3KPNA

Crystal structure of hla b*4403 in complex with eeylqafty a self peptide from the abcd3 protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title T cell allorecognition via molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kpnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kpnA01
1AJ7L 1FYTE 2YD3A 2JK5B 3EO9H 4XCYA 1CXIA 1ZLSL 1UQSA 5HI3D 2FHFA 4JZOA 5TGBB 4XI5D 1OCWH 4HF5L 4YGVA 2DM7A 3CXDL 2RCSL 1BECA 3TIDA 3DGCR 5CILL 4CMMB 4KJWC 4JFZH 1FZOA 3PGDA 4AY0A 1X5LA 3O4OC 1XH3B 3FFDA 1Z6JT 5JPNB 4YBLB 3GIZL 3MNWA 1JP5A 4OFPA 3ET9F 3LH2H 1ZS8B 1OTTD 5L0QC 1IQWL 3B2UD 3F58L 3MMEB 1R24B 1XR9B 4ODWB 4Z8FL 4H26B 1F13A 2HMIC 2BHYA 1ZVYA 3JWDH 4AQOA 5ID1B 1QFWL 5E9DD 3SO3C 3QZWG 1T5WA 1YEJH 4LLMB 3NA9L 3R8QA 5DO2D 1D5MA 4K9EC 5F7LB 4KKLD 2D31A 2VDRH 4Z76B 2DIAA 5J11C 3CLFH 3GUTB 4O02L 1YDPB 2LABA 4ODUA 3KPSD 5DGRA 5MEOA 2ADIB 2IAMD 4HQQH 3I2CH 4PJGF 4I4WB 3SJVA 1A5FH 3ZDZF 3HFML 2BJML 3QNXA 2EKSA 4OD2A 5AD0A 3QUXC 4RAVA 1P9MC 3MRIB 1I8MB 1QR1A 3WO4B 2Y36H 3VXQA 5L9DL 1HIML 2HP4A 2BVUA 4LIQE 3BDYL 1KJ2A 3ZSSA 2YSSB 1Q72L 2GITA 2V2TA 3L3JA 1F6AB 4PJDA 1KUMA 4XVJH 2G75A 5J57B 2NY0D 1HSBB 5E9DE 3O6MH 4QXGL 3KYOB 3TZVA 4MVBA 3DMMC 5ESAA 3FQNA 4FFVD 1U58A 1OM3H 2IFFL 4ZOEA 3BZ4A 2PO6A 5FO8B 1NGQH 4PJ5B 3RY6C 1T22A 4HDIA 4GBXB 2Y06H 2HMID 5IMLA 5D4QA 5C6TL 3KPSE 1B6UA 3QWOB 4XCFL 2ATPB 4NDMA 4NZTH 5I74B 1W0WA 2YS4A 4NOBA 4JREB 4QT5B 4QXTB 3RDTC 5FOBA 1PEWA 1U8KB 1OGAD 1MHCB 3TIEA 4N8VB 1CQKA 4FQIH 3ARTA 4GW1A 3LB6C 4PP1D 3OG4B 3VXOA 4I8DA 2NYYC 1OSZB 1JPTL 1VGKB 5E8DL 4TUKL 1A6WL 4OUOA 4Y5VC 5MEQA 1O0VA 3G6JE 3S6CA 3QUXD 4XMLH 2J1KA 4S1RH 1CGTA 2CDGB 2GW5A 1UKTA 1EX0A 4GS7C 2P43B 1AGEA 3UYOD 2VTFA 4NO0A 3WYRA 2HAZA 1NFKA 5DRXB 2HKFL 3CXHJ 4WO4B 5EH1A 2FIRT 5ANMB 2VDMH 1I7ZB 1P4LB 2WWKO 2Y1VA 2ZKHL 4LL9A 5K9KA 2DKSA 1LK3H 1YQVL 3JV6A 4KUZH 3LN5B 4MA3B 3STZA 1VCAA 1IAMA 3DMMD 1CGVA 2JCCF 4ZO9A 5EO1A 5CJXA 4WUUD 5EU3B 4I13B 3AM8A 4R7NA 1OP3H 1A3RH 4MAYB 5ITFB 2GFBA 3VA2C 1BVKB 1OGAE 3NH7L 4P2OA 4NC0B 4RFEB 4P57B 5EIIB 3CVIL 1EEQA 3ERYA 1RZIA 4NUGL 1YC8A 4K71C 2R0ZH 4ZTPL 1IJ9A 4DFIA 1RUQH 1QEWB 1XEDA 1N5AB 3RDTD 4K7FB 1QBBA 1CG9B 4M5ZL 4P3DA 2IMNA 4HIIB 1JNHB 4PG9B 2FB4H 4F7EB 5DVKA 5CGMA 3HNVH 4KFZC 3MRQB 3WL9B 4YO0A 2CKBL 3QCUL 2UY6A 3LB6D 3OKKA 2NYYD 3ARSA 1L7TL 4TVSa 1IGYA 5I75C 3DNKA 4BUGA 3RIAF 1F5WA 3V4VH 1NFDF 1P7HL 4X80L 4Z95H 3SDAC 1NGYB 3FT3A 5DI8B 4AK1A 1FO0B 1HHHA 1P4BH 5C3LD 3UMTA 1M05A 1JUFB 3MV01 3ZE0F 2DLFH 1A4KA 1AP2A 5K33A 5FYLD 4RAHA 3MRKA 3TA3B 1YEFH 1UXSB 4O2EA 1IGIL 3MLSL 1XIWB 4WUUE 1EHLH 3HE6D 1BVLA 3QCTL 4ALAL 4CDHA 4XCCL 2VITB 4MXQC 3WFCH 5DJ2A 2XZZA 3NABH 3C5JB 1BGXH 4G80B 4JM2D 5E6IC 5GRUL 3FT2A 1CXEA 1Q9WA 4OAWB 1I9JL 4YFLF 3GBNH 1IKFL 1YYML 4WENB 4RBPH 3HPLB 5IQ9B 4AEIL 1CGYA 2DQGL 3CDFA 1NLBL 1FFOA 3ARVA 1MCOL 5ISZA 2DMKA 3CFKA 4PLOB 2FYYB 4L4JA 4X7CC 1CT8A 2BCKB 2JCCB 1G7JB 3DHMA 1X4XA 3MUZ1 4MJIB 4FQ1L 5FA4A 3MZGB 1D9KA 1Y18A 3OKLB 4EIZC 1VEOA 3CSGA 3MXWL 4QTHA 4HMCA 5FYLE 4JKPL 4C56D 1IT9L 4X9BA 1IZJA 4ONFL 2QHRL 1L8JA 1F3RB 3OWEA 4F9PC 4L5FL 2EYTA 2A6JA 2K7QA 2A2QT 1I3UA 5GS0H 5KAQF 1GC1L 3F7RA 3N9GH 1JWUA 1IGML 1R3KB 1K5NB 1VKXA 4M7ZB 2ZUWA 2E8ZA 4PJIB 3GSUB 1I9EA 4IOIA 2JIXB 1NFDB 3KJ4C 3OG6B 5GGQL 1AR1D 5EIQA 3BGFB 4GRMA 1GGCH 4CKVX 1EJOL 4P23A 4DCQA 5LQBL 5L6YH 3C6SB 5HJ3B 1ORQA 2EDKA 3N85L 4L3CA 4N0CD 3LHPH 4Z7WA 1HI6A 3U9PH 4LHQB 1I8IB 3D85D 4X6FB 4MXWL 4OLEA 3WIIH 5EPMB 5H94A 2CLVB 3R06A 5BOZG 2J6EH 4R4FL 2R56L 4P99A 5IJKC 4IRSB 3GM8A 1JGUH 4TN9A 2VLRA 3IDNB 1HZHL 1BEYH 4L8SC 3WLWC 1Q9OB 4BZ1H 5DRNA 3G5XB 3KJ6L 2F53A 5F9AC 5FM5M 3MRCA 3TEUA 2D7PA 3CLEL 1UYWL 1GIGH 4X4MA 1ACZA 4PB9H 1W0VA 1PKQA 4LARL 1JZ2A 4GMTL 1GGTA 4HCRL 3FQWA 2O26U 1F58H 4DEPB 1DVFA 2R1WB 3GJFA 1I8KB 4M6NH 3ULVH 2RQ8A 3CFJB 1G7IA 3PGFH 4KKAC 4L4TB 3BD5A 1F90H 1XGYL 3KR3L 2NW2A 4KK8C 2X89A 1J05B 1UWEL 1SY6L 4YK4B 1PVHA 1IM9D 3H9SA 2BC4A 4H5SA 2X1XR 2PF6A 1H8OA 4OUUA 4KRLB 4NP4L 2EDOA 4NNXA 4OD1H 3QDMB 4YNYB 5F7HA 5TQ0L 5HGAB 3U82B 3U48A 2DKMA 3RWDA 1PSKH 4JY5L 2XKSA 4PJDF 4IRZL 1CDHA 3BEWB 1JGEB 3WSQH 4B41A 4DWHA 4RIRA 4XCYB 5D7LA 1VA9A 2W9DH 1UQSB 4JZOB 4Y2DC 1A6AA 1GH7A 4G7VL 4YGVB 5LCVH 5HDQH 2F5AL 3LV3A 2P47B 1L7IL 1Z3GH 2DM2A 3H8NA 3LMJH 1NAML 5FYJU 4PJHA 3HNSL 3RTQA 1OP5H 3LS4H 3PWVA 1IGTB 5IVXF 3FFDB 3EYVA 3GMLA 3BOVA 3DWTA 3P11L 4PRPB 4G6KH 5EWIH 1CF8L 3FCTA 5BV7L 1KC5L 4OI9A 1QPPA 3ARZA 1PD6A 2P48B 3KPPA 3ZHKA 4Y4FC 5KSVB 5I1DB 4TSCH 2LTQB 1WC7A 4LSVL 1E4WH 5LG1A 4GG6A 3D87B 1MFEL 2F15A 1ADQA 3QUMB 3MUJA 1ZA6A 3MOQA 4EDWH 1AE6L 4MDJA 3VXNB 3HZMA 1KB9K 3GMRB 1D5MB 2W0PA 1TXKA 1XCTB 3NTCL 3ULUD 1H5BA 1QO3A 4TOYL 2D31B 4OCNC 4JANB 4P2QD 4KKBC 5CSZA 4KK8D 2CMRH 5BVPH 4NFDA 4IMLA 4ODUB 5MEOB 1DQJA 3V5DA 4AYFA 3RUGF 4IEFB 1UZ6E 1FORL 3AS1A 1Z0NA 3SJVB 5A3ID 5BZWA 3E3QC 3LS5L 3NACL 1JZ4A 3QNXB 1S3KL 3PQYD 1PY9A 4OD2B 5AD0B 4W4OC 5DYOA 3ZLQC 3ARBC 4RAVB 4F2MA 1QR1B 3VXQB 1KXQE 1OAZL 3QFDB 1FAKT 1NMBH 1UM6H 3WKML 4EXKA 2KH2B 1TVDA 3X13A 1QLRA 4KC3B 2GITB 3GSQA 4BZ2H 2V2TB 2EEBA 