3KPVA

Crystal structure of hpnmt in complex adohcy and adenine
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kpvA00
1HNNA 2NXEA 3FUVA 3G2QA 1JSZA 2YTZA 4XUDA 2C7QA 7MHTA 1JG4A 3LECA 2PJDA 2FPOA 1NW7A 3FUUA 4RTRA 2P35A 3M4XA 5K09A 3C3YA 3KPYA 4BLUA 1ZGAA 2ZIEA 2ZIFA 4A6DA 1RI2A 3M6VA 3REOA 4RV9A 1HMYA 3KPUA 3NDJA 4PYNA 4DMGA 5K0FA 2AN4A 2XYQA 3DP7A 4C4AA 3DTNA 3TFWA 5KS2A 1BHJA 2YXDA 1KR5A 5EQJB 5HFJA 3EMBA 4M36A 1KPGA 2BR3A 5CVJA 1Q0TA 3GIWA 2P1DA 1NW6A 1QAOA 4E2XA 4OA8A 3RW9A 5FA5A 1WXXA 3KQOA 4RX1A 1L3CA 3UJDA 4EVIA 1RJFA 1RI1A 3HVJA 3PT9A 2R3SA 3BWCA 4QPPA 5K8VA 2XVAA 4ER5A 1WS6A 3KPJA 2JHAA 5DM4A 3CJQA 4X1OA 1B42A 5G02A 3LCVB 4YUZA 4Y30A 3FPEA 2O57A 3DOUA 3PX3A 5FWAA 3P2KA 3S68A 3PTAA 2IGTA 1QZZA 3I64A 5T64A 4HGZA 3UJ6A 5HIIA 3C6KA 2YXLA 5FTWA 4CTKA 4E33A 5GOZA 4LECA 1M6YA 4KIGA 2G1PA 2V7EA 5EMJA 4R8SA 3TM5A 5K0EA 2VDWA 3K6RA 1JTEA 4GOLD 2UZ4A 1NW3A 2NYUA 1V39A 2ZLBA 3RIEA 2A14A 3T0IA 3PS9A 4KIFA 3ELDA 1YF3A 3GDHA 2AN3A 4UOEA 1I4WA 2JHPA 1QAMA 3E05A 2ZBRA 3EVEA 3GRVA 3LBFA 5F2NA 3SX0A 5FA8A 5EIWA 3EGEA 3LKZA 3FPGA 3B5IA 3BXOA 4JXJA 5FQNA 3LSTA 3LDFA 3QOXA 2AOVA 3NWEA 4XUEA 5U4XA 2BM8A 3UJ7A 5CD1A 4ATNA 2ZTHA 5F2OA 4WVLA 4YUWA 4P7JA 1DUSA 5T67A 3KR0A 1U2ZA 1QYRA 3HNRA 4GEKA 1NW8A 3SXJA 1NBIA 1Z3CA 3HCAA 3LL7A 2GH1A 3OE4A 1JQDA 2ADMA 2IH4A 3MTEA 1KPIA 1RJGA 4XCXA 3A27A 5DM1A 3FRHA 3C6MA 3PLAE 3DR5A 3KQYA 4KVZA 1XJ5A 2JH9A 3BKWA 4RTPA 4BP1A 5FULA 1R8XA 1R00A 5GP1A 2HWKA 3G7UA 3TQSA 1I9GA 3ER8A 4KW7A 1R18A 3O4FA 4AX8A 2B9EA 3LHDA 4CWAA 4POOA 1SVUA 5BW4A 3EEYA 3HA3A 2JH8A 2EJUA 3LX6A 1P1BA 3KQTA 5ICGA 3QOWA 2YQZA 4PYIA 4PNEA 5E9QA 3TKAA 3G8AA 2HV9A 2CMGA 4E30A 3CVOA 2ZZNA 2DPMA 4KRGA 5LQRA 1YFJA 3DH0A 4PYLA 2B2CA 2ZBPA 10MHA 