3KPTA

Crystal structure of bcpa, the major pilin subunit of bacillus cereus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
350
structure length
350
Chain Sequence
KRGAVDLIKTGVNEKAMAGAVFSLFKKDGTEVKKELATDANGHIRVQGLEYGEYYFQETKAPKGYVIDPTKREFFVKNSGTINEDGTITSGTVVKMEVKNNEEPTIDKKINGKLEALPINPLTNYNYDIKTLIPEDIKEYKKYVVTDTLDNRLVIQGKPIVKIDGAEVNANVVEVAIEGQKVTATVKDFTKMDGKKEFHLQIKSQVKEGVPSGSEILNTAKIHFTNKNDVIGEKESKPVVVIPTTGIIELTKIDSANKNKMKGAEFVLKDNNGKIVVVAGKEVTGVSDENGVIKWSNIPYGDYQIFETKAPTYTKEDGTKTSYQLLKDPIDVKISENNQTVKLTIENNKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intramolecular amide bonds stabilize pili on the surface of bacilli.
pubmed doi rcsb
molecule keywords Collagen adhesion protein
source organism Bacillus cereus atcc 14579
molecule tags Cell adhesion
total genus 63
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kptA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kptA01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kptA02
1YEJL 3O3EA 4K8RL 3ARGD 4M7KH 1JHKL 4F15C 2YPVL 4QRTB 1SJEB 4DOHE 1K5NB 4LCCB 2HJKB 2VDRL 1OF2A 3R1GH 2EO9A 2W65B 3ARFA 4TTDD 3O9WA 1FNEA 1NUFA 3RWDA 4H5SA 4R3SB 2WWKT 4Y2DD 3RDTC 1KB5B 4WUUB 2WP3T 5FGBA 4IGBB 4MD0A 1EIBA 2EYRA 3H9ZA 4EXPX 3GRWL 2DQGH 1H3PH 2XACC 4L3AA 4UMGA 5DJ6A 1Q9OA 3PL6B 1DL7H 2CUIA 2IANE 3EDJA 4U1HB 4YZFF 5HDBF 3P73A 1MH5B 1E4WL 3RWJB 4WWKA 2B1AH 4BELD 5EO1B 2V7HA 1XIWA 3VFWB 2CLRA 4PJ7F 3Q3GB 3GK8L 2FGZA 5FCUL 2BRRL 5IVNA 5CCKL 3FT2B 1N5YH 1QRNE 4R9HA 1JWMB 5C07D 2YPKB 5KBNC 3UTZA 5EU7C 3MNZA 4PJIE 5F6HJ 2EIBA 3SDCB 1Y0LA 1OLLA 2GAZB 1L6ZA 4NN6C 2QQLL 1YEIL 4PRPA 5DJ2A 1ZHBA 3VXMB 5FUZL 5I18H 2DMBA 2QHLA 4WHCA 3NGBC 3RL1B 1QFOA 4XP4H 4Z7QF 4XMLL 4HX1B 2NY3C 4HMCA 3C08H 4NZDA 4J3SA 3BKCH 4A6YA 5AG8A 1MFDH 4J6RH 4MVBD 5I8OL 4PJ5B 1LO0H 2XTLA 3S7GA 2PYEE 5L8JB 4QHLB 3OXSB 4YHKH 3EYQD 4EUPB 3S5LG 2HKFH 1KIPB 4X0KB 4KK6C 4E42A 4HUVA 2Q8BH 3MGOB 3H9SD 5MI0C 3B4NA 4X9BA 3SCMC 1OAYL 1Y6NR 1ZWIA 5DHVB 3MLSL 1QA9B 1M4KA 5ELIA 2CDFB 3QFDB 1I9JH 4G8FB 1NBYA 1FIGH 4OLEA 4M4RA 2D7QA 2E6PA 2FL5A 1FVCA 1XT5A 1DDHB 3ARWA 4MQXD 4POZD 5FYLL 1KENL 3WNLA 1CL7L 1NGZB 4NUJB 2HVKA 4BUGA 5IBTL 3CGTA 5CD3B 2F74A 2GKIA 1XF4A 3BMWA 2YUWA 3QUXD 4UINH 2MTPA 1PAMA 5EOCH 1GL4B 1A7OH 3DXAA 5E9DD 2GJJA 2X1QA 3TPKA 3BPCA 5C0GA 3I6GA 4U1JB 5E2UH 4NNPH 2F8VA 3F6IA 1MJ8L 3HNSL 5TE7H 3NCYS 3NCJL 1KN2L 4AMKH 3ZE0F 1QLRA 4WEMB 3SE9H 5F70A 2NY6B 5EU7E 1JNLH 1BVLA 1J10A 1Z2KA 1D5IH 1CICA 4HF5L 3HPLA 2XY2A 4LSSH 4FTVB 4I4WA 4GRMB 4UQ2B 3ZYIA 1LEIA 5KANI 2KL6A 3PP3K 1Y6KR 2E9BA 1HXYB 3OHXB 5HVHC 1PZ5A 5INDB 4TUKL 4ODVL 3G6JE 5FECA 2LTQC 2VYRE 4GKZA 2UWEA 4XCFH 1MJUH 3RTQA 4NZTH 1FVEA 4NZRL 2HFEA 4D9QE 2ATKA 4ODSH 1P7QB 3ES6B 3QRGH 2AJ3A 3D18B 4OCXH 2AK4E 1MCSA 3RZCA 3ARRA 1FL3A 5F1OB 5J9PB 4MYWB 3DX7B 2BVPA 2IALB 1OCWH 5DC0A 1ROWA 3E2HC 1FDLH 5D1XC 3FQRA 8FABB 1SY6L 4TRPH 4M1GL 4Z5RB 2BSSB 1DVFB 2O26U 5C6TH 1C5BH 1ZA6B 2OQJB 4P3CL 1VFOA 3N85L 3RUGB 4OZHE 5JOPE 1F4AA 2B2XL 3D69A 2YXFA 3QUZB 2BX5A 3O41A 1F00I 1EX0A 1YNLL 3C6LB 3W0WA 4J4PA 2EYSA 1CVRA 3ILQC 2UYLA 4MD5B 4FFWC 4MZ2A 4G43A 4GKSA 4NCC1 2NW3A 1BQHA 1CXFA 4HPOL 4XVJH 2YUZA 3GJFK 4HIIB 1SEBB 3OJMB 2VXTH 3DVIA 4UUJB 3SKMA 1MCRA 4XNMB 5E6IB 2HWZL 4YHML 2ZUYA 5HPMA 3MJ9H 4S10A 1R24A 1UB6B 4LVHC 3WDIA 3DGGB 3GSNA 1NGPL 1LE9B 2KQNA 3VXPA 1Q94B 2IAND 3ULSB 4KZEH 1MJJA 4Q9QH 3O2VL 2RQ8A 2IAMC 1DQMH 4LIQH 3SDDB 2W0LA 5DJAB 1LILA 3A67H 3PGFL 5BVJA 5AAWA 4GS7B 1ZMYA 1PVHA 1DUZB 5F7WC 2A6DA 4KROB 4DW2L 3VGEA 4X7SH 5F93C 1U92B 3IF1A 3UO1H 3S36L 5IT2L 4YQXL 3MRDA 1IGML 2FHCA 3MRIA 2XXCB 4HZLA 4O2FB 5IROA 1NCBL 2Q86B 4FQ2H 3WXVH 1WTGT 3RVWD 1CGTA 1N8ZA 3O2WH 3P9MA 2JIXA 4RFNC 3EO9L 3M17B 4JFYB 5KSUB 4KK5C 1X5KA 2AEQH 5CGMA 1NBVH 5JOFA 3CFIC 3NFPA 2NQCA 4ZTPH 2OX5A 4PV8A 1QFUL 1T7YA 4ODWA 3MJ7B 3T1WA 4MA1C 4J3XA 2VNCA 5F7DA 3X14A 1YYLL 1EMTL 2EDQA 5JZ7D 4KQ4L 4ORGA 4KQ3L 4K3HA 4GG6B 2PYED 3PV7A 4FQQA 2AKRB 4JM2A 4P2OB 5HYJA 4OZIB 3HS0B 1OARL 5CBAB 2PNDA 3DIFB 4EI6B 5TDPB 1LP9E 1QBAA 2F15A 3HC3L 4F9LA 3KPPB 2ARJA 3JUZA 1S7QB 4GXVH 4NRYB 4M93B 1XEDA 4H26B 5C0FB 3T65A 3H7BA 4YXKL 3D39A 3RWHA 3WS3A 2FBOJ 1CGSH 1GH7A 3JWOH 3QIWB 2J4WH 1J0ZA 4HFUH 1ETZB 1Q1JL 2ZSVA 1AXTH 3L3DB 3DVGB 3DYMA 1A14L 1FZOA 1LP9A 5IMOA 3TFKC 3DXAD 1VENA 3BE1L 3T2NH 4GRWB 2YRZA 5D7LA 2NNAA 2NMSA 3W5MA 2AJXH 2CKBA 1KTKE 4NYLB 2D0FA 4F58H 4NO2B 2GFBA 4C56A 5E8EA 1LO4L 2CRYA 3L7EA 4JPIB 5CP7B 5LBSL 4H8WC 1BBDH 4K7PY 2BDNL 2V2TB 1SVZA 2MQCA 4JHBA 3D3VB 4JFEB 1K8DA 5K59F 2DLTA 3PJSB 4BFEA 3ARXA 4WY7H 1KYOJ 4U1NA 3VXRB 1U8NB 4IIQB 3DSFL 2GCYB 4M7ZC 3ARZA 3FFDA 4LSUH 1YNKL 4OLUH 3IU3B 4Y16C 3V8CA 3ZT7A 2RR3A 1URLA 2EC9T 1KPUB 1VEMA 2P5EE 5AUMB 1WCBB 3FB8B 5C0CB 1Z3GL 3PGCB 4MNGB 5EU6E 4OQTL 2P5WE 1YUHB 5IFHL 2Y36L 1CDCA 3S5LB 2GY7B 3RVTD 4F2MB 3SKNB 4D8PA 1VCAA 4N5UA 3DI3B 3OZ9H 4RIRB 4ZYKB 3R06B 2NY3D 1NAMB 3RJQB 1NGYB 4TSBH 4D9QD 2APWA 3GSXA 15C8H 4P5TA 4U1GC 2AK4D 4M7KL 5KSVB 2ED9A 3VWKC 2A38A 5D7IA 5E00B 5ADOH 1LNUA 3MCLH 3C5JB 5CIPA 4KK6D 2G75B 4CW1B 1BEYH 1C7TA 5IWLA 2BRQA 3R1GL 5EA0H 4OF7A 1H8OA 2DM4A 5HYSB 2BMKA 3SCMD 1YEHH 1CFTA 