4ZUTA 4YXKH 1I4FA 2MKWA 1GZQB 2YA0A 3RU8H 1P4IH 3TZVB 4JFEB 5ESAB 3FQNB 4ZFOA 1U58B 35C8H 5ALBL 3ULUE 5E8PA 3BZ4B 1NAKL 4OLYH 5HYJD 2IQAA 4HDIB 4ZOBA 4P2QE 4YHYC 2D7NA 2VC2L 1AGCB 1RZKH 2FWOB 3QB7C 3D3VD 3B9AA 4K7PX 5E0QA 4EUPG 1XGUB 4POZC 4PV8A 2YUVA 5J12B 4ODVL 3HTLX 4P5KA 4OGXL 4XXCC 3V52L 3EFDH 1MRDH 4M6AA 1HH9A 2EIBA 4QXUL 1HQRA 5E8NA 5FOBB 3PQYE 3ZL4H 2CUHA 3T3PE 2OTUA 4NQDD 1QSZA 2VZOA 1NLDH 3TIEB 3CVHL 5GS2D 2ZG1A 4OCSH 1FE8H 4GW1B 3FO1A 4PRNA 2F58H 2L0DA 1A3QA 3ILQD 1IC4H 4HK3N 4ZUWA 5MEQB 3HR5A 4UI2A 2AP2A 1KPVA 5T3ZL 1JMXA 3OJMB 1KEMH 3BGMA 2NY4B 2YPLD 4PY7A 2QSCL 4G3YH 4WFFD 1AGEB 3E8UL 2AABH 4NO0B 4QOKB 5GHWL 2AK4D 4FFYL 5BOPA 3FRPA 4PIRF 1JHKL 2UY7A 2WBJD 5EZOL 1FRGH 2BZDA 5CD3B 4HEPG 5C2BL 4I3GA 5K9KB 1DDHA 3WNPA 3JV6B 3D3VE 4QTIH 2OBGA 3RWCB 4NNPH 3HRPA 1FAIL 3STZB 4KROD 3OKEA 2ARWA 4DW2H 1FQ9C 4JFXA 5EO1B 4LF3A 1J12A 4LNRA 3NCBB 3QIWB 1ZKAA 4TQEL 2GFBB 4P2OB 4XC3L 3CD4A 4NQDE 3MV7A 2F8OA 1J1PL 2FBJH 4HV8A 4WI3A 3TM6A 4OGYL 1ORSA 2HRPH 4X5XA 4XP6H 4DVRH 1CK0L 4RRPG 4F37K 3DYPA 3E3QE 1ZHBA 2XZAL 3SE4C 3CFCL 1FIEA 4P3DB 4FNLL 2LAGB 4QLRA 3IVKA 2V5TA 4DOHB 1EERB 4YO0B 4RNRA 3QFJB 1XGPA 5E2TH 3QAZB 2YEZB 5DUPH 4WFFE 5EO0A 3OKKB 3EDEA 5GIRA 3K7UA 4M6OL 4FRWA 3T4AA 3O4LD 2Q87A 3KPRD 3FT3B 1FCCA 3TWCH 2C1OA 4X7TA 4U6TA 4UZGA 3BWAA 4Z7WF 1A4KB 5F7FA 3RZCA 3EKCA 1QVOA 4L1DA 3X3FH 4O2EB 4KZDH 1NBYA 5BMFH 1J8HB 3ZE2F 1XMWA 3HZKA 5SV3A 1ZGLM 1BVLB 4M1CD 4PJFE 1CVRA 4I0KA 2OXGA 3VXRA 3ZKSD 5LWYL 3MOAH 2AJYH 5KSAC 1SEQH 1Q9WB 3FT2B 3INUH 5HGDB 3EOYG 1WV7T 3PL6C 3STBA 1A7QH 4OTXH 3I6LD 1IVLA 4P5MA 3T0WA 4WV1B 3VE0A 1JYWA 5E94A 2O61A 1E4XH 1FGNL 5IMMA 4JY4A 4PJ8A 3G08A 4W6YB 4Q7DA 1FFOB 5ISZB 1MAML 2BNRD 2DQDL 4KDWA 5F1IB 3CFKB 1CT8B 3DO7A 4XNUH 5D1ZA 4MJ2A 3S35H 3O4LE 4N5EC 5IM7B 4LU5L 3WCYA 3KPRE 5FA4B 4DUVA 5J6GB 1D9KB 1Y18B 5HXMA 1W8OA 1NC4A 3NCMA 1CU4L 3SO5A 4QTHB 1M7DA 4N0YL 4BQBA 5B21A 1H8NA 2YRPA 5B8CA 1MEXL 3O2VL 1RUML 5HHOE 4KTEL 2A9ML 2A6JB 4D0CA 5FUCE 2AXGA 2OZ4H 3VWJA 5C0BD 5C08D 3H2WA 4U2YA 2Z92A 4WGWB 1VKXB 3RVTD 4LLDA 4Y88A 4MB4A 4JRYB 2AQ3A 2D7QA 4P4KA 5D5MB 1CE1L 3OGCA 3MACL 1UA6L 2C3XA 4FTVA 3I6LE 5AYUL 4ZAKD 1ZTXH 4HUVA 5ADPL 4GRMB 3SPVB 4N0UE 4P23B 2YD9A 4DCQB 1I8LC 4PJCE 4K8RC 1ORQB 4L3CB 1BX2A 3NIFF 2BNRE 2RIKA 1KB5A 4HBQA 4Z7QF 1F3DJ 5H94B 3R06B 2MNUA 4WHYH 1QFPA 4JG1H 1MNUL 1KJ3H 5JUEL 4GG6F 4MAUL 5GISL 4JQIH 3SDCD 3TJEH 3PUCA 2VLRB 3W0WB 2NY5H 2JB6B 5JOEA 5FUZH 4KPHH 2FEEL 4UBDD 2X70A 4I0CC 3MV9A 4M1DL 2DYPD 3K81A 3N1MC 1IARB 1HN1A 3MRCB 3Q5YA 2A77L 5KG9A 2AK1L 5ALCL 1BJMA 3NCCB 3QUYA 2OXHA 5TPWL 4BSVA 3L5WA 1PKQB 2BVTA 5BO1L 3FQWB 2OP4H 4PG2C 1T7WA 1SHMA 5C0BE 1DVFB 5E5UB 5C08E 2VXTH 3GJFB 1PJ9A 2YD8A 1G7IB 3FQXB 1H3TA 1G7LA 4WY7H 3FN3A 3CU1A 1CFTA 1NUNB 3BYYA 3UPAA 4GRLA 4CU8A 3IKKA 2EE6A 5EOCH 4NWUH 2AEQH 3H9SB 3OPZL 4H5SB 2BC4B 1JNNL 3NN8A 4UTBL 1RK0B 2XNAA 2O5ZH 4OUUB 1Z5LA 2IWGA 4NM8L 5CEXB 4NNXB 2Q7NA 3HUJA 1CLOL 3RWIA 4DGYL 1AQKL 3NCYS 1P84K 3A6OA 4GXVH 4M62L 3RWDB 1N6QH 2JF1A 1UB5A 1NDGB 1F3JB 1CDIA 3WFEH 1LP9F 1WBXB 4OZIE 2ZJSL 1NEZA 4RIRB 5D7LB 1G9NH 3ZKNC 4LEOA 3V8OA 3OXSA 4IRJD 3GSNA 4NJAH 4ODTL 4QHLB 2K9UA 4N0RA 4PJHB 4YXHH 3RTQB 2WINB 3FKUS 2F19H 4EI5A 4R2GC 3PWVB 5DF0A 4DGIH 3EYVB 3GMLB 3DRTA 2J88L 5MEPB 4ELME 2CKNA 4Q6YA 2YBRA 3VI3F 2ED9A 2W60A 4NQCA 1WZKA 1CICC 3KLAA 3KPPB 5H37H 3CCHA 1W0YT 1JZ6A 4NGHH 4E9LA 4GAYA 5C9JA 1QSVA 3HA0A 2HLFC 2AEPH 1WC7B 3EGSA 1EBPA 4GG6B 1UWXK 5DD3H 4P9MH 4J7RA 3SY0A 1TENA 2MKLC 4MDJB 3HZMB 3GI9H 4G8GA 4NBXB 1QKZH 3PV6A 2P8LA 1H5BB 3F7QA 1L9MA 2RJMA 1M1SA 2JJTC 3ULSA 4IMLB 5E56A 1N2RA 1DQJB 3V5DB 4KK6D 2DQJL 3KYKH 3B8SA 1F8TL 4RFOL 5BZWB 1P5UA 3B9KA 5DS8A 1ACYH 3DSFL 5DURB 4H88L 4QHMB 1BZ9B 4Y1AD 1MJJB 2CJUH 5DYOB 4XP1H 4F2MB 4FXGB 2OL3A 4KQ3L 5ESQA 3ZKND 2J8UF 4M48H 1N5YH 5GZOC 4CN1A 4N5UA 2NXYB 5DFTA 3P0GB 2ZNXA 2I24N 4U6VL 1T2QH 1AKJD 2EC8A 4X9HA 5IMKA 1YEDA 2ESVD 2OSLA 4ODSH 3GSQB 3RHWK 3CC5A 4R2GD 4ZUTB 3HAEA 5D7KD 1HWGB 1I4FB 1MIEH 1G7HA 3MUY1 1A6VH 2N7BA 4GQPH 1I1FA 1RJZA 5DT1L 4ZFOB 3D2UA 5D1XC 4OV6F 5CLWA 3HI5L 4HWBH 4G59A 3U7WL 4QRPD 5E2VH 5ID0A 2Z8WC 3MRDA 2J4WL 5CP3A 4UDUA 4U49A 4NO3A 4P5KB 4LLWA 4M7LL 2PXYC 1HH9B 1V3LA 2GTZA 3L7EA 1HQRB 4M9PA 4HH9A 1PZ5A 3RRQA 3P9WB 4Y19D 2OTUB 1OT1A 3G9AB 4Y1AE 1EGJH 1TPXC 3M8OL 4HMEA 4O51A 4PY8J 1DQLL 2NXZB 3MREA 4ZUWB 3HE7D 4D0BA 2GJ6D 1AI1H 1JGVH 3B2VL 4M8VA 1KPVB 3QI9C 4BFEA 1TQBC 2ESVE 3WXVL 4TUOA 3BGMB 4L8DA 3QHFH 4PY7B 5HD8C 2P8MA 4G8EA 5D7KE 5JLZA 4RX4D 2XV6B 1MAJA 2O5YH 1RZJC 5C0AD 1BBJA 5DR5H 4M7JH 3SKNA 1QFWM 2VIRA 5CJOH 3G5VA 5D70L 1WWWX 1X6LA 2FX8L 3H3KA 1JFQH 1DDHB 4BFIA 2JELL 5BQ7A 4BFGA 3S96A 2CGRL 3OKEB 5DVNA 4JFXB 4LF3B 3OKYA 3O3BA 4J8RB 4LNRB 5BS0D 2L7JA 4ONOA 4KV5F 1ZE3C 3QUMH 1F02I 3RWJA 1QFUL 4Y19E 2FX7L 3LPFA 2Q3ZA 4KAQH 2OJZL 3MV7B 5FYJD 1MCBA 3GNML 4HKJA 4HV8B 4L4VA 4MNQA 1E4XI 5HYEA 1U8LA 4X5XB 5HDBF 1KCLA 3NCJH 4M03A 1WIOA 2PXYD 3WDHA 3MGTA 1ZHBB 4OQ1A 1D6EA 4DKFL 1EPFA 4JO4L 4XC1H 2GJ6E 1KCRL 2ADFH 4E41B 4NYLA 1KN2L 2VLKD 3GGWA 1ZLVH 3IVKB 