3KPUA

Crystal structure of hpnmt in complex adohcy and 4-quinolinol
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kpuA00
3R0QA 1WXWA 3TPZA 2UYHA 3HTXA 3TOSA 7MHTA 4MIKA 3FYDA 5K0NA 1JTEA 1QAOA 3I58A 4GOND 1I4WA 5K0GA 3BKXA 2PY6A 4PCAA 5EG5A 3E05A 3Q7EA 3EGIA 3UJ8A 1EIZA 1FP1D 5T67A 2EJTA 2PBFA 5DRYA 3EVZA 4YV1A 10MHA 2XYRA 5FWDA 3TRKA 2ZIFA 4F84A 3REOA 2ZIGA 3A4TA 3EMDA 4E2XA 3GDHA 2YXEA 1ZHFA 3BKWA 3IV6A 5CVJA 4PWYA 8MHTA 3ELUA 2OB1A 2P7HA 3HP7A 3R3HA 4V0RA 3TKAA 3A26A 1BOOA 3KQPA 2C7PA 2I6GA 5LSAA 2N47A 3KPYA 2PV0A 2H00A 5DLYA 2AN4A 5EIWA 1L1EA 2PKWA 2ESRA 5DM4A 4CKCA 4RTMA 2XYQA 4M7RA 3HNRA 3VC1A 3GGDA 5DTRA 2C7RA 2B3TA 5LQJA 2NP6A 3OE4A 1AV6A 1P1BA 5K05A 4QTTB 2ZBRA 4DZRA 4PGHA 1JQ3A 3I53A 3A7DA 5K0CA 3R9XB 1QAQA 3HVJA 5E1MA 3PLAE 5KVAA 2IP2A 2V7EA 4FT4A 3PFGA 5FQNA 1WS6A 2ERCA 3BGIA 2H1RA 1G55A 4QPPA 4YUYA 3ER9A 2YVLA 3DOUA 5CIYA 3EVCA 3KQTA 5CCBA 1JR4A 3PS9A 2HV9A 4FR0A 3UJDA 2VDUE 1VP3A 4KVZA 5DSXA 5E2AA 5EGSA 9MHTA 3AXSA 1G38A 3OU6A 1SVUA 1BHJA 4PINA 2BZGA 4RV9A 1JTFA 3TQSA 3OZTA 1BKYA 3IEIA 4DCMA 4X41A 4KDRA 3CC8A 2HR1A 2ZULA 1NE2A 4OA8A 5EMJA 3TLJA 3U81A 3AXTA 4RYLA 5JUWA 4POOA 2QE6A 1UIRA 3OPNA 2PWYA 2AR0A 3GRUA 3KR0A 5CVUA 4AUKA 1NW7A 4HRAA 4LWOA 1VBFA 4DKJA 2CMGA 3UA4A 4BLWA 2IDJA 2IDKA 3M6XA 3VSEA 4OBWA 1NW6A 5DX1A 2FRXA 2ZVJA 1O9GA 3SM3A 3NDJA 4RVFA 3EVFA 2QY6A 4Z2YA 3CBGA 4KW7A 1M6EX 5KYGA 3QOWA 2O0LA 5E8JA 2OO3A 1TW3A 4QVKA 2HMYB 3O7WA 4FSDA 3DXYA 1ORHA 4RWZA 5EMLA 2YUIA 3LKZA 5K09A 3MCZA 5LQRA 3DMHA 2IGTA 1XDZA 2IH5A 5C1IA 3KPJA 1JQEA 3HCBA 5U4XA 1ZG3A 4CWAA 2QM3A 1Z3CA 5DXAA 5IKMA 5F2OA 1VQ1A 1PRYA 3FUWA 2WA2A 2ZWAA 3HCEA 1VP9A 4QVGA 4GUAA 4V0QA 3GU3A 2P35A 1QZZA 2AOUB 3BWYA 4YMGA 5FHRA 2OY0A 5HZMA 3UBTA 3FTEA 4RVDA 4C4AA 4CXMA 2P3QA 1X19A 2LD4A 3HCFA 3M4XA 4M38A 2IPXA 2O05A 5CVEA 1TPYA 5BW4A 1NW8A 4RTKA 4EMSA 2I9KA 3P9KA 3LCUA 1YFJA 2YXDA 3B3GA 1T43A 4ER7A 5FUBA 3UZUA 2HWKA 5HEKA 2PWPA 3B3FA 3D2LA 3LKDA 2OKCA 5LQCA 1X1CA 1JG3A 3O31A 1MJFA 5EOVA 4C07A 4F85A 5CCXA 1NT2A 1KPGA 4O29A 4GBED 3UA3A 4F86A 3MERA 1P91A 1NW5A 1KIAA 2AOVA 2JJQA 5EMMA 3PX3A 3T7SA 4KDCA 3NMUF 4P7GA 2NXEA 3FPEA 1KXZA 1NV9A 1R00A 5F2KA 3SX0A 4HH4A 5KQSA 4RTOA 3ERCA 2PX8A 3TKYA 2PXAA 2GH1A 1G60A 2XVAA 4UOEA 1VIDA 1R74A 3ANXA 2YTZA 1RJDA 5GP1A 4R8RA 2ADMA 2NNWB 4GC5A 3C6MA 3HA5A 5EKXA 3SR4A 3G5LA 5DPMA 2E5WA 2P1DA 2BR5A 5EZQA 1WXXA 2ZFUA 5FADA 2ZCJA 1QANA 3MTEA 4ER3A 4PNEA 3MAGA 5FULA 1XVAA 3KKZA 4WVLA 1SUIA 4EQZA 3HCDA 5FQOA 4RX1A 5JR3A 5FWAA 3L8DA 4QDJA 4U7TB 3M6VA 3MCTA 2ZTHA 5D1HA 5T6BA 2NXNA 5ICCA 1BC5A 5DTMA 2OXTA 1N7JA 3UJ7A 1AF7A 1HMYA 1D2HA 4E70A 2PX5A 3G2QA 4HC4A 5DRTA 3LECA 2A14A 1JG1A 2JH9A 1VE3A 1NW3A 3LCVB 4OA5A 1NBIA 3DLCA 4RTRA 2PT9A 1YZHA 3X0DA 4MQ4A 1RJFA 3NJRA 1IY9A 1D2CA 5F2NA 4OBXA 3EGEA 4QDKA 4PYJA 2XVMA 2Y1XA 1R8XA 3FPJA 3FTDA 3HVKA 5T64A 3EEYA 1L3CA 2ZBPA 2PVCA 2ZLBA 4BLUA 2EFJA 3B5IA 5K0BA 2JHAA 3EEOA 4BP3A 4DA4A 5E8RA 2UYOA 4BP1A 2B2CA 3QOXA 2Z6UA 1KPIA 3SGLA 5GM1A 2GPYA 2K4MA 3K0BA 3G8BA 1RJGA 3T7TA 3UJ6A 1FBNA 2XYVA 3MQ2A 3E7PA 2O06A 2ZZNA 2Y1WA 4RTLA 1I9GA 5FCDA 5EHGA 3MHTA 3K6RA 1U2ZA 5ERGB 5EKUA 2B25A 3C6KA 3CJTA 3R24A 3RODA 3FPGA 3KQQA 5EEGA 2Z6QA 2G72A 3FPFA 4Y30A 5DM1A 2ORED 4PYOA 2UZ4A 3CVOA 3JWGA 3GRZA 2AZTA 1M6YA 3GXOA 4AZTA 4RTSA 3KQYA 2P7IA 3PT9A 3B7PA 1EJ6A 4EK9A 1G6Q1 4HSGA 4RVHA 4PONA 1WZNA 5DM0A 5EHIA 1O9HA 4RSRA 1SQFA 3P9IA 1ZGJA 4R8SA 1X1BA 2H11A 5E9WA 2ZBQA 1JG4A 1ZQ9A 2YQZA 3P9CA 3P2IA 1FP2A 5HIMA 4C08A 4YUWA 3O4FA 2ZWVA 2NP7A 1L9KA 1YUBA 3AWIA 3G8AA 3I64A 2OYRA 5ICFA 5DM2A 5ICGA 4A6DA 2YR0A 3CGGA 2NXCA 2VDWA 5M5BA 2P8JA 3OCJA 2VS1A 4E30A 4E32A 2FYTA 4P7FA 3SXJA 5GOZA 2ZSUA 3CCFA 3UJCA 1VL5A 3P9NA 4P7KA 3A7EA 3NVMB 4GOMD 1KP9A 5CVVA 4C03A 1KYZA 3Q87B 2P3OA 3A27A 3HVIA 1R6AA 2FK8A 3TM4A 2C7OA 3T0IA 4OX9Y 2OZVA 2PXCA 5E2BA 2G71A 2UYCA 5DT2A 1INLA 5IH3A 4ER6A 2IFTA 3NW9A 4DM3A 3PFHA 1UFKA 2PLWA 5FHQA 3HVHA 3DXXA 3DULA 3KQWA 4PYMA 4R05A 4XCXA 5C0OE 5LQNA 3P97A 3PX2A 3SMQA 2JHCA 4KRGA 1YZ3A 4MTLA 2I7CA 4CTKA 2BH2A 2AS0A 3KHKA 3NWBA 3RW9A 1DUSA 1JG2A 1Y8CA 3FRIA 3GIWA 2CMHA 1XCJA 3FRHA 3HCAA 4RTQA 3FTFA 5EZSA 1Q0SA 4EKIA 1L3BA 2V74B 3NDIA 3BZBA 4HTFA 2YX1A 4QQKA 5EMKA 2IH4A 2G70A 1XTPA 4FT2A 2AOUA 2P40A 4GF5A 1R8YA 5HIKA 1KHHA 1WY7A 2FHPA 1EQAA 3M6UA 5MHTA 2ONZA 5DSTA 3GO4A 3QV2A 4ZTBA 3E23A 3LGAA 4C06A 3LBYA 5GM2A 2O07A 4IV8A 2WK1A 5GIPE 4HG2A 1QAMA 1YF3A 1XDSA 1YB2A 5ICEA 4MHTA 3HA7A 3GNLA 3KR9A 2B78A 4GEKA 4FP9A 2B9EA 3GRVA 4H0NA 4B17A 4RTJA 4K6MA 2PX2A 4IWNA 4IKPA 4QTUB 3EVBA 1KPHA 1NV8A 3FUXA 2OPBA 3OFKA 2PSSA 2EG5A 1XXLA 5HOQA 3H2BA 5LR6A 5HILA 3OZRA 2AOTA 3E8SA 3LPMA 2FPOA 3HCCA 1IXKA 3IHTA 3B3JA 3PB3A 5DXJA 3VYWA 2AN3A 4X63A 4P7JA 1UWVA 5D1NA 3EGVA 3EVEA 1JQDA 4DCGA 3OE5A 4PYIA 3MGGA 4ATNA 2FK7A 3C3PA 1X1AA 3VC2A 2F8LA 5K8VA 3UFBA 2R6ZA 3BWBA 5KS2A 1FPQA 4PIPA 5FTWA 4FZVA 3HEMA 4DQ0A 3KR2A 2G8NA 2NXJA 4ISCA 4L7VA 3SSNA 2JHPA 3FUTA 1PJZA 3SSOA 4EKGA 5K03A 1AQJA 1G8SA 4RVGA 1KR5A 4FGZA 4OQEA 3M70A 3P2KA 3BXOA 3DLIA 4GOLD 5DX8A 1HNNA 