5JOPD 2GUOB 4JFFB 4D0BB 5ESQA 2RFXA 5MEOA 1JHLH 2VE6B 1AGCB 1WIPA 5I1LB 5KS9A 3B5TA 4WVRA 3QXAA 5HD8C 2DQGL 4O51B 4ZFOB 4OLYH 2ZWLT 3DECA 1DL7L 3BD4A 3OAYK 1MHHB 3LN4B 2J8UA 2B1AL 3RWGA 4LLWB 1CXLA 3ROLB 5ACZB 5EUKB 2Q20A 2X4NB 3GSQA 1MRFH 2BHUA 4HHAB 1BVKA 1UKQA 4O58H 5JQHC 2BSTA 1N5YL 3QBTB 5DUMH 1ACYH 3I3BA 3TZVB 2AXGB 1WWWX 2HLFC 3TH3T 4ZFFA 1XCQB 5GIRA 1P6FA 1KV3A 1CF8H 1FAKT 4C4KT 2JIXD 3WJJC 4FXGA 4R4BB 2BCKA 3BEVA 3CFJA 3GSVB 4BSWA 5IP4A 2X9ZA 1W8OA 5FDYA 2W9DH 1NUGA 1VSCA 5I18L 4PLNC 4WTWA 4HDIA 3BUYA 1Q9WA 4NQEE 3VFPA 4XP4L 4PTUA 1KEGL 3C08L 2NX5B 1I7ZA 3BKCL 1MFDL 4J6RL 2PW2B 2XWJB 4I3GA 4HUUA 3T3PE 5AAMA 1LO0L 4W6YB 3K4DA 5C71A 2CLZA 1KBGH 4JM2D 1HINH 2I9TA 2IH1A 3VFVA 5HHME 2JB5H 3BFOA 3PIQA 4NQEA 1JPGA 3RX8A 2HKFL 1DFBH 3JWDC 1A2YB 4EVNA 2Q8BL 4OKVB 5D1XD 2YD4A 1TZHB 3IJHA 1I7UA 2VABB 5DVKA 3V0AC 1LD9B 1CLOL 1I9JL 3ZKMC 5EU5A 3EZJB 1FIGL 3SQOH 3ZL4H 4U1KB 5DC4B 2EIZA 1U93B 3EFFB 2NY5H 3NA4A 3ILQD 5GGQH 1GGIH 1HWHB 4FFWD 4E5XA 4ELKB 5DEGB 4JGMA 3RY4A 1IARB 3DUSA 4R2GD 5C0BE 3NTCH 1U8KA 5TFSH 4JKPH 4UINL 2FEEI 4GW5B 3IFOB 5EOCL 1BMGA 1GOFA 1A7OL 3VFMA 2HVJA 4F7EB 4JB9H 3CVHA 3QO0B 5E2UL 4NNPL 3F7YA 4FQXB 1Q38A 5IKCB 3MRFB 4BA8A 3ILPA 5TE7L 5T1KA 4MAUH 1XR8A 3BXNB 4AMKL 1U3HB 2BSRB 1FL5B 4HIHA 3SE9L 3VMPA 1EXUA 2IAMD 4G9DB 2NR6C 3WN5B 5IJKA 5IVZA 1JNLL 4RMSA 5GS0H 2APTA 1HQ4A 4FFYH 3IDXH 4DWHA 1D5IL 4HUXB 4OZFH 5FB8A 2I25N 4LSSL 3FCTB 1IRAY 4CU8A 4MCYB 3UCRA 3H0TB 4P5KA 4WHTB 1MOEA 1I8KA 3I6LE 3IGAA 5CJXC 4POYA 3JTTA 1FC2D 1NANI 4U1MB 1IGTA 4U6VH 2H2PD 2P5ED 4XCFL 1MJUL 4NZTL 4N8PA 5HHQB 4EQ3A 4ODSL 1HNGA 3QRGL 2ZUQB 5DK0A 4OCXL 3KLSA 3PUCA 1WBZB 1OCWL 4FZEH 1MJ7H 5DJ0A 1FNGA 3VJ6A 1NUDA 3GIZH 2O61B 3FJTA 3HI5H 1FDLL 3VRLE 3G6AA 1WT5A 4JPKH 4TRPL 2CDEA 2NZIA 3P4OB 3R8BB 5C6TL 1C5BL 2E9WA 2XA3A 5C08A 4E0RB 4UIMA 5BV7H 4KK9D 4IM8A 2OZ4H 4FQCH 1DJSA 1XCTA 4NKQB 1IAKA 3GEWB 5K9QI 5CSBA 4WU7B 3MV7A 1J8HA 5B4MD 5IUSA 3TNMA 3QPQD 3F8UB 2BOCA 5IB5A 1RZFH 2D4DA 3IDYB 4TNWK 4R0LC 5BRZE 1R3HA 12E8H 4XVJL 3FTGA 3F7QA 3B8YA 5I30H 4Q9BA 4PPTA 5F9WC 3SE4C 3MJ9L 4WJ5A 1C7SA 3KYOB 2X4OB 3RL2B 2AXFB 5HGHB 3MROA 4J23A 4ODHH 1FZMB 1MNUH 3GMLB 5I74B 3TJHC 3FFCA 1X5HA 2A83A 2VZ3A 4UV4H 4KZEL 2ADGB 4Q9QL 5JIHA 1UC6A 4JRYB 3VW3H 5ENWA 3ESVF 4HJJH 4MSWB 2N7BA 1DQML 4LIQL 2CUHA 4TNVF 3JV4B 4JZNB 2BNUB 4MMZC 3A67L 5IB1B 4UAOB 4X9FA 3L5HA 4QRTA 1SJEA 1K5NA 4AG4H 4LCCA 3GJFB 4YR6B 4WUUE 2HJKA 4X7SL 4I2XB 3UO1L 2W65A 2ED8A 1NKOA 1PZUB 4DKEH 5FO8B 3MZTA 4FQ2L 3WXVL 1EHLH 3E0GA 4Z7UE 3LS4H 4Y16D 1QHOA 4R3SA 1ZVSB 1D5ZB 2VXSH 3O2WL 4LOUC 1AC0A 2EXYC 5F3BA 3Q6FB 4LHJB 3WBDA 2O5YH 1KB5A 2AEQL 1NBVL 4KRLB 4U3XA 4WUUA 5SWSB 4IGBA 5HYIA 1HKLH 4ZTPL 4NJAH 4NQED 1WGOA 4WFHE 4L4TE 4HGKC 4P48A 2YHGA 5F1IA 5JORB 3PL6A 3UAJD 4AJ0A 4U1HA 3Q6GH 1MH5A 2CRMA 3ABZA 3RWJA 2UWEF 1SM3H 3D25B 4B5EA 5HYEA 4ISVB 3GM0A 3HG1B 3FRPA 5HHMD 1UWXH 3DSNA 2LAAA 4OUOA 5EO1A 4KJQD 3VFWA 4GXVL 3Q3GA 3FT2A 5JLZB 1DBJH 4ZTOH 3MQIA 2EECA 1JWMA 1CGSL 2YPKA 3JWOL 2NY4B 1DQTA 2J4WL 4HFUL 3GNMH 1AXTL 3SDCA 3EOAB 3DI2B 2GAZA 4HK3N 1R6VA 5JIKA 4ZNCD 1GC1C 4LRNH 1IQWH 3VXMA 2G60H 3T2NL 2WBJB 2AJXL 3RL1A 5HD8D 5C0BD 1T7XA 4HX1A 2VZUA 4RBPH 1WFNA 5T1KD 4F58L 1E4KA 4K3DH 4HK3J 3SDAC 3CMOH 1DVFC 2HMIC 2A0LC 1CFNB 5HVFB 4PJ5A 1VESA 1BBDL 3KAAA 3EO0B 4QHLA 5HHXH 1BFSA 3OXSA 5C0RH 4MGXA 4EUPA 4GUPB 3SQBA 4LPUA 4PG2A 1KIPA 3QUYC 2WM0A 4X0KA 2UZYB 4MNQE 1WBYB 4WY7L 1ZOXA 2CK2A 4X7EC 2HJLB 2ATPB 2VQTA 1I4FB 4LSUL 3JZ7A 4OLUL 5DHVA 2V7NB 3A0OA 3MRBB 4XXCA 2FJFB 2AV7B 1G7JB 4Z7WE 2CDFA 3QFDA 4G8FA 4HLZG 4L29B 1LK2B 5I73B 1OP3H 4LLVB 1DDHA 3FAWA 1I9RH 3QQNA 1NGZA 4NUJA 4LGSB 5IEKB 4ERSH 3I6LD 3OZ9L 4XPFH 3WHE1 3VG0H 3HMXA 5CD3A 3BZ4B 4TSBL 1KJMB 3O0RH 3IRZA 2FCBA 2UUDH 2JJUA 1EEUA 5C08D 15C8L 4CVXB 2OBGA 2VR4A 1K4CB 1OD7A 3ZHKA 5CMAB 1MLBB 2EE9A 4GS7C 4L4JA 3BQUB 4FQ1H 4BK5A 5MEPB 5ADOL 4FMKA 3MCLL 1FSKC 1BEYL 4HS6B 4MMXC 5EA0L 1IEHA 3MYJA 2IWGA 1X5GA 1YEHL 1A02N 4KXZH 1ZGLM 3ARBC 4JM2F 4TSCH 3ZKMD 1QEWB 3ZSSA 3LRSB 4OT1H 4HZAA 4FTVA 4UQ2A 4GRMA 4WTZA 3O2DA 2ERJB 5ID1B 3ZYOA 1HXYA 5DFVD 4NP4L 5INDA 1B2WH 5BRZD 2QKIB 1MCNA 4OLYL 2H41A 3IETB 5A2FA 2XWBB 4RSVA 3O3UN 2DN7A 1JBJA 2WMPA 3QCVH 4P2OC 4JANB 1LP9F 4ZS7H 1P7QA 3ES6A 3BZEB 1OTTD 2LVEA 2MNUA 3D18A 3NMEA 5J9PA 3DX7A 5CSGA 2IALA 4NNXB 3VXQB 1MRFL 4O58L 3WEXA 2FEDC 5F8QC 5DUML 4XAKE 2VJXA 1IBGH 8FABA 1ACYL 4Z5RA 2BSSA 3P2TA 1DVFA 3LQAC 1KIUA 1ZA6A 4HMDA 2OQJA 2NR6D 1FFNB 2DQUH 3RUGA 3CH8A 2QR0B 3FQTB 1T20B 1D9KC 3QUZA 3AB0C 3C6LA 4LEXH 1MVUB 4Q2ZB 1U58B 4QTIL 4WUUD 4IGBD 3V4UL 1FYTE 2W9DL 2NY0B 4WTXA 1RJCA 1YA5A 1HHKA 4HIIA 1SEBA 3U4BH 2BFVH 4UUJA 2ZOLB 1KBGL 5E6IA 1HINL 1RK1B 2VSDA 3L6FB 1DR9A 1UB5B 4PJ8B 1XGTB 2JB5L 1UB6A 4L1DA 4L4TD 3DGGA 1S9WB 4M02A 1DFBL 3VDCA 1LE9A 4LAQH 3VD3A 2YA2A 1Q94A 3ULSA 1TTUA 3ME0A 4YNYB 3QXDA 4PRAB 3SDDA 3SDCD 4M6OH 4E41B 5DJAA 5GSVB 4HIJB 3D2UD 3SQOL 3VXUB 3ZKQD 1DUZA 4B7LA 1U6AH 5D7IF 3ZL4L 3EAKA 4F80A 2NY5L 4PJDB 1U92A 3MLPA 2UZIH 5GGQL 1GGIL 2W59A 5JDSB 1P7HL 2X2YA 4O2FA 2Q86A 3NTCL 5CJOH 3V52H 3M1BB 3P3YA 5TFSL 4JKPL 3M17A 4JFYA 5KSUA 4K2UH 4JFQB 1WICA 4H20H 