1B2WL 5I9QB 4JN1L 4RNRB 5IW3A 1XGPB 1F4YL 2ICWJ 4PLJC 3W81A 1NKRA 1WLHA 5GIRB 3DYOA 4CJ0A 5C0AE 3B5GA 1XGRB 5DFWH 1II4E 2WUCL 4I3RH 3MFFB 3JVGA 3LY6A 3K8MA 2C1OB 3OX8A 5AAMA 4X7TB 3GRWA 5EU6A 5JZ7C 3CSYA 4LCWA 3BWAB 5HD8D 2CRZA 1NCDH 4NZUH 1J1XH 5DSCA 3QRGL 3RZCB 1MWAL 4NO2B 2EZ0D 1KCUH 1NH6A 1QVOB 5JXEC 4MJ5A 1NBYB 4OZFG 5B39B 4CVWA 4XVTH 5BS0E 2YZ8A 4X0KA 4ZTOH 2NR6C 1A6TB 3TO4B 3V6ZA 3UJIH 1CDUA 4KZEL 1HH6A 2IPTL 2KL6A 3VXRB 5FYJE 2CH8A 2R9HD 2VDKL 4QY8A 4KJYA 5LKNA 3O6KL 1J87A 3TYGH 4Y4HD 4Z7VA 5D72L 3HS0B 3V4UH 3OKDA 1AGDA 1M4KA 4CW1A 4P5MB 3VGEA 4UAOC 3VE0B 5E94B 2O61B 5IMMB 2CR6A 3IB4A 2DN7A 2VLKE 1KJVA 3G08B 4G42A 4KK5C 1K3IA 3I75A 4ZS7L 1M71B 3ZSTA 2PR4H 2C3GA 3GSWA 4AQ1B 4NCC2 3DO7B 1C08A 2CLZA 3K4DA 1MFAL 4ETQA 1B4JH 1ZMYA 3QWRD 3FT4A 1EA9C 3DUUA 4I0PC 1BJ1H 3WFZA 1DLFL 5IW6B 1NC4B 3HUJF 4S0SD 2BVPA 5L88L 1TTUA 3VW3H 4PLJD 3C60C 1G6RA 4M43L 1E6OH 3FB6A 1NQBA 5B8CB 2DDQH 2WWMC 5DJYA 1EH9A 2XRAH 3RIFK 1WGOA 2A6DA 3OAUH 2APXA 4D0CB 1GOHA 3B3IB 1TJIL 2AXGB 4PJGE 4W6WB 3VWJB 5I1JH 2AGJL 3QO0A 2PETA 4LLDB 8FABB 5I8OL 3QIBC 2IF7A 4H8WC 4LSQH 1FBIL 3OGCB 1JHLL 5IV2A 1D5ZB 1HDMA 2MCPL 4FTVB 1CLYH 1FNGB 3BN9C 4HUVB 1T4KA 4M7KH 3Q1SL 1UM5L 4GRWF 1KCKA 4TNVK 2OI9A 5AZ2H 1PX3A 1U3ZA 1KF9B 4NKOA 3HNTH 1BX2B 2B4CC 1P6AB 2YPKA 1KB5B 3MRBA 5CWSA 2IJ0C 1DL7L 2FEDC 4LSTL 3PDDA 3WJJC 1FO0L 1XF1A 2VERN 3HC3H 5I1HH 1KBGH 1I9IL 3PWLA 4LHUG 2EH7L 3HI1A 3OKNA 1I1CA 5GGSA 4WW1A 1F4HA 2X70B 2R0LL 3TCLA 1UJTA 5A16A 4O4YH 5DJDA 3H42L 2A6IA 1BWWA 5CJQL 3QEGH 3O2DA 5KG9B 4LBEA 1NUFA 4RGNC 4AG4L 3TNNA 3QUYB 4JE4B 1X5GA 4I0PD 2XTJD 2X4QB 4BSVB 3L5WB 5IT2H 1N64L 2X09A 2HG5A 4HS8L 4X6CA 4LAQH 3ZT5A 4KUCF 4J23A 4PRAA 5DVOA 2YRLA 3P3YA 1G7LB 5SWZB 1CFTB 4GRLB 2DQFA 3L6FA 4GSDL 3NN8B 7FABL 3BSZH 4YDJA 2WWKT 3QIUC 3HRZA 1IGCH 5E8OA 3S8WA 1E4JA 2Q6WB 2EXWC 3RWIB 5IGXL 1TVHA 4NRZB 4E0RA 1BLNA 1MUJA 4Y4KC 1KELL 5IF0A 3RWHB 1G9EA 4WI9A 1I3GL 2XZCL 1UB5B 4X8XA 2CDEA 3O3AA 2BFVL 5KAQG 2EEAA 3WIHA 3O9WD 1MREL 4LEOB 5JNYA 4V3EB 3T1FA 3OXSB 5GJTH 2BOCA 4X4XB 3GSNB 1OP3K 2P5WE 4PB0H 3WV0A 5C9KA 1NC2A 3W39A 4DZ8A 4P46A 4EI5B 4KHXH 4I18C 1NGZA 1U3HC 3R8BB 5D71L 1FDLH 5B4MC 4GQ9L 3TESA 2XTJE 3DRTB 2QV2A 3BP4A 2W60B 4I2XA 4NQCB 1U6AL 2PKDA 5TE6H 4LHUD 4RA3A 1FIGL 5DQ9A 3W2DH 3QUZC 3KLAB 3O3DB 1HHKA 3CCHB 3TN0C 5INCA 4X99A 4GAYB 5C9JB 4RGND 3SDXE 3EGSB 4Y16C 2BVYA 2G60L 4FQ2L 3SY0B 3OHXA 2Y07L 2NLJB 2DQTH 3C87A 2VWEC 4G8GB 3MRFB 4J4PC 3PV6B 2P8LB 1QBLL 5D7JD 3TO2A 3VFGH 1FL6A 1GC1C 1UH3A 4XPFH 4GJTB 1KLFA 4PRIA 3ULSB 4YAQA 3MGOA 2UWEA 3WNNA 1TJHH 4K3HA 5K9QG 1RULH 5GGUA 3L1OH 1HYRC 5T5FH 3B9KB 3I9GL 4Y4KD 3TVMA 1WAAE 5DFVC 3OB0K 2NNAA 1PFCA 2HFGH 4MD5A 3ZE0E 4DKDC 5J0BA 2OL3B 2IMMA 5FYKL 3QXAA 4MWFA 1IFHH 1VACA 5ESQB 2DJ4A 5SWSD 1N3NA 3MLXH 4LOUC 3OZ9L 2FGWH 3P0YH 4HUKB 5IR1A 3UJJL 5IBTH 4AEHL 4NFBA 4RBPK 1A6UH 1NCBL 5IMKB 3QDHA 1HKFA 1YEDB 2OSLB 4S1DC 2YD6A 3U0PB 3WFDH 3CC5B 4RGNE 1I1YA 4N68A 5B4MD 4KKNA 2B5IC 3CAFA 2ZP0T 1QLFA 1G7HB 4UNUA 3WD5H 3QHZH 4DTGL 4ENED 1KENH 3BPLB 1I1FB 1RJZB 5BZDA 4Z78B 3D2UB 3MA7A 1A0QL 4XNXL 1DSFL 2F54D 5L2KD 1ZEAL 1FYTA 1PBYA 3X3GH 5ID0B 4QF1A 1A7OL 1R0AH 1MY5A 3MCLH 3MRDB 4L8CA 1AIFA 4PGEB 4UDUB 3UBXA 3O0RL 4NO3B 5EU5A 1OY3B 4LLWB 5D1QA 3DETC 4ZO6A 3L7EB 1U3YA 3NFPB 5ITBL 1PZ5B 5IB3A 3NAAL 4JHWH 3S4SA 1BQLH 3F12A 2OQJA 1GCFA 3FMGH 3H6JA 1IEHA 4JPIA 4X7SH 4DK6A 5HHMB 2VQ1A 3T2PA 4O51B 2C3HA 4L8BA 5SWSE 5DC4B 4EBQH 2G5BA 2WNGA 4EN3A 5AZEH 1DUZB 3MREB 4P3WA 3V7MA 5DFVD 1JWMB 4D0BB 4KI5F 3RAJL 3RBGA 3VA6A 1ND0A 2VYRE 3E1F1 2P8MB 5JLZB 3QULB 1CD0A 5DJ0A 4HK0B 5BXFA 2HFEA 4U3XA 1BBJB 1LO4H 5C8JA 3I6GA 2E9IA 3QDAA 4OF7A 2FECL 3G5VB 4JKKA 1ONQA 5DK0A 3A0OA 3Q5TA 3I84A 2F54E 3GHBL 5L2KE 5DMIL 5A2JH 4BFIB 2O93L 3WNKA 1YEEL 3QSKB 3ZHLA 3A6BL 3LD8C 5BQ7B 4MCZA 4KRPC 3ARDD 5F6IC 5KBNC 5JR1H 3O81A 3P0VH 5F9DC 2CRYA 1CCZA 1UH2A 3RWJB 1GGYA 5BJTB 5J1SC 1EHXA 2VR5A 4L3EB 1FN4A 2FGZA 2RGSA 4V2BA 4L4VB 1FLRL 1KJ2L 4MNQB 1ERNA 1U8LB 4FN0A 1KCGC 4MQTB 2BK8A 4HGWA 4K9EH 3BUYA 3RWEA 3DETD 4J3WA 3MGTB 3JXAA 1Q8MA 3LAFA 3OF6D 1D6EB 2NY3B 2UVEA 4CVXA 3BKCL 5J6HA 4Y5YA 3CZFA 4KKCC 4KDTC 1NJ9A 4NYLB 3GGWB 1S5IL 1BOGA 5E9DA 1FZJA 4LVHB 3WDIA 5DD1H 4XPGH 4PRHB 1NBVL 2ZUQB 5TH2A 4UILL 3Q6FA 1GGBL 4JFZL 4YHOH 4O58L 2V17H 5T1KD 4DAGH 1L0XA 4OI7A 1NSNH 1DQMH 5C0IA 3OX8B 5EU6B 3BT2H 4LRIA 3CSYB 5T1DH 3KPSA 5DSCB 2HTKD 4H1LA 2IAMA 3K0WA 1G84A 5IBUG 3OXRA 1OP5K 2JTDA 3N1QC 1VFOA 5DTFA 4X0KB 5EZIH 5I19L 2R2HB 3VDCA 2ED7A 4R90H 4OKVA 3JWDL 2Z91A 1HH6B 3CMGA 4QY8B 4YPGB 4KJYB 4NKIH 3K80A 1P7KA 1F11A 4HGKC 4XHJD 2OK0H 2VR9A 1G7PA 4Z7VB 5IVXE 3OKDB 1AGDB 4CW1B 3G6JA 3S37H 4OLVH 2V7HA 4X6CF 1KJVB 4G42B 3L9RA 4WU5B 3IFNH 3I75B 5F1OB 3V2AR 2YD4A 5HHQA 3FHAA 2X41A 3GSWB 1NL0L 4TVPH 1A5FL 1C08B 1HNGA 2CLZB 3IXAA 4ETQB 3DUUB 1M6OA 4KKCD 3BKJL 5KS9F 4C59B 1J5OH 2RHEA 2ITDA 1J0ZA 3SGKC 4YHKH 2BVPB 1JNLL 1NANH 2VLMD 1T66C 3HB3D 1G6RB 3TV3H 2WV3A 1XF2A 1WEJL 3FB6B 1DLHA 4F7MA 3KPMA 2FIKA 2QLVB 5GRWA 5GJSH 3CGTA 3PWJA 2A6DB 1OGAA 1RUKH 3RY4A 3ELAT 3RUGE 