1O54A 3ELDA 3G5TA 2BM9A 4HGZA 4E33A 3DH0A 5C9ZA 1EG2A 3ELYA 2QRVA 3EVAA 3KQOA 5GINE 3KQMA 4LWPA 3GJYA 2PXXA 3BUSA 4KWCA 3LDGA 5K0FA 4E2ZA 3B89A 2GA9A 1TW2A 5E9QA 4YUXA 2Q41A 4JXJA 1DCTA 2EJUA 2OBFA 3ME5A 2GB4A 5B1SA 4AZVA 3I5UA 3G88A 3KPVA 4PIMA 4YUVA 4Y2HA 2ZIEA 3OFJA 2UYQA 2VZ9A 5EIFA 3WSTA 1KYWA 5EEHA 5FA5A 2PT6A 5CUQA 3DMGA 3G2OA 3TM5A 2C7QA 1SKMA 1Q0TA 3ELWA 3AJDA 2I62A 3M33A 3DP7A 3KPUA 1WG8A 3THSA 3KPWA 5HIIA 4R6XA 3G2MA 4RTPA 4PYLA 2HNKA 2GLUA 3M6WA 3TFWA 4KIGA 5EVJA 2HTEA 2VP3A 3I9FA 4YMHA 3DXZA 4PYNA 3TMAA 3EPPA 2IIPA 3KR1A 1VLMA 1M0EA 1OR8A 3BWCA 4DMGA 1DL5A 5E1DA 2QRVB 3G89A 4DF3A 3OU7A 4FS8A 2AOTB 2BR3A 3BWMA 4QQNA 5FA8A 2AVDA 3MTIA 4NECA 4P58A 3UWPA 2VDVE 4CTJA 4PYKA 4GQBA 3DTNA 4HGYA 2ZZMA 2GS9A 1N7IA 5GIOE 3C3YA 1MHTA 4E31A 4KIFA 3BT7A 3NWEA 3OZSA 1L3IA 2DULA 4FSXA 4G56A 2JG3A 3GRRA 1D2GA 1RI2A 3JWJA 3LBFA 2AOXA 1YFLA 2CWWA 4X1OA 3S68A 3C0KA 3V8VA 2PGXA 4IV0A 4YV0A 4AZWA 2ZW9A 2XBMA 1RJEA 3FUVA 4ER5A 5HIJA 4EVIA 3UJ9A 3A25A 4LECA 3PVCA 5EC8A 1XDUA 3AY0A 3CJRA 3P8ZA 4BLVA 1RI4A 1VPTA 1AQIA 2EX4A 3BGVA 1X1DA 2BR4A 5CD1A 4C05A 2Z6AA 5CM2Z 4YUZA 3LSTA 1ZKDA 3IYLW 4XUDA 5H02A 2G1PA 5CVDA 2IH2A 4BY9E 1ORIA 3DMFA 4X60A 4CKBA 4PCLA 4YV2A 2WA1A 2P41A 1JSXA 3TR6A 3NTVA 5BW5A 3NVKI 3DUWA 2NYUA 3GWZA 3LCCA 3UJAA 3HM2A 3JWIA 1P1CA 3MB5A 3EMBA 2O57A 3GCZA 1JSZA 4GOOD 5BP7A 5K01A 5E1BA 5E9JA 3P2EA 1B42A 5G02A 4GC9A 4OQDA 1EAMA 3THRA 1EJ0A 5LQKA 2IBTA 1V39A 5KQRA 4PGGA 3EVDA 3ID6C 3GRYA 2PX4A 5E1OA 2AOWA 4ER0A 4M36A 2AVNA 5DTQA 4XUEA 1G8AA 1SUSA 3LDFA 3KU1A 2GAFA 4CKEA 2CL5A 2YXLA 3HA3A 5EQJB 3UJBA 2JH8A 4C04A 3LHDA 1IM8A 5P8WA 4XUCA 2OB2A 4HTFB 5K0EA 1RI1A 3LDUA 4X61A 2P3LA 1F38A 3ER8A 4MWZA 3BGDA 3FZGA 3RIEA 3PTAA 3FPHA 3DR5A 3JWHA 3P71T 2KW5A 5GWXA 3T7RA 3FUUA 5K0LA 1P39A 2QYOA 2DPMA 3F4KA 4M37A 1XCLA 2ZZKA 4E2YA 3CKKA 4PYQA 4WXHA 5EPEA 4E2WA 1ZGAA 3CJQA 3EVGA 3LL7A 3SSMA 2BM8A 3LX6A 1F3LA 2R3SA 5BXYA 2CKDA 5DX0A 5HFJA 4R6WA 1N2XA 1R18A 3KQSA 4LG1A 4RTNA 5K0JA 5LQAA 1XJ5A 1I1NA 1NBHA 1NKVA 4A6EA 4AX8A 4U7PB 1QYRA 3SVZA 2FCAA 2AN5A 3G2PA 3G7UA 4QPNA 5DWQA 1H1DA 2ONYA 4AZSA 5LQUA 3ORHA 2IBSA 3R6TA 3KQVA 3V97A 1FJXA 1SG9A 3FTCA 1RI5A 1SQGA 3OU2A 3FYCA 2PJDA 1RI3A
chains in the Genus database with same CATH superfamily
1S2LA 5IDYA 3R0QA 2GBPA 4B7XA 2SCUA 2PSDA 2ZJOA 2GAAA 3DDHA 1UINA 2ZAGA 4EI7A 2GSDA 3AEXA 1K7EB 1RWQA 3RYTC 3K6JA 3R9XB 4HRYA 1O03A 3K8OE 2WW8A 4TLLB 3KQNA 2QTHA 3LYUA 1CJCA 3GEMA 3IODA 2L42A 3QFTA 4FNAA 4GKBA 4IVQA 1J5XA 1EFPB 4JLJA 4RPCA 1WDTA 3L6UA 5HS6A 2IYOA 1W5SA 1PGOA 2NZJA 2POCA 5ALHA 5A7GA 3U7EB 4LJRA 3TKAA 4IY1A 3QWAA 1MT0A 4PHGA 4UMFA 1WBBA 2IYXA 1V16B 1Z28A 2C3UA 2OGUA 1M1NB 3DBHB 3HMQA 4UBLA 1FRVA 1FQKA 1MNQA 1P2VA 1I2ZA 4PYRA 3QLEA 4WKCA 4OO3A 3HNRA 1Z6ZA 3VR5H 1JFVA 3RLFA 3IBTA 5BV7A 2J7PD 3RANA 4I9HA 5BWCA 3E22A 2X9QA 1P29A 5LQJA 3A6PC 2UUOA 5IDXA 1NJGA 2V5VA 4OXYA 2W90A 2AD5A 2WWRA 2A6PA 3NHUA 1LWOA 1YASA 1M6HA 4QJIA 5JXHA 2FLKA 1G5IA 3WOHA 1YE8A 1YZKA 2GUGA 1IG3A 2BT4A 3COWA 3X1XA 1EGHA 2ZBVA 4JI1B 3RC7A 3M1AA 1UT6A 4HLUC 3HFSA 5THKA 2G9ZA 2ORWA 4Q4JB 5DN6A 3WTBA 3ACCA 3DZBA 1IOVA 4UOZA 4LYJA 2A86A 1N5KA 4CQLB 1GU1A 4FIDA 5G1NA 4GECA 1Z7WA 4IOLA 5BUZA 1Z2CA 4LOKA 1Z34A 3TW8B 1ZMBA 2NAPA 3RFTA 1II0A 1ZKMA 3GVHA 1JHQA 1U7OA 2HZBA 2BZGA 4MV5A 4IDEA 5FPPA 3UW3A 4EHFA 4ZI5A 1E0JA 3E7WA 4GPAA 2NV0A 4Y2VA 1PDVA 2ZRDA 4F7DA 1HYQA 3K53A 4PPYA 4S24A 3JASA 1T1GA 2ZITA 2JFUA 4N5DA 4RYLA 5CCEA 1BMDA 4LQCA 2W2QA 4QU0A 3LCRA 3Q3IA 3S1AA 1R0YA 4N7MA 3NXSA 2J9RA 2WMNB 2B7LA 1VC2A 5ES3A 3WNZA 4QBHA 3CR8A 1SB9A 3TLYA 3TOCA 3ZCXA 3QE2A 4RY9A 3VDXA 2DZDA 1YR6A 4QHTA 2ID9A 3REFA 3O83A 4F04A 2VATA 1YR2A 4HBGA 5A3SA 5UKDA 3ZE9A 3G68A 2OO3A 3GLFE 4AKHA 2O1SA 1XLWA 3LKZA 1WBDA 5DDIP 4J91A 1QO0D 2IXGA 4TTIA 4MVJD 3C3BA 1NLYA 5U4XA 2EG9A 3KU4A 1TO2E 1CZUA 5B1HA 3KOWA 1QO9A 3TKLA 3AB8A 1NXTA 2V7WA 4CT4B 3R9WA 4MKZA 5LD2B 3RBVA 1HDZA 1KETA 3MOGA 4M1SA 1R4AA 2QLJA 3ENKA 4FXOA 1HWYA 1ODSA 2PT7A 4GUAA 4S1TA 2E85A 2IRWA 2POQX 3EWAA 3PD0A 1UKZA 4QUEA 1WXGA 4KRXA 1Y7PA 2P3QA 2VYVD 2BMEA 3ETEA 2AXQA 3L7BA 3A4MA 3QVVA 4JC5A 4UTXA 3RK1A 3TCNA 1E1RA 3WLQA 4QO8A 5BW4A 4NZYA 5BR1A 2OM6A 3A6LA 4W5TA 2CLHB 1JE0A 2O0HA 3WTCA 4YRFA 3VQTA 1E3MA 1CCWA 4JOCA 1JEJA 3OF2A 4RK0A 3PUJA 4BE4A 4DCPA 4AECA 1FP6A 1OU4A 2J45A 1JXMA 3T5TA 2NU9B 1ZVQA 3OZAA 4WVFA 5D85A 5EMMA 2PANA 2VG8A 5C80A 1K3UB 4YI5A 4ZANA 4Q4CA 1JHXA 2NUBA 3E9QA 3JYNA 4HH4A 3ZBPA 4A26A 2HJ9A 4KITB 2NW6A 5EIEA 1NQTA 1SRRA 5IM4F 3PCRB 2W6JD 1RXUA 1QM5A 4CV2A 4CCSA 1B43A 3QEMA 5GP1A 3WJAA 3OC0A 1BFUA 1U8ZA 3VYTB 1T4DA 3EA4A 3Q0EA 1PSWA 2EZTA 3IJEB 3MCWA 1SXIA 2HGZA 2RGXA 2RGUA 2WP0A 2ZQYA 4JB2A 4YMLA 5JZBA 1W0KD 5JS1A 1XRPA 5DLDA 4K9LA 2XB9A 3AF5A 3FFTA 5H83A 2WHXA 2BFBB 2AXNA 3HB9A 4KNVA 1NW4A 3G7SA 1G0NA 3MAGA 1XTUA 3KLPX 2FFHA 2DY0A 2H9AA 3L9XA 4IGKA 5AUQA 3IEVA 1FMFA 3BL6A 1FFYA 1E0DA 4G4SO 2DQKA 2DHQA 4ENSA 1X9IA 4M9ZA 2Y1EA 3DLTA 4UZSA 1KDOA 3L7MA 4CMKA 1EGAA 1QGED 2CLEB 1XQ9A 1P5FA 1PZMA 1X0VA 5IEJA 2Q3MA 3UJ7A 1HMYA 4OQQA 1D2HA 