1ZHFA 5DSXA 1XDZA 2P7IA 2ERCA 1NW5A 1JG2A 3M6WA 3DLIA 3UJCA 3T7TA 1X19A 3FPFA 2E5WA 2PGXA 4DCMA 1L3IA 4IV8A 5KQSA 2I6GA 4GUAA 5F2KA 4HH4A 4MIKA 4GBED 4GOMD 5C1IA 2CL5A 2VS1A 2IFTA 1NT2A 3THRA 4C04A 2O0LA 4CKEA 3KU1A 3EVGA 3HTXA 3NW9A 5DXJA 3FTDA 2PXCA 2VDUE 2G70A 3EVBA 2C7OA 3KPVA 2VZ9A 3I9FA 1F38A 2P3QA 4CKBA 1SG9A 1SQGA 4ISCA 2ZBQA 5E8RA 4GF5A 2I9KA 2GS9A 4RVGA 3CC8A 5EPEA 4BY9E 3EVCA 3IYLW 5K0BA 2AZTA 2EJTA 2ONZA 3ANXA 3KQQA 2UYOA 1D2HA 1RI3A 2VP3A 1VP9A 3DUWA 4E2ZA 3L8DA 4YV1A 3AXSA 5FHQA 3KR2A 2YX1A 1EQAA 2PBFA 5CVVA 3P2IA 4P7GA 4QQKA 3DULA 1JTFA 3EVDA 5E9WA 3BWMA 4ZTBA 3UBTA 2H11A 2I62A 2NNWB 1JQEA 2CMHA 4F84A 3EVFA 3HA5A 2Y1XA 1X1DA 3VC1A 4E70A 1YFLA 3PB3A 5ICEA 3MHTA 3QV2A 4X60A 5JR3A 4RTKA 3AY0A 4FSDA 3GRZA 2OKCA 3DMFA 4PIMA 2OXTA 3FUTA 3MAGA 1X1CA 3EVAA 2HTEA 5ERGB 4KDRA 3TRKA 2AOWA 2FK7A 1NE2A 4H0NA 4F85A 1D2GA 3LDGA 2EG5A 4P58A 5CVEA 5CIYA 5M5BA 3FUWA 3GCZA 1KP9A 5LQCA 2FRXA 3VC2A 3CKKA 5E1DA 1L9KA 5GINE 4IV0A 5EHIA 1RJDA 4BP3A 3MB5A 2H1RA 1WG8A 2HNKA 2ZZKA 4C08A 1KPHA 1L3BA 2PWPA 1G60A 4RVHA 1WXWA 3V97A 2P41A 4OA5A 3BWBA 4HTFA 3ME5A 3DMGA 5D1NA 2KW5A 1MJFA 4OX9Y 1AF7A 1P91A 5LSAA 2BR5A 1Y8CA 3NJRA 1INLA 5LQUA 1P1CA 4K6MA 1G8SA 3HCBA 2ZWAA 2PX4A 4LG1A 5EKUA 2BH2A 1DCTA 1JR4A 3BZBA 4FP9A 1VPTA 3Q7EA 1VL5A 4U7TB 5DWQA 5DX1A 5K0JA 1TW3A 5K0GA 2OZVA 5DTQA 4RTNA 2QY6A 2OB2A 3SM3A 3SR4A 1MHTA 5LQKA 2ZULA 4EMSA 1KIAA 1NV9A 2PVCA 4HTFB 5DX8A 3TLJA 2CWWA 4PYMA 2XYRA 2Z6QA 4ER7A 1KYZA 3FTFA 4PGHA 1TPYA 2AOUA 3P8ZA 3P9CA 2PT9A 1VP3A 4FT2A 1KYWA 1NBHA 4DZRA 1X1AA 4FT4A 4Y2HA 4YUXA 5LQAA 2QYOA 1EAMA 5H02A 3BKXA 5HZMA 3R0QA 1XDSA 2UYQA 2IP2A 3GWZA 3OZTA 1YZHA 2OB1A 3A25A 3KHKA 3M6UA 4OQEA 5E8JA 4G56A 3KR1A 3OPNA 3K0BA 4GC9A 2H00A 4QQNA 