5KW9H 1CLCA 4NQUA 1E6JL 1EMTL 4FZEL 4Q58C 4J2XA 3W9EA 1MH5A 1Z0MA 3VFVA 1OAQL 4OLUL 2BXZA 1ZT7A 4GAJL 5IV2B 1HDMB 4OLZL 1GJIA 3UO1H 1F2XK 5I76B 1CLZL 1ZXQA 4UINL 3EFFA 3HMXH 1T4KB 4CU6A 1PEZA 3QUXA 2OI9B 4K23H 4WUKH 5I73C 1P9MA 3MOBL 4NQVB 1DBBL 4NRYA 4NKOB 3U0WL 5I8KL 4MX7B 3LEYL 3MRBB 5E7BA 5CWSB 1AHWA 1KFAH 1MAKA 5GGVL 5B3NA 3K2MC 2ED8A 1NCTA 4YUEL 1T0MA 3GBML 4QHKI 3JTTA 3V6OE 1B3JA 4TRPL 3GZKA 2UYLA 3PWLB 3WUWG 3HI1B 1LDPH 1H3XA 2AI0H 3OKNB 4RMSA 1KTKE 5GGSB 3S3SA 4WW1B 5F3BA 1URLA 1ZOXA 5D2NC 3TCLB 1YEKL 5DQDH 5JW5B 2FR4A 5DJDB 12E8H 2VLME 4LVEA 1PLGH 1EEZA 2A6IB 5EU4A 3VG0H 3VRLF 3DMMA 1NGWA 1IAII 2XWTA 4PRBA 4WUUA 5DJXA 3BMVA 4YFDB 3TNNB 3UYPA 4XMLL 3RY6A 1FNEA 4ONHA 5FGCE 2HG5B 2AW2A 3U1SH 1T66D 4PRAB 1MJUH 4PR5A 1AFVL 2RR3A 3NCEB 5JXAH 2DQFB 4P5TC 3L6FB 3RVVD 3RDTA 3SKMA 4KVCH 2H8PB 2VUOA 1H3PL 3FTGA 4PLKC 4NT6A 4YDJB 3O45A 3VWKD 3AU1A 3HRZB 1A1MB 4U6HB 2OM5A 1MCPL 2MWCA 1A47A 1IC5L 3GO1L 2A1WL 1TVHB 4E0RB 4IJ3B 1MUJB 5F44A 5SX5H 5IHZA 5IF0B 5D8JH 1A3RL 3MRPA 2CDEB 3BPOB 3O3AB 1JRHH 2FJFA 4NRXB 2QADB 3TT1H 5JNYB 1ZT1A 3EOBA 4YC2C 3T1FB 1T0NA 2XWBA 2BOCB 1OQXA 1PG7W 4M9OA 2D03L 5CUSL 5I71C 4CVZA 2NY6C 5GS0C 1NC2B 3W39B 4DZ8B 4P46B 4EKXA 3RI5F 1NGZB 4P4RB 4R0LC 5L8KB 3TF7A 3HE6A 4U1HA 4JZJC 3EYQD 5GGTA 4KJQC 3BP4B 5CP7A 1UACH 2R4RL 1KN4H 15C8L 4JM2A 3L3IA 3GK8L 3KS0H 4M1GH 1WVZA 4DQOL 3VGBA 1HHKB 3V4VL 3RNKB 5INCB 4X99B 3TPKA 3IU4L 3S88H 5DA4A 1A64A 2SEBA 4RWHA 3PP4H 3DXAD 4ZXBC 1G9ML 1FFQA 2GKIA 2YD7A 3OHXB 2JE8A 3D9AL 4RGMB 1AH1A 2MPAL 3T65B 4LKCA 1EO8L 3TO2B 4ZG1A 1FL6B 2CLRA 1HYSC 1QHPA 4XVUD 3VFWA 4PRIB 4YAQB 2UWEB 1YC7A 1XGTA 3AFLA 2QQLL 3VCLA 1X6NA 5GGUB 5IKCA 1INDH 3TVMB 4WW2B 2NNAB 1RURL 4MD5B 1K8IB 3B9DA 2VISA 2R1XA 4K3JH 4MWFB 1VACB 1N3NB 5MI0C 4YQXH 3ULVC 1I9RL 1CDJA 4IOFD 1EXUB 1R5IA 1YEIL 4JLRB 5IR1B 4G8IA 5K9JL 2VQUA 2VXUL 1MFCL 5GS0D 2Z31D 3MUGA 4S1QL 2PW1B 4ONGH 4J12A 4RISL 1QLFB 3DXAE 2R69L 1RUAH 5DC0A 3OAZH 5EZLA 4F58H 1RZFH 5KVFL 5BZDB 4N0CA 1CGSL 3MA7B 3D85A 4IM8A 3T08A 2YR3A 2DMCA 3ME0A 2D7TH 3P4MA 3PHSA 4XGZA 1FYTB 4JDZA 3EOAA 4ZNEE 4QF1B 4YZFF 1TTFA 5F7EH 3TH3T 4L8CB 25C8H 3QWQB 1AIFB 1AY1H 5EBLA 3UBXB 4XNMA 5EU5B 1GVIA 5D1QB 1FH5H 2KBGA 1YNLH 3CX5J 3RVXC 4DVBB 5LBSL 3MBEB 2VZVA 3MR9A 5IB3B 2DQHH 3F12B 1SY6A 1XZ0B 5GS1C 2OQJB 1CFQB 4JPIB 1AD9A 2VQ1B 3R4DA 4L8BB 3QQ9D 2G5BB 3LHPL 4RAUA 4EN3B 1FFNB 4Q6IA 4XTRC 2CRIA 4ORGB 2OLDA 4NBYB 5C3TA 1ADQL 1DQTA 3BZDA 4JR9L 4IIQA 3W5NA 1JZ3A 1LILA 5FF6A 1ND0B 5ADOH 5DJAA 1IM9A 1DBAH 4U05A 1HEZA 5DJ0B 5BXFB 2HFEB 5BCAA 5C8JB 3I6GB 4QRRD 1UCBL 4GO6B 5JHLH 1ONQB 3LKQB 5D2LF 4ZDHA 2OTWB 1GIGL 3VRIA 1OAKH 1TZGL 3NIFE 3QA3A 1K6QL 5HYSB 4DN3L 4K94L 5C0DA 2ATKB 5GZNC 5LJYH 5FGSA 2ADJA 2I9TA 1U3JA 4XNZB 3AROA 1I1AC 1HINH 1FCGA 2MFNA 2H6PA 4HPOL 4L9LC 3MO1A 5IEKA 4U3HA 2D9CA 1G7QA 3V6FA 4OD1L 3QXUA 4HGWB 3P9MA 3BUYB 3RWEB 5D7IF 1KIPA 4XRCA 3RVXD 3ECBA 4CVXB 3K2UH 5J6HB 2NY2D 1ROWA 4Y5YB 3CZFB 3KPQA 3WSQL 4PJAF 3RX8A 2XZQL 4R9HA 3SDDC 2B0SL 4O2CA 2VXQL 1QYGH 2X4NA 1W8NA 4ZFOL 5CKGA 5E9DB 3MX0A 3GIVA 2IQ9L 3JWOC 3S35X 3C6LC 4PYHA 1UEYA 3BQUD 1NANI 1EFQA 1DEEA 1VEPA 4QRRE 3Q6FB 1RHFA 5TH2B 1RZKC 4XTRD 4OQTA 1BZ7A 1T03H 3SE8H 4P2QA 4U1LA 5JIHA 3DX6A 5J3HD 3G6DH 4H1LB 3CMOL 5TDNA 3OXRB 3L7FA 1OVZA 4QHUA 1LP9E 3DI3B 5DTFB 4MJ4A 3VRJB 3PQYA 1FVEA 1S7TA 1EAPA 4MQ7A 5FO7A 4URTB 1CD1A 4R96A 2Z91B 2ENSA 3QDJD 3T2QA 2VH5L 4EDWL 3M45A 1P7KB 1S78C 1Q0XL 4NWTL 43CAB 5KOVC 4NCC1 2I9LA 1KCSH 4XB8A 2ICES 3G6JB 5DDHA 5F70A 4DN4L 2CMRL 3ETBF 3EYUL 4X83A 5C0NC 2V7HB 3MCKA 2ID5A 3FAWA 4Z7NF 4ODXA 5I2IA 5IJVA 3L9RB 1G0YR 5EO9A 2NY0B 4V3DB 1TMCA 5JPMA 1TLKA 4YBLC 6FABL 3E6FA 5C7XH 4KXZH 3BFOA 3IXAB 3LCYA 1M6OB 3BDBA 4FMFA 1JPFA 4PGCA 2ITDB 3B4NA 1M7XA 3D3VA 1CTOA 2W1NA 3BDXA 3S34H 3OMZA 3L3KA 1YPZB 1ZHLA 1XF2B 1BQUA 1TETL 4F7MB 2K7PA 1PYWA 4UT6H 3U9UB 3IXTA 2R2CA 5L7XL 3VXTA 3QZWB 4YFEA 4NQDA 2D4FA 5IK3A 4HEME 4CRPA 2X1QA 3C09B 3VFVB 1QSFD 3VGAB 1IILE 3QDJE 5MERB 4EQ3A 1RMFH 3UDWA 1HKLH 2XQYG 3F7VA 5TE7H 3E3QA 4YWGH 3DURA 1U8IA 2ZOKA 5DC9B 2J8UE 3EYSH 5DD5L 4E5XA 3EFFB 2DWEA 2B1HH 2E5EA 1JRHI 1U92A 4PJ9D 3QRFM 4F9LA 2JJSC 1QRND 4NRYB 4F57H 3O6FB 2QQKL 1HWHB 3WO4C 3FN0H 4YEFA 1AHWB 2XWJA 3D39E 1JTPA 1CTNA 3QNYA 4UT9L 4YDKH 1H8SA 1J0KA 1L0QA 3IFPA 4R26H 1T0MB 2WBJA 2Y9RT 1JI1A 4UV4L 2D0GA 4WDIA 4NBZB 2UYLB 5C0ND 3V5HB 5F3BB 5GGSY 1WZ1H 4OB5H 1KTDA 4LSUL 5EU4B 1NGWB 2I07A 4ZD3H 4QHNA 2ZCLH 4WUUB 2ZUXA 5DJXB 1D5BA 4PJFA 2DB8A 2CQVA 3CPLB 5MEND 3IDIA 4ONHB 2CKBB 3RGVD 4GBXC 4KQ4H 4WHDA 4HGMA 1QSFE 4FFWC 4B53A 4HWZA 2H2SC 4PR5B 4MJ6B 2EDXA 3DRQA 1AGFB 1PZUB 5I74C 1FRGL 1PAMA 1BJ8A 2EDTA 3CK0L 2WQRA 3SKMB 3ZKQD 3UZEA 2D9QB 4LSRH 1FV1A 4JREC 5F89A 5IROC 3FTGB 3TH2T 2HVKA 4EUPA 1CBVL 2IPKA 3O45B 4JO3L 2Z0BA 1FPTL 2BNUA 4S1SH 4HZAA 1SBBA 4RMVA 1MJ8H 2LU4A 1BREA 1QRNE 4LAJH 1XT5A 5IHZB 2CR3A 5FDWA 3O4LA 3MRPB 1NEZG 4HT1H 5CGYC 5KVMC 2A38A 4F3FB 2E7LE 3KPRA 3QDGB 3L3HA 4H25A 1ZT1B 2FBJL 3EOBB 1T0NB 2HRPL 1LDSA 3DV6A 1G0DA 2QQNH 2VZUA 5HHOA 3EBAA 1S7WA 3E2HB 3DX9A 4WO4C 