5IJXA 2WIGA 3ESBA 4E70A 3TWOA 1P7YA 1FY2A 1JA1A 1N5OX 4QRDA 3UK7A 3ZC3A 3ITDA 4WBXC 1GL6A 1TT7A 1EE1A 5FKJA 1YZHA 2Z1DA 1AHNA 1RJFA 2A1TR 3RR2A 5ISMA 2FN3A 4O4HA 1L4LA 3RAFC 2BF4A 3FIUA 1P9WA 1XD2B 1P5HA 1KI7A 3U80A 2PZAA 4FYKA 4OXQA 3QKIA 4BQEA 2ABWA 2MSDB 3AM5A 3FTDA 1H1TA 4K81B 4MS3A 5T64A 1XEWX 1DBVO 2ZRHA 3ZHQA 4K88A 1KI8A 2BFFA 4TYPA 1E1QA 4R7GA 2GVZC 2GUWA 1K08A 2JHAA 3EA5A 4D4IA 3EEOA 4DA4A 3MLAA 4RIGA 1RRPA 4QNRA 4BLPA 3HKDB 2ZR7A 4ZAVA 3NR2A 4WBNF 1UPFA 4RNDB 4A2CA 4JP1A 1Z7YA 2ETXA 2JI4A 3WDKA 5AW8A 2HBRA 2RK4A 3J81A 4IW3B 1Y3FE 4I1IA 4B33A 3D8HA 3E7PA 1UJ6A 3RYCB 1LDGA 2HZ7A 5KDLA 3I5YA 1JB1A 1T2FA 1I9GA 2GN4A 1VMIA 4HYTA 3TE6A 3USZA 1Q21A 3TTSA 4DQUA 3I2HA 2X3UA 4IMPA 4YCCA 5L7TA 1T3SA 2B25A 4B2YA 1U31A 2H1WA 1FDOA 2WFAA 1FJHA 3VZDA 4TKVB 3IQZA 4WNAB 3EH1A 5IJAA 3VXKA 2PD3A 2A88A 3VZPA 3D1VA 5IFLA 1FTWA 1RHQA 1ESMA 1IQPA 3R5KA 2OUIA 3AX6A 3H0KA 4P84A 2PQ0A 4EW2A 3GJQA 1B15A 1AHHA 1T8SA 5CFLA 1JLLB 2C2ZA 2Z5LA 3ET4A 1UXJA 2PZKA 1XLTC 2ATIA 3TW4A 4RK7A 1NAHA 2KMLA 3E58A 3CU5A 4F4DA 1XCBA 1TJYA 3HKBA 3SJAA 4DBVO 4YUWA 4U1RA 3TTXA 5K20A 1XALA 1YUBA 3AU8A 1GAQA 1M5RA 4F46A 2VWQA 2YR0A 4IYJA 3G79A 3AF0A 2C2HA 2EYQA 3HR8A 5EJ2A 3OCJA 5HFNA 2O1XA 5A4JA 4PG4A 2D62A 2DC1A 2FYTA 2MYUA 2VAXA 3MUFA 4W5WA 5TGTA 1XG5A 2H2HA 3CLSD 4M8LA 4OFBA 4X95A 4ZREA 1V0JA 1W93A 4GOMD 5D3KA 5KCZA 3HUEA 1IN4A 2D0PB 4LCBA 4NKRA 4V38A 3TM4A 5AVSA 4OX9Y 1HDXA 2J9GA 2CB0A 1X3LA 2OZVA 1SVKA 2ZRMA 4ICIA 5KYVA 3HJAA 3ZHUA 3NHRA 4KFSA 1ORRA 1ULTA 4TXJA 1EQUA 5DYYA 3J7TA 3RKUA 5DTEA 2IWHA 3A1CA 5L51A 1DG9A 4TKUA 1M7BA 1YOVA 2FVXA 1UL1X 3W6ZA 5ITZB 2VTDA 1OH5A 2J0SA 5AXAA 1DFGA 2W6JA 1YHNA 4NYJQ 4Q3KA 3KHKA 3MRXA 5CAEB 3RVQA 5JFOA 4X64B 1XEXA 2WTUA 2Q0QA 3ICEA 4MV3A 1W88B 2FG7C 3G82C 5TGDA 1VJDA 2ONKA 2H06A 1C4OA 2LR0A 3CH7A 3EB9A 4FLEA 3WMEA 5B36A 4NJEB 3MW8A 2G70A 4KRYA 3I3OA 3D43A 1AGNA 2FHPA 4Y7CA 4FX2A 5FPSA 1I5OA 2XE4A 4DXAA 1C7ZA 1ZN2A 3M6UA 3OAAA 1WB5A 4OGLA 4UCWA 4WTOA 5EP3A 4C4TA 1ZHOA 1KJYA 4C06A 2V6FA 5JV5A 5A2GA 1NA5A 2VXCA 2WK1A 3ICCA 4L8FA 4H3KB 4KWIA 3R7BA 3KR9A 4GEKA 1CP3A 1GKYA 2OXEA 4H0NA 4RZHA 5I7WA 3RIGA 4BLSA 1PR5A 4C0JA 4DLBA 4XQEA 4RPJA 5ALKA 1AKRA 5KQLA 1I2MA 1U0NA 2V6GA 3OLYA 1MAVA 2DUMA 4YJHA 1LI5A 1XZEA 2IHTA 4TTJA 3EQZA 3FFXA 5E6SA 1PEDA 5FWYB 2P2LA 3ZQJA 4J7XA 4YRGA 1OAAA 4PXSA 2C4HA 4JR2A 2LNDA 2I6SA 3N1UA 3K1TA 3N76A 1YVEI 4ND8A 5JQGB 4QDZA 4PYIA 4PW0A 1H69A 4FPXA 3FPCA 4UDNA 1CS0B 2A9FA 1TYZA 1F20A 2C4WA 2G3YA 3PTLA 3QITA 4C30A 5KVCA 1HNXB 1YK0A 3N3BC 4HFRA 2QQ5A 3SSOA 1MC1A 1S3FA 2FDRA 2Q99A 5FT9A 4WOBA 7MDHA 1KIFA 1NR7A 1TYDE 4PSKA 1YJXA 4RGQA 5C32A 1XRQA 3SLGA 5CLJA 3QVKA 4HJXA 3MAJA 5H70A 4GOLD 2N1MA 1R8QA 2BMWA 3F5DA 5K3FB 2BM9A 3BAFA 3OO0A 2RHCA 1E5QA 2CNBA 2AKAB 3CR7A 2FUG1 3WWDA 4UAJA 3G8CA 3QWHA 1KQPA 1Q7GA 4J03A 4PVCA 4B4WA 1CULC 1I4EB 3LDGA 4MDEA 2BDEA 2YY7A 1VSQA 2H29A 2LZ0A 4H1TA 4MVJP 4UFNA 2XODA 2HSDA 1YJQA 1M6WA 4C3VA 3W8FA 1LBHA 3PF9A 3UMRA 3ZYZA 1Q0UA 4DY6A 1DCTA 2EJUA 3NX4A 2G7MC 3IOBA 4AZVA 1FTSA 4OJNA 1SO8A 2KJQA 2NT4A 4JGGA 5BQFA 3PD7A 4FWBA 1IHXA 2X0KA 3DKKA 3ZH9B 4YK7A 1UH5A 2J0UA 3AJDA 3A6JA 3BL8A 3O84A 1FLVA 2I91A 1J42A 3BD7A 2I87A 4PO9A 3LUGA 2ORIA 3NHAA 2XKBA 3UMFA 1NQWA 3AEZA 3EXIB 4JQCA 1VJ0A 4G5FA 2R84A 4BN0A 1VI5A 3EQ8A 2QV0A 4ZYLA 1H8HD 4I7EA 1XLVA 1U0RA 3KELA 4Z3KA 2BMJA 2C2OA 4JBXA 2O8EA 4I36A 2QRVB 4M9RA 4XVUA 4RVCA 3GFOA 2V6IA 2M32A 2E37A 2X0DA 1JDPA 2M2IA 1KBZA 1KO4A 5LKAA 4RM3A 1L4HA 1DC8A 3DL7A 3QTBA 1II8A 5IVHA 2O3UA 2M9MA 4E31A 4G84A 4UTRA 1JIIA 1V6AA 3H1TA 3LOUA 1I0ZA 1A5SB 4QUGA 4FYXA 4ZEXA 1ZGHA 4X1OA 3OTWA 3RTDA 1DB3A 3NATA 1W9HA 3VHRA 1TGYA 3EHEA 4PLCA 4MQFB 1M2WA 1CQIB 4LYAA 1GCUA 4RS4A 1NXXA 1QOQB 2FW9A 3O2QB 1TYBE 2BEWB 2BR4A 2HA3A 3EXEA 3R5SA 4K8RB 4OGKA 1THTA 4OSPA 2IEBA 3D02A 3IYLW 4XUDA 4Q05A 3ROKA 2JLQA 1LB1B 4DCVA 4X60A 5EGNA 1L6IA 4MVXA 4B3CA 4CVNA 3C8HA 3ZE0B 1LF0A 3IUJA 4GMGA 1HV8A 3NRCA 3TRHA 5IXJA 3RS5A 3GVIA 2FPIB 4YAIA 2Q2VA 3HUUA 1Q20A 2O57A 1K8YB 3BIFA 2VJAA 4Q3BA 1M1ZA 4UQOA 4WHMA 2CN1A 1VSTA 2OFOA 3NHMA 5A0FA 5LZ7A 3VZCA 4DQDA 8ABPA 4ALKA 2E7ZA 1V39A 1V5FA 3BORA 5KQRA 1N6IA 4DHEA 2FWMX 2JAPA 3JQDA 3LUDA 4KVAA 3AEKB 4XX1A 2G9VA 3W2HA 1R88A 2CZCA 1ISMA 4RGYA 5JJBA 3SIPA 4Y1FA 3HA3A 4FOOA 4Z3DA 3ZV3A 4XRGA 2VKQA 4L5CA 4C5AA 4P0PB 1Z8NA 2ZP1A 3LYHA 4P4NA 1KDYA 1OX6A 1Y9ZA 4HNTA 1U3CA 5L3ZA 3DDNA 3HL4A 1DRUA 1W1UA 2QRUA 4OKNA 4H7IA 3BGDA 3ER8A 2Q3DA 4M8IA 4CM4A 1JHAA 1W8DA 3RVLA 5GWXA 5JAQA 1Q1AA 2GYWA 3PXCX 3D5QA 3ZHCA 3UYLA 1MC8A 1V25A 3D6NB 1LK5A 3F4KA 4YECA 1XCLA 5JMPA 4CI9A 2IPMA 3HB0A 1D4ZA 3EGDB 3CJQA 3TCXB 2QRMA 3LL7A 2QMYA 5CB6A 4R3WA 1GZHB 1ZD4A 2EKDA 2BYTA 3FZQA 1J99A 5B2FA 1ZUD1 4IXMA 1KF0A 1RQ7A 5GV8A 1JALA 1ORDA 1N2XA 3IPLA 1UQUA 3ESXA 4MKRA 3EH2A 1QQ5A 2QQFA 2IHZA 4D4GA 1XQYA 3QKRA 3DE7X 2BF7A 2XUGA 1JFFB 5KNBA 4ZZ2A 4EDFA 3GT0A 3HLYA 4JX9A 5JD5A 2RHBA 5FFMA 1FJXA 2VSFA 2R5WA 3JATB 1ENPA 5GV7A 1JZTA 1X7YA 4EY7A 5JJKA 3FYCA 1YWGO 1NN5A 4EX6A 3B6ZA 4Q7MB 4LNUA 4UBMA 4ZKEA 4F9GA 3TLEA 4MIKA 1WZ2A 