2G5RA 4JB9L 4RA0C 2LQRA 3OXRB 1SJVA 5KS9F 3X13B 5JOEA 4H1LG 4FA8A 4MAUL 3REVA 4NSKB 4GG6A 4RX4A 4K7PX 4P2OA 2AKRA 3Q2CA 4OZIA 4JAMA 4UT7H 3HS0A 5GS0L 5CBAA 2J8UF 2Q3AA 4FFYL 3DIFA 3IDXL 4KRPB 5TDPA 4EI6A 5IGXH 3KPPA 3HA0A 1ZT4B 2R23B 1T6VN 4M62H 1S7QA 2EDJA 3SN6N 3ZE1E 2ZZUT 4NRYA 4H26A 2RBLA 4XNXH 5C0FA 4U1IB 3T0WA 1NUNB 3QIWA 4MNHB 4FQHB 3E3QC 4HWNA 9CGTA 1ETZA 4U6VL 3L3DA 4I5BB 4CN6A 4LGRB 4YBQC 1RIHH 4YXHH 1ZSDA 1T0NB 3GHEL 4LOUD 3JSSA 2PR4H 2BNRE 1SYVB 3D3VE 4JFEE 4IMKA 3HR5B 4NYLA 4FHBD 4FZEL 1MJ7L 2R2CA 2KZWA 3GIZL 3HI5L 4X99B 1QACA 5ETUB 3MA9L 3I2CH 3WKNA 4JPKL 5LVEA 1RJYB 4JPIA 2V9RA 2NY6D 5CP7A 1I7RB 2X5PA 3N1QC 5F89B 5GISH 1CD1A 4Z6AT 4W70A 2V2TA 4D9RE 2OZ4L 4FQCL 1SVCP 4JFEA 2P4AB 3PJSA 2FX8H 4FTVD 3VRIB 2R0WH 3ULUC 3VXTB 3VXRA 1U8NA 1P7KB 2PUQT 4IIQA 4LSRH 4ZUSB 1RZFL 3BHBB 5GGVY 1D5MB 5FOJA 12E8L 3IU3A 4DAGH 1XR9B 1KCLA 4X5XB 1BOYA 2YD6A 3F62A 5L2JB 1OAUH 5I30L 1KT2A 5AUMA 3LZFH 1WCBA 3FB8A 3GHBH 5ERWB 5C0CA 4MNGA 2N56A 1P7QD 3BISA 1YUHA 2L7UA 2VLRB 4EI5B 5I17B 3MNVB 3S5LA 4F2MA 3SKNA 5GRVL 4ODHL 4JM4H 4Y5VC 4RIRA 4ZYKA 3R06A 1CQYA 1KCKA 4UV4L 1S9KC 1NAMA 2D2OA 1NGYA 3QO1B 2Z9TA 3SDAD 3VW3L 1DVFD 3C6SB 2A0LD 4HJJL 5H94B 1CI5A 3GDBA 3TO4B 5SWQB 5KSVA 1OSPH 2EO1A 5FCSH 1F4YH 5E00A 1FZJB 3C5JA 3QUYD 3VGHA 2DI7A 4AG4L 4XAKD 4CW1A 3C5ZC 4Z7OE 4MXQC 5CINL 4Y4HC 3FRUB 5L0QC 2FHFA 5HYSA 4LBEA 1U8LB 4LAJH 4DKEL 3U7WH 3MBEB 2FWOB 1EHLL 2GUOA 2M26A 4JFFA 3LS4L 1EHXA 4D0BA 3HLAB 3OJVC 4C58B 5JW4M 2YRLA 1TQBC 2VE6A 1AGCA 2QSCH 2VXSL 1QUNA 5I1LA 1FYTD 3BH9B 4X8JB 2O5YL 5DZOA 4A6YH 3IDNB 1CE1H 1KLFA 3P9WB 3Q48A 1HKLL 4NJAL 4OCYH 3HC0B 2DICA 5FO9B 4HS8H 4ZFOA 2IBZY 1W72B 2EEDA 1UH4A 1UZ6E 4FFVC 2Y5EA 3F12B 1CDUA 3Q6GL 4JZOB 4WI7A 1MHHA 5C70A 1SM3L 1ZLUH 4MCZB 1T80A 2XG4A 2VUOA 3OPZH 5C2UB 2VZTA 4LLWA 2IF7A 4W6XB 2WINB 4PGJA 4FABL 2YPLA 5ACZA 5EUKA 2DQCH 2X4NA 3RIAK 4HHAA 1DBJL 3QDHA 4ZTOL 3ULUE 2X4SB 2JJTC 3TZVA 2AXGA 1KTLB 3EDKA 4YDLB 4ZO7A 3EGSA 3GNML 1XCQA 4AEFA 3R0NA 3U0WH 2NX5E 2I07B 3UDWC 3RWIB 1XF2B 3GMQB 3SJVB 4UDUB 2HG5A 4R4BA 3GSVA 2C1PB 4LRNL 3TPUB 1IQWL 2A9MH 2XXMB 4Z7NF 4PRIE 2G60L 4NQDB 3VRLF 3RVXD 4B0MM 1N6QH 3OGOE 1G9NC 5E5UB 3L5JA 2WOYA 4JFDB 2IQ9H 2NX5A 4TUJB 5HXMA 4K3DL 1RULH 4PV9B 4KJWC 2PW2A 1V5JA 3LEYH 3MRMA 2XWJA 4R7NB 4X80H 3JV0A 3NFNB 4XVTH 4RX4D 4P2OD 1EO5A 5ALBH 1HXMB 5C0RL 1MWAB 2P1YA 4QHKJ 4Y1AB 4N8CH 1A2YA 1BZ7A 2OM5A 4OKVA 1TZHA 3IDYC 1N7MH 1KELH 2R4RH 4JY4A 5T3ZH 3TT3H 2VABA 4R4ND 1LD9A 4HWBA 3ULVE 2COQA 2HT3C 4U1KA 2YK1H 5KVEH 1U93A 3EFFA 1I9RL 4QRQB 1GVIA 3HI1B 1TQCC 4ERSL 5J56B 2AEIT 4ELKA 4XPFL 5DEGA 4D0DB 4YHZH 1MCHA 3KS0H 3VG0L 3G6DH 3SGDI 3O0RL 3FB7B 5D2NB 1KJ2B 4RWHA 4GW5A 1FE8H 3IFOA 5EUOB 4YBHA 2BNRD 4F7EA 3D3VD 3QO0A 4JFED 5I75B 3DWTA 4FQ1L 1ZKAA 4Z18A 2GJ6B 4FQXA 4DKFH 5C6WH 3MRFA 5IKCA 4EQ2A 1Q72H 2DWDB 3ZKND 1CU4H 3MLVH 3BXNA 1U3HA 2BSRA 1FL5A 3BGFB 4XMKH 4G9DA 4HKBB 2EE2A 3WN5A 4D9RD 4MXVF 4TSCL 1ND0B 1TVHA 3D6GA 5ICYA 4HUXA 4OT1L 4HUNB 1CFSA 3CFDB 2YSSB 4P2QB 2D7TH 4G6MH 3FCTA 5TF1H 5B22A 4MCYA 3H0TA 2KPNA 3QNYA 1B2WL 4XC3H 4WHTA 1MCCA 3FONA 4RMVA 4MJ6B 4U1MA 5J6HB 4RISH 1J0HA 1F45A 1OPGH 3GSNH 4J3UA 2X4TB 2JK5B 3QCVL 1OT2A 5HHQA 4X4YB 4ZS7L 3VDBA 1N64H 1EEZA 3U4AA 1WBZA 4JE4B 1BGXL 2O61A 2JJWA 1NPUA 3OG6B 1IBGL 3CUPB 1BD2B 3P4OA 2V17H 1NFIB 1WV7T 2JJSC 4PJAB 2DQUL 4E0RA 5D1QB 3S8WA 4CDGC 4LEXL 3ZMRA 2J6EA 2XZAH 4WU7A 3BP4B 1HYSC 1INQB 1QNZH 3OTTA 2OTPA 2Y06H 1NCAH 1N0XH 2YD9A 4Y19E 3S3PA 3AMKA 1DQQB 1NBQA 2AAVA 3O4OB 4KUZH 3U4BL 5D2LB 3VI3E 2BFVL 3RVUC 1MCFA 1IEBB 2YD7A 3M07A 1G6RA 3H7LA 3HUJE 3KYOA 3CX5J 1JGDA 2OCFD 2X4OA 3RL2A 2AXFA 2I27N 2EEBA 1FZMA 3GMLA 1JWUB 4LAQL 3C2AH 2ADGA 4I2XE 4JRYA 2C3HA 1MF2H 3X17A 3WO3B 1FORH 3B6SB 4XCEB 4M6OL 4F3FB 3JV4A 4JZNA 2BNUA 5IB1A 5MHSE 1U6AL 4F9PC 1N6VA 4ZODA 5GRJL 3GJFA 4YR6A 4JCLA 4RFOH 3ULUD 3VA6A 4I2XA 2UZIL 2DLGA 2ZOKB 1YN7B 5DSCB 1IAIH 2AJYH 2NX5D 3BIKB 5CJOL 1KTDB 3V52L 5C09B 3HAEB 1MHPH 1ZVSA 5IHUH 5IHBA 5MP6H 3Q6FA 4KY1H 2ENSA 2QADB 4K2UL 5SWSA 3CNKA 4H20L 1H0DB 1A6VH 3GJEB 1RZ8B 1B0WA 5D7SH 1CK0H 1FFOB 5E94B 2XWTB 1R3JA 5JORA 1PEZA 4LF3B 5MEQB 1YN6B 3QAZB 5LXGL 2NY7H 2HYMA 3MRLB 3ARDC 3D25A 4ISVA 2XNAB 2W0PA 3F5WB 3G9AB 3HG1A 5J06A 3OBAA 2X4RB 1MCPH 4UT7L 3P4LA 2H26B 1MFCH 1PX3A 1MHEB 5IGXL 5J7CC 1RZIB 4M62L 5FHAH 1XGQB 1JTOA 2R9HC 4XNXL 3AY4A 2ERJC 4D94A 5JLZA 5GRYA 3C5ZD 2DF3A 5AZEH 3I75B 4DKDC 1X5FA 5CEZE 4PJFE 3C09C 1DBAH 3WS6A 1KB9J 5H35B 5TDNB 3ULVD 3EOAA 4M5ZH 1FYHB 1RIHL 1AXIB 4YXHL 3UTSA 3RUGF 1A7RH 5FYJU 1LE5B 4ETQB 2PR4L 4S0SD 1UJ3C 3JXAA 5ADPH 3G5YB 2WBJA 5HGDB 3B2VH 3EYVB 4XPAH 4OCMC 2MQ3A 3I2CL 3WLWC 5HHOB 1CFNA 5CIPH 5EIIB 2CK0H 5BS0B 2I5YH 3EO0A 5GISL 1J1PH 3WO4B 5E08H 4GUPA 4CADB 3EYSH 4N0FB 4X9IA 4YH6A 2FX8L 1UKTA 2R0WL 1WBYA 2MQ0A 2ICES 2HJLA 2ATPA 2MOVA 2FATH 1I4FA 4LSRL 3SEPA 3P4MB 1FL6B 2V7NA 3GSUA 5E8OB 3MRBA 1KC5H 2FJFA 2AV7A 2DLFH 1G7JA 2JCCB 2VO5A 4OAWB 4XVSH 4DAGL 1OAUL 2RHEA 1BJ1H 3LZFL 1LK2A 1V3JA 3GHBL 1TCMA 1YECH 4P46C 4PJ8C 4LLVA 4L5FH 5CSZB 4W4OA 1CVSC 1U8IB 4Q6IC 1PJ9A 1RQ5A 4JM4L 5IEKA 3IU4H 1TPXB 3BZ4A 1HZHH 1KJMA 2AJUH 4PG9B 1C08B 3I84A 