2IBBA 2OR8A 5ESQA 4QO1A 5EZOH 3B9DA 1MJ8H 4OD2A 4FQPA 2Y06H 1Y6NR 3GJEA 3A6BH 4MD4A 3VWKC 1CL7I 3RAJH 1I3VA 4Y2DC 1W72H 5INDA 5F6IB 1U8PA 1OAQL 4FFWD 1E27A 3CXDL 3DTXB 5C09E 3HNSH 1KCUL 3VXRD 2AJSH 2VDNL 5DXWA 1PYWB 3NFSH 4JB9H 4P5KB 5I1AA 3CD4A 1FL5A 2EZ0D 4JG0H 1TXKA 3TBWA 2JCCE 1R3IL 1G84A 4W68A 3KPRE 2FEDD 1TZGH 5EDXA 1FRGH 5INCB 4TPRL 2HTKC 5SWZE 3UZQA 5EZIH 2CO7B 1WAAF 1NGXB 4P2RA 5GGVY 5D93B 3U82B 3OXSB 1PY9A 2M8XA 2UV3A 1QRNE 2XKNA 4EQ2A 2ADJB 3BKYH 4OI9A 4KMTH 5C0FB 3B9VA 5JQHC 2MCG1 4OZ4A 1JV5B 1R5WB 1WLHA 5I1JH 2IG2H 4KTEH 4NQDE 1I1YB 3P30H 3S36L 2YWYA 4P9HC 4S11A 1FE8L 3KPSE 4QOKE 1HXYA 3PWUA 5CEXB 2R9HD 2OZ4A 1JHTA 1NLBH 4PRIB 5GGSA 2B1AH 2F53B 1PG7W 1AGFA 4QHUA 1P5VA 4XT1C 1B3JA 4KK8C 4M7JL 3LPFA 4N0FB 4PBVC 5C0BE 4N0UA 2ARWA 1Q94A 4GXUM 5C0CD 3DX7B 4CU7A 3QXDA 4HIIA 4J3WA 1T1XA 2CGRL 3CIQA 5L7XH 3MBED 1DL7H 1H3PL 1CICA 1FNGB 5JZ7D 1T6WA 2GEEA 2PKDA 4LLWB 5LCVH 3HB3C 4HF5H 4PLJC 1TIUA 2G60L 3BDYL 4JFDB 4EUPA 2A6DB 3WXVH 3BH9B 3BKCL 5D1QB 5D7JD 3EW3B 1T2XA 5TDOB 3UXFA 3W5MA 3FO1A 4YLQT 3VD7A 5TPWH 3NZHL 1B0RB 3QYCA 4Z7UA 3WIIH 4MNQA 4RGNB 1H15B 5FUOH 2BMKB 3UMTA 4Q2ZB 5DRZA 5DYOB 4OCSL 4BELD 3U48A 5TGBA 3H9HA 1M6OB 2JLLA 2X4NB 1PKQA 2JIXB 3D1MC 4JZOA 2EE2A 3HAEB 5DD6B 1VEOA 4C4KO 5FDWA 1R24B 4XP5H 3ARDA 3ZL4H 3O0RH 3O6LH 3VXRB 5IWLA 4UT7H 4HPYL 4HS6A 2VLLA 4XNZC 3ZE2E 5LBSH 4GBXC 4Z7VF 1M7XA 1OD9A 2YPVH 4N5EA 3B9KA 4UIMA 2NY6C 1TQCB 4GG8A 3HB3D 1FGVL 5T3ZL 3KLAB 1S78C 1GGYA 5D1QA 2E9BA 4XVSL 3BEVA 1BX2A 4X9HA 4XCNB 3BZ4B 5EIQA 2OP4H 2BHUA 1JWUB 4URTB 4XPBH 2AI0H 3V6ZB 1G9ML 1NEZA 3D25A 5AUMA 3FONA 4NKIH 2VABB 4P2OD 3O3AA 2HN7A 4QEGA 3DV6A 1F11B 1RAMA 5EZIL 3E8UH 4OIIH 4PJFA 1LNUA 3D39D 3WYRA 2VXTL 4YHYC 4Y2DB 3BPCB 4CN4A 5I19H 3PL6A 4NO5A 1MNUL 3DMMC 1WTGT 5ACMA 3AC0A 1A02N 2BJML 4YDLB 2ZUYA 4EJ1C 1VGEH 1I1YA 4IM8A 1Y6KR 4Z7WA 2F53D 5IB1B 2X09A 4ZNCD 1Q9KA 4NRXA 4PLKD 5T1KB 2ED8A 5KG9A 3CFCH 1D6EA 5KSAA 1CR9L 1JZ5A 4ZTPL 5GSRA 3PHSA 1T66C 5GGVH 5DC9B 3F8UB 4NJ9L 1NC2B 4ETQA 1ZGLB 3KPOA 4EI5C 1HNFA 3OL2A 4JZJB 4L4VB 5F1OB 5SX5H 4JFXB 2IFGA 1IGIH 4PD4J 1UQSA 1A3LL 4DQOH 1W0WA 4IMLA 4U1NB 5IV2B 4XMKL 2ADIA 3V95A 1U93B 5IG7B 4WV1B 5CSGA 5HJ3B 1JI2A 3QEQA 4AG4L 1UXSB 3WKNA 3QSKB 1LEIA 2YPKA 4XRCA 1KCSH 1S7VB 2W0PA 1KC5H 3K81A 2KQNA 5B39G 1X7QA 3QDJB 5L8JB 5TDPB 2O61A 3C6SB 3SDXA 1NAKL 2H32B 2V2TA 1QZ1A 1CICD 4WW2B 2HWZH 4KMQA 4L4JA 4MQXC 2BY0A 2EDRA 4H8WH 1IZJA 4JFFD 2HRPH 1MFDL 4LEXH 3CSYA 5H2BA 3UTZB 4Z76B 3ARZA 4ZO7A 4QRPE 1JPTL 1JZ4A 2ZCHH 4M61B 4JO2H 3VMPA 1S9WA 1RZFH 2V9TA 3FMGH 5D7IE 1HSBB 2AXFA 3IKCB 4KTYA 1NL0H 4P9MH 4YNYB 2GJJA 1IAOB 5CUSH 2XN9A 4XPTL 1V3JA 1PGRB 4WGVB 3WUWG 4ERSL 1X44A 4AL8H 2FX8L 5FF6A 1JP5A 1AGDB 2W9EH 5HYEA 3ZHLA 4OJFL 3FRUB 2V5SA 3WLBA 1UM5L 1ZAGA 3OAYK 3WO3B 3QR2A 2FBOJ 1KIRB 4LAQL 2Y5TB 5DGQA 5E08H 3ZKMC 2DQTL 2X1XR 1XCQA 5IBUG 2IPUG 2RB8A 1X5KA 5CJXC 5IB2B 4ZOAA 3VXUB 4LCIL 4YXHL 3V6OC 3QDJA 4V2CB 2IQ9H 4KHTH 4M61A 4ODSL 1CICC 2Q86A 3QFDA 4M7KH 1R3JA 1LD9B 3FQUA 4HC1L 5IB4B 3SN6N 2Q7YA 1YECH 2FB4H 3DO7B 5TFSH 2AI0L 4IHOA 1EX0A 1KIPA 1C7SA 1KCUH 3VGFA 2VQUA 2XNAA 4I18C 3JWOH 4G43B 2ATPB 