1MA0A 2VNKA 2RGBA 3K1YA 1TM7E 4BNZA 3QUSA 2P6OA 1QAOA 2YN4A 5K0GA 1CR0A 2DWOA 4FOLA 2OFFA 3E05A 2L18A 1YR3A 1WPQA 2LUOA 2IDZA 3BREA 1JLRA 4H27A 1IBMB 3GOQA 4I66A 1RBMA 2OXCA 1YQQA 4FDAA 3ZY2A 1J1UA 1AKMA 3H4TA 3U7QA 4NPCA 2F1OA 1X7WA 1M0WA 1ZHFA 1ZD3A 1SA0B 1Z6QA 1E2FA 3QKSB 3U61B 3LE8A 5FFFA 3WMFA 3ZH2A 2Q2WA 3KQPA 2JGFA 5K6AA 1OLUA 4LTNA 4R1LA 1M8GA 1O77A 4XVRA 4YJKA 4CIXA 4F3TA 4PRLA 1HH4A 1G6OA 4JP3A 4A8HA 2P9YA 2AG5A 3LIPA 1SCNE 2GM3A 3B85A 2XMQA 1A8HA 1UJ2A 1C29B 3CW9A 3KKPA 5BOVA 2XGJA 2C9MA 1TK2A 1ECPA 2NTVA 2Z9BA 2C3OA 1F51E 3IOYA 5HKOA 1R0RE 4LYHA 1DP4A 5BQOA 1KFCB 3F5FA 2DP4E 4PZCA 3V4LA 4TRRA 1UDXA 1BCSA 2I6FA 4HNRA 3WQSB 3MWKA 3NNDA 4R9UC 2P77A 2ZATA 4QODA 3T35A 8MHTA 3W5VA 2IP2A 1H2BA 3UBMA 2XUFA 4KAJA 4MS1A 2O9JA 1JHRA 3T7AA 3ASYA 8ADHA 1J90A 2JASA 2QTFA 1Y9DA 4NYMR 4Y9SA 3RD5A 3SBDA 1COWD 4DKXA 1IE3A 2ZIUB 1A8SA 1ZD8A 3BRWA 3NETA 4L95C 4V03A 1Y7TA 5D5HA 3R75A 2PTGA 3VKWA 3PUHA 3NEYA 2ZPTX 1ZH6A 3FLMA 4FR0A 2ZU6A 3UJDA 3WLNA 2IK8A 5BSFA 3WLEA 3LDHA 4FR2A 2FHSA 1RLUA 2LKDA 2BWJA 5EP2A 1HRDA 3HSYA 4CNBA 1ITZA 2I4RA 5DYNA 3A3PA 1SGWA 3HB7A 5A05A 4IIEA 4UPVA 3R77A 4MV7A 3ZWWA 3TG2A 2CWDA 3BT7A 4I50F 3VU0A 3D4NA 4AZ0B 4AZWA 2ZR0A 4BE9A 2CVFA 3NZEA 3WGQA 4GRAA 2FSGA 2J4FA 4EG8A 3CF4A 1QC5B 5LBIA 4HDRB 1P8JA 2FZ5A 4OQNA 4F2PA 1KEKA 2UZ1B 2O8BA 1JR2A 3ZEAA 3ETLA 5KINB 2BGLA 3G6KA 1YD7A 3AI3A 4I55B 3LLCA 4LWQA 4GW3A 1XZDA 1XDGA 1PUXA 2IQIA 3OWXA 3PC8C 4Y9RA 1DINA 1D2AA 3DFZA 2DBZA 4JVSB 2L17A 3WWOA 1S7CA 1EA7A 1NFQA 2CVQA 3FETA 3P9PA 1Z63A 3SQXA 2PZEA 3KTDA 3CTPA 4K6CA 1X13A 1DBWA 2K7FA 3O92A 1TL7C 1N34B 1PRYA 3WNBA 4BZWA 1A7UA 4QM7A 1R6XA 4FI3F 4KKXB 3K2BA 3FTEA 3EOZA 2JGDB 2HNBA 1ESZA 1DZIA 4HPJB 3RRXA 2ANCA 2RAUA 5KYWB 4PGFA 1W87A 5IM4A 1D4OA 1YZNA 3DE2X 4OLFA 2Q4RA 4MRSA 2YDYA 4ER7A 1KRHA 2Y1GA 3MG9A 5HEKA 5BWMA 2QPAA 1U11A 3ENNA 3UPTA 1KY3A 4YP7A 2QD1A 3NJ8A 1MO2A 5CGQB 4EGSA 2NU7A 3JASB 4EUSA 1K97A 3JY6A 4PC6A 5C7IO 5CEFA 4KRFA 3D4BA 2JJQA 1KIAA 1YVPA 2A58A 3GL9A 1C1DA 4JNKA 5D6NA 2XOKA 4ZKDA 2ZRBA 3I8SA 4RTOA 2QLFA 3H1BA 5CGZA 2PS3A 1L4EA 2FR0A 2XLCA 3DLBA 2BEUA 3L8CA 3NBAA 4MAFA 4RJIA 4B44A 1DKRA 2ZYWX 2FP4B 2I03A 3MQFA 4XFDA 3CZQA 3FF1A 5SV2A 1Z5UA 4DABA 3C6MA 1XEXB 4PHCA 2DG2A 3FLBA 2JLYA 1OFUX 1W88A 2PS1A 1QIFA 1IK6A 3C70A 3MSXA 4D26A 1VLJA 3GY0A 1LBQA 5HUQA 1H05A 4TT3D 1XKXA 4LC1A 3F6BX 3RTBA 4Z1OA 1B1AA 5EIAA 4E13A 4LVNA 2OHJA 2ZAIA 1OZFA 1YO6A 3WLTA 2JA2A 3ANYB 5DB4A 2JIDA 2WKPA 2DFDA 3OEEA 2ZRJA 3QLUA 2XIJA 4RX1A 4O4HF 1N5MA 1FF9A 4CF7A 4QDJA 5D1HA 5JARA 4EFDA 4DSNA 3R3JA 3NKLA 3RAGA 2YVAA 2YIDA 4JNCA 3F8SA 1DRJA 4KQWA 4EBFA 2PX5A 5EZQA 2DGDA 5IP5A 2PUEA 4JLSA 5I3CA 2BEVA 3OX3A 3CINA 4DCCA 3EIFA 1E6MA 2FGJA 2YWHA 2YWFA 1EM6A 1K6JA 3AI7A 1G2IA 4PO3X 4JT4A 1ILWA 4TWZA 4XD7A 3NLLA 2F7SA 1Z0SA 4HH1A 1G1AA 2WPNA 4PFKA 5BQPA 5DNDA 1FTQA 3E15A 2EFJA 1KH3A 2ZYHA 4H18A 4MW7A 5ENDA 1K89A 1ZEJA 3AP2A 1X7XA 2GEKA 3OOSA 3DDCA 4XVQA 2OSVA 3QE4A 4IJVA 1SHKA 2P0YA 2QP4A 2Y0PA 3D5EA 3IKTA 2HF9A 1CUDA 3NNSA 4K6KA 4QJBA 5D5PA 3WK4A 1X0XA 2GQ0A 4QNMA 1ZLYA 2FQWA 5I47A 5DGDA 1B7GO 4GLBA 3JQBA 1Z6YA 4RCYA 2ACEA 5AJVB 1Z2DA 2J09A 1WXEA 4RTLA 1CJMA 5KTSA 1NVBA 2FCRA 2O8NA 3TIFA 3CISA 1TRHA 4RWEA 5KHAA 4AP5A 2CV2A 2EXXA 4FJ1A 3UO8B 5LNK6 2QTTA 1LX7A 1VL0A 1FSFA 1O8CA 1Y4UA 4F5ZA 4Y2JA 2IYPA 1P0FA 1H3NA 2EP8A 2PKQP 3JWGA 2VF7A 4O1IA 4F1JA 4EUEA 2V7BA 4NCNA 4TYQA 1T3HA 5THXA 4DLAA 1WCV1 3TJMA 1RHUA 2I3AA 3BULA 2X0NA 1DBPA 4INAA 1TJ5A 2BFBA 2CGEA 2ZYIA 5EHIA 3ZE1B 3ETDA 3TGWA 4KV7A 1HNWB 2GCPA 1HFEL 1H0HA 2OKGA 3KB8A 3WWCA 3P9CA 4BRUA 2VPIA 3ADPA 3P2IA 4HATA 1XD2A 5H80A 4HUQB 3RCBA 1SU7A 3SIWA 3R40A 1DMSA 1T35A 2LRHA 4Z9BA 1ETHA 2NP7A 1JDNA 1YZQA 3EIOA 1PV2A 1IONA 3OMXA 1PL8A 2OYSA 4EY3A 5DO9A 3VPCA 1OIVA 1T24A 2X4GA 1GFIA 4W1SA 3T7KA 4MUMA 3GFQA 5TGZA 1DSSG 1CR4A 1S6YA 3C4VA 4EGJA 3GLHE 2YMMA 4PXYA 3WRXC 5B3JC 5C7LO 3PHBE 1LGYA 5IN4A 2CF6A 3DR3A 4C5CA 3ORRA 1J8VA 2VQ3A 1JJBA 2DFKB 2EZUA 3KSMA 3EG5A 4HHEA 5IH3A 1KYVA 2WUWE 3WMGA 1KH2A 3MJHA 4EENA 4RF5A 4MHSA 3UGKA 3KBOA 4UM5A 2VK8A 3P5SA 2YHUA 2B3DA 2H2GA 3QQPA 1QH8B 4CHGA 5CFZA 1V9CA 3LPCA 1J0AA 3I61A 4OYYA 1T1RA 1IN6A 2PFGA 1JG2A 3F9RA 4L85A 3T52A 5IKEA 3Q9LA 5ESRA 4DLXA 4CIWA 1XTZA 2P6MA 3RS8A 4LY0A 3VJLA 2J9ZB 1JKFA 1HDGO 4F1WA 1RAEA 5B12A 3BZBA 5ITWA 4NEGA 1E5VA 4QBTA 2QRQA 3TR5A 1AN0A 1O7JA 1U7UA 2ACWA 2EX1A 3QFCA 5FLEX 2P40A 2XKKA 3ZGLA 5F7ZA 3R76A 4OQPA 1OBVA 5C81A 3WQQA 4Y2XA 3WR5A 1ONPA 4PX3A 3MINA 4X45A 1BDMA 1Z7GA 2FEKA 4KG7A 1ECBA 1GFZA 2BEWA 2A57A 2CJFA 4I8XA 5IS2A 5JD4A 4HG2A 4H4CA 5GIPE 1DPFA 2NACA 3EBLA 5C1PA 1JSLA 4H08A 4KZKA 2YHIA 4DQKA 3STYA 1A7AA 1Z4MA 2EJWA 2R00C 4B80A 2QUJA 2RDMA 4X1KA 4TTTS 1NV8A 4L4SA 1D1PA 1M2FA 4DOMA 1OYVA 1N33B 1QO0A 3D54D 3DEKA 5HOQA 1JHZA 3PV0A 5CRIA 4BAZA 1TQ8A 3FNFA 4GG1A 4BMXA 4BPBA 2H3HA 4MZXA 5CDFE 5DXJA 3H05A 5TPWB 3INRA 4UULA 3BQNB 4L27A 4DDHA 3DL4A 3MBIA 3VYUB 1NQOA 4OV6B 1EXMA 2YJTD 3EVEA 1KERA 2CEKA 1P73A 2I7XA 3IERA 5FBRB 3ZWBA 2GHQA 2WRZA 3GAAA 3O75A 2QNRA 3N0RA 4LC0A 1IMJA 