4CVXA 1O7VA 4AQ1B 1K4CA 1KTRL 3QIBA 1MLBA 1OSPL 5CMAA 5JR1H 3MLXH 4A2LA 1B88A 1F4YL 3BQUA 4HEPG 5MEPA 3VD9A 2N1KA 4HS6A 4ONGL 4YHLH 3KYNB 1QYGH 1I8LA 1OQXA 2EH7H 4WI3A 1N3NB 3PGDB 1IM9D 3U7WL 1KCVH 3NCMA 4M00A 3GMPB 4GG6F 5KVDH 2WWKO 3T0XA 5KSBE 2MCG1 4MDIB 4OZIF 1QEWA 2QSCL 2WP3O 3QHTC 3LRSA 4WRLA 4WW2C 4A6YL 4D9LH 2DD8H 1CE1L 4YK4C 2K7QA 4X83A 1T03H 5ID1A 3I02B 4OCYL 1T04B 4Y19D 4HS8L 5FM5O 1BWMA 5BVPH 2QKIA 1RUQH 1ZEAH 2XWBA 3G5XB 2A74B 4JANA 4TYUA 2R0LH 1UEMA 4HPYH 3BZEA 3OPZL 4LMQI 3EJZD 2AEPH 3QG7H 2DQCL 4NNXA 3VXQA 3IXTB 4GRWF 1SJHB 3RGVB 3AS3A 1A3RH 1IFHH 1T89A 3O6LH 5DK2B 1FFNA 3U0WL 5KSAC 2QR0A 3FQTA 1T20A 1WK0A 1AXSB 4PJHE 1MVUA 4Q2ZA 3TBTB 1OT1A 5IBUG 1DP0A 1OB1B 1GZPB 2A9ML 1JIBA 4OLWH 4LDLB 4F33B 4YDIH 4CVZB 1N6QL 5LG1A 4ZUTB 2XKUA 4AT6B 3CVHH 2IQ9L 1SYSB 3B9KC 3ZLQC 5F7HA 2NY1C 4D3CH 3LEYL 4X80L 3PWPE 4RQQB 4XVTL 1FFRA 2ZOLA 4G3YH 4JRXE 5ALBL 1RK1A 3BESR 3L6FA 4XTRC 1UB5A 1XGTA 5FA3B 3FT4B 2J12B 1RK0B 4N8CL 1S9WA 5FGCB 3MSPA 3GUTB 5DUBB 3W39B 2B39A 5DJDB 1RHHB 1PY4A 1E0OB 2NY4D 1N2RB 4YNYA 3CDCA 5KOMC 1N7ML 1KELL 2R4RL 5T3ZL 4ONHB 4PRAA 3TT3L 1FH5H 5EDXA 1JPSH 4E41A 3OAZK 5DVLA 5GSVA 4HIJA 4AENB 1NC4B 3VXUA 3IAGC 4EI5C 1I3RB 2QEJA 4GT7A 2YK1L 1X6LA 5CEZD 5KVEL 1HK6A 1HYSD 1CXEA 4PJDA 3MGAA 4DZ8B 2WBJD 2K3TA 3ZTJG 5L9DH 3AS2A 4M8VA 3KJ6L 5D70H 2DBLH 5JDSA 4YHZL 5J1AB 3G6DL 4Q0XH 1K2DB 4JZJB 3M1BA 4WNQA 1U36A 4HH9B 3OKMA 3RVUD 1XGRA 1FE8L 3DTXB 4ZOEA 2YN3A 3BPNC 5IBLC 3DETC 3QXUA 3N06B 2WLZA 3VG9C 2MKLC 3HZKB 3ZKXC 3PV6B 3MZGB 4AH2B 3OXRA 2OP4H 1M6OB 1NFDB 1YPZB 2R15A 4DKFL 1A3QA 5C0EA 4L9LB 1LO2H 1Q72L 2Y25A 3MLVL 1PG7X 1UH3A 4GAYB 4NSKA 3QCTH 1D5XB 4XMKL 4F37F 5EZOH 5T3XE 1BPVA 1FLRH 2XTJB 3JV6B 5E2VH 2H6PB 1ZT4A 2R23A 2D7TL 1X6NA 4G6ML 3S36X 1V7MH 3RKDC 5TF1L 5HI5C 5EFIB 4U1IA 1UZ6F 4MNHA 4XC3L 4FQHA 3K2MC 1F3DJ 3PDOB 4RISL 1E28B 1OPGL 3GSNL 1T0NA 4IS6B 3D1MC 2DYPD 4HCRA 1N64L 2X89A 4HWZB 3X12B 1NKRA 4IRJC 3BQUD 1SYVA 4YC2B 3HR5A 1KPRB 3T0EB 4WI8A 2YD8A 4X99A 1NQBA 2NXYC 2WLYA 5ETUA 4DUXA 3BI9X 3DROB 1PKQB 2EKSB 4DN4H 1BQLH 1X5IA 5JW4Q 3UPRB 1RJYA 2V17L 4M9OA 2CXKA 1I7RA 1C8PA 5F89A 2AK1H 5J4MA 5D71H 2GK2A 1FJ1B 3FMGH 5KN5B 4GW4B 4S1SH 2VXVH 2XZAL 4G8IB 4QRPE 1Z6JT 2R9HD 5C7XH 1NDMB 5F7YC 5B3NA 1QNZL 3VXTA 2Y06L 4JVWA 1P7KA 1WWBX 1NCAL 3OAUL 3MTRA 1KB5H 4ZUSA 3BHBA 3P0VH 3NH7H 1N0XL 1D5MA 3BGAA 3DUUA 1XR9A 4X5XA 4OIAA 4KUZL 1Z9OA 4OGAC 2R39A 5L2JA 1I1AC 1U42A 1LGVA 3LKPB 5J11C 5CFHA 3HN3A 4MAYC 5ERWA 1F4WH 5BZDB 2HFTA 2RAMA 4XH2B 2VLRA 3MNVA 1PKOA 1NJ9B 1RUKH 4DGIH 5EO0B 1AKJB 4O4YH 2IBZX 3JTSB 3QO1A 3C2AL 3WLWD 4Z7VB 5I8CB 3ULVF 1MF2L 4IJ3C 3C6SA 5H94A 1FORL 3U1SH 3TO4A 5GRZA 4F7TB 5I8KH 5SWQA 3STBA 3AM8A 2BNQB 3IJSB 2FO4B 1TTFA 1FZJA 1KLGB 1RZKH 2VLLB 4RFOL 2NY0D 3KPTA 3FRUA 1U8LA 3ARGB 1IAIL 2AJYL 2FWOA 3MBEA 5F21B 3TCXA 1UVQB 1VEPA 1T3FB 1YMMB 3HLAA 1RZJH 2CKBL 3HTLX 1G0XA 1MHPL 5IHUL 4AEIH 1HEZB 5MP6L 1JGLH 2IH3A 3BH9A 4KY1L 4X8JA 1JF1B 5GRXG 3IDNA 5GGTA 4PJ8D 1D6VH 5FM8A 1JPFB 1GCFA 3HC0A 4Y5YB 5D7SL 1CK0L 1TETH 5FO9A 4M61B 4RDQF 1W72A 4DK6A 1NAKH 4EUPH 4Y2DB 4ZXBB 3BGFC 2NY7L 3F12A 3LMJH 4JZOA 4UT9H 4EJ1C 5GZNC 4JRXD 1KOAA 4MCZA 5A40E 1MPAH 1MCPL 4XNZC 4NQUA 1ZHKB 1MFCL 4IEFB 2WINA 1VFBB 5DHVH 1F90H 3SJVE 5FHAL 2F6AA 5B39G 5BMFH 3NZ8B 5AZEL 2X4SA 5IW6B 2YEZB 4NQDE 1KTLA 1R5WB 3AAZA 1DBAL 5SX5H 3FKUS 4NO5B 5ICZB 4J2XA 1EPFA 5ITFB 2I07A 4M5ZL 3RWIA 3VMNA 1XF2A 3O8XB 3GMQA 1A7RL 4MB4A 3MA7B 1JJUA 4UDUA 3HMXH 4KKNA 4DVRL 2C1PA 5AZ2H 3TPUA 1G7PB 4PJXB 5ADPL 1AGDA 3U4EB 3K1KC 4NQDA 1U8PB 2P8LB 2WUCH 4Y1AE 2EDKA 4LQ1A 3B2VL 4PIRF 4JFDA 4XPAL 2Z8SA 2LU3A 4NQSB 4TUJA 1EVTC 4PV9A 1L6XA 5AEAA 2QBWA 4N68A 4R7NA 5E8NB 4QOKB 3ISWA 4JPWH 2CK0L 4GRLB 3CDYA 2I5YL 5BW7A 3QIUC 3BD3A 2D31B 1QOKA 1HXMA 3RHWK 1J1PL 5E08L 2D7NA 4Y1AA 5IBUB 1B4RA 3EYSL 3TBWB 4RGNB 1BZ9B 4KRMB 2B1HH 4RWYH 1GSMA 4F8TA 5HDLA 5DD0H 4X4XB 3H2WA 2FATL 1A1OB 1DQLH 3OF6A 4UTAH 4OTXH 5T3XD 3O2DH 5DJXB 1S9VB 1KC5L 2DLFL 4XVSL 2YMXH 5KSAD 4JJ5B 1TZGH 5E7FA 1G7MA 4YBLB 5B3JE 4IMLB 5D5MB 4ZPVB 2X89D 3WHXB 4L5FL 2HTLC 4G7VH 4QRQA 5E99H 1U2HA 4I8DA 5E0QA 5CZVH 3AVEA 4D0DA 5CKGA 5LJYH 4PLOB 3IU4L 1HZHL 3B9KD 1E27B 3FB7A 2AJUL 2NY1D 2YWZA 5D2NA 4N0YH 4OFYA 2XZZA 3NABH 4ZD3H 4F7PB 5EUOA 4JG1H 4NBYB 4AIOA 5ITBH 1G9EA 2WBWB 3HE7C 3EHBD 3CH1A 4KJYA 1EDQA 5JR1L 3MLXL 4XTRD 1FQ9C 3CC5B 3KNBB 2GJ6A 1PEWA 4XNYH 5J0BA 2DWDA 4YHLL 4PJCA 1QYGL 2Z91B 5F1KC 5FKAA 2EH7L 2ESVE 1EHAA 1V8HA 5DEFB 4NPYB 4DEPC 4X6FB 4HKBA 4KMTH 1HOCB 5KVDL 3GBLA 1N4XH 2X4PB 1ND0A 2QADC 4QRPD 1IC1A 3THMH 2X41A 3CFDA 4D9LL 4EI5D 2DD8L 2YSSA 2R8SH 4P2QA 4PUBH 4PYHA 4L8DB 1T03L 4OGXH 4YGAB 3T8XA 1QR1B 1DBMH 5DD1H 3MBXH 4KXZI 5BVPL 4MJ6A 5J6HA 1RUQL 1ZEAL 3V0WL 1BD2E 4LPWA 2X4TA 2JK5A 4QHKI 2C3XA 1AE6H 3TO4D 3W9DB 2R0LL 4X4YA 1MHCB 1H5BB 1QR4A 3O11B 4HPYL 4NQCE 3LVEA 1CFVH 2AEPL 3QG7L 1MCOH 3VI4F 5A1AA 4U2YA 1QSEB 3CUPA 5IFJB 1BD2A 1QTYT 4O5LH 1A3RL 3HNTH 1AQKH 1IFHL 2WUBH 1NFIA 2VTFA 5FYJE 4PJAA 3ZDXF 4C4KO 1J88A 5D1QA 3VFSB 4U6XB 2A6IB 5HSFA 3MCG1 1OLZA 4ACPA 1J0IA 3MX0A 2XPGB 3RY5A 4HC1A 1BZQK 1YZZA 4YDIL 4UNUA 1HHIB 43CAB 1XGYH 2Z8WC 3CVHL 