3EGVA 2AVDA 3E7PA 4FGZA 1VE3A 3D2LA 3G5LA 3OZSA 1JG1A 4M37A 2P40A 4FZVA 2PXXA 4RVFA 4M7RA 4RWZA 5GM2A 3UA4A 4CTJA 4YV0A 2P8JA 2XYVA 3R6TA 2ZW9A 5DM2A 1WZNA 4E32A 4DKJA 3P9NA 1ZGJA 4E2WA 4YV2A 1F3LA 4X63A 1TW2A 2ZSUA 5ICCA 2UYHA 2NXCA 4CKCA 4F86A 2G71A 1NKVA 3EPPA 3UJ8A 1KHHA 2QRVB 2G8NA 5BW5A 2AOTA 1FP1D 3MQ2A 3PVCA 3IV6A 5K0LA 3NVKI 4LWPA 2B78A 4DA4A 1SUIA 3A26A 3ELUA 2NP6A 3NTVA 9MHTA 4YMHA 4MWZA 3MCZA 3HP7A 1O9HA 5GWXA 5EGSA 2IIPA 1XCLA 1YUBA 3KPWA 5JUWA 5K05A 3THSA 1EG2A 3AWIA 3EGIA 5BXYA 3GRRA 5KQRA 2ZCJA 3LKDA 3CCFA 4C05A 1FP2A 4PIPA 4MHTA 1N7IA 4DQ0A 1ZQ9A 2O05A 3TOSA 2P7HA 3OU6A 4GC5A 4ER3A 3B3JA 2YVLA 3U81A 1IM8A 2K4MA 3BGDA 3LGAA 2F8LA 3UWPA 3HCEA 5HIJA 3OU7A 4HG2A 1AQIA 3SMQA 3FUXA 2EX4A 1UIRA 2I7CA 3O7WA 5DX0A 4E2YA 4HGYA 1XDUA 3JWIA 3MGGA 3SVZA 2IBSA 2PXAA 5LR6A 2HR1A 5FWDA 5K03A 2ZWVA 3KKZA 5EOVA 2LD4A 5HEKA 2ZZMA 3R9XB 4YMGA 4DM3A 4QVGA 3TPZA 1G6Q1 1XTPA 4P7FA 2GAFA 4U7PB 3BWYA 5FHRA 3HM2A 4EQZA 3ER9A 3BT7A 3GRYA 4Z2YA 1G8AA 3GJYA 3I53A 3SSMA 5T6BA 3M6XA 4EK9A 3A7EA 3X0DA 3KQMA 4BLWA 2ESRA 4R8RA 5LQNA 1G38A 5GM1A 4V0QA 3JWHA 2ZIGA 1SQFA 1VIDA 2QRVA 2PV0A 5C9ZA 5DTRA 1N7JA 3G89A 2Q41A 3HVKA 5LQJA 5EMLA 5FUBA 3BGIA 5DRYA 2P3LA 5HOQA 4CXMA 3NDIA 2PY6A 3SSOA 1KXZA 3GGDA 4PYOA 3DXYA 5DSTA 4QDJA 3FPJA 3NWBA 5EZQA 5P8WA 4PYKA 1JG3A 1FPQA 1H1DA 1Q0SA 3B3FA 4NECA 1XXLA 2ZVJA 5FCDA 1FJXA 5EHGA 5EKXA 4RTMA 5CCXA 4AZVA 5CM2Z 4L7VA 5CVUA 2WA2A 2B25A 2GB4A 2ONYA 4IWNA 4B17A 3A7DA 3GXOA 3CJTA 4OBXA 1UWVA 3GRUA 2PX5A 3HEMA 3PFGA 3IEIA 5K0CA 4P7KA 2B3TA 3JWGA 3UFBA 1O9GA 1RI4A 4RTQA 2PLWA 2YXEA 5ICFA 3UA3A 5HILA 3ELWA 2PT6A 3DMHA 2DULA 3T7RA 4RTJA 2IH2A 2JHCA 4HRAA 4OBWA 2C7RA 3BUSA 4AZTA 3GU3A 3HVHA 3C0KA 2YR0A 3O31A 2IBTA 5DXAA 1RJEA 