1FPQA 1Q1EA 2VP0A 3WP0A 1CV2A 1JIVA 1C2YA 1XXHB 3SQLA 2C29D 3U1BA 3HEMA 5BSWA 2G0NA 1BMQA 3UB3A 2IS2A 1E79D 1SCAA 1ST2A 1XL1A 2QKYA 1BS1A 2RONA 1P5JA 3RIMA 3GDGA 4OQEA 4ON9A 3K6SB 2GM9A 3BXOA 5DX8A 4QPJC 2MYPA 4EKYA 3X2SA 4ZALA 1EFHA 1UBJS 4K28A 1YNOA 2D59A 2C58A 2P9EA 4ZARA 3D4IA 3VR6D 4MWCA 1PHRA 4EW1A 3KZKA 4LWPA 4LJSA 4N5LA 5REQB 1HQKA 4XPZA 1PEAA 3IHLA 2CK3A 3DMYA 4TGLA 2WJHA 3WLOA 1V1JA 2P0EA 4DL9A 4DSTA 4B87A 3ONDA 2F4VB 2X0EA 1Z17A 3TYXA 3FKSA 3VBCA 3BFVA 1SXJE 1X7HA 3AKYA 4XPIB 5CITA 2HQRA 2OHOA 4YUVA 3TLCA 2IPNA 5TJHA 2VZ9A 2E2WA 4A0HA 1KYWA 1KK2A 1X7YB 2PT6A 2Q5EA 3ZQ4A 4ZMSA 4MWGA 4TWRA 1ZIYA 2DWCA 1PD1A 1IY0A 3THSA 3N05A 1LPBB 2YJNA 3TOXA 4ADSG 1M66A 3V4OA 1H3FA 1N0UA 3G2MA 4WJLA 3M6WA 3B20A 4RANA 1CUAA 3L92A 1T5SA 2O8DB 1P3Y1 1UPXA 2WNSA 5A6VA 1VLMA 4Y2TA 1HFJA 3FCUB 4TX1A 5CW1A 1T4CB 4MUXA 1YFZA 2P2GA 3BWMA 3L9WA 3QMMA 5JXIA 3MWEB 3PHIA 1WD5A 1QG0A 1W5BA 2P9CA 1ESCA 5KKAA 2EQBA 4D44A 4IGAA 1ELOA 4PZZA 2CLDX 4W6ZA 1JX6A 5BN5A 4LNAA 4XWKA 2WFLB 5EESA 1NHWA 2RC6A 3KJQA 3HWWA 2COUA 4FSXA 2CUTA 1N7HA 1VBNA 4G56A 4D4HA 4F4FA 4JSTA 4ZCPA 1XD8A 3S68A 2XZLA 5CH3A 1HE2A 1AM4D 4YV0A 2DR2A 1UKVY 1NI4B 4REQA 4BMPB 1JR3D 1CF9A 1CS4C 1RJEA 4GYYA 3DTVD 3IR7A 5AJTA 4HEHA 4DPMA 4YV7A 3H9GA 4A9AA 2RH4A 2Q3EA 2QG9A 2W6QA 3DOEA 3NBQA 4QLOA 4YUZA 5CD1A 4MDFA 2ZZNA 2O8FB 3BDIA 1TOAA 4I2VA 1ORIA 3ICPA 2O7NA 3EHDA 2RGWA 4GT1A 4IMRA 1ML4A 2VPXA 2W8BB 1Q44A 3U17A 4KREA 5I3ZA 2NUPB 4X0EA 3HU2A 1WSWA 2AG6A 2PA3A 4N03A 4JU9A 4BDTA 5IASA 3EXIA 1LI7A 4F21A 4DN6A 4PEVA 2QGNA 3K8YA 3U44B 1C7EA 2V0NA 2GVNA 2IHVA 1KJWA 2VRCA 2UVPA 4HUTA 5BP7A 1H5NA 3X44A 5E9JA 3VJKA 3GUYA 4FQ7A 3HFJA 2QMQA 4PHTA 1PL7A 4JLDA 1E1CB 3EXAA 3RFVA 3T5GA 4PGGA 5J5VA 2WAYA 3GRYA 1BGVA 2G4VA 4MRMB 2JNWA 4BX2A 4FUTA 4DS3A 3W6NA 5DTQA 2WG1A 4RPLA 5AMXA 3AV0B 3C1TA 1RACA 4IWYA 1NUAA 4TV8A 4CG0A 1TTTA 3AVUA 1TAUA 1FX0B 3BE6A 3FVTA 3DMTC 3H1GA 3UJBA 4JYBA 4C04A 2A35A 3R9XA 2ZJFA 3GQVA 3MIIA 3G59A 4C0QC 2WIFA 4CEIA 4EY8A 3NNNA 1K1EA 4DDWA 4UJ3A 1W96A 2JH3A 2CCKA 4OUDA 1U0SY 5L7WA 4P2BA 1ISJA 2XNCA 1PZEA 1E59A 3BMQB 4KYTA 1YGYA 2FMKA 5CJPA 1P1HA 5JQWA 4LC9A 1EHIA 1JSRA 2QS9A 4N3NA 3E53A 1EX9A 5DCUA 3O94A 3LLUA 4Q4AB 1C7FA 4P53A 3VGJA 1QGUA 1U8FO 4UHDA 4UVDA 4WXRA 1Z83A 2DWUA 1P33A 4HTAA 4OQLA 2OBNA 1A96A 1QH1B 2FG6C 4G5SA 4K86A 4NENA 2QRHA 3U3RA 3IP9A 4E51A 1HYGA 2LDXA 1B0ZA 4QYMA 1SVSA 5E0KB 3A9CA 3EQ6A 5KOHA 1MUUA 5GONF 2X4DA 1UDRA 1TX4B 2H51A 2I1WA 3H04A 4LXUA 4MYHA 5LQUA 4TZTA 1SIBE 2H7VA 1BO6A 1DX6A 1COWA 2PRKA 3FTCA 4NYMQ 3W2TA 5FHQA 3QSYA 1NUPA 5FUXA 4BZXA 1QHYA 7MHTA 2NZ8A 5BSEA 4RA6B 1GWNA 1DC6A 1RPNA 2YZKA 3JPWA 2FPIA 3LX8A 4X1KB 4YP1A 4MVCA 4RK1A 2Q3HA 4EA7A 1OQAA 1Q77A 1EVQA 1L7QA 2AF3C 2WKSA 3OQ6A 4JC4A 5HK8A 1Z7EA 3BS4A 1KE2A 3REOA 1L5OA 1ZXLA 3D4OA 3GJ8A 4NG5A 2QAJA 4JODA 3X1YA 3A4TA 3OUTA 4D9JA 1SULA 1BRTA 1PGQA 1T2UA 4BUJA 1EFUA 3FMFA 4CETA 4BMDA 4HLCA 5CX1A 2Z1MA 1QHXA 4HNUA 3ZW8A 3IAM6 5EIHA 3SDSA 1ULHA 3BWEA 3GFPA 4QX6A 4FZ3A 3JQGA 4D79A 1B8VA 3AB7A 2I80A 3H9CA 4G0OA 4JR0A 4PPQA 4E5DA 1XMVA 2HHCA 1TMKA 1V5IA 3L0DA 4TTQA 1HMPA 4RESA 2C7RA 3V3KA 2BMFA 4LXGA 1Z45A 4EPYA 1WP4A 4WH0A 4EFLA 5C52B 2PRJA 2AFIA 4RMJA 3MRVA 3PR3A 3HVJA 5REQA 3ZYCA 5GGYA 1C7JA 4EA8A 5JIBA 1BWSA 2W37A 5KVSA 1UKAA 3SOZA 3PFGA 4GX5A 2GESA 5FQNA 1WS6A 3K5WA 3M9WA 5LP1A 3NOVA 2SHKA 1K8ZB 2G40A 2F48A 2HK6A 1JQLB 2J3HA 5DLPA 3OCCA 5HGJA 2ONJA 5BR8B 1B3BA 4ITRC 3QHAA 4GXTA 1TA0A 4PHFA 1SQ5A 3UJNA 5DTIA 2W4IA 4CE6A 3DMRA 3FHJA 2JJ2A 3LPDA 3W06A 2QI9F 4D4JA 3BEOA 1SVUA 4YRLA 1BHJA 2C9BA 2JGNA 1M1UA 2YW2A 2FW8A 1F0PA 3DCIA 3O0TA 1TM4E 2SECE 3K1AB 2JLUA 3HN2A 3IEIA 1C9NA 4X41A 1LZKA 2UAGA 3E5HA 1S8AA 3OJ0A 4LE2A 4OA8A 3OLZA 4TS1A 4DWOA 5JUWA 1LLFA 4RE5A 1E2EA 5LP6F 4D8WA 5K3AA 4MCAA 1BEUB 1OKKD 1V3VA 3MGKA 5LOVB 2DETA 2R1UA 3LUCA 3COYA 4HQOA 4LDAA 3P9YA 2WF5A 2XB6A 3EFEA 3EUEA 5BNWA 2WD7B 5ALVA 4JDUA 4QIHA 4K3VA 4KW7A 1NONA 1JHOA 1SWWA 3L05A 2RSLA 2C5GA 2WVHA 3CV3A 5L8VA 1BE6A 1U2RA 2HREA 2R6R1 4KFUA 4ETMA 3KOUA 1GQQA 3WDMA 3TTVA 2YICA 3MCZA 3DHEA 4W5JA 5G0SA 1DOZA 3MTJA 3ZDZB 2HLDD 4KPEC 5BOSA 3H2GA 1G5HA 5CLQA 4GXRA 3LY9A 1K0UA 1W581 3P94A 2FGKA 4G1CA 3W6OA 2BHRA 1P1FA 2HMSA 1PLJA 3IVCA 3TLJA 2HCBA 1RQLA 4OHVA 3SK0A 2ATXA 3TN7A 4DMMA 5C5EA 1YZGA 5K0FA 1GU7A 3M4XA 4IJ6A 1WQ4A 5AKLA 1KY4A 2RGYA 3FMPB 3GFRA 3NQ41 3H11A 3LF1A 4GP9A 5H3CA 3QW2A 1DC5A 5JH7B 2W8BA 3KJXA 2ZDHA 4PM4A 2CNWD 2FW0A 5ED4A 1Y8ZA 3NBUA 5C51B 2CUNA 1MO6A 4CUKA 1GO2A 2TSYB 2WIKA 3SQNA 2R0QC 4O02B 4C0XA 4WGGA 3UXHA 1U3UA 3O9VA 3NMUF 1Z6XA 2EP5A 3QUQA 3AU9A 5L7YA 1NNI1 3G5AA 4TMXA 3RBZA 1R6BX 3LKBA 4UOEA 5LXTB 2PAFA 3IEUA 2H8GA 2Z6QA 1U63A 2IZ7A 3A70A 4AYTA 3LK6A 1IAVA 3IO3A 4R8RA 2WF9A 3NT4A 4GC5A 3PEYA 3FGNA 3WLLA 1VMAA 3HA5A 3QKUA 1VGQA 4BO5A 3ESQA 2SCUB 2RI0A 1WZIA 2WKQA 1Y33E 4RQUA 3WL8A 5FADA 4DC1A 3PQ6A 1PJBA 4KN9S 2R8YA 1CUGA 1J8QA 5DNWA 2ZR9A 3VNSA 1O1YA 4H6XA 3KJNA 5KYUB 1ZL0A 1XJWA 4M8SA 2A78A 4U2KA 4EQZA 1U9IA 2VR1A 2X5JO 3HPQA 3WLPA 4QATA 5FOXA 2WY2D 2R8ZA 4QELA 4U7TB 