5ISZA 3IDGB 3SDXE 3C2SA 4JFOB 4HH8A 4DOHB 4D3CL 5D2LA 2EC9U 1T5WB 4OD3H 4G3YL 4KFZC 2R56H 3MV11 3HZYB 3WO4C 3RI5K 1KLUB 4IRJD 1QFWI 5I71C 5HHNB 3SBWC 3FQUB 4YGVB 3IS0X 4CDHA 3N50A 4ZUUA 4KPHH 5JHLH 5DK3A 4CN1A 4UDTB 3B6SA 3BPOC 4XCEA 3WUZA 2P42B 1FH5L 3MRHB 1MREH 4X6CE 1JPSL 4F3FA 5DJZB 2D03H 5C09E 1CTOA 3SJVD 2P44B 4PRBB 1QSFE 2CO7B 2MFNA 2IANB 1L9MA 3P9LB 5DVMA 1BQSA 4NQDD 5I8EB 5KTEH 5L9DL 3T08A 2ZOKA 1YN7A 4I48B 3CVIH 3UTOA 2J5LC 2DBLL 1JL8A 1LHZA 2IGFH 5DSCA 4OLXH 3BIKA 5DI8B 4Q0XL 4GRWH 3V6OC 2R4SH 3HAEA 4OGAD 3DBXB 1T0MB 4MAYD 1QRNB 2BVOB 5DD3H 1QFPA 2NW2B 1GGTA 4DVBB 1H0DA 3VFTB 4K71B 4Y1AD 3GJEA 4PJIB 5HDQH 1RZ8A 2OP4L 2XQYK 4P4KC 3C8KB 1FFOA 1LO2L 5E94A 2XWTA 4XCNB 2BVUA 4LF3A 5MEQA 2HH0H 1YN6A 2DJSA 1P4LA 3PQYB 3MRLA 3OF6D 5SWZB 1MAJA 4FXLA 2XNAA 5EZOL 3F5WA 2X4RA 4S2SA 2H26A 1FLRL 4DJMA 1WQVT 1EO7A 1MHEA 5E2VL 3KPMB 3R8QA 5I19H 1RZIA 2VN4A 1XGQA 1K3IA 5JW3H 1V7ML 2EDLA 5HI3C 4R97B 3I75A 2PYEB 1G9MC 3QE5A 1C16A 1XH3B 5H35A 5JW4N 5TDNA 3S96B 1JPST 4OFYD 1DCLA 5HHOE 4F15B 1T1ZB 2PW1B 1LE5A 1YJDH 3CXHJ 1NAMH 4ETQA 4TVSa 5BS0E 1AQDB 1ONQB 1MY5A 3G5YA 1VGEH 5CJQH 5B39B 3F58H 3EYVA 3RGVC 3V10A 4U33A 3VH8G 2VDLH 4DN4L 1BQLL 4P99A 3TYFB 1EGJH 4JFHE 3RDTB 5DTFB 4LHUG 2QSQA 5GZND 1CFBA 2OXGA 5BS0A 5EIIA 2DDQH 3DHJA 3L5WB 2AK1L 5D71L 3FMGL 4I18C 3ZSTA 1GHFH 4CADA 2VXVL 1MQKH 3FN0H 4NM4H 3SBWA 1EAJA 4M7LH 5C7XL 2HLAB 2ESVD 4K8RC 1A1NB 1PG7W 3GKWH 1KB5L 3UTQB 3P4MA 3L3GA 3IDIB 1FL6A 2W0FB 1NANH 3P0VL 3NH7L 5E8OA 5FUCC 2JCCA 4OAWA 1UXSB 5JA9A 4AQOA 3H6JA 5F9OH 3V6OE 3E6FB 3QWQB 1F4WL 2V5MA 3LQZB 4WCYH 4KTDH 3M8OH 3Q5YA 1DQJB 3AUVA 3ZHDA 4ESKA 5CSZA 1RUKL 4DGIL 4PJDF 5IIEB 4O4YL 1T1XB 1BD2D 3UJJH 3I3DA 4CAGA 4PG9A 3K1DA 1CDYA 4NN6B 1C08A 3WD5H 3U1SL 3OJ2C 5I8KL 3K74B 4NQCD 4OFDA 4XP1H 2CRIA 3NGBB 3G6JB 4WI4A 1WC7B 4N8VG 2NY3B 1VFAB 3QEQE 1RZKL 4YJZL 3IRPX 3KYNA 4RZCB 3L3OB 4ETYA 1N3NA 2AK4B 4JQXC 4JZJC 4EEEA 3TWCH 3GMPA 1RZJL 2EE6A 2P49B 4MDIA 2AJVH 1JYNA 3ORJA 4AEIL 5DQJB 5EORH 4OFQA 1JGLL 2CJUH 1D6VL 1T5XB 5GRVK 5MI0B 2HTLD 3I02A 5EZLB 4U31A 4Y0GA 1TETL 2Z92B 1T04A 1OAQH 1N5AB 1ZA3B 1BBJB 4NWUH 2FIRT 1YEDB 3GMRA 1NAKL 1JE6A 1GZQB 4UT9L 3LMJL 1IC5H 3G5XA 3I50H 2NY2C 2A74A 2EXWC 2XQYG 3MXVH 2VH5H 1MPAL 1HH9B 2DQFB 3PWJB 1F90L 1ZHNB 3BJ91 1OL0A 3DVFA 4BZYA 5BMFL 3MYZA 1QLFB 1SJHA 4OV5B 3UTPE 1EFQA 2DQEH 1KEMH 5DGRA 1BQUA 5DK2A 1BOGB 5C09D 5DLMH 3DGCR 5FUCE 2HRLA 1AXSA 2X4QB 4NFCA 3HMXL 4N0CC 2QADD 3TBTA 2LAGB 5AZ2L 3ULVH 1A9BB 1OB1A 1GZPA 4KV5E 4F33A 4IDLA 4CVZA 4G6AD 3U2SB 2WUCL 3L9RB 3T0EC 4ZUTA 4QXTB 5FGCE 4KHTL 3HB3C 1SYSA 1B0RB 3CX2A 4RQQA 1MCWW 1NCWH 4NKIH 4JPWL 1UWXK 1F02I 1KNOA 5KAQG 1NEZB 5C86A 5HVHB 3MV8A 5FA3A 3FT4A 1RK0A 2B1HL 4RWYL 5DD0L 2LTQB 5B8CC 4KDTA 5DUBA 4UIKH 3W39A 3GUTA 3QQ3B 1XAUA 5DJDA 4OZFG 1N2RA 1DQLL 4UTAL 4OTXL 4P5MB 4ONHA 3O2DL 4NHUB 2YMXL 3TBYB 5DQ9B 3IT8D 2FD6H 1JZ6A 1TZGL 4AENA 1NC4A 2P48B 1I3RA 3ZDYE 3E2HB 2GW5A 5D1XB 5J89A 2X9YA 5KZCB 4G7VL 4DZ8A 4P0DA 5E99L 2P8PB 4RBPK 1NFDE 4CL7A 5CZVL 3B83A 3KWWB 5J1AA 1Z9MA 1AFVH 1FV1B 1K2DA 4JZJA 1JZ5A 5HHOD 1EHNA 3IDJB 4HH9A 4TN9A 1TFHA 1JTTA 4N0YL 4R96B 3NABL 4ZD3L 5BS0D 4JG1L 4AZ8A 5ITBL 1FNSH 1S9XB 1WUNT 1T66C 3PV6A 4AH2A 1A7NH 1M6OA 1NFDA 1O5DT 1YPZA 4L9LA 4XNYL 1M7DB 4M1DH 4JFHD 4GAYA 4LCWE 2J6EH 2E27H 1D5XA 4U7MA 4KMTL 1F13A 1K85A 5FM4A 4LVHB 1N4XL 3JV6A 4OIIH 2H6PA 1OP3K 3OSKA 5T1LB 3THML 5IVXE 4P59H 1VB9A 2DM7A 2R8SL 3MJGX 2AVGA 1FHGA 3MRJB 1QO3B 3EO1B 4OGXL 4PP2B 4Y5YC 4XP5H 5EFIA 2VDOH 2ZCLH 3K3QA 4HUMB 4GAGH 3P11H 1DBML 4FP8L 5DD1L 1ZTXH 3MBXL 3T0EE 2UUDK 2J8OA 3PDOA 3QULB 4ZXBC 3V5DB 4BFGA 3V5KA 3BVNB 1E28A 4IS6A 4X7CC 4JQVC 4YLQT 1AE6L 1RU9H 1Z9LA 4L3EE 4K9EC 4HWZA 3X12A 5HGBB 1BM3H 3EJYC 1FGNH 1CFVL 3SE3C 1ORSA 4A2MA 1MCOL 1KPRA 3ZYJA 3KXFE 2P5EB 3BZFA 5GS1C 5EU6B 3DROA 1PKQA 1GYAA 4O5LL 1S5HB 2P5WB 3HNTL 3UPRA 1AQKL 2WUBL 3GJFH 2W9EH 4KH2A 2NTFB 1FJ1A 4QY8A 5KN5A 4GW4A 2B7DT 1F8TH 4MA1B 3QEQD 1F6AB 4NN7C 4G8IA 2X40A 1NDMA 4U0QB 5IMLB 1XGPB 5HI3D 3NCYP 1CYGA 1MFAH 1XGYL 3ET9F 4BQ8A 3QJFB 3VXOB 1FFPB 2E9IA 3GSWB 5CUSH 4J3OC 2D7PA 3LKPA 4TULH 2E7HA 4OD3L 3EDEA 1I3GH 5BQ7B 4QGTA 5BZDA 4HKXB 2R56L 5I2IB 1RI8A 2KQMA 3QEHA 4XH2A 5DEZA 3U7YH 4MWFB 2X70B 2RJMA 1NJ9A 1F58H 4B50A 1OWWA 3DRQB 2GSGB 4RGNC 5EO0A 4XGZB 1AKJA 4G6FB 4G5ZH 1NLDH 1FO0B 2Z31C 5JTWA 1JRHI 4YHOL 3RGVD 1MUJB 4HLJA 4KKCC 1AO7E 4Z7VA 4KPHL 4BSJA 4M7JH 1ZHLA 5JHLL 5L8KB 3VGAC 2EKJA 2FYYB 4OJFH 1MREL 4F7TA 1ZVYA 5EUOF 2VDQH 2D03L 1YMME 2BNQA 3IJSA 2BXYA 1BREA 2FO4A 2Q7YB 1JYWA 2WNGA 1KLGA 3UTPD 2VLLA 1WIUA 2ZUUA 3G08A 1DE4B 2AXJA 5KTEL 4K8RD 2ILLA 5FFLA 5F6IB 4PJCF 4HXBH 3RPIB 2I26N 2IGFL 4OLXL 3ARGA 1ZGLB 1UVQA 4R7DB 1T3FA 1YMMA 2R4SL 3ETBF 3LS5H 1WAAE 4QCIA 2B8OT 3U30B 1HEZA 5DD3L 1JF1A 1NMCC 1B9ZA 3U0PB 1T2QH 1JPFA 4M7ZB 1IM3B 5HDQL 3BP5B 3QEUB 4BKLB 1A22B 4M61A 4Y16B 5D96C 1EH9A 4Y2DA 2HH0L 4KDVA 4ZXBA 4P23C 4L8SB 2AV1B 4L4VB 4IDJH 1SEQH 4NC2B 1M05B 1ZHKA 4HUWB 4BUHA 5I19L 1VFBA 4XMPH 1KF9B 1WBXB 4MDJB 5GRWA 4HIEB 3NZ8A 5FYKL 1PG7H 5JW3L 1QBMH 3V0VB 3VD7A 5IW6A 2YEZA 1X5AA 5ICZA 4U1GB 5ITFA 2R69H 4RMQA 4WEBH 3VWKB 5FEBA 