3HE6B 4U1HB 4F7PA 3VXPA 2Q76A 3GJEA 5MENE 3LZFL 1OPGH 5CP7B 4FQXB 2DD8H 4KV5E 3WNMA 4JM2B 3L3IB 3VGHA 5ENWA 1VFAA 3CFBA 4HPYH 2NY7H 1ZLVK 1RVFL 3D6GA 1NBQA 1WBZB 4WHYG 4N0UA 5HPMB 5HDBE 4JAMB 4MAYC 4H0GA 1KB5L 4PJCA 2Q8AH 4PJ5D 3WS6A 3VFPA 1CVSC 2BNRA 4LKCB 1KLGA 4U6XA 4ZYKA 2CLRB 2NY5C 5I1EH 3IAPA 3SE4A 5E99H 4IDLA 4OZGF 3U7YH 5I1KH 5D7SH 4RRPA 1XGTB 1PG7L 1MI5D 1OW0C 1LO5A 3QQ4B 4MB5A 5EA0H 5IKCB 4OM1L 5I18L 2UZIL 2VXSL 3FO2A 1CDGA 3RWGA 5IHLB 3CFIC 2VISB 1WF5A 1N7MH 2R1XB 3TJHC 4WEBH 4K8RH 3C8HA 5E6YA 3C5SA 4LPWA 5C0BA 2CK2A 5C08A 1A7RL 5JMRA 4PUBL 4XPHL 4G8IB 3PHOA 1SBSL 3TA3C 2BOBA 1R3HA 4ZSOE 3MUGB 5IESH 2EE9A 4GKNA 4ZAKA 4WTZG 1QFHA 1H15A 2ZUTA 1XIWC 2APFA 1OTUC 2X42A 1YYLH 4PJ5E 5EZLB 2OTPA 3LSOA 2VDQL 1RY7B 3JUYA 1T1WA 2XQBH 4MNGE 3DYMA 2CDFA 4BH8A 1WWAX 2DS4A 4KY1L 4NCDA 5IBLC 1WZMA 3P4MB 4JVPA 5CBAA 4XGZB 4JDZB 4OZIA 3SDCA 3GDBA 2VMFA 3BZEA 8CGTA 5F7NC 3GSNL 1YY8A 2VOTA 4MAYD 1ZANL 4JGMA 4XNMB 2NY1B 3WJLC 3WFHA 3MXVH 1MI5E 3LEVH 4R3SA 3ULUF 4ZODA 3MR9B 2DYPA 1INEL 3VXSE 1K85A 3BXNA 2BERA 2DM4A 3DV4A 1MQ8A 5I17A 2YOCA 3PGCB 3BRDA 4K3EL 1CGXA 1X5FA 4ELMA 4OJFH 1CL7L 1BM3L 4HUUA 3T0AA 2CK0H 1GGIL 1BZQK 1JYXA 4RAUB 3SGEH 4NN6B 3PABA 2VDNH 3EYFA 3BO8A 3U4EA 1SM3H 3WKNA 1JL8A 4Q6IB 2M2DA 5IEHA 1MLCB 2H32A 1YNKH 2ICWA 4IIQB 4Q9CA 5FF6B 1UWGH 4OZHB 5DJAB 4UOW1 1IM9B 4TSBL 3TJHD 4OIIH 1G0XA 1LNUA 4M6ML 2WZPD 4MS8A 1MQKL 1HQ4B 2EC9T 1HEZB 2AEWA 4NM4H 1QLEH 5IB4A 5I15H 4MLSA 1JF5A 1NAMB 1G1YA 1ITBB 2XKUA 4M7ZC 1QTYT 2XN9D 1P2CB 4ZDHB 4AIZB 3ROOB 3VRIB 4NQEB 3MLRL 3DX8B 3TFKC 4ELKA 5TE4H 1XR8A 3BGFC 4OCWH 5IHUH 4IRJA 1D5IH 5C0DB 4FQCL 3CFDA 2AXFB 1LMKA 2OL3L 3BI9X 2ADJB 2I9TB 4G6MH 2J3SA 2H6PB 3IFOA 3MO1B 4IRSC 1JZ8A 1H0DA 2HVJA 1G7QB 3RKPA 3V6FB 2OR8A 4AH2B 1C8PA 4XWGH 3P9MB 4JKLA 4JFDD 4BK5A 1KIPB 5DJ6B 2ZUYA 2AJUL 4GXVL 4HKXA 3ECBB 4FABL 1TIUA 4Q0XH 1YEGH 1RFDH 4MHHI 1GXEA 4WCYL 5KVDL 2HA1A 3WFEL 4JG0L 5BVJA 4O2CB 5HY9A 1RU9L 4PJBF 2X4NB 2DQUH 1QP1A 3PG2A 4OF8A 3GIVB 2HWZL 1J0YA 3UTZA 4PG2A 1NCWL 2HT3C 2DRUA 3LIZL 1DEEB 2Y6SC 4DEPC 4U33A 2AJ3B 5C92A 3VG9B 5KJRL 1BZ7B 2EC9U 3MJ9H 3BEVA 4FP8H 2XN9E 4U1LB 1JNJA 4W4NA 1Z9LA 5DK2A 1C5BL 4YK4C 3WHXA 4C58B 2CD0A 3L7FB 4OCYH 4QHUB 1YECH 2PNDA 3PQYB 1YNTA 1S7TB 3ZYIA 1EAPB 2NMSA 3MV8D 4MQ7B 4Y1AA 1IQDA 5FO7B 3Q3GA 3MNZA 3VD3A 3MRMA 1CD1B 4YHLL 4JB9H 4R96B 4C4KO 3ARGD 3KPOB 3TFKD 2JIXD 2IG2H 4R8WH 4D3CL 3OBAA 4QGTA 4EDXA 2E6QA 4JFDE 1MCKA 2I9LB 2FD6H 4PJFF 1AKJA 2NQCA 2ESVA 3VDAA 4WI2A 5I2IB 5IJVB 4XZUB 3VMNA 4AL8H 1JVKA 5EO9B 1TMCB 3HC4H 5DJZA 1N0XL 3LPGA 3E6FB 3IDMB 4D9LH 4UQ3A 1W72A 4YR6A 1EVTC 1ODAA 4FXKA 2G9HA 2DLGA 2BX5A 1JPFB 1AXTL 1FFPA 4P59H 3KLHC 2LTQC 3L3KB 4YHZH 1F4WH 1CFSA 1ZHLB 1AJ7H 5TDOB 5HYQA 2C4XA 4NOFA 1ZLSH 2Z8RA 1PYWB 4J6RL 2O5XL 3IXTB 1YEHL 4PS4L 3HR6A 4HF5H 2E6JA 3CXDH 4Y19A 1EZVX 2RCSH 3IT8D 3MV8E 4RGOL 3O41A 1OARL 5IK3B 4HZLB 4NSKA 1IRAY 1RZJH 2UUDK 4PJEE 4O5LL 5FUOL 3GIZH 2EE2A 3DURB 1WK0A 1U8IB 2ZOKB 2J8OA 2C1PA 3VGDA 4O2FA 1VSCA 3QDMD 3HE7A 1T6VN 2GJ6A 5I8CA 4E5XB 2Q8BL 2DWEB 1IQWH 3F58H 5E4EB 4ZS6D 4Z8FH 2WIMA 3QJHB 5L2JA 4RX4A 4KI5D 4Z5RA 3EAKA 3KNBA 5C0AA 1RI8A 1UADC 3QNYB 4FG6C 3IFPB 5LXGL 2WBJB 3GRWL 4I5BA 5A2FA 5HYFA 3NA9H 4XMPL 4WDIB 4OFYD 3K4AA 3VH8G 4IHOA 3HMWH 4WHTA 2Y25A 4KROB 3P4OA 4O02H 4AT6A 1ES0A 2I07B 4PRPD 5C0CB 4QHNB 3TZVC 5BS0A 4MVBC 2R0WL 3WN5A 5FKPA 4WTWA 3IDIB 1T21A 1O7VA 3HFMH 5JA8B 2BJMH 1NFIA 2YD1A 1XF3A 4U1SB 3KLHD 4WHCA 4HWZB 3DRQB 5J12C 2BSSA 2PXYA 5L9DH 1BIIA 3T8XA 1HIMH 1FV1B 3QDME 4EUPB 3S3JA 3QUKA 3BDYH 1VFBB 4G9DB 2EDWA 2VLKA 5T1MB 1Q72H 5I1CL 1MOEA 4YDLB 1B4RA 4KI5E 4YHPA 3FZUC 4JFFB 3MRHA 5DD0L 5FDWB 2A74A 3O4LB 4QXGH 5DQJA 2GY7B 4X4ZA 2VDPL 3RNQA 3L3HB 4H25B 2VKXA 4W68A 1G6RL 3EIFA 4PP8C 2IFFH 5EOCJ 3IU3B 2NY4C 3NCJL 4NZRL 5CD5C 5C6TH 2WP3O 3DTXA 5HHOB 5ICYB 1MCSA 4OZIF 4XCFH 4PRPE 4N90D 3DX9B 1Z9MA 1X44A 2E7HA 4F7PB 3CFEA 3RVUC 3VXPB 2Q76B 3GJEB 3LKRA 4PJGA 2AJSL 4UB0L 5CZKA 1TJGL 2VXVL 3UC0L 2LFGA 2BSRA 1OP9A 3B6SA 5J1AA 1C5CL 1N8ZA 1VFAB 2I5YL 5ENWB 1JZ5A 1KCVL 2MJWA 3CFBB 4Y4HA 4HXBL 4R6UA 4JFED 1JPTH 5HI5C 3QIWC 4ELMF 2DQEH 3AM8C 5E8DH 5FHBL 4TUKH 2EIZA 1A6WH 4PJCB 3WS3B 5BW7A 1J1XL 5DHVA 4EVNA 4P2OC 1UT9A 1EV2E 1FVDA 3F5WB 4U6XB 4ZYKB 1WT5C 1ZVHA 4RMWA 5D93B 3ISWA 1U8HA 3QWRA 3I3DA 1NGPL 3L5IA 2HKFH 1U41A 4H8WH 4EQ2A 1LO5B 1S7RA 1FVCB 2FLRT 2ZKHH 2QL1A 3O3UN 3QAZC 3P4NB 3SGEI 3V4UL 4EZMA 4X4YB 3RWGB 4NHUB 1UWXH 3GFUA 4F33A 4N90E 5IVZA 1T7YA 1GPOH 1UG9A 2YPVL 5AUMA 4CGTA 1UB6B 3C5SB 3ARRA 5C08B 4LVNB 3NH7H 3PHOB 1U8QA 3CVIH 4QOKD 2BOBB 3MA9L 4J1UB 1R3HB 4NUGH 4JFEE 4GKNB 4ZAKB 4LCUA 3MODL 4XNYL 5A2LH 4OZFA 4HBCL 2FO1A 4LPTA 3LSOB 2YWYA 4M5ZH 3SCMD 4GLRI 1MIML 1JJUA 3RGHA 1T1WB 1IBGL 4YBQC 2VDOL 2CDFB 2CKBH 1L6XA 3QCUH 3QPQD 4XPTL 5CZXC 3WIHL 2VN7A 5CBAB 1L7TH 2MQ0A 3SDCB 1C12B 1IAIM 5HI5D 3BZEB 3QIWD 3SDYL 5A2IH 1YY8B 3GMMA 1A7PL 4X80H 4WV1C 4WIQA 2Z9TA 3WFHB 3BP5A 4N8PA 4OGAC 4X5LA 1F45A 4U0RB 2EIEA 4R3SB 2P5WA 4BYHA 2R4SL 3S4SG 3PHQA 5KS9E 1ZSDA 3DV4B 5I17B 3RFZC 3DO3A 1JK8A 