4X93A 3I28A 1ZNQO 2JKVA 3QVLA 4C6TA 3V34A 2GPAA 4NOKA 1SC6A 2ASEA 4NK5A 1E1QD 1H2FA 1RE0A 2Q9AA 3KAQA 2CSUA 3GLQA 2A14A 1ZMTA 4HAXA 9GPBA 1TI7A 3N3AC 4OA5A 3QF4A 3DLCA 1M1NA 4YBZA 4RTRA 4YH1A 2P5YA 2IUTA 4RF2A 1AY0A 1KZ6A 5H4HA 3S8EA 5HQTA 1KJNA 2P6NA 3U7FB 1N36B 2FZGA 2DR3A 2NQ8A 3QUAA 4MS4B 2XB2A 1IY9A 5LYJA 4OBXA 1PLLA 4DV0B 4B45A 3UTCA 4ILEA 4JITA 2ZM6B 2K2QB 3E22B 1V9LA 4KQXA 1R4NB 3DWEX 2PL9A 5KNCD 5A7HA 1C0KA 2E82A 1Y9AA 3MPOA 1SU6A 1XQXA 3B7WA 3PWSA 4FGLA 4GPZA 3W2FA 4E14A 5CA1F 4ZQFA 2GEJA 3RS2A 3P4XA 3QOXA 1DQSA 3L8GA 4RELA 1R0BA 1VIAA 4FFWA 2FOIA 3GUCA 2I4IA 3TLKA 1EGMB 1RYYA 3N0XA 4OHUA 3D0OA 4GVPA 3GOHA 3DS8A 3Q2OA 1YXMA 1H4TA 5LQDA 4R68A 1MOSA 2Y1WA 2YY5A 1YZTA 3IAFA 4JBNA 4YDSA 2M1XA 5HP4A 3L7DA 5EHGA 4OK3A 2C2XA 3VH2A 5M04A 5JAHA 4GDMA 4GPD1 3OESA 4LZNA 1LU9A 1W5AA 2O4CA 4W82A 4AMZA 3ROMA 4R1NA 3RODA 4AULA 3STHA 3QEKA 1KTVA 2XX3A 3CRQA 8LDHA 1Y3DE 2HSZA 3G9QA 4TYMA 1L8OA 1IHDA 2QYTA 4P4GA 3U13A 4D9CA 2W83A 5IJ9A 2PUJA 3IPCA 4WZBB 1VJ5A 4CMIA 2A5FA 2OQ2A 2Q2NA 5CU7A 1SKAA 3KQYA 2IL1A 1ZXBA 4GMKA 2QT0A 1NNEA 4ZEOA 4PR3A 4RSRA 1WZEA 1GN8A 2PX0A 4RJ2A 2PSEA 4MR8A 4LZLA 4WKNA 2EW8A 5BUQA 1A1SA 1Y37A 4CDMA 1LNQA 4F6LA 3QBTA 4XGQA 4EB6B 1M6VA 2ANBA 3INTA 1V16A 3IHKA 2OYRA 2WAXA 2IZ5A 2QLBA 3MTQA 1CY0A 5ALIA 1N8KA 3W3AD 4KN5A 1FNCA 3NDPA 1NVGA 3H2YA 3KYIB 3D6TB 1Y6GA 2OXRA 2BEVB 5JNTA 2AEJA 2OESA 2WHPA 1JFSA 2G08A 2B30A 1RJ9A 4I50B 821PA 4YB8A 4HNAA 4WLOA 1KYZA 3DDUA 2YL2A 1LI4A 5HDQA 1RXVA 3NBMA 3A27A 3GARA 2FK8A 4R3NA 3GRPA 5E2BA 3Q3HA 3ZDXB 2WV9A 4ER6A 1CVRA 1D07A 3FMOB 2I2AA 1UFKA 1W2WB 1O97C 5AH0A 2QUAA 3DXXA 5K3CA 3WZ2A 1ISIA 2VDRB 4ZOCA 4FB4A 3C8UA 4NU8X 1FU7A 1YZ3A 4IHQA 3AESB 3NHWA 5PGMA 2Q6KA 3VO2A 4DG8A 2CMHA 1XTBA 4GUDA 4Z0NA 2QVLA 5EZSA 3IVAA 3RRYA 3VBEA 4DSZA 3HQ4O 5HUHA 1DTEA 2PZBA 4EW6A 3ZVLA 5EMKA 5BUSA 2Q0SA 4BO0A 1UMCB 4WESA 4FT2A 1EEHA 5T4EA 2AOUA 1SD5A 2FN7A 5AO9A 3UB2A 2CHUA 3FM9A 4R31A 1LY1A 3WXBA 4NJMB 3DZDA 3WAGA 1J07A 1KVSA 3VPFA 1GUDA 4NOLA 4MDYA 4EB0A 4W9MC 4ARVA 4Q3EA 4L9WA 4H7EA 3K9WA 1A9YA 3N2IA 1YB2A 4GYJA 5K3DA 3V4FA 2AH5A 2HBZA 4GR5A 3SMVA 3ZCQA 5F21A 1C5KA 4OH7A 3GRVA 4B17A 4AY2A 1UK9A 2XXAA 2V6MA 4K6MA 2F59A 2AUNA 1JVNA 3OETA 1K2VN 1LNSA 4PX5A 4QYIA 5JZMA 1GUAA 2Y1KA 4PN3A 3GH1A 4PZEA 4L5IA 3N07A 4H6PA 4ESHA 1JKXA 4U0JA 2Z6VA 5A5EA 1U8YA 5CJJA 2R5NA 3LRTA 1Z5NA 2I7VA 3B8HA 3E8SA 1W4ZA 2OLJA 4L4XA 5SY4A 3RT7A 1DRKA 1Y3AA 3VYWA 3D6MA 3E18A 5EXXA 5F5LA 5FEMA 3L8MA 3VR6H 4ARBA 1S2IA 3ADOA 4G67A 3T9CA 1ZN9A 3NAGA 1GPLA 2ZBDA 2G76A 3H3XA 1X1AA 3LRXA 4HAOA 5SICE 2Q7DA 3UFBA 3WI7A 4MYDA 4EEKA 4FU0A 2ZRAA 4ZGWA 1XEWY 4IYRA 1JKJA 1YONA 3IULA 4X91A 2HU2A 1CHNA 3CVVA 4F0JA 2V7TA 2D7CA 1ZM9A 5ALMA 2XYGA 2OCIA 2PMDA 1D09A 3HB1A 3FDZB 2WJZB 2AC7A 1HNNA 4EKEA 4P92A 5L3QA 5MF6A 2H0RA 4CGZA 3U4MA 1PR9A 1JI3A 1VCHA 4QU8A 2V5AA 3CUKA 4EJ6A 1FPMA 4ZOBA 5GINE 3R5HA 2QYSA 1PS0A 1YS4A 2QX8A 4AN1A 2QUBA 5JQGF 4URFA 1RFLA 3EBPA 3GG2A 1E8NA 1EFVA 1Y80A 2D5AA 3K30A 4YUXA 1JEQB 5IJ0B 1XU9A 1DT3A 2H63A 1QPGA 2JI8A 3QK7A 1P60A 4HDNA 3U4DA 1L7DA 3UHFA 2A3NA 2Q4EA 2X22A 2KB0A 5CBPA 2BDUA 1KBOA 4JXKA 4OLHA 4ZEWA 5CJ2A 4MRPA 4HYQA 1JI0A 2AE1A 1QRUA 2VPWA 3LQFA 3IESA 2CLLB 1V4NA 4LTDA 3H5RA 4MJ7A 4BQQA 4ZTUB 3ZV7A 5JC8A 3KPUA 1S7GA 4II3A 3I73A 2FWRA 2V58A 4EYKA 3T7DA 4Q3CA 5KUTA 1ADCA 1VDZA 1VECA 1E89A 1R4ZA 3MMNA 4NABA 5K0ZA 1QIKA 2W2LA 4GX2A 4YDQA 2JZOA 2HTEA 2VP3A 3QIVA 2P1ZA 3ZLJA 2G7ZA 5IDWA 1DWPA 4AQDA 1B2LA 2WPDD 4ZT6A 3W5HA 4C0WA 1I2DA 2AOTB 5EJAA 5AVVA 2EHJA 1QR2A 2VPQA 1ZZGA 3MWFA 1XR3A 4UBJA 2VDVE 3CN7A 1PZNA 4A8JB 1WU8A 4MICA 3I4FA 4I1SA 5H68A 1J2UA 4BVFA 4G0ZA 3F7NA 3VSAA 3O90A 4RPHA 1R3UA 3U0BA 5K8JB 5B7QA 1DHTA 3ET5A 4RD3A 3W79A 1L3IA 1QORA 3GRRA 2PKEA 4C43A 2GNOA 1WDKA 2PXHA 4P2GA 1X1RA 5LMNB 1R9MA 3DDSA 2XTZA 3G13A 1PI3A 2WM9B 3OIFA 4MUKA 3GN1A 4P3OA 1YRAA 2BFWA 3E61A 3ZWYA 4ZT7A 4EVIA 2Y6VA 2FW7A 2ZPUA 1J49A 3GMIA 4U6SA 2AFIB 2H5EA 4PCVA 3MWLA 1J0XO 4C05A 2FUG6 1T36A 1OZGA 2C4UA 3AKZA 2QVCA 3FB4A 1E2BA 3GZTB 5FNVA 2IXAA 2ZYTX 4XJVA 3W90A 4CKBA 3F6EX 5TLSA 5ESWA 3EXFB 3K73O 5EP4A 1AMOA 3GAZA 5LUAA 2LE0A 1LS6A 5DK6A 3NVKI 1EEXB 1B8UA 1U4SA 3LQYA 3CUUA 3IQEA 3DCJA 1E2HA 3EMBA 4I9FA 4C78A 1URPA 1ZBQA 1S2OA 4K9QA 4UFOA 1JXAA 4YRRA 4F8YA 5A4FS 3JTMA 3PUVA 1TAHA 1YRLA 5LFAA 3GGPA 2MT9A 4N7BA 1EVJA 2H4JA 3FYUA 5SYAA 5FYQA 2AOWA 3VC7A 1FBTA 2PKYX 2HJRA 4DGQA 5KTMA 5JS2A 1MJNA 1ZWLA 2AE2A 1HE4A 2EFCB 2FNAA 4NDZA 3S7TA 4PQGA 5EQJB 4I99A 4H9GA 3H3JA 5J5AA 4NS4A 3ITNA 1BD4A 2ALJA 2HI0A 3M5CA 3I5MA 5E6SB 3AUUA 1VL2A 3GR6A 1EIWA 3MYYA 2M6LA 1OT3A 1Q0RA 3FZGA 3I30X 2LCIA 4JQOA 4L7QA 4OKIA 1F2VA 3ABRB 2VDQB 3T9AA 2KW5A 1FEZA 3OEYA 3ZZ1A 4ES6A 5IWCA 1G4HA 1RWBA 2QYOA 2J5XA 1YCDA 2ZE5A 4E2YA 2KM1A 1OLUB 2QZ9A 3LUPA 5EPEA 1A9RA 2D1YA 5JTUA 3U16A 2F9FA 1L4KA 3VOAA 1H93A 2A9QA 3AILA 3FG9A 1LSUA 5DX0A 3AM1A 4XASA 5AKEA 3ZHTA 1HYBA 4Q12A 3VZRA 1WUKS 2IQ5A 5BOSB 4RTNA 4E5UA 4KLAA 5EWLB 1NKVA 3NIGB 2VJDA 4P81A 3AVXA 4AX8A 4MH0R 1LW7A 2A1UB 1E9CA 3HBJA 3SVZA 4Q16A 4E4YA 4WLNA 