4ONHA 2ZWLT 4BQ8A 3QEQB 4QYOA 3OAYH 4E5XA 4JDVA 1T89A 4KDTA 3BESR 4IRSD 2YR3A 3HZMA 1DQJB 4UV4L 2AS5M 1ZLSL 2Z91B 3JTSA 1MRFH 1V3MA 2NLJB 5E1AA 1B6UA 4YHIA 1DBML 3QZWG 2J6EA 4GRLD 4OT1L 4YDJB 2VDOH 2OMNA 2PCPA 2OMBA 4OCRL 1ZHLB 3DI2B 3I6LE 2KUTA 5I74C 1OQOA 1QFWL 5DEZA 3VRJA 1RQ5A 1GGBL 1UM4H 1QRKA 1EPFA 2YUZA 4MHHG 1VFUA 4HJGA 4QOKB 3ULUH 5F44A 3EDJA 3EUUA 4K2UH 5JHDA 1Z9OA 5D70L 5C08A 2WY3A 3GNML 3RDTB 4M9OA 1EGJH 3GBLA 1MVUA 1JWUA 3RIAF 5DJ8B 4ZSOA 5CAYB 4TOYL 1WFNA 5GGQL 3VWKD 3GK8H 1J8HA 4QRQB 5MENE 1T0MB 5LCVL 1CG9B 3GJFK 3FT2A 4NWTL 4PRAB 3HLAB 3ES6B 3DVGA 3ULVE 4DTGH 1ZA6A 3O41B 1XF3B 1KLGA 1J0KA 1IQDB 3ARGB 3S37L 1N0LA 4RFOL 4JGMA 3QQ4A 2EIDA 4FFZL 4N9OB 1KPUB 1KYOJ 4MCYB 2XZAL 5CZXD 3O41A 3PHOA 1VADA 4PJ7A 3X13A 4U6HA 4ZDHA 4PP2B 3CVHB 2IC2A 2VZVA 2ED9A 4AJ0A 1QKZH 4F7CB 3WDJA 4DZ8B 4GG6A 1TETL 5DVNA 5I8EA 1AH1A 4EUPB 4UZGA 3V0WL 2EDJA 3FB8B 4JFDD 4BFIB 1TJHH 2BY1A 1MY5A 1A9BB 5IVZA 4Q9BA 1DTUA 3KVQA 4GXUN 2F54A 2Z92A 3ZDXE 4WTZG 2A74A 1YEGL 3OB0K 2PO6B 2EDHA 5EO9A 3LQAC 3ALWA 1IGTA 5A16A 4Z78B 2XOTA 3HC0A 5GGRA 1A6AA 1IC4H 4Z7NE 3GMMB 5C0JB 2YPLA 1VSCA 2RGSA 1U91B 2R29H 4IOFC 2IAMB 1EHLH 3MGOB 4XH2A 1CF8H 4D9RE 1NCDH 1O5DT 1DFBH 1JGEA 3ZSTA 4Y5XA 1KTKE 5H8DA 2EDYA 1WFTA 4PJXB 4AT6A 3N50A 5D7LA 1WC7A 1WBZB 1ZLSH 4YH6A 2Z31B 2VXTH 5ACZB 5F1KC 1KPRB 3FQWB 1N4XL 2BNQD 2DLIA 3O8XA 1CFSA 4P2RB 3OKLA 4IRJA 1ZV5A 4O02L 5I8KL 1L4IA 2J5LC 3K4DA 5FUCE 2LU4A 1MI5E 4YK4B 5E6ID 5TE4L 4D9QE 5I1AB 1ES0A 3PXHA 4LASH 5LBSL 2BSSB 4MJ2A 1JI1A 3HE6D 1JPSL 2CKBB 4TQEH 4DQOL 4CNIA 1DQTA 4V3EB 1E27B 1MCBA 2BVPA 3RAJL 1I4FB 5TDNA 2ESVE 3UP1A 3GSWA 2H32H 1DR9A 4XVSH 1R5VA 4BZ1H 5LGJA 4FQHA 3LQMA 3PWJA 4YHNA 2A77H 4AMKL 4GKNA 4HHAA 4FQXD 4QHLA 5I1LA 3T4AA 1NCUA 2IMNA 4X5WA 3V4UH 2VDNH 4BUGA 2W91A 3HZVA 4ONFH 4LHJB 1YEKH 3HE7D 4LRNL 3CX2A 3OXRA 1CFVH 4LHUG 3NZ8B 1T5WB 4NHCL 4OLXL 1YN6B 1BZ7A 4JHBA 5HGBA 3D2UD 4RDQG 2DMKA 5ISZB 5I18H 4XP4H 3MRQB 1I9IH 4BFGA 4HIHA 1ZS8A 4L3EB 2XZAH 2ZOKA 1HHIB 3ARBA 3B3IB 4HJJL 1XGUB 4H25B 4MSWB 1INDL 5C0CB 3IFLL 4OCLC 4N68A 1A14H 4Y19A 4XXCC 4U6VH 3FAXA 4KV5F 1BQHB 2X7LA 4RNRA 4APQD 2ESVA 2P5EB 4FXKB 4Z7QF 2X4SA 1J1XH 1N59B 1NCNA 3MV9E 3TV3H 1FE8H 1OP5H 3WL9B 4QHNA 2AXGA 3AMKA 1R3LA 2APXA 2GCYA 4P23D 1ZHKB 4M7LL 4MWFA 1P4IL 3QXWA 1T3FA 1H5BC 2X10A 4HZLA 4Y4KA 2XKSA 1UYWH 5EU6A 1KJ2H 4EBQH 4RA0C 2DKSA 4JFXA 5CJQH 3O4LB 4Z7UF 4XCCL 2OR9H 3OF6D 2P8MA 1PX3A 5EC2B 2HRPL 1OP3H 1I9EA 4CU6A 2P24B 4GKSA 1U3HB 2EC9T 2Z8WC 2LAGB 1QBLH 3G6JB 4GAFB 1ZT1A 5IJVB 4JFDE 3FB7B 1L0YA 1RZIA 3SEPA 2VDQL 2HLFC 3DX8B 1U8JB 1G6RA 1S9VA 2V6HA 5K9JL 5C71A 3HG1B 1TJIH 4G6FD 1Q9WB 1DDHB 1U3JA 2GHWB 4HLZH 4NWUH 4YC2C 4UT9L 5DC4B 2P43B 1GVIA 4RNRB 4X9FA 1JPFB 1LNUB 2A6IA 3SCMB 2WIMA 4DK3A 1OLLA 1J1PH 5I2IB 1KTRL 4JFOB 4GXVH 2YHGA 3MV8D 1FORH 2J5LB 2OZ4H 3KYNB 3GGWA 3BZEA 1NEZB 1FO0B 5JNYA 5E2VH 3MREA 3TP4A 4B53A 3O0RL 1F58L 1XIWA 5D96B 2OI9C 1GGBH 2CJUL 2NZ9C 3HRZB 4M7KL 1KB5B 3MLPA 3QIBA 3T0VA 3NCCB 3WNNA 1LDPL 2IPKB 3TN0B 2XV6B 1RUPH 1LGVA 3GNMH 5ITFB 4FMKA 4YO0B 2ZOLB 3PV7A 4CJ0A 3RVWC 4ODWB 1Q38A 3O81A 3OKDB 3IRPX 1U8LA 5JXEC 4MJIE 