5EC8A 5EMMA 1XVAA 5E1BA 1UFKA 2AR0A 3ID6C 1M0EA 3G8BA 2PKWA 3R3HA 4QTTB 4GOOD 3DLCA 3ORHA 1D2CA 3OFJA 1VQ1A 1PRYA 3M70A 3C3PA 3V8VA 4C06A 1JQ3A 3OE5A 1IY9A 2R6ZA 4C03A 3RODA 4C07A 4ER6A 3OZRA 3OCJA 2GLUA 3E23A 3MTIA 3G2OA 3G5TA 2VDVE 3FTCA 2V74B 2GA9A 1I1NA 1G55A 5CVDA 2UYCA 2JG3A 2FCAA 4PCAA 1L1EA 2XVMA 2OBFA 3ELYA 2IDKA 4QTUB 4E31A 3HA7A 3MERA 4RTOA 2AS0A 2BM9A 5EIFA 5CCBA 3E8SA 3MCTA 4EKIA 3KQVA 1BOOA 1RI5A 2XBMA 3UJ9A 4RTSA 2PWYA 3KQPA 4YUYA 3HCFA 5EEGA 3VSEA 4PYJA 5CUQA 5EVJA 3LCUA 3NMUF 4KDCA 4PCLA 3H2BA 2HMYB 1DL5A 1R74A 1ORIA 2AOTB 3VYWA 1JSXA 2C7PA 3EMDA 4QDKA 2OY0A 4QVKA 4RSRA 3KQWA 3P2EA 4DCGA 1EJ6A 4OQDA 3AXTA 4EKGA 3I5UA 2QM3A 4GOND 4RYLA 4RVDA 3FYDA 3HCCA 1SUSA 3G2PA 3TM4A 3GNLA 2FHPA 3EVZA 3R24A 1QAQA 1SKMA 2Y1WA 5KYGA 1YB2A 5DRTA 5DT2A 4R6WA 2WK1A 2QE6A 2OO3A 5GIPE 3SSNA 5K01A 3WSTA 3G2MA 2CKDA 4AZWA 4XUCA 4QPNA 3CJRA 3PFHA 4O29A 3FTEA 4X61A 2ORED 2EFJA 5E1MA 4PINA 1R6AA 4HC4A 2Z6UA 5HIKA 1AQJA 3ERCA 1EJ0A 4V0RA 5K0NA 1M6EX 3B89A 4GQBA 3HVIA 4AUKA 3A4TA 2P3OA 1YZ3A 2AOUB 5DLYA 4PYQA 4MTLA 5EEHA 3LCCA 3DXZA 3KQSA 3SGLA 3BGVA 1VLMA 3M33A 5FADA 3OU2A 3LDUA 5D1HA 4PWYA 3DXXA 4R6XA 3FYCA 4ER0A 3B7PA 5EMKA 3P97A 2JJQA 4BLVA 3KR9A 3UZUA 2NP7A 2FK8A 3NVMB 1P39A 1NV8A 8MHTA 3T7SA 1O54A 3FRIA 1AV6A 1BC5A 1T43A 4A6EA 1ORHA 3GO4A 5E2BA 2OYRA 4LWOA 3UJBA 3EEOA 2IDJA 3PX2A 1R8YA 1XCJA 3HCDA 2PX8A 1PJZA 5DM0A 3P9IA 3F4KA 2NXJA 1VBFA 2OPBA 1FBNA 3OFKA 3UJAA 2AN5A 5B1SA 2BR4A 3CBGA 4PONA 3CGGA 5DPMA 5FQOA 1EIZA 1N2XA 3Q87B 1IXKA 2AOXA 4RTLA 2FYTA 1WY7A 3LPMA 3AJDA 3TMAA 4PGGA 4M38A 4IKPA 2O06A 3FZGA 2IH5A 1BKYA 4FSXA 5KVAA 4HSGA 1ZG3A 2PSSA 3TKYA 4FS8A 2YUIA 5E1OA 5MHTA 5IKMA 5GIOE 2N47A 1ZKDA 2GPYA 2NXNA 4WXHA 3I58A 1OR8A 3P9KA 3G88A 4MQ4A 1QANA 2Z6AA 5EG5A 2AVNA 2IPXA 4FR0A 5HIMA 2WA1A 4YUVA 4X41A 5EZSA 4R05A 2G72A 4DF3A 5DTMA 5IH3A 5E2AA 3B3GA 3FPHA 5C0OE 5BP7A 3JWJA 3LBYA 2PX2A 4KWCA 5E9JA 2BZGA 3P71T 2ZFUA 3IHTA 4AZSA 1X1BA 3TR6A 2O07A