4QUAA 1KRWA 3KCQA 5AVKA 1GTZA 3G9ZA 2I8AA 1EUZA 4GX1A 2CZQA 2P3SA 3ORHA 4L76A 4P3KA 4KMRA 4JLNA 4EFNA 4ILKA 3UK2A 3O1JC 2J6IA 2Z3WA 3MLBA 4BBZA 2D1SA 4C6HA 3RHZA 4WXMA 4Z53A 4LJ5A 1MQ9A 2DYKA 1C9DB 1EUDB 1GNTA 1XQ1A 5LZ8A 4CCYA 2O7VA 3SFVA 1GGEA 3I58A 3QLTA 1J97A 3WLRA 1N4AA 4K0RA 4EFKA 1X8JA 1SBIA 3EGIA 3MOIA 3QLVA 4GZ5A 2OD7A 3NALA 1CJVC 4OMFG 5FWDA 2ZIFA 3W34A 4F84A 4BX8A 1SHJA 2QE7A 1O58A 5AJWA 1OBHA 4KC0A 5IVIA 4QDOA 1YRWA 2V98A 2XXAB 2GZAA 4EHAA 1C3OB 1FS4A 2OFXA 5KPDA 4MR7B 3EG9A 4HQNA 3PC8A 1KZ1A 2EDCA 1LCIA 3KPYA 3IDAA 4OREX 1WEHA 3CMCO 3HGMA 3A14A 3E48A 3EBOA 5EIWA 3SLRA 1BMFD 1L8LA 1SUPA 3DKRA 3IQHX 2AMLA 2C2YA 4RH0A 1P7WA 3ZY5A 4A2PA 4I9GA 1S0UA 4MA0A 5MGNA 2X86A 1VSBA 1KAEA 2B3TA 4NU6A 1VKZA 5JS8A 3BHNA 3OTHA 5B7NA 3LVFO 3OC6A 5K05A 4M1ZA 2VTVA 2HX1A 3DMTA 4G9BA 4J4TA 2RBEA 4LCJA 3A7DA 5HM6A 2FSFA 4DV2B 2CLCX 3Q72A 1U9CA 4JBLA 4R1TA 4CCAA 5L4LA 3IC5A 1NOJA 2QN1A 1IXRC 2H1LA 3JQ6A 4MS4A 1ISPA 4Q66C 1RKQA 3OPMA 4YP5A 4OJTA 3UPUA 4U7JA 2HV9A 4F91B 1QXSA 4ZQIA 1KGSA 3AI2A 4JYCA 4LHZA 2X8JA 2R68A 5DSXA 4IBOA 1Y1KE 5EFOA 3B5JA 4Z0TA 1PR1A 2A9PA 3I39X 4KQCA 2JIZD 4PINA 1YKFA 3ZLTA 2AA3A 2ZETA 4D2IA 5A5DA 4DCMA 1N0IA 1SKYE 2ZULA 4MGYR 3RSZA 2FR8A 3BG5A 4AZ3A 1AIPA 1CZHA 1NW7A 2NUAA 2JLBA 2C31A 2XSZD 2AIRA 3FCAA 3PVZA 5J2TB 5C5DA 2IDKA 1HYHA 4LF8B 2J67A 3A2KA 3CLTC 1H0RA 2OEPA 5FX2A 1F2UB 1PQUA 1UJ4A 1FJ2A 3GGJA 1RRVA 2G1KA 3Q11A 4E11A 2P0AA 3GUZA 4EI9A 1I7DA 3HI6A 1KE1A 1H0KA 4NY1A 3EVNA 1QGZA 1OE0A 1UDWA 1WF6A 1FFBA 2IW3A 4KXVA 2DFLA 3PCTA 5HF6A 4KIWA 3RHSA 1Y8RB 2H5JA 4LYDA 2YMLA 1P2FA 4CLXA 3ABIA 1J06A 1ADBA 1TO6A 3GXBA 3UAOA 5TNXA 2RH8A 3MJVA 1ODFA 1JHMA 3UKDA 3LUAA 2NO4A 5LC1A 3KKEA 1ZUNB 1ZOIA 2NVUA 1HT1E 3C3DA 3E9CA 4GH5A 4BRZA 3FN4A 1P1RA 2Q3BA 3F49S 3TQTA 4RKYA 1PNVA 3HZHA 5JI2E 4YLGA 2WZQA 5EXEA 1T0JB 2ET6A 5EOVA 2GZ1A 3GJZA 5KYXB 3VA7A 2H7CA 4BEJA 3GGOA 4TZ6A 1N6HA 4NBWA 3RARA 2Y2VA 3DCYA 4O5AA 3VU9B 4KNWA 1XYVA 3B2EA 4N47A 4ETNA 3DAPA 2XVAA 5EHQA 3U44A 1AZWA 4BO7A 3ANXA 3M6IA 3KZCA 4IG9A 3T7CA 1WX1A 3KDPA 1RCUA 1S2GA 2WABA 3L6BA 2DCUA 4M1EA 3OLCX 4RZIA 3KQLA 1XL0A 4X6UA 3IUNA 2QX6A 4LE1A 1THZA 3QU9A 4M0EA 3LZ6A 4B3RB 2C07A 4HDCA 1BVYF 5ELXA 2LVBA 5CVCA 3B6KA 1Z9BA 3RAPR 5EJ6A 2CNOA 3DM9B 3HJNA 1QANA 3OOHA 4QOFA 1TFRA 1HDIA 1KMMA 3SF8B 3Q1KA 1U80A 4W7HA 4M53A 3RVRA 3ZDBA 2ZJ4A 3KKZA 1PFVA 2OAGA 2R1TB 6PFKA 2WG0A 5JCJA 1G18A 4NNOA 2XDYA 1H9BA 1UC5B 1NVUQ 3F46A 4J07A 3MCTA 5FWAA 3UFXB 4C5BA 3CVUA 1XPOA 4Z4GA 2ID8A 4YMIA 1PSZA 1DG3A 2QORA 5EJ9A 1HLGA 2VOJA 3ICVA 5IN5A 3RNOA 3WIOA 3N70A 4JI8B 3QF7A 4MV0A 4WKOA 3E4DA 1DGQA 2P6UA 2W2PA 2YJ6A 3ZD8A 4DYDA 5BSUA 4I3FA 3RASA 2PZLA 2P4EA 3E03A 3RTCA 5F2NA 2G09A 2VP6A 4L22A 1E2DA 1UAGA 2XVMA 4DUGA 3UAZA 4BIIA 3F1LA 4FSHA 2FWIA 2I2WA 1BXZA 4ZAWA 3U6BA 3LXMA 1Q91A 3T38A 5K6RA 4Y2YA 1JP7A 3BXPA 2BFFB 4I5FA 4WUVA 4B34A 5AW0A 1H4SA 2GMWA 2FX5A 4OP2A 4BX3A 4NCAA 3HNPA 3FHTA 1F60A 4G37A 4JJ8A 3TG8A 2NPOA 2CCJA 2AB0A 3CG0A 3LY8A 4TMVA 2JAUA 4Q1EA 3HJCA 1SG0A 4Z0HO 2AJ8A 1JKJB 2OHGA 2PMBA 3K0EA 2FB9A 1QP4A 3C4JA 2IHNA 1RZ3A 5DNEA 1S8OA 2QVYX 4NHOA 5J4LA 1KO5A 4R51A 3C16C 2AQ8A 1QFSA 1UK7A 4O2RA 2QIPA 5IG2A 2IJGX 1HL7A 1JEQA 4C0LA 4MXDA 2Z08A 1G66A 4RAQA 1GAEO 1C7RA 2B1RA 3PBKA 2OXIA 4QGSA 4R71A 1G21A 1G6Q1 4HSGA 3L0CA 1VB3A 4YP9A 4C4RA 1JNYA 1OFGA 4XOUA 3LBAA 4QSHA 5IAEA 5J2UF 2RHOA 5KYUA 3P9IA 3GH3A 1JEAA 3PDWA 4RENA 2QUIA 2ZCUA 2YASA 3L6DA 4F5DA 5LYJB 1YQWA 3I64A 5ICGA 4JOBA 3AVTA 5DBEX 1CJKC 2XVYA 4N3GA 5ADWA 4FEGA 3A6KA 5D5QA 2YXNA 3D3JA 4DUZB 5EWMB 5EUQB 3O8DA 4ITUA 5AXBA 1MD9A 1N6PA 2WJ4A 1RP7A 2Z98A 4DV4B 2ZSKA 2YIMA 1GA1A 3AG6A 1EE9A 3HVIA 3NYQA 4IKEA 4YAFA 4N54A 5F9FA 4EVQA 1C1DB 2X8LA 4F4IA 4B3TB 4XLZA 1UPBA 3TSAA 1FDUA 5LYYA 3SXUB 3GYGA 1O4VA 3T5PA 2J9FA 2PLWA 4PQRA 1QYWA 2XUHA 3DVAB 1DKMA 2WJPA 4XCXA 5EERA 4F2HA 2HNAA 5F23A 3ESZA 4YAUA 1EUCB 3LK7A 4RW0A 4WCFC 3ZD9A 1I7QB 4KMOA 1DUSA 3U37A 4RFSA 1M7HA 2WG2A 2YVQA 3SYLA 3U09A 2YX1A 3AB3A 4DPLA 3R74A 1ILEA 1XTPA 1JWAB 1MDFA 1P9NA 4FMDF 2OHFA 2BGTA 4UATA 5HZKA 4KH0A 3C3AA 3KB2A 4HGQA 1W49A 2GF0A 2FP4A 3ZGYA 3OFSA 4HDKA 4OXKA 5GM2A 1DAOA 1TNDA 3AP1A 1G5FA 1VB5A 4KQIA 1E2LA 3FH0A 4KXQA 5HCNA 1GZ7A 2GK4A 2QRKA 2D3TA 2JFWA 2ZI6A 3FNRA 3NM6B 4RF4A 2ODEA 3AZQA 4XIIA 4IJWA 1GZ4A 4QDTA 4ZJPA 2IXBA 1AOXA 3LYAA 1AKVA 1SCBA 4AU1A 4B82A 3T0GA 3TAXA 3W2IA 4BQOA 2Z5GA 1KVTA 3ZCUA 4F8EA 1ES9A 3U19A 1N6OA 1BJKA 2VZ0A 4FI3C 1SEPA 2QL7A 4PAWA 5EIOA 4C3ZA 4ARZB 3ASVA 2JAHA 5LLSA 2NVUB 2FPOA 1SVOA 1IXKA 1YR8A 2B6NA 3IHTA 3P9XA 4I1YA 4KJZA 4NQZA 2HD4A 5KAMA 2C59A 1A04A 3WL3A 1E2QA 1JQDA 1TTHA 1ZJ5A 2WTEA 2JI9A 3CH5A 3CPHA 3KKLA 3GLTA 4ATNA 1YI0A 4BNTA 2WHPB 1H4VB 5K8VA 2JFPA 3BWBA 1P9OA 1R9JA 2WPDA 1D9ZA 3IXQA 4Q34A 5JQGA 3HXMA 1TVKB 4A16A 2OP1A 3CT4A 1JEEA 4DQ0A 3AHDA 4ME6A 4EKGA 1UFVA 2OWDA 3E81A 3AONB 2J6HA 3SSNA 1NTRA 3VHLB 1J0EA 1D1TA 5KJFA 4XRRA 1SUFA 4X84A 3VUFA 5ALXA 1KR5A 4MPPA 4D1YA 3NKFA 3D8TA 4QO7A 3KYJB 1J20A 3M70A 1M8PA 2YHSA 5BYJA 4ZYXA 4GOKA 4PLWA 3Q12A 3G5TA 3NTUA 2GTPA 3PYXA 