3P4NB 1G7HA 3VXUE 3TWCH 4PJCE 4Y7MA 4G7YL 1HH9B 3MJGX 4QKXB 4WTXA 5JW4M 2ICCA 4NHCH 4OLXH 4YR6B 2MCPL 3WN5C 5IBUB 1WBXA 4RFEB 3OJDA 4KKAD 3R8QA 4Q2ZA 3FFDA 3QPQC 5MENA 4PG9B 4OT1H 2MHAA 1TTUA 3PV6B 2IF7A 4U1LA 2A73B 1QSZA 2Z93B 3BT2H 3FOMB 4J23A 4Z7UB 4AEHL 1FSKB 4M6OL 3BUYA 1P6FA 3MRBB 3B2VH 4LLQA 3I50L 5LXGH 1IC7L 4JFDA 1FYHB 1OW0A 4ZTPH 1S5IL 3LEYL 4W6XB 4G42B 3O4LD 1EXUA 5DUPL 1NGZA 2BHYA 2MOVA 5D8JL 3V5KA 2NY7H 3OKEA 3QRFM 1IM9B 2QSCL 2XRAH 3UAJC 5B38G 2WP3O 3Q6FB 3GHBL 3U6RA 2R1YA 1CK0L 4RGMB 3LDBB 1NC2D 3V6OA 5FYLE 4WUUB 3BWAA 4JAMA 4NQEE 3WFHB 1A4JB 1NAKH 3CMOH 1AXIB 3LKSB 1A7BA 2ZJSL 1MRCL 1JNNH 5FM4A 3IU3A 3BPNC 1WIUA 3T0EA 1QSFB 5HHMB 5CZVL 4DTGL 2OYPA 4EXKA 1Q72L 2A73A 1I8MA 2F5AH 4K3GA 1JPTH 5SWSB 4Y19E 5DFVD 5EU5A 1JYVA 2NMSA 3D9AH 4HBQA 4POZC 1OGAB 3DUSA 1V05A 4QRRA 3G9VA 4PGCB 1HSAA 2F19H 3EO0B 5C0BB 4LVOB 2D7MA 4R3SA 5E4EC 4F7PA 1YDPA 1CXLA 5D7IF 1VADB 4QF1B 1HWHB 1F97A 5CWSA 2DKMA 4MZ2A 2HMID 4U1JB 4KUCD 3LD8C 4HV8A 3U36B 3V0WH 3QWOA 3M8OH 4NKOB 5F96H 3MRRA 3QEUA 2R2HB 4FZEH 3LKNB 4G8IB 4ZQKA 2W0KA 5F7EH 4JANA 5FM5M 35C8L 4YXHH 1ZTXL 2WWMD 2ORBH 4KHTL 4D0BA 4NCC1 1BFOA 3OX8B 1J8HB 3SGDH 3TJEL 3UTQA 4JANB 4HKZA 1U8IA 1A1MB 1LO4L 2IH1A 4XVUC 2H6PA 4PRPB 3JV0A 1K2DA 3BWUC 1FFNA 4DN4H 1R3IH 2E8ZA 4PJCB 3H3BC 4GKZB 25C8L 4V2BA 4U1JA 5FYLH 3VFSA 3HTLX 1D5XB 1HQ4A 1ZGLM 5GPRA 1QEWA 4NQUA 1YDPB 2I27N 2R0KL 3C2AL 4XAWL 3K46A 3X14A 1T2JA 2X4PA 4XCEA 1REIA 3UDWA 5F8QC 1TCRA 2IFFH 4IRJC 4UV4H 3G6JF 2AXHA 1D6VH 5IF0A 1QBML 4CADA 2WM0A 3RDTD 4U6XB 3EOYG 3T3PE 3LKRB 3FCTA 3IJSA 4M9PA 4BK4A 3V5HB 5F1NB 4YIQA 4XCFH 1OP3K 4D0DA 2GK0A 3CVHL 3PJSA 3UTTE 3DETD 4UINH 3RL2B 3NOIA 4XXCA 3JTSB 2NY7L 1ZOXA 1X5ZA 3E0GA 4LSQL 4OV6F 1UWXH 3BQUA 5FCUL 2XRAL 1NAML 4MDIA 1UM4L 4NJAL 2B1HL 3WFCH 1RSFA 4Y16D 1T3FB 3WD5L 1KJMA 3BPLC 4M7LH 3D3VD 5JO5B 3JVGC 5GS0L 5IESL 1JPST 5C9JA 1MCDA 3IDMB 3DVNB 1QFWM 4KPHH 4OLWL 5HI4D 2KKQA 3WN5A 3WXVL 2E3VA 3JTTA 1ZT7B 2L7UA 1FP5A 4X6BA 2HKFH 1I7UB 1RZKL 3FFCA 5IW6A 3KPSB 5GRZA 5AZ2L 4WFED 2EDWA 1TVDA 4JN1L 2UUDH 5J9PA 4FQXB 4PJFE 1GC1C 1QTYT 3UPRA 3UEZA 1T7WA 2FATH 1KTLA 2P1YA 4RFOH 3FFDB 4JFZL 4TUJA 1L9MA 4J4PA 3O4OB 1ZEAL 4X6FA 1INDH 2F8OA 4YX2H 1SBSL 1OLZA 3HG1E 5E2TH 5KSBE 5IGXL 4LKCB 4BK5A 3QNZA 2ZUWA 3CDYA 5GRJH 1CD9B 4UIKH 4WDIB 3R06A 1JWMB 4UUJB 4UT7L 5DJDA 1OAYH 1NSNL 4IRSA 3KPRB 1LILA 2VLRD 3MUZ1 1ZTXH 5DEFA 4LFHD 4WDIA 4WGWB 2IPKA 2X9XA 4L3EE 4BQCA 3QNZB 1C7TA 1MLCA 2VZ1A 2BSTB 2Y9RT 4ONGH 2AV7B 4Z7OF 3CPLB 1IQWH 2VKXA 2QQNH 4O4YH 4GW5B 3QDME 4K8RC 3EOAA 3BKJH 4TTDD 1U8NB 2DQIL 4OZFG 4EN3C 1EFXA 3QI9C 2JJTC 3O3EB 4XHJD 1WWBX 4U0RB 1QQDB 3MBEB 1UXSA 3SJVE 5C0AB 5J6HA 4U3XA 3QBTB 2YRLA 3JV6A 2LV4A 4KXZI 2NW3A 5DURD 2G5RA 3SDXE 3QCTL 2FGWL 3MNVB 5BZDB 4CL7A 5I6XB 5I17B 2L4OA 5CIPA 1Z9LA 1FVCB 2DI9A 2IADA 5HDQL 4HCRA 2DTML 4HLJA 1I8MB 2IH3A 2HJKA 2VLJB 4P3CL 3OG6B 5DR5H 4IOFD 1YUHB 2CDFB 3VXMD 2NR6D 4L5FH 3LKSA 4ONOA 5IW1B 1X4ZA 5BRZE 3ARBC 4LCUB 4I0PA 4GAGL 5KVGL 1J0ZA 3G08B 1LO2H 2WQ8A 2YPLB 5SWZA 1CTNA 4Y2DA 2CJUH 1M71B 5JPNA 3MPCA 4OZFH 1YY8B 3TO2B 4NO0B 2NQCA 4WI5A 1JZ7A 2VN4A 3O3AB 5TE6H 3KPSD 