chains in the Genus database with same CATH superfamily
4O4IB 1X7DA 2ZSJA 2BGUA 2YTZA 4XUDA 5C35A 3EIHA 3MUNA 2CUZA 3E2IA 5DGDA 1J22A 3HQ4O 5D85A 5JS7A 2Y4OA 1N2CE 4JS0A 2PGOA 2ZXUA 2ZIFA 3ULKA 1E9FA 3C4VA 4YAFA 2J0QA 1NP3A 2W71A 4V3BA 1F4VA 1XPRA 3DQQA 1BE1A 1MKYA 4OFZA 3T54A 2ZI5A 4DMGA 5LYJB 1IZZA 3DTNA 4MHSA 3QEOA 3UT6A 5DBEX 5ISMA 3O0DA 2O5VA 2P8SA 1N5OX 1PEDA 2R8EA 4JUAA 5FA5A 2FSVC 2H31A 4F2WA 1L3CA 2EATA 4H7JA 3T5DA 2R3SA 4QPPA 3FR7A 2XVAA 3QYAA 4MJLA 1NRJB 4S1WA 3KAKA 3F5SA 4BNLA 4KUEA 1E1MA 1NY5A 2HSEA 2VP2A 3DOOA 1WXDA 4RHFA 4D8XA 3FPEA 4YUZA 3NEYA 2R1VA 1REQB 4ARZA 4AI6A 4EBBA 1G3RA 1XTBA 3WYEA 1Z7BA 2XOKD 3CX8A 1HDYA 2DTXA 3JYLA 4URXR 1XAGA 4CLDA 1Z6XA 4FNGA 4IOLA 1M6YA 4LECA 4NNOA 4RESA 3PYMA 3M5DA 3R3YA 1V8DA 2JBAA 2P11A 2IUFA 1EI9A 2BGJA 1U0SY 2V7XA 1V39A 4DSNA 3V3TA 4Z4GA 5IBRA 1BD4A 3VR4A 1Q12A 1X7XA 2P4EA 1XTJA 3T4PA 2ZE6A 4Z3OA 4J7XA 3KIPA 1QK3A 1U9CA 1YC5A 3ZWMA 4IF4A 4W5TA 1TDJA 4DTIA 1CUCA 5MGNA 3EC1A 2WVAA 1Q74A 1E2PA 4WOBA 1U0HC 4R5HA 5TPZA 5C1OA 1LU9A 1AUOA 3IBGA 5CXQA 1EP9A 2B0CA 5T67A 4G4JA 2GZMA 2H0RA 4HB3A 4KVAA 1GSAA 4F4HA 4GEKA 1U02A 3A11A 1OOEA 1E3QA 3GLIB 1BMFD 1XKXA 2QD1A 4JU8A 3NPMA 1BTOA 2HIAA 1U8AA 3STXA 5I6DA 1EU1A 1U5AA 1ATZA 4LRYA 3AF1A 1IBKB 1YQEA 3ABZA 5CB4A 5KX5B 1U90A 2VJMB 4D0GA 1JA9A 3IAM6 3ZDYB 3UAOA 2JJ2D 1P17A 1R18A 1A5BB 3RPEA 4BKQA 4RQBA 4GDFA 2FP4B 4AQDA 4FFMA 4K6GA 3WVNA 3N7AA 4IHQA 1SBIA 1V1RA 5C5DA 1JR3E 3STYA 3LTNC 1CNEA 1M2OA 1RAAA 2OR3A 2H7CA 3KOUA 1MA0A 4RSGA 3RG2A 