3LVBA 3HO1A 3GAFA 5E7JA 5KNDH 1VMEA 4UQLA 4AMGA 4L9AA 5IW8A 1F5SA 2NLOA 3UANA 2B8TA 2EIXA 5TRTA 4B2LA 1Q7EA 5IT9A 3QVSA 4NS1A 2C97A 5CNIA 1K68A 2IITA 4BP8A 4NMXB 1MRSA 1FYFA 1LZLA 1WHSA 2FWNA 2IXFA 3ZWVA 1Z2OX 1NVDA 4MPRA 2DBRA 2PHZA 3FYSA 3KPVA 4O2AF 2GPTA 3NGMA 9LDBA 1AMNA 5C1OA 5CA0B 4DQVA 4IXWA 1GKKA 1U5BB 5AJYA 5FA5A 3UHJA 1LPSA 3H5TA 5G3YA 1AD2A 3BBPA 4PSAA 4B3HA 1WG8A 1NMSA 1CE8B 1GGFA 3MD0A 5THQA 3FCEA 5KZMB 3O8OA 4X00A 4LJYA 4PYLA 2JFFA 5B57C 4MVWA 1GQSA 3RYHB 2QDXA 4F45A 5IHXA 2A30A 5CFNA 3B2QA 2VI5A 1O94C 2BCJQ 2Z04A 4IHKA 4L74A 4MVJH 1XK7A 3VDQA 1DL5A 3P9SA 5D8DA 1PHPA 3N0VA 5J4YA 5JAIA 3V6LA 1C7IA 2VT2A 3TZHA 5BSTA 3T3OA 2NYVA 2C9YA 5LQMA 2Y66A 4ZT2A 2X5XA 1JG6A 1QZTA 4B7ZA 2BOVA 4UC0A 4GMXA 4ISBA 1KMQA 4PG6A 5JJ5A 3RT9A 4HQRA 3I04M 4NWIA 1DUIA 1L7NA 1RJWA 2Q07A 1TU0A 2HC9A 3WIUA 1IULA 1GN9A 2H2AA 3CF4G 2BONA 3H8SA 1NRJB 1TU4A 4H4DA 1TCCA 5K0SA 4RD6A 2WILA 4QICA 4WLUA 1QJ4A 3WG9A 4MMYB 4C87A 2O2SA 1QH0A 2CE7A 1OREA 1ETUA 3R5FA 5HIJA 3UJ9A 4CKEB 5GZ1A 4RXUA 5F9MA 4BLVA 4LBYA 2Z6AA 4AKSA 2VA9A 5CCDA 2Z5FA 1XPUA 4YBRA 4EIWA 1CFJA 1NNLA 1PSDA 3EAGA 4GHWA 5FBLB 5AM1A 5B4UA 4PCLA 1FCJA 3DHWC 1MMFB 4DDMA 1ZIXA 4U7FA 1IG0A 2B1JA 4YAJA 2GM5A 5JD3A 1KFJB 2CXTA 3PQEA 2FOLA 3GWZA 3A1DA 3KLBA 1I4TD 5IVDA 1F1JA 1H2AS 4DA0A 3DW3X 4DLTA 4EYOA 1J9EA 1U6JA 3V9PA 1WUIS 2Y1OA 4TMTA 3VJRA 3RDPA 1XA4A 1TA9A 4O2AB 5CM8B 4LGVA 4DRZA 4FM9A 3IOCA 4MKGA 3B5EA 5DW0A 5AJUA 1PZFA 2BEUB 4ZGGA 2OHXA 2UU9B 2Y1DA 1UWKA 3OQNA 1NY5A 1G98A 1WSBA 3KD2A 3NWOA 3PNMA 4ZT4A 3N2GB 1G8AA 1SUSA 2FX2A 1ZX1A 4BCDA 1BFKA 4LJ6A 4X9XA 1E7RA 3ZDFA 4D6PA 4WASA 2HSGA 5BWLA 2CJWB 3A9TA 2QE7D 1QYVA 4ZI3A 3QY0A 5DTJA 4ZAGA 2WZDA 5JNWA 4DNOA 3P2MA 1KC3A 1M10A 1UBMS 1XP5A 2KSQA 1XUOA 2CVHA 2VJPA 4H3VA 4DR3B 2AZXA 1XU7A 2Z56A 1ZPDA 3DR5A 3JWHA 1DMRA 2VP9A 4WLVA 1E3WB 1O95A 2XF8A 3DDZX 4Z99A 4M37A 3GLGA 4R84A 2A1TS 5CX1B 4E2WA 5KOIA 3L0SA 2W5UA 4XD7D 5H81A 2Q4BA 3RJZA 1RSZA 4B6FA 1G4UR 1JS1X 4ML3A 4QOEA 3DB2A 3KVNA 3G8YA 2IY7A 4H7DA 1OY1A 2Q8QA 3FDJA 3W5DA 4BO4A 5K8TA 5LBUA 3U40A 3R20A 2PVPA 4MNTA 2JKYA 1QYRA 1WLYA 3G7UA 2WYWA 4J0IA 4LOHA 2JZCA 4C7BA 3TLGA 7ADHA 1ADYA 4X8MA 4AZSA 1N2GA 3Q3VA 4YO8A 3UMVA 3E6AA 2BVNA 3KSZO 4DV7B 1Q19A 1K6EA 1RI5A 2VCHA 5KYXA 2IS4A 4XB6B 3WK9A 6ABPA 3M4ZA 4B71A 4BMNA 4IMIB 2UYHA 1NRIA 1J70A 4YT8A 1D2NA 1IIBA 1DT5A 3SYRA 1W2GA 1FOEB 4W1QA 1XRRA 1FMCA 1PL6A 3T5CA 10MHA 5EJMA 4TKVA 5KX5A 2B36A 3T5MA 1YHYA 1WB6A 4UXIA 1MV5A 1EDZA 1WWKA 4DRXA 3GLFA 3D8SA 3NM4A 1A4RA 4IUDS 1SN7A 2TMYA 3LNCA 4NHEA 2HA0A 2QZPA 3TO5A 2OB1A 4A15A 1U2DA 4V0RA 4M55A 4J9UE 4TRNA 5BWOA 2BZSA 3A26A 2R8EA 2I6GA 5LSAA 1TJNA 3RPEA 2O0MA 1BX0A 3I37X 1SQ0A 1ZJJA 2AGVA 4G5YA 2BHTA 1OFUA 5B3KA 5KNBH 5DM4A 3LTEA 4FHZA 1Z0DA 3F74A 4OSOA 4B76A 1AN9A 2Q21A 3DBIA 5CFOA 3B1KA 4HLUA 1Q0LA 4IILA 4DYHA 1T2VA 1CUIA 2L2QA 3CZPA 4UUOA 5BV8A 4HS4A 5J63A 3I52A 4YJGB 2IOHA 3IO5A 3O9ZA 1QTIA 5GONA 2OA0A 2O5VA 2IIBA 4JEMA 1Y5RA 1HDYA 1W4LA 2Y4NA 3LPLA 3FROA 3G1UA 3L3BA 4K46A 2NWQA 1KJZA 1OT5A 3MPUA 4ZQCB 4UU8A 4CHTA 1E1YA 3A6HA 3LT5A 2VHUA 3KSDO 4QLAA 3R4CA 4YAGA 1AXRA 1KEUA 2GWRA 5J2TF 4X92A 4X8OA 3ZWMA 3TBFA 1U5BA 3A1EA 4Y6SA 4XA8A 5DT9A 3SEQA 2XQKA 1LLQA 1P72A 3OU6A 1AC5A 1DIOB 1H6AA 2FF7A 1PIWA 4WK6A 4CL3A 2ZIWB 4JD5A 4C4ZA 4MCIA 5LMUB 5FD8A 4CTOA 3FWKA 3GLVA 3VO8A 4F3CA 3R7FA 1ESDA 1X42A 4DDUA 1NE2A 3EJWA 3OKCA 4I8DA 3K8ZA 4E6PA 1P3DA 1Q2UA 2BJHA 3ED1A 1NKTA 3RVMA 4HRAA 2X6TA 2HLDA 3Q1LA 3KO8A 5SYNA 4FFSA 2R85A 4MMZB 1J2YA 3B9QA 3O4JA 1MVLA 2EOAA 2YWRA 3PNLA 4IS2A 1E1LA 1U9YA 2C77A 4L4YA 3S55A 3L77A 5LDHA 2GX6A 4CEIB 4XLTA 4URXR 2QY6A 2O2ZA 1UWLA 4YJFA 1VPEA 4UMEA 5KIAA 1HORA 1OAKA 1SOAA 4FVTA 4DXHA 4RZUA 1BMTA 1B26A 1G2OA 3E1KA 4HNSA 4WZZA 3VV3A 5K09A 2HUNA 3PIRA 4YQYA 2IGTA 1NP7A 1MAAA 3TUIC 2E6UX 4F8JA 3LY5A 4YIHA 4O4IA 3E27A 3INGA 1J1ZA 3ZK8A 2QM3A 2Q50A 4JJ6A 2C88A 4XFJA 1YAJA 5T57A 2FSIA 2OFWA 3R3YA 4LYYA 4E09A 4CNQA 4BYMA 1QZZA 1ULSA 1VSVA 1WV0A 2OY0A 4NV3A 1SUAA 2VWPA 3L7JA 1GL9B 1JIJA 1Z4IA 4NAUA 4CPDA 4J0EA 3VAYA 3DLPX 2REBA 4MINA 2QL5A 1YFJA 2I9KA 2PSJA 2D8MA 1BJTA 1OHHA 5ER9A 4JASB 3ZU3A 3C3KA 4ID9A 4P0QB 1BS9A 3FOBA 5B1YA 5CCXA 4O29A 4PFQA 1LF5A 4MUJA 4MKFA 3OZUA 3TRIA 3WA7A 2BGIA 3IP5A 1VL6A 2VHYA 4J2OA 4P7GA 1IVNA 4R5MA 2MCFA 3A9UA 2PX8A 2R60A 3CNHA 3JTEA 2PJZA 3CWQA 5DLQC 2ZI9A 3E4CA 4Q47A 1IC6A 3DC2A 3E8MA 4CEJB 2WSSA 1EVZA 2LDBA 1JQAA 3MJCA 1CF2O 5I9SA 3AHFA 2VDOB 2W4MA 3O8NA 1C0IA 3T1HB 2MSWA 1ZZEA 2JF0A 4FBMA 4KH1A 4CLHA 4JLOA 1U0BB 3K0HA 1JR6A 1D4AA 1WM1A 4KO4S 3I9LA 1MP0A 3OAAD 5J2TA 3EYWA 1GADO 2ERXA 4FONA 1Q7RA 3IAS1 3WHLA 5AUPB 2K87A 5AKKA 2PIDA 4L0QA 3SJBA 1ZESA 5JO9A 4WXYB 2JLZA 4N9WA 4Q9JA 4BB6A 1SVMA 2XVXA 3AOEC 4NNJA 5A06A 3ZDDA 3LGXA 1FYWA 4D0NA 3UT5A 1UKEA 1GZ3A 5JNRA 4G4JA 4YCNA 3CONA 4KE9A 1I30A 2O1EA 4K9NA 3FRJA 3PC6A 3O1LA 4AYWA 2WQZA 3LQRA 5CB4F 3DAGA 5DRTA 5I7UA 2RAFA 1JG1A 1HFKA 2DLNA 1NW3A 1W19A 2WHYA 4GP7A 4XUGB 5D3ZA 4EPXA 4F4CA 8GPBA 1L1QA 2Q5QA 2NM0A 3B60A 3CF2A 5DK4A 4OIMA 5G0VA 5IBRA 4PN7A 3ZY3A