4PJ8B 5ISZD 3RY6A 5T33L 3ZTNH 5GS0H 5IESH 1OAXL 1IRAY 3P4MA 4QTIH 4I77H 4JRXE 3GHBH 3QUXC 1R3LB 3A0OA 4I3GA 4WFFD 4KPHL 2VDLL 5F3BB 3L5IA 3QQ9D 1AI1H 4RWYL 5CBAA 1GH7A 2VH5H 3IDJA 3HMWL 4QXUL 3ZKSD 4G7VL 2EEBA 3TWCL 2C1PB 1Z6JT 5IHZB 2VDKL 4PGZA 1HQ4B 3TCLB 4POUB 2AV1A 4OBRA 4XNXL 3PDDA 2DLFL 3WIHL 2EH7H 5LQBL 1P7KA 2QQLH 4O2FB 3RP1A 1V5JA 2NNAB 3EO9L 4JEGB 2X4QB 5CP3A 3QQ4B 5D2LF 5GIRA 3TBSA 4DGIL 1FHGA 3CH1A 3PWLA 4GS7C 4LBEB 2XQYK 4HUVA 1VA9A 3PP4H 3GSRA 2CUIA 5JW4Q 3U2SA 1BIIB 1W2KT 1NCCL 5C09A 1Y6MR 2XPGB 2HA1A 4F15C 3CCHA 1ZLWH 1KV3A 2P45B 1UH3A 1U6AH 4LVEA 1UA6L 3T4AB 1KB5L 1WITA 3CX5K 3WJJC 3QG6B 4G6MH 5JQ6H 1T20B 1NANI 5D93C 3T0XA 3QQ9C 5LGJB 3QXVA 1XR9A 2I07B 1P4IH 2A83A 3AM8A 3DUUA 5AAWA 4KJQD 1YMHA 4HWEH 6CGTA 3Q48A 4OZFB 3X12A 4N0CA 1FO0A 3WS6C 4AEIH 3CMGA 2X1WL 3V6FB 3VFNB 1MRCH 4LPYA 2EIEA 4U2YA 1WFOA 1MREL 3PNWB 5I2IA 4JM2B 3FRPA 3DVIA 4AM0B 2VL4A 2OCFD 3QI9B 4QGTA 4XVTH 5HYJD 1H5BB 5FGCB 1LEGB 3SCMA 3MTRA 4Y5YB 3UBXI 1RZ7L 1QSFA 5MHSD 1YNKL 3D9AL 2V9QA 3HI5H 5JUEL 1DDHA 2IBGA 2EEDA 3HMXA 1KEGL 3NPZB 4OAWA 4XP6L 4DCQB 1R5IB 4YPGA 4P48A 5KN5B 4JHZA 5DRNA 3EYFA 2D7QA 4GKSB 1MF2L 4OGYL 3HE7A 1QOKA 3AAZB 4U1SB 3U7AA 3NIGE 3DSNA 4ONHB 4XWGH 2GFBB 4PJ9A 4MZ3A 1A0QH 1Y18B 5C8JA 2PTTB 3C5SA 4Z7VB 5FM5O 4HJ0C 5FUZL 5HHPA 3KXFB 1P2CB 2C26A 5L6YL 3FQRB 5I30L 3TA3A 1RZ8A 5ICYB 1K6QH 2Y6SC 1OPGH 1GAFL 3CXDH 1N8ZB 2DI7A 5GZND 4QT5B 1UWEL 2MHAB 3MNWA 5CILL 1A9BA 1MJUH 1RK0A 2VH5L 4KI5C 2XZQL 1HZHH 1F45A 1G7MB 2DBLH 4ZOEA 5E03A 4LU5L 1BZ9B 4O2CA 3DMMA 4WCYL 5I75C 5DJZA 2HFFA 5HDLA 4GRLC 4MCYA 3MLUL 3FO9B 4XPHH 4JKLA 1BLNA 1IGFL 5LGHL 1FG2A 1QBMH 3SE3C 2YSSA 5CSZA 1QFUL 2RQ8A 4M1GL 2C4XA 1G6RH 4UT6L 2X1QA 4F3FA 4J8RA 4Q9QL 3REWA 1KLGB 4X7DC 3IAQA 2YEZA 4M5ZH 3BE1H 4PRAA 5FA3B 5HDBF 2QR0A 3TT1L 3S5LG 1H3GA 5CBAB 1ZANH 3K3QA 3QEQE 4Q6IC 2E27H 1I9RH 4H5SB 1EGJA 1S7VA 15C8H 4MA7L 1XGQA 2AJVH 2J4WH 5IG7A 5HHPB 5H37G 1S7TA 3LB6D 4I9WD 4ZFGH 3KPMB 4K8RD 3NACL 2AEPL 1I8KA 1IQWL 1FZJA 3H9SD 3S5LB 1DL7L 3GSVB 3L6FB 4MS8D 3BW9B 5JDSB 3CDCA 1FLRH 2YOCA 3V52H 1CGSH 5T3ZE 2OJEA 4F8TA 4DUXA 4I18A 4LSTL 2PCPB 4DCQA 3IKKA 2DJUA 3ARYA 1WWCA 2VQ1A 1FIEA 4ZAKA 3CFJB 3VJ6B 1RU9H 1H3WM 4CRPA 3DX6A 5KANI 3QG7L 2ZZUT 3W9EB 1MI5D 2DTMH 3F5WB 4OGYH 4YDIH 4K7PH 4Y5VB 3PWPB 5I1EL 5D5MF 4AM0A 2C1OB 5T3XD 4IRSC 1DE4B 5C3TA 4RQQA 5C6TL 3H9SA 2FIRT 4Q74A 3L6FA 3QQNA 1CLYL 5IMOA 3V4VH 4WO4A 5DRXB 1JPSH 1G7QA 3KJ4C 3EOAB 5ABDE 2YMXL 1GZPB 4FXKA 3RWCB 2XTJC 3KS0H 5BOPA 5MHSE 1ZVHA 3L3DA 5IK3A 2DS4A 4YHZH 1NLDH 4JZJC 3TA3D 4LEOA 1LMKA 4AMKH 5E0QA 3GUTA 2MWCA 4MSWA 1KJVA 5BCAA 5E8PB 3LQZB 4PB0L 1KN2H 1U8QA 4OQ1A 3KS0J 1EO5A 4HAFA 4ONFL 3GM8A 3TO4D 4S2SB 4HK3J 1AD9B 1ZT4A 3MRLA 3OR6A 1JUFB 4C57C 1BIIA 5E8OA 1UENA 5GS1B 3B9KC 2BSED 1T5WA 4WFGD 5DSCB 3PWNA 1EJOL 3L3HA 5HPOA 3PHOB 4G8GA 3FTGB 3OXRB 4S1SH 4JM2F 4EQ3A 2XWJA 3O11B 1LP9E 2X4QA 5DI8B 5EOTB 3LS5L 4Y16B 4OD1L 2IFFL 4FTVD 3RZCD 3OG4B 5A2JH 1IBGL 4ODVL 3UPRB 4YNYA 2VE6B 3O2VH 1QFPA 1DLFL 5BJTB 4FQLL 3GSWB 2P5EE 2NY3D 4JO4H 3MOAL 1QRND 1BVKA 1FFOB 1N0XH 1U58A 2F58L 2QSTA 4ODUA 5AD0B 2K7QA 3DX7A 1CE6A 4FOMA 1NUGA 