3MELA 4D81A 1Y6ZA 5PNTA 3ZE6A 1VJCA 3MN1A 4HJRA 4NICA 2CMGA 1A2QA 3HJGA 1JW9B 3OO0A 5GQSA 3VJKA 4RH3A 1Z4JA 2AZ4A 1ZI8A 1D09A 2ZIVB 3R0JA 5E6RB 5FJJA 5G1NA 2HDNB 4QBIA 1YR2A 5JHGB 3DL7A 2QX4A 4IG9A 3U5ZB 2J46A 1B3BA 1FTWA 4BLPA 1ZESA 4OIFA 4IV8A 1GAJA 1Z2NX 1I2DA 1WX1A 1BS2A 3VFDA 3NR2A 4NQRA 1P2VA 1CUFA 2PMWB 3NASA 2AQKA 2C77A 1KDZA 4Y6QA 5ALDA 2P6UA 1KGDA 1IY2A 4C4PA 5A6SA 1Z29A 1EESA 1RKQA 3MGAA 2VDUE 4JCCA 3VZQA 4XZ3A 1Y4UA 3MTDA 1Y42X 1X9IA 2PR2A 3DBOB 5A3JA 5ALUA 5MGBA 2BGGA 2C2GA 3JARA 1XRRA 1SKYB 1IBCA 4KQEA 5TS3A 3M3DA 3P26A 1OLSA 4J0FA 4X6LA 3UXMA 3WGZA 1UPFA 1ST3A 2BELA 4Z2AA 2FDRA 2R97A 3ZBPA 8ABPA 3BMNA 5H70A 3TSOA 3ZV7A 3EX7C 1Y9DA 4U2KA 3LUPA 4RNDB 1IB0A 4V1CI 5CVVA 1U9YA 2H2WA 1VPVA 4BVHA 5AVOA 4BMXA 3AI7A 4Z49A 1OI3A 1FNMA 5KDDA 4LJRA 1H3EA 3LMKA 3QV2A 3L7CA 3LVBA 1LJUA 3ST7A 2R1VB 2AXNA 2QPTA 2O8BA 1GPLA 2YIMA 1X1CA 3EVAA 2HTEA 2W98A 1Q7BA 1C2TA 5M5BA 3AF5A 3JQ6A 1Z06A 5COBA 5K8UA 1I4DD 1N0HA 1W34A 2A59A 2Y1KA 4Z6KA 2ZTUA 3O4HA 5D86A 3VYVA 1NQUA 4LUCA 3C87A 4C4SA 2R87A 4M4SA 3A6JA 3M6LA 2E4UA 1SR8A 2PUJA 1HSOA 2GKGA 3ISTA 4OFWA 5B7QA 1G60A 4IDCA 4RVHA 4DS3A 4B6GA 4CGYA 3E5HA 5DBIA 1IJKA 4HTFA 3SHQA 3A6LA 3N2ZB 4GPEA 2QAGC 1XQWA 3B8EA 5D1NA 3WGJA 1EXMA 1T91A 1T34A 1W5SA 3FFXA 3K92A 4BNXA 5LZ2A 3DDWA 4RPLA 3WNZA 4DR2B 4N3AA 2XUAA 3PTZA 1K5GA 3HCBA 4AG3A 1MA3A 3NC0C 1ZCZA 3WV4A 1V5FA 2UZ1A 4FP9A 5K0GA 4U2DA 5BNTA 2DUWA 1OLXB 2OHVA 3F5MA 1P8AA 3RAEC 4O4LA 2B6NA 4WQMA 3CZ9A 3KUKA 4RM2A 1KIAA 5D3MB 5DLDA 1DBVO 1H9BA 3H1TA 2CNLA 4K5QA 1YDEA 2H7YA 2FZLA 2P5TB 3K9HA 1GT91 2BVNA 1J2RA 5LQAA 2JI6A 4ALMA 5AVSA 5BSMA 1JP7A 3W8FA 3V48A 2EYUA 3D8TA 3FDZA 5HSGA 1UOOA 2HHJA 3DLPX 1UQUA 2LR0A 3LF1A 5KREA 4W5WA 3KQHA 3JD4A 5C46F 3F8TA 