4PJAF 3O8XA 1OW0A 2FEEL 2X10A 32C2A 3WJLC 3MA7A 4QOKE 5EH1A 4QWWC 1YJDL 1NAML 5JQ6H 1QP1A 1G7PA 4PJXA 3U4EA 1S9YB 1VGEL 4MQTB 1U8PA 5CJQL 2P8LA 4JGUA 2DLHA 5GGVH 2E7LA 4RGNE 1M7IB 3F58L 5EOTB 4NQSA 3S4SG 1DBBH 1JK8B 2VDLL 5J12C 2DI8A 5E8NA 4EKXA 4JDVA 4QOKA 2PF6A 2NY2D 5D2LF 4GRLA 2DDQL 2D31A 3LQMA 5HTSA 3I6KB 4PJGB 3SGJC 2FLBT 2XTJD 3SGEH 5DA0B 1GHFL 1KPVB 3NZHH 3TBWA 1MQKL 3FN0L 1BZ9A 4NM4L 5DHXB 4M7LL 5D5ME 1HHJB 4MA7H 4J3WA 4X4XA 1A9EB 4LCWD 3GKWL 5F88B 1A1OA 3TVMB 4UOJA 5CGYC 1W8NA 5DJXA 1S9VA 5GZOC 1F42A 3O6FB 2JF1A 4CMHC 3KPOB 4JJ5A 5F9OL 1OVZA 2DIJA 3WNOA 4DKAA 3WFZA 2ICEB 4ZFOL 4IMLA 3VGBA 1JZ2A 4N0CD 4WCYL 5D5MA 4ZPVA 2W0KA 4KTDL 2VB5A 3M8OL 5SX4I 3WHXA 1JNNH 1K9TA 1EEQA 3T0ED 4UILH 3B2UC 3ZTNH 1EAPB 4PRNA 2ZUXA 4OZFB 3VXNB 3UJJL 1E27A 1MIMH 3DMMC 4L3ED 1IVLA 3WD5L 2VISB 4N0UE 1T2XA 1LO5B 4X4MA 2K9UA 3U7AA 4XP1L 1A6ZB 3CC5A 4XI5C 4KKLD 3KXFD 3KNBA 4UOW0 2J1KA 5I1GH 4JO1H 5DEFA 1EUTA 1R3KB 2EZ0D 4NPYA 1WISA 3NACH 4X6FA 3B3IB 5T5NF 3JVGC 3OAYH 4CKVX 3TWCL 1F6FB 4PRHE 1EO8H 1HOCA 4Z0BH 5ESVB 4HJ0C 2AJVL 5EORL 4YDVB 3NVQA 5IEHB 3MUGB 1RZGB 4S1DD 2CJUL 3TBVB 2ICCA 1P5VA 4L8DA 5GHWH 5D9SB 3RNKB 3QJHB 5I9QC 4WU5B 4WUKH 3UXFA 1UADC 2DJUA 1VEOA 1OAQL 1QR1A 5ACLA 4NWUL 4XVUC 1T83A 4JHAH 1IC5L 3I50L 3HFMH 3G5ZB 3MXVL 5EC1B 3W9DA 1MHCA 2VH5L 1H5BA 3MRRB 3O11A 3NIDE 3WIFB 5AG9A 1K4DB 1I7TB 5C0NC 5BRZB 3FN9A 2WANA 5HGAB 1BFOB 4HWBL 1CGYA 1AO7D 3K2UH 2DQEL 1QSEA 1KEML 5BCAA 5DYOB 5IFJA 5I1IH 3UYRH 3KPNB 1I1CA 1KXQE 4JKKA 4RRPG 4HV8B 4YX2H 2E9JA 1YMMD 1AC6A 5DLML 4OSUH 3VFSA 4U6XA 2A6IA 4JHZA 1R5VA 3MXWH 3KPSE 3CSPA 3ULVL 3DV4B 4UV7H 3N1PC 4P2RB 2XPGA 5CEYB 1H3TA 1ACZA 4NJ9H 5H2BB 2B5IB 1HHIA 5I6XC 4ONOA 3WFHB 43CAA 3OX8B 3CK0H 1H15A 3IDGA 5I66B 4EOWH 1IGJB 4JFOA 4ZXBD 2VDPH 1DANT 5L2KE 1CLZH 1NCWL 2GYSA 2JCCF 3CMGA 4NKIL 1ZLUK 1T1YB 3QFJB 3HZYA 5DRZB 4AIZB 3HCVB 1KLUA 5A2LH 4JREC 3EJYD 5HHNA 2QSTA 5M95B 5IB2B 4Z7UB 3FQUA 1VFUA 4YGVA 2H8PB 1F3JB 4UIKL 5J13B 2H3NB 2CSPA 4APQC 1A3LH 4UDTA 2CXGA 4HIXH 1QKZH 3MRHA 3KPQA 4YHYC 3BOVA 1PQZB 5F7LB 3T2QA 3O8XD 1LDSA 5DJZA 2E3VA 2C4FU 2FD6L 4L4TB 1Z9SA 4LU5H 2X1OA 1E4XH 3LKNA 4PRBA 3IJYB 1A6AB 5T3XH 3MLYH 2IANA 3P9LA 4TNVK 1H8SA 3A6OA 4LSVH 3K7UA 4LDEB 2HTKC 4HCRH 4I48A 3WL9A 3O6MH 2Q76B 5DI8A 1AFVL 3FHQA 3D2UB 1CT8B 1LEGB 4QOKD 3S35X 3PQYE 3DBXA 5DZ9A 4EN3C 1G7LA 1T0MA 4KVNH 5SWZE 4GRLD 1QRNA 2BVOA 2NW2A 1QVOB 1FNSL 4DVBA 5KG9B 3VFTA 4PJIA 1A7NL 4RGND 3C8KA 4R0LB 5CJ8A 1VACB 2Z31D 2V6HA 3PWVA 2A6JB 4M1DL 4XCNA 3TN0C 2DQHH 1FRGH 3PQYA 5IMKB 2J6EL 5SWZA 4GSDL 4R26H 1I1YA 2E27L 4FN0A 5F9WB 1D6EB 3KPMA 4OIIL 3DVNB 5EBWB 2VDKH 4JKLA 3QA3B 4P59L 4Y4KC 3TH4T 2IQAB 2VN7A 4XP5L 2WIIB 2PYEA 3UBXB 1G6RL 2VDOL 2ZCLL 4GAGL 3P11L 1XH3A 1ZTXL 3SGDH 1T21B 1UACH 5I1AB 3S96A 5E8PB 4Y4FC 5DS8B 4MNQB 1T1ZA 1RPQA 2PW1A 1JMZA 1RU9L 2ZUWA 1AQDA 2W60B 1ONQA 4ZAKC 3ZE2F 1BM3L 1FGNL 3TBSB 3TLRA 3SO5A 2H9GB 4Z7WB 3JUYA 2D0GA 3TYFA 3RDTA 5DTFA 1W2KT 3PHQA 1CGUA 5C9JA 4RNRB 3D0LB 3RIAF 3L5WA 3MPCA 1E6JH 1RJLB 5JPMB 5CLTA 5IF0B 5I1EH 1F8TL 3CD4A 1D5BB 2Y1VA 1WEJH 2QV2A 3MR9B 3V9FA 3NCBB 4JG0H 3UZVB 1J0JA 1A1NA 3IFPB 5J3HD 3UTQA 1KFAH 3IDIA 4PRHD 2W0FA 5GGTH 1MFAL 1NMAH 5EWIH 1T4KB 5E2JA 1UXSA 2EDNA 1ZLWH 1PDKA 2YD5A 5CUSL 2FH8A 5GS2H 4QF1B 1IILE 4TULL 1YNTB 3E6FA 4MQ7B 1I3GL 1W72H 3LQZA 4QWWD 1P4IH 3U7YL 1DQJA 1YY9C 2QHRH 3T2PA 1F58L 4PJEB 3BIBX 2HP4A 5IIEA 4G5ZL 4J1UA 3TA3C 2OKMA 4PB0H 1NLDL 4ZUVB 4GXUN 1T1XA 3PXHA 1CDHA 4KDWA 1QSED 4C54A 3KG5A 4PGCB 1CLCA 4Y2OA 4WI6A 4M7JL 1WFUA 4OJFL 1S78C 3ZDYF 2VDQL 2WZPD 3CSGA 3A6CH 4GQPH 3G6JA 3W2DH 1WC7A 1VFAA 3LSOB 5B21A 1HHHB 1NFDF 1YPZF 3WNMA 3SDAB 4RZCA 2HRPL 3L3OA 3BSZL 3O3AB 4HXBL 2AK4A 2R0KH 4X6EB 2E8ZA 5EZIH 1JWSB 2IMMA 5JW5A 3LS5L 1DLHB 1OAZH 5FA4B 3QUYB 5DQJA 3JWOC 3ZT6A 3TM6A 3VFUB 2AQ3A 3WYRA 4GH7B 1T5XA 3MFFB 1T2QL 4ONFH 2VR9A 4ZOAA 3HHRB 4G9FE 5EZLA 3SCMA 3ARVA 4OZHA 2D7OA 2Z92A 3U9UB 1N5AA 1BF2A 1BBJA 1YEDA 5AWNH 1GZQA 1A7BA 1FYTB 1T1WB 4QNPE 5TH2A 2GQHA 4W6WB 4IDJL 3RRQA 4V2BA 1SEQL 1HH9A 2DQFA 2B4CH 3S37H 4X6DE 6CGTA 4LSQH 4XMPL 1ZHNA 2F58H 2Q6WB 1B6DA 4XI5D 1BLNB 1QLFA 3VCLB 1PG7L 4OV5A 4DN3H 1QBML 2WQ8A 2LE9A 3PWLB 2C3GA 4KGJA 5GQBA 1BOGA 4HG4K 1HSAB 2R69L 4WEBL 4DUVA 3UBXI 1T2JA 1P9MC 4Y88A 1QRND 3MJ8B 1V3LA 1FSKB 4OM0H 5JQ6L 4LFHG 1A9BA 5IB4B 3QQ9C 3WFBH 3U2SA 4GMTH 2EYTA 4XP9H 3L9RA 5GGVL 4QXTA 2FB4H 1SQ2N 3ARBB 2F68X 4KI5C 4QRSB 1DBBL 2HT2C 3PQYD 3B9AA 1J12A 5SWZD 1AGBB 5T1DH 3GMOB 1VADB 5DD6B 2FECI 1NEZA 4G80A 3IAPA 2Z8VC 2VC2H 4XHQA 3G5VB 1QBLH 3NZHL 5KJRL 1OY3B 2FRGP 4O00A 5IESH 4MA7L 4NDMA 1RUMH 3QQ3A 1B0GA 3HR6A 4HD9A 4HGMA 4JGJA 4CNIA 1BQHG 5F1NB 3HE6C 4FFZH 4P5MA 4Z7VF 4NHUA 5I1KH 3TBYA 5DQ9A 2C1OB 4OCLC 3LKQB 3TC9A 5D1XA 2KKQA 1JNNL 2EDFA 2P8PA 2R1YB 4NWTH 4UILL 3KWWA 4DFIA 3H9YA 1FV1A 1D9KB 2BOBA 3IDJA 3AB0B 3RDTD 3QWOB 1MIML 1CDJA 4K23H 4R96A 7CGTA 1YY8B 4L8BB 4LEOA 1S9XA 2CO6B 4GOSA 4NCC2 4GAFB 4NKDB 3WMSA 1M7DA 1FN4B 1EZVY 5F6IC 2HT4C 4JO1L 4HT1H 5A2JH 1XZ0B 3RBGA 2IG2H 2BNRB 3UZEA 3NACL 4LKXB 3VWJC 2P47B 3NIGF 1EO8L 4HC1H 4Z0BL 1MCDA 2OTUB 5ABDE 3GSRB 3U30C 2O5ZH 4ZDHA 4F8QA 5T1LA 3KDMB 