2AJVL 4F37K 2J12B 5JZ7C 1RZ8B 2YPKB 4YBHA 4HJGB 4QOKA 4QHUB 3VMNA 1QNZH 3JTCA 4LSVL 2EIZA 2QADD 1U95B 3O4OC 3IXTA 4LSSH 3SDDD 5F71A 1KN4H 2YZ1A 4MVBD 5JXED 4KK9C 1E4XL 2ZKHL 1V3LA 1MI5B 5BV7H 3BVNB 4X4YB 4Y5YA 3BVNA 3LY6A 5FYJH 3EYQC 3LKRA 5LQBH 1GC1H 4LQ1A 1G0DA 2ZCHL 4WHTA 3QI9A 3KWWA 4XNYL 1DEDA 4M48H 3EO9H 4OAWB 4CVXA 2IAMA 3S3PA 5FHAH 5BZWB 4HEPG 5BRZD 1NGXA 2YD9A 2CDEA 3GKWL 2BNUA 3HNVL 3GMMA 4DOHE 5I76A 1KCVL 1FNFA 2ATPA 5GRUH 2NY0C 2I07A 3KPTA 1EJ6A 5DDHA 1U8NA 3TCXA 3HN3A 2EH8L 5HGHA 1UA6H 2AK4A 3N1MC 3OQ3B 4R2GC 3WFDH 3DBXB 2JB5L 2PYEB 5A2LH 5KSBF 1BECA 1YEGH 1E4XI 2FX9L 1HH6A 1KCRL 5C09B 1FG9C 4KK9D 4ZS7H 4PLJD 4RGMC 2FHCA 5D1XD 3CVHA 4U33A 4GMTL 3RNKB 4MHHI 1B4JL 3C60A 1DVFD 2JCCA 5GSVA 5J1TC 1KPUA 4DW2L 4JFPA 4O4YL 3V5DA 3CNKA 2NY5H 4PJIB 1F3DH 2VXUL 3WFBL 1DSFH 1JHKH 4M00A 1J9CT 2BERA 3P9MB 3HZKB 4L3CA 4F58H 3QHFL 3JWOL 1E6OL 3FQTB 3RUGE 3HHRB 4XCYB 3D87B 3RWDB 2VQTA 3E2HC 2I25N 3INUH 3O45A 5FO8B 2FRGP 1KB9J 2VXSL 1ACYH 3G5ZA 4LCCA 1KXQE 2HT2D 3NA4A 4OB5L 3WFEL 3P9LB 4JFED 3TFKC 2XFXB 4LLVA 2HVJA 3QAZC 2RHEA 4ZD3L 3IU3B 5IBTL 2APVA 5JPNB 1G7QB 2C3XA 2B0SH 3OB8A 1QLRA 4K7PX 1G7JB 4YXKL 4ZFZB 5F89A 1BJ1H 4LDLB 3MRCB 2D4DA 3VFRA 1NAMA 5MERA 2AGJL 2VC2L 2ZCLL 4LL9A 1FL6B 1RFDL 2DQDL 1IC5H 4PTUA 2ZNWA 4WV1A 2EDQA 1YUHA 1XF4A 1T7ZA 4G6AD 5EA0L 1B2WL 2VLJA 1HI6B 1SQ2N 1WZ1L 4ZPVA 1MJUL 4G3YL 3W9DA 5L8LB 4M4PA 2GSIA 5IW1A 5IHUH 1D6EB 5KG9B 2HJFA 4OKDA 3WCYA 5BV7L 5DD5H 3HMWH 1ADQH 1ZHBA 4LLQB 3NAAL 2X40A 4RAUA 1EO7A 1DQML 3D2UB 5FV1L 4UTBH 1YEHL 4HKBB 3QDMA 4QCIA 2N56A 1NBQA 1RIUH 2O5XH 4KI5D 2QQLL 4KJPD 3WSQH 1I9JH 4M6NL 3A67L 1GGCL 3FT3B 2WLYA 4NQSA 4KJYB 3JV6B 4GW4A 1OGTA 4BYHA 3OZ9L 5E8EA 2YD8A 4JHAL 4ZUSA 5ID0B 3D0LB 1D7FA 5E95B 1A6WL 1A1MA 4NM8L 3TYFB 5T1MB 3G6DH 3SDYL 4JREB 2DLHA 3T2NL 2D31B 5L2KE 1CFTB 3ILPA 1E4KC 5DMIL 1ITBB 5FV2A 3D3VE 4KROD 4OIAA 4FQJH 4BJLA 1OQXA 3ZTJG 2FZ3B 4YQXL 4PTTA 4ZG1A 1RUMH 4G8IA 3MODL 3ILPB 1CFTA 2QHRH 1DBBH 1QVOB 5CBEB 5KSBB 2FJHA 1R24A 3EYUL 4HV8B 1J0IA 4YDLC 5HDBE 1DANU 4ZFOB 2XN9B 1KYOK 2HFFB 5D1XC 1CF8L 3FFCE 2DQGL 1QFHA 3VXQB 1WJ3A 3NPSC 2R1XB 2CK0H 4F7MB 1HDMA 4K23L 3FL7A 4QTHA 3S88H 4LLUB 2VIRA 5KSAD 2R1WA 1BP3B 2A6IB 4X6CA 3DUSB 4FTVE 4NQVA 4QRRB 2Z8VC 1MCWM 3AY4C 3MNWB 3VG9B 2WQRA 3QG7H 3HG1A 3HC3H 5JW3L 4MNQB 1ZWIB 3CU1A 5IJKC 2ICEB 3TNNA 5DQJB 5EZJA 2FNBA 4MX7A 2O5ZL 4N1CA 1UACL 1MFNA 3SGEI 5A2FA 5HBBA 3MOBH 4A2LA 4MDIB 4NBZB 1YQVL 1A0QL 1L6ZA 2X89D 2P8MB 5T5FL 1ZVYA 2ATKB 5B3JE 1TJGL 1MJ8L 1PY4A 2YMXH 3GMRB 1JTOA 4K3EL 2B1HH 5E9DD 2ZCLH 2P44B 1T66D 2BVOA 1F8TH 4JY5L 3WEXA 1NLDL 3P73A 3GZKA 4GRLB 1LDPH 3QFJE 4FQIH 5EORH 5HHOE 4HUWB 4MVBA 4XC1H 1Q9KB 3GIVB 4Y1AA 5KN5A 1KULA 1K3IA 5EBLB 2AXGB 1RZGB 3Q6GL 5F9JA 4ZUWB 4DOHB 4D3CH 1U92A 2WINA 4JG0L 2X4SB 2GK0B 2XZQH 3UTTB 1BVZA 2R56L 3P9LA 1TZGL 3KJ4B 1DQMH 3HUJE 3X17A 5F3HB 1KEML 3P40A 4B0MM 3MFFB 3P0VH 4JLRA 2C7UB 2DWDA 2OXHA 4WI2A 1H8SA 1FYTE 3MCKB 4RFEA 3RPIB 5SWSE 3PABA 4I3SL 3HUJF 2NX5A 1S78D 4KK5D 4CJ1A 4U49A 3QHZH 1OW0C 3SDCD 3HNVH 1CFBA 5I1JL 3IF1A 2YZ8A 3BXNA 2HH0H 3CDGB 4XMPL 4UNVA 4D0BB 1CDHA 4L29B 1DBAH 3KHQA 1WEJH 