4ZFGH 1EJ6A 1IGIH 4I0PA 1G7MA 3CIQA 2LU3A 4I1NB 3MLSH 4HUUB 5L8JB 1D9KC 3QCTH 4ALAH 1JBJA 3PABB 4XCCH 3EYFB 3BO8B 4IS6A 3U4EB 3CX2A 5IEHB 3QFJD 3OB8A 1MCCA 4RQQA 4PJ7F 2ICWB 4M4RA 3TCXA 3B9EA 3SDXA 4QOKE 5B38A 4UIKL 5GRUH 4G7YL 5I8EA 1IKFH 1LNUB 5IOPA 1YYMH 4GKSB 5KSBF 4AEIH 5IB4B 3O6LL 1R3JA 3ESUF 3D69A 5DD6A 1LO3L 2DQGH 3QEGL 3GHEL 3KYMA 1NLBH 3LOWA 4ORZC 5B3JF 1S9KC 1MCOH 3N0PB 3EDJA 5DXWA 2R29L 1J8HD 1T04A 1PKOA 3BH8A 1IE5A 4ELKB 4KVNL 1F97A 3O9WA 1XR8B 5I30L 3QT2A 4P23C 3SGJC 2EH8L 4FQ1H 4IRJB 3UTTD 3CFDB 1WAAA 4MXVF 3MLUL 1S9WB 4YBQD 3MXWH 3HC0A 4HH8A 1G9MC 5GRVK 3VDBA 4JKPH 3GKZA 1NCUA 1I85C 3IFOB 1IT9H 4ONFH 2QHRH 1H0DB 4P2YA 2HVJB 3VRLE 4ZO8A 1DE4A 3O8XD 4NQTA 1GC1H 3FO0L 3LQAC 1BD2D 3U4AA 5CZVL 4LHUA 4HJJL 4HKXB 1IGMH 3BMWA 3L3GA 3QFJE 3WUZA 2E8YA 3G5ZA 1ZHKA 2R15A 1REIA 5DMGC 5HY9B 3PP3K 5HHVL 5SX5K 1JPGA 2DKUA 5GGQH 1MFBL 2P5EE 1A6PA 1EJOH 1JGDA 4GXUM 4PB0L 5LQBH 1DVFC 2P7TA 4OLXL 4CJ1A 5D7JA 1TITA 2Z8SA 4PGBA 3BEVB 4Y89A 3N85H 2X5PA 3BKYL 3BP7A 4MXWH 3RL2A 1J8HE 2BNQD 4R4FH 3WHXB 1S7SA 2E3VA 1BP3B 4F37F 1HZHH 3UTTE 4HMDA 4JFHD 1H3UA 5CAYB 2IPUG 1YNTB 3JUZA 4JRYD 4LASH 2CXGA 4YDVA 3Q3GB 3MNZB 3MRMB 5DVLA 3W9DB 2HN7A 3C5ZB 1WFUA 4HLZH 1OLZA 5SWSA 3CLEH 3T0ED 1QNZL 3RVWD 5EU7C 4EDXB 4LARH 4GMTH 3FOLB 4HCRH 1BD2E 5I1IL 1JFMA 1AKJB 3REWB 1QFWI 3H9HA 1G6VK 1IC1A 2ESVB 2DQCL 3AREB 1U42A 3OR6A 4I18A 5HGBA 3RTQC 2ERJB 1HILA 2DLEA 3H0TA 1XGYH 3KR3H 4HJ0D 1A7NL 5DJZB 3W0WD 1UWEH 5T5FL 4G9FB 4YHNA 3X12A 4BH7A 2E27H 4NP4H 1XCQA 4YR6B 4FXKB 2G9HB 2X9YA 2YXMA 2F54A 5L2KA 4HC1A 5TQ0H 4APQD 4MMZC 1BQHG 2FZ3A 2BNQE 4MZ2A 4JY5H 2FGWL 3I50L 5IB5A 4EXPX 1N0LA 5HYQB 5AEAA 1CXFA 2PTUA 5K9OA 5DUML 1DVFD 4JFHE 4MDIB 3GSXB 4G7VH 4JRYE 2F5AH 3MRGB 4Y19B 1H5BC 5D5ME 1L7IH 4LIQL 1WTGT 5D6DC 3O41B 4JCLA 3VXUD 2H9GA 1V7NL 1NAMH 1B0WA 4WI8A 3HNSH 5JQ6L 1FG9C 1F6FB 1BFVL 4ZFFA 3T0EE 2IBZX 3P11H 2YUXA 2B1AL 2C1PB 3VGFA 4O2FB 3HE7B 1CF8H 2GJ6B 3U46B 3ARUA 1KC5H 1C7TA 5BV7H 5I8CB 1YN7B 2IADA 1U2HA 3OAZK 5E5MA 5DWUL 4K94C 1R3LA 5D7LD 2VE6A 3C08H 4IOSD 4Z5RB 3W0WE 3BJ91 3KNBB 5C0AB 1MFEH 2DICA 1NMAH 1OAUL 1UZ8B 3UYRL 5I1LA 3TNMA 1L4IA 4A6YA 4I5BB 2NXYC 4XP4L 5JHDD 3EO1A 3HI6L 2EDLA 1WITA 5IFHL 1KYOK 1A9BA 3ZO0A 2QKIA 4TOYH 4IHOB 4KJWD 4WHTB 1E4KC 2CXKA 4G43B 2XFXA 3P4OB 3CH1A 4P2RD 4AT6B 2B20A 2V5SA 4N8CL 5FGBA 2L7UA 2P44B 4I48A 3ARDA 5BS0B 4YZFE 4I77L 4FA8A 2HLAA 1FORH 3WN5B 1A9EA 2VSCA 3LS5H 4J3UA 3NACH 1ULVA 3ESVF 2DI9A 2N4IA 1S3KH 1AXIB 2AV1A 1CZ8H 1NFIB 5IIEA 3VXUE 1OAXL 1XF3B 4R97B 1SYVB 5CJBA 2KDGA 4LSSL 1ZHNA 1K2DA 5IVXA 3ZTJH 3IJYA 1OAZH 4KRMB 1BIIB 3T8XB 1RIVL 5DGQA 4ZQKA 1UKSA 3WKMH 1AO7D 2JJVA 3QUKB 2VLKB 1MWAB 3NZHL 1MHHA 5SWQA 3NPSB 2NXZC 4YHPB 5EULV 3MRHB 3QEQB 1SVZA 2A74B 1U9KA 5DQJB 1FL3A 5T1KA 1PGRB 3RNQB 5JHDE 4UQ2A 1IAKA 4WWKB 2R1YB 2AQ1A 3DJ9A 5ALBH 4PJHE 3MLZL 1NAKH 1UH4A 4JEGB 3VFUA 2VC2H 3H3BC 5D2LE 2WUBL 4Z7UF 3W5MA 3DTXB 4P2RE 4ZPVA 1JWSA 2J5LB 5T5NG 3X11A 4ODVH 4OGXH 3RUGA 3V52H 4JFQA 3CFEB 3WFBL 1IZKA 3OGOE 3LKRB 2PUQT 4PJGB 1MCJA 2E7MA 4QXUH 1A2YA 1AXSA 5ACMA 3S36X 3CSPA 2WM0A 1VHPA 2R8SL 1BWMA 2BSRB 3B6SB 4LLYA 3CVHH 3IF1A 5J1AB 1LEKB 4Y4HB 2ZUVA 4JJHA 5F7MC 1AO7E 5EUOF 5JQHC 2EIZB 5EBMA 1B0RA 2W9EL 4LRNL 5D7IE 5DHVB 4EVNB 5HVHB 4QKXB 2DMBA 5T3ZH 1JHTA 1KXTB 5JW4Q 1CDCA 3BPNB 3WMSA 4PJAE 3BRGC 2QSCH 3SDXF 4UOJA 2D0HA 1KJMA 3E8UH 4C83A 5HHPA 3V6OA 5GHWH 1U8HB 4LCIH 4FFYH 1TNNA 1JHKH 4KDTA 4TVPD 5CIPB 4NKIL 2NZ9C 4LDEB 1S7RB 5I9QC 1WUNT 5C2BH 4LFHG 1TFHA 5EFIA 2NXZD 1S5HA 3SOBH 1FAIH 4F33B 3ZKXB 5AUMB 4G6AC 5CINL 3VFSB 4D9QD 1I1RA 5C07D 1OB1B 1WAAF 4TVPL 4JO2L 1T89A 4UNTA 3FB5A 4JN2A 3RZCC 1J1PH 1LHZA 1U8QB 3SKOA 4Y5XA 4BSJA 4OGYH 3DGGB 5KSUA 2YKLL 5C0JA 1EUUA 3UTSD 1ZT4A 1CK0H 4OF3A 4ETYA 5J56B 4JHAL 4U1NA 3TO4C 2XZAH 1BQSA 1VERA 1FLTX 3CFCH 1IAOA 4OZFB 1U8JA 2IBGA 1D7FA 4JY6A 4FNLH 3LKOA 3OB0H 4N0FA 3EJZC 1YUHA 5JW4R 3S9DB 3QQNA 5IUSA 3BPCA 5C6WH 4Z7NE 1RUKL 4X98A 5FYLL 1OAYL 1KEGL 3GMMB 5E08L 4GKZA 1O5DT 2X4PA 3BP5B 4TVPE 5DLML 3ILPB 5FCSH 2P5WB 5FKAB 1MPAL 3PHQB 2X1PA 1JPSL 5GGTL 4MGXA 3RHWF 3FN9A 1JK8B 9CGTA 2XTJB 1G7MB 3X17A 3BH9A 2V9TA 1JE6A 1QD0A 3SGKA 1GAFL 4E41D 2NZ9D 5C07E 4K7PY 1NBZA 4IS6B 3G9VA 2R0KL 3CSBA 3PWNA 1BF8A 5B8CC 3SBWA 5I8EB 3UTSE 4LFHD 5IOPB 3KPLA 4WNQA 3VWKA 2PYFA 5HBBA 2B7DT 3SDAD 3VWJC 4CNIA 4F7TA 4PTTA 4CAGA 3D69B 1FGNH 5DD6B 4BELD 3M1BB 3UAJC 2K3TA 1CDYA 2OR9L 3WIFB 2IFGA 1EVUA 3OL2A 1MAMH 3MRNA 2DQDH 2W9LA 1T04B 4YHML 4MSWA 3I85A 1JGLL 1WWBX 2FLBT 4XXDA 2C26A 1YMMD 3TPUB 5DMJB 3TO4D 3O9WB 4LU5H 4B0MM 5ICXB 3LRHA 4MXQD 5HSFA 3EJZD 1CU4H 1VADA 4N0YH 5DRZA 5E6ID 2M8XA 5IP4A 2AJXL 3OSKA 1MEXH 3O2VH 2E9JA 1RUMH 4KTEH 3H7BA 1DE4B 4GOSA 2BHZA 3D18B 4E41E 2GTWB 1IGFL 4LHUB 3WUWA 3V79C 1JF1A 3L3GB 4LGRB 2HTLC 5I1AA 2DIJA 3G5ZB 1ZHKB 1WFOA 1CE1H 3MACH 4XMKL 3DXAA 4UT7L 3U0TA 4C56E 3QUYC 5FK9A 1UA6H 1JYNA 3JWNC 3VFRA 5ADPH 1JGDB 2W07A 2P7TB 5D7JB 1RZ8A 1WCBA 2OS7A 3REVA 3BP7B 4ZNEA 1FYHB 2X2YA 3RL2B 2V5RA 2CIKA 4GRLC 3N06B 4LPUA 1MNUH 1YMME 5JUEH 4MAUH 5GISH 2FX9H 1HHGB 