1D7FA 4GFTB 3MRJA 5GHWL 1QO3A 4PP2A 2JLLA 4WUKL 2IAMA 2HTKD 1I9IL 2AGJH 5IW3A 3UC0H 2C3VA 4NOFA 5CWSB 2R2HB 2P43B 5ANME 3QULA 4JHAL 4L8SC 3V5DA 5LGJB 3BVNA 3DX6B 1RUAH 4S0TD 4KI5E 1YEGH 3HFML 1P9MA 4EN3D 4BSVA 4OD2B 3BJLA 5DJ8B 5IJVB 5HGBA 1BF8A 2DMCA 2I24N 4PJXF 1P6AB 1A5FL 3FT3B 2P5EA 3TN0D 5EU6A 3UYRL 1S5HA 1X5YA 2P5WA 4ZS6C 4YX2L 5B38G 2NTFA 3OR6B 5CJ5A 4OSUL 4EDXB 3MXWL 4GKNB 1F6AA 2QJDA 1BVZA 3RGHA 4UV7L 3HAEH 1HILB 1EBPA 2X6MA 2WK2A 2F9BT 2MJWA 5D8JH 1XGPA 5IMLA 2J8HA 2Q1EA 1GGCH 4NJ9L 5E1AB 3CK0L 1BWWA 1A21A 3QJFA 3VXOA 1FFPA 4EOWL 2Y5TA 2VDPL 2NY5C 1Y0LB 4Y4FD 1CLZL 5BQ7A 2FDBP 4HKXA 3T0VA 5I2IA 5TQ0H 1VDGA 5F97E 2QSVA 4MWFA 2X70A 3CCHB 4G9FD 5D5MF 1WLHA 2K7PA 1ZE3C 3DNKA 3DRQA 2GSGA 3CFBB 4MB5A 2H32B 1H3PL 4XGZA 4YPJA 4U3HA 3BMVA 1FO0A 4AEHH 1MUJA 1CD8A 3TVMC 1A3LL 1C12B 3MRNB 4HIXL 4QXGH 1QKZL 3O6FC 2FYYA 2EE3A 5DXWA 3F7PC 4LU5L 1E4XL 2Q7YA 3MLYL 4PS4H 1DE4A 3LD8C 4LSVL 5GS0C 4HCRL 5SV4A 1FLTX 4WGWB 3O6ML 3RPIA 5T1MB 1ZWIB 1LEKB 1ZGLA 3L3HB 3T4YB 4RMRA 5H37H 4XX1G 4KVNL 4L4VE 3KPRE 4K3EH 2FL5B 3WUWG 3U0PA 1IM3A 3BP5A 3QEUA 4BKLA 3TA3D 3LKSB 3C60C 4Y16A 2DQHL 1FRGL 2AV1A 4L4VA 4R26L 4Q6YA 3DURB 4PRIB 4YHKL 1XFPA 1M05A 5TE6H 4Y5VB 1WBXA 5C0GB 4MDJA 4HIEA 2VDKL 2WQRA 3LIZH 4I0PC 5KZCD 3N0PB 3V0VA 1RIVH 4GBXC 3LPFA 1LVEA 4YO0B 5ECJE 1UACL 2PXYC 3VWKA 1FPTH 4YZFE 4YUEH 2N7AA 3NIDF 3MLRH 2Z8RA 4GAJH 1HDMB 2EICA 3C5ZB 1MQ8A 3L3JA 1UM5H 5DMIH 4PJGE 4Y4HB 1S9YA 5L0QB 4PJ7E 3B43A 1KG0A 2D0HA 1M7IA 1KXVC 5EOTA 5DFWH 2XN9E 3T4AB 2MMXA 5T5FH 3RQ3A 1JK8A 1TQBB 5DJCB 3EBAA 1LQSR 4GKZB 2UWEB 1T6WA 2AP2A 1PGRB 5GGUB 3I6KA 4PJGA 4B7IA 2VITB 5I1EL 3OKYA 3AGVA 5C0BA 5T1LD 1KPVA 3GBNH 3T0AA 1WEJL 1HHJA 1ZLSH 4JG0L 4UTBH 4OV6F 1A9EA 1H3WM 2NXZC 4JY6B 1RVFH 3NAAH 5FGSA 3T1FB 2B5IC 2FLRT 5F88A 2DKMA 4Z7QE 1KFAL 2V2WB 5GGTL 1NMAL 3BPLC 5EWIL 3KPOA 3UROR 1G9MH 2QQNH 4E9LA 2ICEA 3C5SB 1W72L 3EYOA 1P4IL 2D7MA 3QQ9D 4P57B 5DJYB 4PB0L 1M71A 1UQSB 4NKMB 5J13C 4H88H 3EW3B 3PWNB 2CLVB 3DO7B 3VXNA 5EU6D 4KI5D 3RZWA 3ZO0A 2P5WD 3GB7B 3WJJA 4KK5D 2VISA 1CD9B 1LO5A 1MCIA 4IRSC 1TXKA 4K3JH 3BIAX 1A6ZA 1UEYA 3A6CL 3PG2A 3W2DL 4HULB 1OTUC 1IC7H 4PJIF 3VXPB 5DURB 5CZKA 5F7NC 1R3KA 2R0KL 3B3IA 5EZIL 4LHUD 5ESVA 5GPRA 1JHKH 4JPVH 1TJGH 1OAZL 4HKJA 2HJFB 3BN9C 4X9GA 4QXUH 4ZFGH 4YDVA 1HI6B 3OKDB 4MD4B 5IEHA 3MUGA 1RZGA 3TBVA 1FG2B 2JTDA 1U91B 4ONFL 4X4ZA 5D9SA 3IF1B 3RNKA 3QJHA 1TMCB 1IM9B 4NCDA 4G6FD 2F54E 4WU5A 3VXSB 5F72S 2FH6A 4DCQB 3PDDA 2XA8H 4Z77B 1IKNC 2VXTL 3TFKD 5AWNL 3ZE0E 1NCDH 4R6UA 2A9NH 2UZXB 3QI9C 5EC1A 1EJ6A 3MRRA 2B4CL 3S37L 3WIFA 3E8UH 1TQCB 1K4DA 1I7TA 1J1XH 4LSQL 4M3JA 5BRZA 4Y19B 2F58L 3MRGB 5HGAA 1BFOA 4DN3L 4P9HH 5J8OA 4P2RE 1Q9LB 3QHZH 5EIVA 3KPNA 4PD4K 3KYKH 4HV8A 3HUJB 4Y5XC 2ZG3A 3VWJD 1I85C 2AEWA 1OM3H 4OM0L 3DV4A 3MFGB 3QFJE 1RURH 5EB9A 3WFBL 4RMTA 1NLBH 4GMTL 4XP9L 5H2BA 4YDJB 3FOLB 3WFHA 5CP3A 3OX8A 2FB4L 3RY6C 3ALPA 5I66A 2P45B 1IGJA 1EVUA 2JKXA 4L4VD 3KPRD 1T1YA 5B38B 1P84K 2E6QA 5T1DL 3QFJA 1J1OH 5DRZA 1DSFH 1J0YA 3HCVA 5DRWB 4AIZA 3KHQA 2VC2L 3RJDA 5D72H 1QBLL 5IB2A 4Z7UA 5CJXA 2AQ2A 2CKBB 5IESL 1AI1H 2X42A 2H8PA 4G8GE 4LASH 1F3JA 1RUML 4Z8FH 5SX5K 1AH1A 1S5IH 2D9CA 5E8EB 7FABH 3L7EB 3S88H 4FFZL 3VWKD 3MRKB 1PQZA 5I1KL 1H9VA 4XWGH 4L4TA 3IJYA 1A6AA 5JIPA 4JKWA 1MFNA 3G6JF 1JFQH 4N1CA 3U83A 4CUCA 2YS4A 4XT1C 2P24B 4TTDC 2Q76A 4H0GA 1WCQA 4IBLT 3D2UA 1CT8A 1LEGA 1PLGH 4K23L 3P4NB 2M1KA 4NIKB 4FXKB 4X9HA 4PJFB 1I8MB 5KG9A 4ZMAT 1KENH 3JWNC 3SHSA 4GW1B 3T04D 4R0LA 1VACA 2XN9D 2J2ZA 4OZHF 2A6JA 4KKBC 4HT1L 5IMKA 3TVMD 3X11B 2IG2L 2EC8A 5KANG 1GIGH 3SE4A 3O6FD 2VXQH 3AMLA 4HC1L 5D6DC 3RWEB 1D6EA 2O5ZL 4XPBH 3DVNA 5EBWA 1A6TB 3WUWB 5IG7B 3MGOA 3QA3A 5L88H 2YBRB 2DS4A 2IQAA 4QHMB 2HLFD 2WIIA 3UBXA 3WXWH 1QA9A 5GS0D 1HSBB 4YE4H 2AGJL 3UC0L 2VQ1B 5DWUH 1T21A 1X5XA 5I1AA 2VRAA 3K8LA 5E8PA 5DS8A 1RUAL 4PGDB 4MNQA 5MEOB 1YEGL 1WSST 3SGKC 4CVWA 3O45B 5CD5C 3D0VB 4X8XA 3OKNB 3EYFB 2W60A 4Z1PA 3QDMB 1CBVH 4YIQB 4WO4C 1AIFB 3T3ME 4FQIH 2H9GA 4Z7WA 5MENE 2UVEA 3MJ6A 1MCJA 3BYYA 1G1YA 2B20A 2DYPB 4LRIC 4NZRH 4RNRA 4JJHA 1KJ3H 4U1JA 1RJLA 5JPMA 5FAAA 5IF0A 4NNYB 3FO0H 1D5BA 3QG6B 5F6HI 2JB6B 1F4XH 2IPKB 3MR9A 1NH6A 3CSYB 4I0PD 1KSRA 3MUZ1 3Q5OA 5D8JL 4HWEH 1I3UA 2BSTB 5IMMB 3IFPA 4QLRA 4LSDA 3LDBC 1GGCL 2VAAB 4PJEE 3ARDB 2MPAH 2VXUH 5D1ZC 3KLDA 4CN4A 2PXYD 1JHLL 5FOBB 1T4KA 4QF1A 2MHAB 1LWRA 5FUOH 3OHXA 4PBWD 5TQ0L 4EUPG 4POZC 4WV1C 2F54D 1PBYA 3C09B 4PJEA 5K59E 3CDFA 4PB9H 1CIUA 4ZUVA 3LN9A 4I9WE 4K9EH 3VFPB 5KSBB 4AEHL 1UCTA 1RSFA 4PGCA 3QUXC 4U49A 3DHMA 2YZ1A 1UJ3B 3F65A 4QXGL 4NQVB 2X9WA 3KHOA 1K6QH 1R5IB 4PS4L 3V5HB 3LSOA 1JZ7A 1HHHA 2B0SH 4P2RD 3SDAA 2DJ4A 1XF5B 4R4FH 4XCCH 3O3AA 1ES0B 1E6OH 5C07E 4YEFA 1CF8L 1V3KA 4X6EA 1JWSA 3TP4A 1DLHA 1WVZA 4LP5A 5FA4A 3QUYA 2CUMA 3DV6B 2APBA 3QFJD 3VFUA 4K3EL 4QKXB 2EDEA 4MD5A 3TV3H 1QFWH 2EIZB 4JN1H 5FHBH 5I0ZA 4IHOB 1AGEB 5F96H 1TENA 3U9UA 4QRRB 2X1XR 1YC7A 3PNWB 4PJHB 3S35H 4XNMA 1J5OH 2Y4SA 1FYTA 1T1WA 5F1SA 4NUGH 4P46B 1X9QA 4WFHD 4C59B 5IV2B 5TE6L 1EBAA 4Q6IB 3AFLA 1VGKB 1WWAX 3LH2H 4WTZG 2Q6WA 4G8GD 3RWCB 1BLNA 3F7YB 3LIZL 5DD5H 1HCFX 