3LZFL 1SM3L 3WIFB 5JORA 5DEGB 2E9WA 2VLLB 5DEGA 2C3VA 2XA8H 4NRYA 1LP9B 1NUDA 2E9IA 2EKJA 2H9GB 4BH7B 2ZUXA 4DEPC 4OFIA 4WY7H 3HAEA 3IF1B 2J8UA 1L9NA 1YNTA 4LPCA 4OD2B 4YWGH 1VEPA 4XX1G 3EYQD 3ZYIA 1IEAB 2DI8A 3CH1B 3F6IA 1M6OA 1UYWL 2CKBA 3U0TB 3LKNA 4EBQL 3PDOA 1N5AB 1UJ3A 3ZT7A 2G2RB 2PXYC 4PGBA 1MHEA 4JLRB 4K94H 4ENEC 4R4FH 2X1OA 4P2QB 2YD6A 4IOIA 5JHDD 2J3SA 3MSPA 3ALXA 4NZDA 4Y4KC 4M03A 5TDOA 3IVKB 4H20L 4P3WA 5I1CH 1SBBA 3DO3A 3GI8L 3VH8B 1H3XA 3GKWH 1RZIB 1IAIH 4NWUL 1LO5B 2YN5A 5BVJB 3QNYB 3BN9D 1IEBB 1Q0XL 5CHNB 4A6YA 5KS9F 2ENSA 4PJDA 1C5CH 4J7RA 4YHLH 2DOCA 3NABL 3O2DL 4OFYD 5FB8B 4K7PL 2CPCA 1Q0YL 3Q0HA 4GRWB 5DMYA 4YDKH 3IDGA 1MJJB 1YMMD 4CMHB 1BD2A 3L5XL 3BN9C 4KH2A 2KBGA 5CINH 3EHBC 2VO5A 1NGZB 4PJ5E 3QFJB 2PO6C 1S7UA 2C3HA 1F3JA 3IDGB 5C0GA 3VI4E 3MACH 5EWIL 3HC0B 2EYSB 3N1GC 3MO1A 2JKXA 1U8MA 2X4OA 4HC1A 1RJYB 1R5WA 3BUYB 3IGAB 4X6CE 2A74B 4KFZC 4BKLA 4LCWD 1X5YA 4DGYH 2O26U 1IGML 4EDWL 4NQED 2Y5EA 5BVJA 3F7PC 2IADB 1P6AB 4G42A 3QIWB 4P2OB 5B39B 3SOBH 4PJXF 3BHBA 1LE5A 4DVRL 3QIBC 2V5MA 2ICEA 5C7XL 5KAQF 4DZBB 4F9LC 1HDMB 1NGQH 4Z0BL 4R90H 3B3IA 1JZ8A 3KG5A 5CIPH 4XC3L 3WJLC 5IEKB 1IC1A 1XGPA 3ESUF 4KKNA 5ISZA 5IIEA 1AFVL 4G9FE 1XCTA 4YFLF 5CBEA 4LQFL 2XWJB 1BJ8A 2ZCKH 1KG0B 4JVWA 2UUDK 3VGGA 2E7BA 3O2VL 3L3HB 4XMPH 3TO4C 1XH3B 1JYNA 1VEMA 1U8PB 3ULUC 3PL6C 1T03L 4I8DA 3DI3B 4IS6A 4XZUA 1RZKC 1JBJA 4DKAA 1N6QL 1OD7A 3MGTA 4RAVA 1KLUB 3VFPA 2D31A 2AEWA 1U8QB 1A3LH 3LQZA 4MVBC 4YHNB 1S7XA 1MAJA 4OCWL 2C9AA 5ID0A 1L8JA 1I4FA 2H2SC 3AMLA 2GUOA 4BQBA 5ESAA 3F12B 5C08B 1HHJA 3WXWH 1AHWB 1EEYA 3RWEA 5C70A 4DEPB 5HY9A 3FT3A 3EKCA 1XIWB 5FYKH 5DHVA 5T1MA 1FCGA 2A6KB 4TRPL 1GZQA 3FRPG 1G0XA 2G75B 2QHLA 3BZEB 1MFDH 2X42A 4LOUC 5D1QD 5D7JB 1MWAH 1HEZA 5GZOC 5EBWA 1FDLL 4KJYA 4L8SA 5DJYA 4UB0H 3FMGL 5IW6B 1WICA 1YEFH 3KYKH 4HWBA 3SJVB 4KVNH 1Q9LA 4UILL 2NTFB 1I9JL 4YHIB 1Q9WA 1VKXB 3VGDA 4ZUWA 4V1DB 1EDQA 3R4DA 2WANA 3MZGB 4JPIB 5DK0B 4L4TD 5EBLA 1KIUA 1S5HA 4UIKL 4WHDA 3GSNL 1VERA 4PG2A 5MERB 1C5DA 2YRZA 3BW9A 3QEQD 1JWSB 1MIEH 1RHFA 3SDYH 3WL9A 4XPAL 3MOBL 4NFBA 4QHKJ 2R23A 1U3ZA 2F54E 4HZAA 1OSZB 2AKRA 4FQJL 2YD1A 4N0CC 4M43L 5I30H 4PGEA 5HHOD 2RBLA 2HTLC 2ORBL 3BP6B 5E1HB 1R3JB 5CJXA 4GG6E 3TJEH 2J88L 1T0NB 3O45B 2IMMA 3RY6C 4I0PD 4QWWD 4KZEH 4F2MA 3TC9A 2IAND 4WV1C 3MJ9A 4XGZB 1CT8B 2BRRH 4GBXA 4D3CL 1FJ1B 5DO2C 5FA3A 3U46B 3WV0A 1F4WL 2A9ML 1NGQL 5ICXB 4MQ7A 4J6RL 1MEXL 3AU1A 3QCTH 5FKPB 4QOKD 2LVCA 3BJLA 4ZFFB 4UU9A 4EI5D 4IIQA 4OLYL 2YWZA 1G6RL 5GGTH 5EG6C 2EYTB 1NGYB 4Y4FC 1YNTB 5C2BH 3B2UC 2GJ6E 3CX5J 2X41A 1QHPA 5EH1A 4WFGE 1EO8H 4C56D 4NPYB 1Q9OA 2W59A 5GSVB 2JCCB 1TQBC 2E27L 5E00B 5D2NB 5E8NA 4CVZA 4M7LT 3SDXB 1SYSB 5I6XC 2QL1A 3T3PF 2OBGA 3ULUL 4FTVB 4QRRE 3SQBA 4XMKH 3IDYC 3WXWL 1P7QB 1JL8A 5D71L 2GJZB 2R39A 1L0QA 1UG9A 4P23C 4CU8A 4ZFGL 4PJGF 2PYFB 5DHXB 3VDCA 1RJCA 4PP1D 2VXQL 3VRJB 3TPUA 1CFSB 4KAQL 1IAMA 1AI1L 3K0WA 3A6CL 2X4UB 3EO1B 5D96C 5IR1B 2DD8L 2HG5B 3ZT5A 1INEH 2I5YL 4WUKL 3TNMB 1BAFL 5J57B 3QIBD 4G7VH 3CGTA 3SY0A 4ETQB 5F7FA 4M3KB 5J7CC 1DUYA 3TIEB 1W0VB 4GAJH 5CGYC 1I85A 5D7LB 3WIHH 1MFAL 