2BMKB 2JB5L 1KN4L 2AQ2A 5E24E 2YZ1A 4EJ1C 3AB0B 3SQOL 3PDOA 3UAJD 1U8OA 4FQPA 2AAVA 2HN7B 2XKNB 4PD4J 5SWSB 2A77H 2AK1H 5ALCH 3BESR 2X4RA 1R3IL 1NGXA 5TPWH 1RIHL 5BO1H 3A67L 1V5JA 2PTTA 1EEYA 2Z31A 5HGBB 3TIDB 1Z9OA 4EI5C 1YA5A 1HILB 3H0TB 5FIEA 3F7YA 1FZOB 5C09D 3PGDB 5IB1A 3NA4A 3MRRA 3OPZH 4S10A 1JNNH 4QNPF 4UTBH 5CEZD 3X12B 4YHNB 1UCTA 4BH7B 4TNWK 2P8PA 2Y5TA 1XCQB 4NM8H 3WLWD 3MNWB 2HTLD 1CLOH 2F54B 4DGYH 5L2KB 3KHQA 4YQXL 5H2BA 5F1KC 4O9HH 1RIUL 3N1GC 2R39A 3S7GA 5IB5B 3S36L 2ZJSH 1VPOL 2DJUA 5K9OB 2DI8A 1RUPL 1T7VA 2J6EA 1QFOA 3P30H 1XAUA 5CEZL 4OZGE 2EDHA 3Q6GL 1T5WB 2ORBL 4G5ZL 4HUXA 2H9GB 4ODTH 5SWZD 2Q1EA 4KKAD 5E03A 3AY4A 1Q0YL 2MCG1 4ZMAT 3C8DA 2PYED 4ZFFB 1QA9A 2VABA 3IS1X 4DKAA 5C0GA 2D7TL 5I6XB 1DJSA 2EDDA 5DZOA 5F7EL 2EKSB 3G6AA 3C2AL 1FJ1A 3ULUL 2VE6B 5C09E 4OQTL 3ARFA 3U4BH 2GY5A 3ZE1F 5CEZE 4QRRA 5JTWA 3MJ8A 5I1LB 3TNMB 3UZVB 3RIFF 4Y2DD 1T1ZA 3PE9A 3EO1B 3MNVA 1A9BB 5FOJA 1KJ2B 1JIBA 2ICEA 2BRRL 1FNHA 3L3JB 2XFXB 4PJDB 3CH1B 4OIAA 5TDPA 4N9GA 1LP9A 4JQXA 2G75B 3ARDB 3BPLC 2B2XL 2DQJH 1VGEL 2HLAB 1F8TH 1GOGA 4RFOH 3F62A 2KZ1B 3EW3B 3DSFH 4H88H 3JWOH 4LVOB 4TNVF 5IIEB 5SWZE 1MHPL 1DBAL 2PO6B 3P4LA 4Y4FD 1T22B 3B5TA 3UTQA 3IFLL 4XNQA 4CVUA 2ZZUT 4KQ3H 5BRZD 5IVXB 1D3CA 2PYEE 2BP3A 2GT9A 5IMLB 3IJYB 3T0VA 1F2QA 5DRWA 2FNBA 4ODBD 4NDMB 4ZQKB 3D5OF 1W0WB 4U6VH 1CWVA 4Z0BH 2BY1A 1T7XA 1T5XA 2AS5M 1YQ2A 2Y72A 2N7AA 1MHHB 4LCCA 4DZBA 4KKBD 5SWQB 4D2NA 4OD3L 1FGVL 3BQUA 2XICA 3VXOB 4X6BA 2DL9A 1HINL 5T1KB 2VQTA 4UQ2B 5HVGB 3HI5H 5HDLA 3U7WH 3VFUB 5I1GL 1DQQA 3ARBD 3MLYL 5KVGL 5CMAA 1QPXA 1JWSB 2DM3A 2J4WH 4JM4L 2F5BL 3X11B 2BSTA 4M7LH 5HGHA 3RUGB 4JFQB 3VFOA 1A2YB 4RWYL 3QDJA 1C16A 5HYJE 4A2MA 4C57C 4LLYB 3IF1B 3M8OH 3P40A 3VJ6A 5BRZE 1DQLH 3AMLA 2J8UA 1WFNA 5FHAL 1FZMA 1N4XL 2DTML 5EBMB 4UOW0 1B0RB 1QBML 1EO7A 4R7NB 4IDJL 3B2VH 1LE5A 4DKEL 3WXVH 1S9XA 1JHTB 5LAXA 3EJYC 4OCRL 5F9WB 3D39A 1DCLA 1KJMB 4C83B 4PJBE 5HHPB 3NFSL 1RZIB 3KS0J 3AUVA 4K2UL 4POZD 4P3CH 4U1IA 3VMPA 3O2WH 2NY3C 4OT1H 5D70H 5TQ2L 2FX8H 4YJZL 3CXHK 3EO0A 5HHXL 5HHMD 2YXFA 5KOMC 5EFIB 1S5HB 4LVHC 2YPLE 1V3KA 2JELH 5EC1A 2ZUQC 2CGRH 1FP5A 1IGYB 2AK4E 2FATH 5FGCB 3JVGC 1QSFA 1TTGA 2WBWB 2FX7H 3I6KA 2OJZH 2KPNA 4G6JL 3FB5B 1HHHB 4YE4H 1M05B 2QSTA 3SKOB 1WIUA 4GW5A 4Y5XB 2BDNL 1AP2B 5KSUB 3P2TA 3GKWL 3MRKB 5C0JB 1ZT4B 1NUDA 2M26A 4U1NB 5IBUB 1IAOB 5I16A 3RKDC 4PJ9A 4DKFH 3KLSA 5IMOA 5ICZA 4JY6B 1QRNA 1KCRH 4M61A 4J3XA 3MRJA 3SKJL 5GSVA 4N0FB 4BA8A 1YUHB 1B2WH 5DJ2B 4JN1H 1F4XL 5TGBA 1F4YH 3BPCB 3ARYA 5JIKA 1KG0A 2E7LA 1WISA 3WLBA 3FL7A 4UV7L 3OJVC 4F80A 2WUCH 2HT2C 4GKZB 5TF1H 2X6MA 4BK4A 5J13B 4L3ED 1FSKB 1HKLL 3BGAA 5JPNA 3ZKMC 5HHME 5F8RC 3QRGH 1MWAH 3SHSA 4NKQB 4Q9RL 1YJDC 1ZS8A 2C4FT 5MENA 4HJGA 4GMSL 4PGDA 5F6HJ 3RGVA 2K1MA 4A2LA 1NBZB 4KZEH 4UUJA 4PY8I 2IPTH 5ID1A 2CO7B 2Y4SA 2VDKH 5C0FA 3SE3A 4S0TD 4NZDA 4PRHD 3O6KH 4X9GA 3QH3A 3RA7L 5D72H 3KPLB 4WNQB 2EIDA 3VWKB 4OB5L 2PYFB 2EYTB 4CNIB 4F7TB 4PTTB 5E1HB 3FQTA 3D0LA 4HX1A 1TVBA 5FV1L 1QQDA 1JWUB 2ZCLL 5D96B 3MRNB 2FEEI 2XYCA 2HT4C 4JVUA 4ZS7H 4I4WA 4MSWB 4XXDB 3UJTL 1R5WA 1MFAH 4IOIB 3RQ3A 4NIKB 4QGYA 4GAGL 1D6VL 2OI9C 5F96L 2JJUA 4L3EE 4Z7OF 1DLFH 1VADB 5L88H 1J1OL 4Z7WB 1PX4A 4M43H 1HI6B 5DRZB 4U1GB 5KSAD 1K9TA 3T2NL 1RJCA 3PL6D 1QR4A 2YSSA 3EOTL 1JV5A 5I0ZA 1M7IA 2C4FU 4HIJA 1TJIH 4OV5A 4JGUA 1EFXD 2VUYA 3WUWB 3ZDXF 2AGJH 1JF1B 5F97E 1ETZA 5DRNB 5I1AB 5I8OH 4ZSOA 5CIPH 3BD4A 2LU7A 4PRHE 5CLTA 4KGLA 1FBIH 1S9VA 2F53B 3DXAB 3U0TB 2WLZA 2MCPH 4PJ5A 4JPVL 3VFRB 4N5ED 2BVQA 1A21A 3Q1SH 5FDYA 5T1LD 1UM5H 1W0VB 2ICWI 4MNGA 5GS3A 1RZ8B 2LV4A 3KXFD 2ZG3A 4X6DF 3REVB 1R6VA 4QT5A 1DL7H 2CIKB 4LSTH 1FO0H 1HHIA 4KK9C 3ULVF 1I9IH 2NW2B 3V5KA 1MI5A 1MHCA 5EOQL 2EH7H 1QACA 4HXAL 4BKLA 1OLLA 3DBXA 3PDOB 3VXSA 4HPYL 3OJDA 4IJ3C 2R0LH 1U8OB 1OSZA 3L3DA 3B43A 1Q9LA 4K7PL 3T0XA 2JLLA 3BPOC 5CJQH 2DI7A 3JSSA 5F9OL 3MCG1 2QR0A 4AG4H 2QADC 4HIHA 1NGXB 4PRDA 4TYUA 1A6AB 4QWWC 2EDQA 2PTTB 1EEYB 4K8RD 2Z31B 3LV3B 4FHBD 4P46C 2V5MA 3F7YB 4KHTL 1RD6A 4RSVA 5IB1B 3VXMD 3OAYH 3MRRB 2Y5TB 3LN5A 4MA3A 5F8QC 5IGXH 3KXFE 3FCTB 4OM0L 5JMOC 1KELH 3MC0A 5EU3A 3D0VA 1B6DA 4DUXA 1I3GH 2XZCH 4MAYA 1C1EL 1WBYA 1CGWA 2BFVH 4RFEA 4RGMC 1MREH 1ZA6B 1KPUA 1KULA 3K74B 4JPKL 4HUXB 2APVA 5FECA 3G5YA 2W92A 3NGBB 1N5AA 1QO3B 1OQOA 1YYLL 1WSST 5CSZB 5D71H 3IDYB 3VFTA 4PG9A 1SYSA 4GQ9H 4CMHB 3R0NA 1QA9B 2VABB 3V8CA 3MRQA 3RJQB 5HHNA 5C0GB 3DVGA 3TVMC 1U6AH 4W81A 4WW2C 4WFGD 1UM4L 5KTEL 1DBKL 3TJHA 4RA0C 3S97C 1FJ1B 3QXWA 1NGYA 1J86A 3VXME 2G60H 3ARFB 1RZ7H 4QRRB 2Y07H 5IFAL 1T1ZB 2XN9A 1IMHC 3BP6A 3MNVB 1UXSA 1QBLH 3X13B 1QLRB 4OJFL 2ICEB 2C3VA 2CK0L 2YK1L 2VITA 5C1MB 5TDPB 4N9GB 1LP9B 4XPAH 4EOWL 4WTZA 1MRCL 3HG1D 2IAND 3IRZA 4MB3A 5FM4A 5DJ8A 3FHQA 3I9GH 5LGHL 4OIIL 5L8LB 3HZVA 1NMCB 1LO0H 1LWRA 5TFSL 1CICD 5E8PB 1A3LL 3HPLA 4QXWA 2IQAB 3A6CL 2HLFD 3BE1L 5FYKH 3TLRA 3WJLA 4JFDA 2GT9B 4XPBL 2X1OA 1P1ZA 2ZSVA 3OZ9H 5DRWB 5D1QC 3STLA 4FQHA 2WLYA 2NY2B 4PV8B 5HDOA 2X9XA 3UJJH 4AEHH 3MBEC 2A9NH 3IDXL 4YH6A 