3PWPB 5J1SC 3VCLA 1RIVL 5ESAB 3ARFC 2DWEB 4JRWA 4LVOC 4P3DB 3PWLA 3ARPA 4JRXB 4JDZB 3O9WC 3BD5A 2X44D 4XBEH 4DUWA 2XKSA 1HSAA 1FPTL 4YUEL 4I3RH 2F53E 1RJZB 3V4PH 4LLUB 3MLRL 4GAJL 3MJ8A 5HVWA 1DLFH 1H3GA 5FGBC 5IB4A 1ZGLP 1UM5L 4HBQA 5DMIL 1FP5A 4UU9B 5DMGC 1IEAB 3QXWA 4HAGA 3ARBA 3JTTB 4WFEE 4QRSA 4RRPA 5T5FL 2VLJB 1ITCA 3MRPB 1S3KH 4WW2B 3DYPA 4WWKC 1AGBA 4YK4B 5BJTB 3GMOA 1VADA 5GGRB 2ADFH 3REWB 4R8WH 3MJ7A 5DHYB 1XIWC 3TJHD 3G5VA 3OV6A 3GBNL 4WFGE 3WHE0 4Z95H 1ZXQA 1ZLSL 4IOFC 4UTBL 5F9JB 1EZVX 1RVFL 3NAAL 4ALAH 5F1NA 1PY9A 1OAXH 4MJ2A 3TEUA 3SGEI 3FO9B 3JV5A 4UB0H 4KTYA 3GKZA 4MNQD 1G9ML 2C1OA 2QQNL 4GG8B 5LAXB 1KIQB 4PLJC 2PN5A 5CLWA 2VLKB 1INEH 5TE4H 1VA9A 2R1YA 2BOCB 3DVGA 3WFCH 4MA3B 3SDYH 4H88L 4TVPE 5KSAB 3OJDB 1D9KA 2MCPH 2EXYD 1T22B 4LCIH 3QWOA 4NHCH 2F19H 4AIXA 4DGVH 4RFEB 1YY8A 4L8BA 1HYRC 2WBKA 1S7TB 1IAOB 3J7HA 4BM7A 4Q7DA 4NO2A 5MEND 1IC7L 5K9KB 4NKDA 3B9KB 4M3KB 3MUHL 1FN4A 2NY1B 2BJMH 4K55A 1XZ0A 4ORZC 4WI5A 5BV7L 2BNRA 3CZJA 3TIEB 3VU2A 3HMWH 4LKXA 1JN6B 1YEFH 2OTUA 3D3VA 2OTWB 3GSRA 5F44A 4JPVL 1DZBA 1TJGL 2V5SA 4QXUL 4WHDA 4ZFGL 2PTVA 3KDMA 4F37K 3OB0H 5CJBA 2GCYA 1AD0B 2VZVA 3BWUC 3D9AH 3T3PF 3DARA 3WNNA 2XA8L 5TJWK 5CWSA 2R2HA 3VGGA 1KPUA 3TGXA 5LGJA 2YC1B 3PGCA 3DX6A 2FZ3B 4QRPB 1MRCH 1T0PB 1NCDL 2A9NL 1IT9H 5F3BB 4OD2A 5IJVA 5DJ8A 4OB5H 1Z0MA 3E8UL 1MNUL 2L7JA 1J1XL 4I9WD 5E70A 3FT3A 1PW3A 5DC9B 2OS7A 2SEBB 4P9HL 2HMID 2OLDA 5F1IB 1MRDH 4KKBD 4LVNC 3QHZL 3RA7H 1AHWB 3MV01 3AU1B 4LDOB 4BH7B 3KYKL 2VDNH 3BPNB 2C4FT 3P40A 2BHYA 4XBPB 4KC3B 2FX7H 3VG9B 3OR6A 3ZKXB 1EGJA 2C3WA 2G75A 4EDXA 4PJGF 1CICC 1OM3L 4GKNA 3UZQA 1HH6B 2M2DA 3WCYA 3ARSA 2G5BB 1RURL 1HILA 4PRPE 1NLBL 4F7MB 1AGFB 3E3QE 5E1AA 2F5BH 4K94H 5F71A 1MCLA 3RIFF 3RTQC 4O02H 2NCMA 3FOMB 2OK0H 4R90H 1IMHC 3OAZH 4RGMC 5CD5D 1J1OL 5KAQF 1DSFL 4NO3B 4ZG1A 2N4IA 3RZCC 3CCHA 1UKSA 2EDBA 3RVTC 5D72L 3CFBA 2H32A 4O51A 4WO4D 3MLTB 1AI1L 4LASL 4HMEA 1KEGH 4Z8FL 3LN4A 1S5IL 4D0CB 3DX8B 7FABL 1C12A 3S88L 1OSZB 3MRNA 1JV5B 3ROLA 4IRJB 4XWGL 2R0ZH 4GLRH 4WFFE 3QUMB 4QTHB 2NXYB 1BHGA 1JFQL 4J4PC 3C8HA 4HWUA 2DQJH 1F3RB 2GJZB 1C5CH 3QDJB 5LCVH 5T1MA 5D1ZD 3ARBD 1LEKA 3L3HA 1G1CA 4PY7B 4AY0A 2F53D 1AJ7H 3T4YA 4QHNB 2FBJH 1CLOH 1PLGL 1E4XI 4WI2A 3BKJH 3QDGB 2ZG2A 3A6BH 3VRJB 43C9B 3DXAE 2R1XB 4RAUB 2VL4A 1HNFA 3LKSA 5IOPB 4WFED 2EH8H 3CMOL 1TJIH 3NCFB 5HYSG 3DRTB 1I1AB 5J11B 4MAYB 4XCYB 5HHXL 1GIGL 3DURA 3EOBB 4PRIA 4IOSD 5D93B 4NBXB 2VXQL 4JN2B 2O5XH 4XPBL 3RAJH 3QB7C 4WFGD 4Y5VA 2DQIH 3HZMB 4LLQB 2FEDD 5INCB 5L88L 3BKYH 4U7SA 3L5XH 5T3ZE 1ZT7B 4IJ3B 3MYJB 4OM1H 3WXWL 4YE4L 3STZB 2GY5A 1MY7A 1CFQB 4YO0A 5IROC 5DWUL 1M7XA 3DJ9A 5GGRY 1D9KD 1RHFA 4NQXB 3EFDH 2ED7A 5DT1H 2UWEE 4WW1B 2ZUTA 1HDMA 3C5ZA 5BO1H 5C0DB 1CBVL 4Y4HA 1WZLA 1QSZA 4FQIL 3BP6B 4TVPD 3WNPA 2FJGB 3T4AA 5I1CH 5DJCA 1JUFB 5K9QG 1BFTA 1Q0YH 3IYLW 4JM2C 1KJ3L 5GGUA 1NGXB 1JGEB 1WIOA 2VITA 2J88H 4F9LC 3MACH 3FO0L 3LHPH 1F4XL 4LKCB 3Q1SH 4JLRB 4Z7UF 3WEXB 2KDGA 4HWEL 3W0WE 4JY6A 3ARFD 4QYOB 4HJGB 5F9AC 3T1FA 4LHQB 2MPAL 2VXUL 3E6HB 2V2WA 3O9WD 2GEEA 3OL2A 4XNZB 1K8IB 1DUYB 4X7TB 2H2SC 2HKHH 5AD0B 1NDGB 4YHNB 2IBBA 3ESUF 3AROA 3C5SA 2CQVA 4CU6A 4JFPB 5FUOL 2ESVB 2OL3B 1YC8A 2JJTA 4H1LB 4U6YB 3KPLB 1NCNA 4P57A 4PB9L 5DJYA 1UQSA 4NKMA 5DMGD 4K9EL 4P2YA 1B3JA 3PWNA 2CLVA 3DO7A 4R2GC 3UDWA 1UFUA 1HHKB 3GB7A 3RKPA 5IHLB 3UTTB 4I13B 5C8JB 2W1NA 4WWKD 3ZKSD 1QFWM 4H25B 5CEXB 4YFDB 3WIHA 4EBQH 1JZ8A 3CU7A 1K6QL 1XIWD 4OF5A 1CS6A 5EN2B 1ZANH 4NRXB 4NT6B 2B0SL 4IOFD 4R4FL 4XCCL 1R3LB 4YFLF 2YD3A 3VXSE 1SMAA 1E6OL 1GOGA 3QXDB 4NQCB 3QIUB 1KACB 2Z35B 3D85B 2DQTH 3U79A 3N1FC 4WENB 5IW1B 2HJFA 1BX2B 1NBZB 2CDGB 3KJ4C 1HI6A 3OKDA 4MD4A 4PRPD 4PLJD 3TV3L 1FG2A 1QFWL 4JN1L 5FHBL 5HYQB 1U91A 1GAFH 4PGZA 1T7WA 3OKKB 4J8RB 1IM9A 3VXSA 5F96L 1JRHH 4DCQA 4KZDH 4Z77A 4YBQD 2YUVA 1G7HB 2BSED 2H2PC 3S35L 1QLEH 4P3WA 4YDKH 1J5OL 3VFRB 1P5UA 4NUGL 4P5TC 3UPCA 2E6JA 5HGHA 5HYJE 3LH2L 4Y19A 1VPOH 3SDXB 3MRGA 5D7KE 3BZDA 4WGVB 5DD5L 4LLDB 4RDQG 5IWLC 4Z7WF 1F3DH 1KXTB 5LQBH 3K4AA 1Q9LA 4MSWA 3V95A 3D39E 2ICWJ 1FNHA 3REVB 1L7IH 3HUJA 4XBEL 1UZ8B 3HE7B 2DLIA 2GTWB 3BGMB 4JAMB 4KK9C 4I3RL 3V4PL 4WFFD 2UY7A 3OR7B 3SE8H 1DLFL 3T3MF 2V2XB 5B4MC 5FO8A 3QPQC 4X6CB 4DEPB 5D7LE 3UYOD 4YDJA 3FOLA 4TSAH 2DI9A 1D5ZA 1QSFB 4ZPTB 3B9EA 1S3KL 1Y6MR 1ZSDB 3QDAA 4C56E 4PRID 5B38A 1KULA 5DRWA 2ADFL 2BHZA 4R8WL 4U6HB 3QT2A 4PJEF 1J86A 4Z95L 1VHPA 5E4IA 3EDFA 4ALAL 3TESA 1OAXL 3MRKA 1CD1B 4UB0L 2OXHA 4YWGH 4U0RC 2VIRB 1CICD 3F7RA 2CR3A 4N90E 4BJLA 5T3ZD 4MXQD 3CU1A 1PYWB 5JO5B 3V6FB 4Y4HD 1BJMA 1INEL 4PFEA 5TE4L 4XPHH 1RAMA 1GGUA 3EKCA 2JJSA 2P24A 3WFCL 3SDYL 1KCRH 1V3MA 5TGBB 3QNXB 2MCPL 5I16B 5L6YH 5LWYH 3PF2A 3W5NA 4LCIL 3RTQD 4NHCL 1KT2B 4Y89A 3P4NA 1U2CA 2A73B 2F19L 2EDDA 4FXKA 4NQTA 4PJFA 4DGVL 1I8MA 4XX1E 5F7FA 3RZCD 4LFHD 1CWVA 5D7IE 3L3IB 4GW1A 4C57C 3MGTB 3HKFA 4FFVD 3AS1A 3N9GH 2BJML 4ODUB 3UAJC 4QT5B 2Z1PA 4WIQA 3X11A 1FIEA 3HMWL 1YEFL 5DDHB 3RWEA 5I71B 4NBZB 1CG9B 4OF8A 4KJQC 3BDBA 5DMKB 1X5LA 5SX4H 3LN5B 1A6TA 3H3BC 4FZ8H 1IZKA 5CZXC 4K7FB 3WUWA 1JGVH 5IG7A 3W0WD 2YBRA 4J4PD 1ZLVH