5B38B 1J5OH 1IM3B 2IGFH 4KVNL 5D72L 4A2MA 5EUOA 3VXMA 1U2CA 3S3SA 3BGFC 3MLRL 3WFHA 2W60B 1RZJH 3AS0A 3GI8H 4JDVB 3LEVL 3EDKA 1HI6A 2EIZB 4OTXL 4YDIL 2R1YB 3GBMH 3JWDH 3QULA 4HD9A 4JY4A 5EBMA 2Y1VA 3RTQD 3RWJB 3VFMB 3KNBB 4NO2A 1WWWX 3IFOA 1UB6B 2X5PA 2HG5A 3TYGL 2F54B 4OLUL 2XY1A 4WWKC 4L8CA 1LWRA 3GI9L 1A6WH 1FNEA 1QSFE 3C5JB 3VXPA 3C9NB 4PP1C 3C6LD 3L7FA 4DJMA 4FA8A 4JE4B 3BZ4A 3UTPD 4FXGA 4MD0A 1LD9A 4X6DB 4WEMB 4NIKB 4GG6B 5D2LE 2VXVL 2PO6A 3OV6A 1NGWB 4LCCB 4LARH 1A22B 2YRPA 4X6CB 2BRRL 3QQ3B 5IB5A 1JF1A 5F1IA 3BPNB 1F4WH 2A9MH 3FTGA 2MNUA 1UZ6F 4DVRH 5C7XH 3V9FA 3I2CL 1F4AA 2A1WH 4QRUA 3HI1B 3HI1A 4HCRL 4JFFE 4PGDA 4J3XA 2XXMB 2JIXD 5FF6B 1CG9A 3EYVB 5JOFB 1L7IL 5A1AA 3RTQC 4TNVF 1AO7A 1H3TA 5CKGA 4UI2A 3WJLA 5GRVL 5HHVL 1YEIH 1UZ6E 5C08E 1KJVB 2NX5E 2BMKA 1IQDA 3ARGA 1NANH 4Z76A 1FYTA 5C0AD 5IHZA 3GJFH 1QR4A 2HJLA 3GSUB 4F2MB 3STZB 3T8XA 2DYPB 1Z3GH 2FEEL 3BGMB 2GKIA 4TQEL 4XRCB 4LEOB 1CLZL 4KI1A 1DE4A 1AR1C 1UC6A 3E6FA 1U93A 2GTZA 5FGBA 1A7PH 1SYVB 3BDBA 1T1WB 4NO0A 1RV6X 2ZUQB 2BNUB 4KZDH 4I0PC 4QWWC 4LNVA 5E70A 2J6EH 4ZAKB 1G6RB 1S9VB 3VFUB 5K9KB 4LRNH 2XTLA 5DUBA 4LF3A 1W0YT 2AK1L 1DBKH 3U7WH 1OP9A 3UO1H 4QYOB 2EO9A 3ZE0F 5E2WH 4U1HA 3RI5F 3MLRH 4RGNC 3GSVA 5IB3A 2XNAB 3AUVA 4AEEA 1CGWA 1RZJL 3QNXB 4P23B 2XKNB 2Z91A 4OV5A 3TBTA 1BHGA 1J0HA 4WUUD 4WNQA 2Y4SA 5FYKD 3SGJA 1EERB 1U0QA 3GDBA 3JUZA 4KQ3L 5IB4A 4POYA 1PG7X 3QDJE 5JIKA 4LVNC 4LCYB 1FNAA 5EO0B 5JDSA 4G43A 2V17L 3D85B 1U3HD 4B5EA 1TZHA 4OLZH 1SM3H 3WDHA 4XPAH 3LHPL 1NEZG 3T09A 3QXAB 5EZLB 2V2WA 2Q8BL 1P4LA 4G6ML 4HKXA 1BVKB 5FA4A 3KGRA 2X2YA 3LRGA 4I48A 4PRDA 5BV7C 4EIZC 2K3TA 4G9DA 4NHUB 5FO8A 4HS6B 4U7KA 1FN4A 3FKUS 3D39A 5I71C 1DSFL 4K94C 5FDWB 2DLTA 1G7PA 4Y16A 4MJ5A 1KGCD 2DWEB 5E9DA 1A6UL 3I85A 4BFBD 4UAOB 4P5TC 2WMPA 1QA9B 4X98B 3RFZC 3RL1B 3H9HB 1KG0A 4M62L 5T3ZD 3U0WH 4MJ5B 4PJDF 3MLTB 1AY1H 5J1AB 3WS6A 3EAKA 3INUL 5ALCH 3MLYL 2LU3A 4KWUA 5D7KD 4TTGA 3C60B 1F6FB 1NDGA 5DJ0B 5IEKA 1IARB 1B0RA 4IDJL 4TNWK 4XP6H 2BHZA 4WWKA 2ADFL 4TSBL 2B39A 5ICYA 3BYTA 1LEIB 5IFJA 1C5CL 2IBZX 3QIUA 1P4LB 3O2DH 1HINL 4HKXB 4CW1B 4NRZA 3GSQA 1JPGA 1MIEL 1BD2D 1RK0B 4JQVC 2NXZD 5IV2A 2MKLC 1DN0A 2VR9A 3DVNA 1Z0MA 3UTTD 2AERT 3VRLF 4Y19D 3NCJL 1T1YA 3OPZH 4JZJA 4OQTA 1Y18A 5C8JB 5FOBA 3NFPA 4JM4L 3TA3B 3GBNH 3OAZK 1HIMH 1AXSB 2JK5B 3IFNH 4MNGE 1S7UB 4WVRA 1J88A 3HNSL 3OKLB 3EFDH 4F7EB 4PB0H 3BYYA 3CXHK 3DX6B 4X80L 3KWWB 1GOHA 1ZGLA 1VB9A 5DT1L 3V4UL 3PL6B 1HHHB 3DHMA 1Q9LB 2AK1H 4R97B 3WIHA 3JWNC 3QHTC 3I3EA 1QSEA 3KPNB 3DWTA 4Y5XB 2P8LB 4L4TE 3ZE2F 2ADJA 4R4BB 2CIIB 1IGJA 2IANB 3DURB 4XPFL 1NMCB 3MLZH 5I66B 2QADB 3BKYL 1MCHA 4K71C 4P2OC 6FABL 1IBGH 4K8RL 3HI6L 5A16B 1SYVA 3S4SG 5BOZG 3B2VL 3EZ8A 3F7YB 3MRGA 1MSPA 2V17H 3PNWA 4P2QA 2FCBA 5CS7A 2GSGB 1T7XA 3TF7C 3LEYH 3B9KB 4UIMB 4PB9H 4LNRA 5KJRH 1N6QH 2ZG1A 3BZFA 3ET9F 1I1RA 2DYPA 4OLUH 1FFOA 1U58B 3V8OA 3X3GH 4JDZA 1KELH 4JPWL 4NPYA 4HKZB 3ARFB 3KPLB 1KLUA 2WWMC 3MV7A 3UJIH 3WHXB 3NN8B 4ZPTA 4Z7WF 1BFOB 2VE6A 2WNGA 2BP3A 1FYTB 4LSSL 1C16A 4PJ8D 4NP4L 1UCTA 1KN4L 2EYRA 1PFCA 5TQ2L 2XTJB 1DQLH 3S96A 3KDMB 1SJEB 1SMAA 4FQXC 