3IC5A 3AEKB 3IIIA 3EZYA 2AVDA 3N2GB 4DMLA 3HSKA 3UCXA 4C3ZA 2BFCB 3X1JA 3K8ZA 4MVJD 4GU5A 3VOBA 1H0HA 3HWRA 2ZW9A 4CM4A 4MV1A 1HZZC 1RM3A 1A4XA 1YHZA 2B4YA 2PA0A 2W2OA 3D31A 3DEYX 4XM1A 4PO9A 4X63A 4EJ2A 2W6NA 2BEUA 1XNJA 5M3BA 2NPFA 3QKIA 4ETIA 1YZQA 3EPPA 1Z8NA 5AYVA 2B21A 4C0XA 3NETA 2PSFA 3T7DA 1P3DA 1R8QA 2JCVA 1N25A 2B78A 4G8JA 4D7AA 1P2DA 3BTVA 3CMMA 4RDIA 1Y8ZA 1SBZA 3EK2A 2UZ0A 3LLMA 5FRDA 1UDCA 2I2AA 2VHQA 2M1ZA 3A8TA 3F71A 1A2KC 2YICA 1LF5A 1L7OA 3FPCA 3O3NB 3H2JA 1TVCA 2IIPA 2FR0A 3IDZA 3ZVNA 2ZCJA 3ZDZB 1W4ZA 4PNPA 4ZI7F 4OHOA 1YAJA 5BN1A 4PIPA 4AJEA 1X7HA 4ZAXA 3F7MA 4PSCA 5CLGA 3HGTA 4GC5A 2YVLA 4HFRA 5BORA 2H2IA 1Y7IA 3LGAA 5A9RA 3BG5A 3VVLA 3D81A 3A9VA 1XA4A 2JJYA 3QXCA 3L7AA 4IX9A 1Y34E 2XE6A 4UBMA 3RM3A 3SIPA 1XQ6A 2ZAIA 4BRSA 2GQ0A 5A3SA 4PFQA 4ZO4A 2XQJA 4EG4A 1RXIA 2PL3A 5T8KA 4F6RA 1YZLA 3OZAA 3IMGA 5M2QA 1MUUA 4BO8A 5AVYA 2ZWIA 4M9ZA 1VLVA 2LD4A 3AI3A 5H4HA 3ZI0A 5BR4A 4NBKA 1VKRA 3BF7A 1EUZA 3JS5A 4BXOA 2QUBA 1G6Q1 1J97A 3PHJA 4P7FA 4G8CA 3ZDFA 1HETA 2FQWA 3ETHA 1PLKA 4EYKA 2H4ZA 1XPOA 5K0ZA 5TEVA 4OXNA 4LHVA 3FLEA 1MGPA 2EKQA 4DIEA 3BSYA 5LQNA 2J59A 3EWSA 1QGDA 3HN6A 5LOVF 3A6DA 4JGBA 4WKPA 2IPOA 4I9NA 4YWHA 2EW2A 1KK1A 1D5WA 1G4HA 2C58A 1DBRA 2XCQA 4NZZA 3EIQA 4FUTA 3UBMA 4XJSA 4RL6A 3GCXA 3P9XA 4CMCA 1H05A 4L7QA 1K8RA 1ZISA 4AZVA 4YX9A 4MR9B 1SAYA 2WJJA 3CO0S 3JQRA 2E5FA 3NTQA 4P38A 2AN1A 3HB0A 2NZXA 4Q4AA 2YIDA 5EXTA 5JDCC 1N6KA 3KKKA 1UMBA 3OIYA 4M7WA 3TX6A 3KOXA 2NOAA 3HL4A 1MX5A 1L5NA 1IHPA 2KM1A 2V5VA 2J9RA 4P82A 1XZQA 2O48X 1B4DA 1U7XA 4PZ0A 3ZE9A 3GLGE 4ZTUB 1ZM9A 3ELWA 4EJ6A 2RE8A 4C0HA 1GU0A 5B1EA 3ZUPA 1DMRA 3RNLA 3VPFA 3V55A 5DXAA 1MTZA 1M1ZA 1ULAA 3LUCA 4IDAA 4X90A 2HOQA 1RD4A 2V7QD 4LI0A 