1NCBH 5DJCA 4WFGE 5E8NB 1T5XB 1W72L 4LCCB 4BQ8A 4DZBB 4PJ7E 5ELIA 4F7CA 1Y6MR 2VJXA 1B90A 3BQUB 4EN3C 4DTGH 4G6ML 3FO1B 4X6BB 4DK3A 4PRNB 3MLWL 4HIEA 2HKHL 5KSBE 3K8KA 1A0QH 2GSIA 4YEEA 4XNXH 1DSFH 5E2WL 3FOMA 3HR5B 2YMXL 4XWGL 1ZEAH 4DFHA 1DQQB 4OFVA 5B3JE 2BSED 1A7OH 5CMAB 3O0RH 3HG1E 2IANE 5F7DA 4JPWL 2BSTB 2KUTA 5HGHB 3MV8A 5MP6L 5GZOD 5ITBH 3ARGA 3TFKA 3NAAH 1YY9C 2JIXA 4MXVE 5EZJA 4J3VA 3IJSA 4PJEA 4PBWD 5JDJA 4QRPE 5HI3C 3VJ6B 4FQQA 3V0WH 3C6SA 4PV9A 2J8UB 4UTAL 4Z6AT 5C0RL 1FZMB 4ODHL 4HIXL 4XNZC 1DBMH 5D1XD 3IDJA 1FYTD 3RAJH 1LE5B 1EAJA 1S9XB 2GUOA 4LPCA 5LAXB 4F15B 5HYIA 5FCUH 3D39B 1CXLA 1RK1A 4CN6A 4D0DA 5CEYA 1ORSB 4PJXE 3G5XA 1OTTC 4OSUL 3B2UC 1SJHA 3MBED 2P46B 4Y5YC 3LN4A 3GHBH 3EO0B 5GPRA 1GYAA 2DQIL 1A14H 5KVEL 5FA3A 4Z77A 4HWBA 1YEEH 3A6BH 3NIDF 4EN3D 5FYJL 3LRGA 5EC1B 4KI1A 5DO2C 5EO0B 4PFEA 3T0BA 3CFJA 1GHFL 3DIFA 3T4AB 3UROR 4AL8L 4JO1L 1QSFB 1MFNA 4LRIC 3I6KB 3QI9D 4Q9QL 5GGVY 2NPLX 4HS6A 4OCLC 4GW5B 1FLRH 1KJ2H 1DBJL 4KMTH 1EGJA 3THML 4MYWB 5GRYA 3QDMA 2ZG2A 1LK2A 1U95A 2J12B 5I16B 3HZKB 4PJ9B 5IMOB 5ICZB 4M00A 1JGEA 1QRNB 3VI4F 4M61B 2EYRA 3MRJB 2AVGA 5GSVB 1S5IH 3PNWA 1KB9J 4UIMA 5DEGA 4Y8AA 1IKNA 5FO9A 1KG0B 1NBVH 5GRJL 3WLBB 2W59A 3DI2B 4OFYA 5HPOA 4UILH 1HE7A 1GGBH 4O58H 1KACB 1RZJL 3ZYOA 2DLHA 1IGTA 2NY0C 1MELA 4JY4B 4WWID 4R4BA 4PJ8B 3MLVL 2NZIA 4OFDA 4PRPA 1T80A 5E2UL 2X40A 4FFVC 4NC1C 2EKJA 5MENB 1X3DA 3I02A 4HJGB 5D1ZB 5I19H 4PGDB 5KSVA 3RGVB 5I1DA 5JW3L 1WFTA 3J7HA 1Y0LA 32C2A 4UUJB 4LQFH 3QUMA 5B38G 5C0FB 3VXNA 1M7DB 4YX2L 3GMRA 3QH3B 4LEXL 1N59A 1XCTA 1DQDH 3QO1A 1L6ZA 3HMWL 4JANA 1MJ7L 2X4UA 5FFLA 5K59F 3C09C 3VGAC 3FQTB 4LSPL 3D0LB 4HX1B 1TVBB 1QQDB 4PP1C 4Y7MA 3ORJA 5JZ7D 2Z92B 3L5XL 1OSPL 4NHCH 5EORL 4FFZL 1NL0H 4P4KB 3GMQA 5JXED 1OT2A 1R5WB 1X5JA 5SX4I 2IGFL 2GCYA 3M17A 3TC9A 4LP4A 1OTSC 2FHCA 4RMQA 2NR6D 3BKJH 3EZ8A 2QQQA 3O6FC 4HWEL 3QFDA 3TT3L 1JNLH 5T33H 1OL0A 1AHWC 2C7UA 1WEJH 2X4OA 2VLLA 3R1GL 1JV5B 1E0OB 2GQHA 3BVNA 1M7IB 3BN3B 4HIJB 4OV5B 1E6JH 1EMTH 3RPIA 5C6PB 4FZEH 3AXLA 4YDIL 1GZQA 2VZ1A 1ETZB 1OAQH 4KK5D 4OLUH 4ZSOB 3VH8A 1Z2KA 2GYSA 4ZUVA 4AENA 1E27A 4JFEA 3SEPA 3MV9B 1S9VB 4GAJH 3CDYA 5ILTL 2DL2A 5CCKL 4OLZH 4TSAL 1CLZH 4UINH 1AGCA 2FWOA 4DGVL 2BVQB 2MQ3A 4MNGB 3MOBH 1DBBH 1XGUA 3U0WH 5I8KH 3LEYH 4ZPTA 2BRQA 1Q94A 3C60D 5GGVH 4H20L 4YUEH 1HHIB 3GBMH 2WWMD 2LE9A 3V5KB 3T3MF 1MI5B 1Q9KA 4TRPH 4MA8H 1BHGA 4BKLB 2XNAB 3DBXB 3VXSB 3OJDB 5KS9A 1Z5LB 1CS6A 1YEKH 3H9YA 1U8NA 3HUJB 3L3DB 1MHEA 3QJFA 1Q9LB 3QIBD 2DQEL 1TZIA 2PN5A 3Q0HA 2B8OT 2QR0B 2MSPA 4Z7UE 3MBXL 2IH3A 2YHGA 1OTSD 4HIHB 1NEZB 4KTDL 3BN9D 5C0EA 4PRDB 1LQSR 1SJXA 3O6FD 3MV11 4QOKA 1NPUA 4XVSL 5HVWA 1AFVH 1JTOA 1TQCB 3E2HC 4NC1E 3TF7C 2FEDD 3I3BA 3HE6C 4H8WL 5CD3A 4QRQA 1H3PH 3SCMA 4XP9L 4FQXC 2NX5D 3RWCA 3BAEL 5EUOE 1MCPH 2YBRB 4GRWB 4JM2C 1YPZE 1IC5H 3GO1H 4PLNC 2A1WH 1J0HA 4KGJA 1IAIH 1GPOL 4YFLI 4NN7B 3BX7C 3QIWA 3D0VB 4YXLL 2B4CL 1MRFL 2HH0L 1WBYB 1V05A 2XA8L 2D3VA 2I25N 4M5YL 3TBWA 1WT5A 1KPUB 2HFTA 2D03H 2D4DA 3G5YB 5CUSH 5FECB 2ZPKL 3DOSA 3WHE1 4OLWL 3AS0A 1N26A 1NCCL 4MA7L 4K3DL 3VFTB 4BSWA 1JN6A 1SYSB 1LD9A 1N2RB 3QFJA 5HHNB 4PJIF 3QIUD 2YEZA 4IMKA 3DVGB 2R4RH 4LCYA 2A83A 2GHWB 3T4YA 15C8H 3JTSA 4G6FD 2EXWD 3GK8H 5DS8B 4DQOH 3GI8L 1OGTA 5E7FA 4PGZA 4Z18A 4PJEF 3QDGD 2P5EA 2ENYA 3IU4H 1V7ML 1CFVL 4TULH 1G9MH 3ES6A 3EZJB 3D9AH 2NX5E 2XN9B 3M07A 2MPAH 2VAJA 3BP6B 4I3SL 4ZFGL 1J8HA 1EO8H 2UUDH 4JFPA 4Q2ZA 2GAZA 2W0FA 2C3VB 4QRUA 1AR1C 2OYPA 3S5LG 1Q1JL 3LQAH 4HLZG 3HAEB 1U3HD 3UTTA 4FQXD 1T83A 2QQLH 3V4PL 4N0CC 3D1MC 1ZAGA 4M7LT 5DJ8B 3F7PC 3PWPD 4HFUL 5HGDA 1BBDL 1IC7L 3HZVB 1RURH 3QUZD 2UVFA 3TN0D 1YN6A 4WV1A 1SEBA 4LGSB 3GJFH 3O8XA 4Y16D 3NPZB 4JFDB 3BW9A 2NY1C 1BD2A 1P1ZB 2ZCKL 2ZSVB 1JZ7A 1I9RH 2V2WA 3STLB 4FQHB 1YEIH 2QBWA 4FQLL 4P9HL 4FQJL 5F1IA 5K9JH 5DJCB 2GTZB 4J4PD 2FDBP 4HH9B 2VXUH 1MFCH 3LEXA 4XP5L 4YGAB 2FECI 5IM7A 4F7CB 4S1QH 2FH8A 3QDGE 5J6GA 4RISH 3FFCD 4HC1L 4NJ9H 4RCAA 3ZTNL 2R69H 2E9WA 1VENA 4NN6C 4YIQA 5K9QI 5B22A 1MCFA 1P5VA 1BAFL 4Q6IC 2IH1A 3SQBA 5KVFH 4HIEB 1CGSH 1QRKA 2NW3A 2GSIB 4IIQC 2BNQA 3FOMB 4M8QA 3QP3A 3WXWL 4HUNB 5DA0B 4LDLB 3ZT7A 4TUOB 3ZZ1A 3QPXL 4L8DB 3DVNA 4G8EB 4ERSL 1SJEA 4AZ8A 4LOUD 4RMRA 4JRYA 5F7DB 1BFOA 5D5MA 5E00A 4JQVA 3MV8B 3PWPE 4OCXL 4JHBA 5LBSH 2WIIA 3SKNB 2VIRB 3BYTA 3ARGB 5EZJB 3IJSB 4S1DD 4PJEB 3SPVA 3T0EA 3SGJA 2VDLL 5BV7C 5IWLA 4FQQB 1UJ3A 4PV9B 1ZLWH 3S96B 5SV4A 1MF2L 5E2JA 4JRXD 1S7QA 3O3BB 2VWEE 1I85A 5LGJA 2Z93A 4L29A 1ADQH 3EUUA 3IDJB 4JR9H 4A6YL 2GUOB 3W0WA 3H3PL 2JB6A 4TPRL 2FJGA 1RK1B 3TH4T 1P84J 4HKJB 2YRZA 3EDFA 3FFCE 5CEYB 2NY1D 1BF2A 4D0DB 1BFSA 4LASL 1ZA3A 1A4JA 1SJHB 4BQ6A 1S8DA 1UCBH 5IQ7L 4APQA 1VFMA 5CGTA 3WBDA 1DN0A 2DBLL 3LN4B 1EO5A 1LGVA 1CR9L 1TZGH 3EO9L 5FA3B 4Z77B 1K6QH 3IJHA 5TJWK 5F93C 1OCWL 1P69B 3ZTJG 4DN3H 4K94H 3ULUC 3FQXA 3VG9C 4BQCA 3DIFB 3VXUA 2BHUA 4HPOH 4HS6B 1RK0A 1DEDA 2YN5A 2E27L 1O7SA 4LCWB 5CEXA 3EDKA 1H9VA 2D0FA 5A3IC 2CO6B 3LH2L 4MJ5B 5C2UB 3GBLA 3FB8A 4RMTA 1LK2B 1U95B 2BY3A 4JRXE