3VFGL 1CTOA 1BLNB 1SEQH 1QSFD 3CDGA 3GO1H 2P5WB 1JN6A 2HFGH 1HKLL 4Q7DA 1CGSL 2BNRB 4MD5A 2H3NB 5DHYB 3PWLB 4RMTA 1FJ1A 1A1NA 4OZIB 1AD9A 3BI9X 3OR6B 3HCVA 2W0FB 3ARFA 4ISVA 4PBXA 3BSZL 5LGKA 5DJ8A 2CKBH 3T0DA 4NQCB 3L3OA 2N4IA 2R0LL 2ADFH 1NGWA 4PRHB 1OT1A 3L3IB 5T3XL 3CLFH 5GS0C 3I3BA 3KYOB 4PJ8A 3DXAA 2JF1A 3TYGH 3MA9H 3MRJB 2R23B 1PLGH 5E99L 1BIHA 1WUNT 5I15L 3OGCB 4HUKB 5CEXA 4Z7VA 4OUOA 4FQ2L 2PF6A 2OJZL 4HUWA 4KRMB 3FO0H 3QCVH 5E2UH 3C60C 3T77A 3PF2A 1E4JA 3GMRA 1A7NL 3ZHDA 2MPAH 1HHHA 2N7BA 4K3DH 3MXWL 4JR9L 3A6OA 3PWVB 5E1AB 5TF1L 4JO3H 4I2XE 1A6PA 3WKML 1I75A 1YMME 4W4NA 2VL5B 4M7ZB 1EZVX 4Q58C 1HQRA 5D2NC 2BCKA 4CMMA 3OSKA 3O3EA 3MLZL 1NCBH 2MCPH 4PPTA 4KKLC 2VLJD 5D2LB 2ARJB 4LCWB 3LSOB 2RR3A 1MHEB 5CKAA 2GK2A 4OLVL 3FB6A 4GW5A 3F7VB 1WBXB 4QTHB 2Q8AL 3EOBB 5AYUH 1PZ5B 1IEAA 3BT2L 4EXPX 4XBEH 3G04A 3W5NA 4X6EA 4P2RE 4YHPB 4MXVF 4ODBD 1QHOA 1U8LB 5IBTH 3TJHC 1K4DA 3TBVB 3QG6A 5BO1H 3KPRA 1HHKA 1YC8A 1LHZA 2M2DA 3TGXA 3RNQB 4BSWB 4J3OC 5DUPH 5JORB 4M1DL 3J7HA 1JF5A 4NZRH 4JQIH 3RI5K 2N7AA 4FHBD 3R1GL 1D9KC 5DEFB 4PY7A 4M8VA 3M1BB 4KZDL 5J89A 2E7LC 5CGTA 2A0LC 3MOQA 4K07A 3UTPE 1H8OA 2J6EL 4S10A 3VFOA 3ZDYE 4UU9B 2F5BL 4R26L 2BY3A 4YHYB 4NCDA 4LEXL 3MRIB 2BNQA 5FKPA 1UEYA 3UO1L 2VOTA 4NKDA 1AKJB 1EH9A 1WFUA 3L3JB 5FGSA 5JXAL 1YEHH 1I7UA 3FFCB 5IFHL 1HHGA 1NL0L 3VW3L 3WIIL 3QXAA 4G6JH 5LJYH 2HLAA 2VSCA 1CT8A 4NOFA 5E2JA 1GGCH 3TF7A 1S7SA 4GQ9L 5F3BA 2H1PL 3QO0B 2D0GA 4MXWH 2Z0BA 3S35H 3RTQA 3U4BH 4APQC 5KZCD 3GBML 4ZXBB 1KJ2A 5F9WB 5HGGS 3P73B 4RGND 2CRYA 2D2OA 1T04B 1FAIL 1EUUA 3T2NH 3KLHD 5DVOA 1M71A 5IVOA 2VLKA 4OGXL 5J12B 5DJ2A 4MA8H 5GS3A 4TSCH 2WWKT 1ACZA 5DMKB 1H9VA 4D0DB 2A38A 3OPZL 2ZUSA 2NW2B 35C8H 4Z6AT 3RTQB 4HDIA 5J8OA 3EYFB 4M5YL 1IEBA 3DJ9A 2QHRL 3ARDC 3GSOA 4PJEA 3EYUH 5DRWA 3MLVH 1FGNL 3DIFB 4DW2H 1TCRB 4NO5B 5I1HH 4NN7C 4XPBL 3M17A 4JG1H 2EC8A 5M94B 2XYCA 1T21A 1QEWB 3TFKD 1LEGA 3BJ91 1HN1A 4Z0BH 4Y19B 2V5TA 3H9YA 5DJAA 2R1XA 5D7JA 4PV8B 4F7MA 2BNQB 5EOQH 2ZOKB 1V7MH 4F80A 4ZFOA 1OM3H 1MVFA 4ZTOH 3X12B 2X05A 5HGBB 2AVGA 2Q8AH 1G9NL 1SY6A 3ZYJA 3T4YA 1X5LA 4Z7NF 1AO7E 4WEBL 3HAEH 3FQXA 1ACYL 1E28B 1XF2B 3L7EB 5EIIA 3UTSE 3ZDZE 4ESKA 1FFNB 4WI8A 3BD3A 3NTCH 5D1ZC 4XCFL 1LO2L 3WHE0 1U8IB 4JKPL 1YJDC 3VFPB 3MGTB 4LSQH 4RAVB 2RFXA 1F8TL 4JY5H 3ZDZF 3TH2T 3MUHL 4NJAH 4XXDB 5CWSB 3BPOB 3FJTA 1YQ2A 3QAZB 3EFDL 3Q3GB 4P46C 5EA0H 2R0WH 4RBPH 1A6VH 4U1GC 3T65A 1XCTB 4TOYH 4RWYH 3LB6C 4R26H 4RMQA 5DDHB 4S1DD 2D7PA 3D39E 4WENB 5EFIA 4FQXA 2HKFL 1IL1B 2D0HA 5HHMA 5MI0B 2CDEB 3S37X 5GISH 1HXMA 3MUJA 4JO2L 5D7SH 4Y16C 4V1DE 5MP6L 2QSVA 1R3KB 5FXCH 3BRFA 3TO4A 5LG1A 4JZNA 1CICB 4M93B 3PWVA 1OARH 3GSXB 3WSQL 3JV4A 4NO3B 1C12B 3DXAD 3MRKB 4XAKD 5C9JB 2OI9B 4PUBH 2PR4H 3NIGF 4LIQE 5C0GB 4JY6B 2F53A 4JQXA 3C6LA 4DFHA 3MA9L 1C12A 1NFKA 4PJ8C 4KKBC 1MQKH 2P5WD 4JZNB 1U95A 4NYLB 3V0AC 4PJHF 5C07E 3SDDC 1A6AB 4W4OA 5DMIH 4NN6C 3VWJB 4ODSH 4YIQB 3DXAB 2D03H 1P1ZA 3JSSA 3ULUE 2YA0A 3KYMB 1QSVA 3STLA 2NCMA 4WFHE 1J0JA 5EFIB 4IMKC 3GSXA 2V7NA 3EYSL 3WLWD 1K4CB 5DZOA 3IRZA 4TNWF 3OXSA 2K1MA 5I17A 3V2AR 3CFKA 2E7CA 5AZEH 4XVTL 4HWBL