1UFKA 2YV4A 4XJXA 4AJJA 1K86A 2WYUA 2I6TA 3FWKA 3QV1A 2VPZA 5KYKA 1M5RA 3BK1A 3EZXA 4UW9A 2XRMA 4MQFA 2AXEA 1XAHA 5DTEA 4DDUA 3V8VA 1JHDA 1JQKA 3V4LA 3PL5A 5FR2A 3R5KA 2O2GA 2VEOA 3EJ6A 1ZXXA 1QNLA 3BRWD 4B33A 5CFMA 1KI4A 3WRXA 4DLRA 3THWA 2IGBA 4WNYA 3RRFA 3B2QA 1OIVA 1ORWA 4CCSA 4PG5A 4OUKX 1I80A 1ODTC 1QQAA 1M73E 2ZB3A 3I0NA 3ZH9B 3L4KA 5JECA 2F3PA 2X4GA 3DWIA 4F9GA 5EWLA 4Z3DA 4JHXA 2GD0A 3FM9A 4H4CA 1X7XB 2ORIA 1N3YA 4PVDA 4CDRA 3RSCA 5THQA 4F46A 1NUQA 5IANA 2PUWA 3E9MA 2YWCA 4X1KB 3ZY2A 3QUSA 1U9IC 3UANA 1GRVA 1THZA 3AGQA 2DLCX 5KVQA 4EHKA 4P0TA 3AOGA 5CFQA 3TTXA 2CWDA 5EUBA 1BDMA 2E1PA 2P77A 3GJZA 3PFCA 2R8BA 3U3XA 4DBVO 3K35A 1ECJA 3PD7A 2VAVA 4IRXA 4QBHA 1ZOSA 4QQRA 2JGAA 2B8NA 2WK1A 3AJEA 5GIPE 3AC0A 4D9FA 3KYDA 1IUNA 1N5LA 3VGJA 3WSTA 3BFPA 4YR7A 5FAKA 2R44A 2Q1SA 4PO1A 4W4TA 3TRHA 5LA6A 1W47A 3CUYA 1EJBA 5K8LA 2BISA 4TVSA 1BJKA 1ZITA 4B8WA 4EUEA 3JQPA 2ZR0A 3I04A 1WMFA 4FU0A 5HM6A 3B89A 2HXYA 3USCS 1SVOA 3KYIB 3SPXA 1KU0A 3TGWA 4MTLA 4DCNA 3DDNA 3WFJA 4EJSB 1DINA 3DXZA 3SGLA 1ZJZA 2PHZA 4TWBA 2C0QA 1HEUA 4PNZA 2C5LA 2VSXA 2D1SA 3EDYA 5JQWA 3WB1A 1NX6A 1EGAA 1L5FA 4LIPD 4J3JA 1CZLA 4NCNA 4PWYA 1XMOB 3HRHA 3CSSA 4E3WA 3NBYC 4KGXA 3GMIA 1S8FA 3L8MA 1CY8A 4RK7A 1KIMA 1PFGA 2WIAA 1E2MA 3I01M 3KZMA 3NYIA 3G0IA 1RWXA 1R5OA 5KC9A 2VYNA 3ETCA 2HA7A 2Y05A 2JFYA 1Q91A 2JAUA 1IN5A 1PTKA 2Q7DA 4CN8A 3CLUD 3WQHA 4O2AB 5GONA 2F55A 1YIAA 3M9WA 4EHBA 3I6QA 2C2BA 2N1BA 3QKRB 1J2YA 4YBZA 5ETJA 1ZM2A 1K68A 3ZC3A 3P9IA 4ZI7B 3AU8A 3F4KA 1KKMA 1IDOA 1LFDB 3DFMA 3K09A 3RK1A 5EKSA 3N6XA 5B1SA 3ZCSA 4AY6A 2OAGA 1M2NA 3A9SA 1OLUB 4Z4QA 1ZVVA 4IO0A 5CDUA 5IM4F 4DR4B 4RS4A 4IQ4A 1KI3A 4WBNA 4C7VA 3D5TA 3ZDBA 3T95A 2D2VA 3MMNA 3O1LA 2PKCA 1J8FA 1ENPA 2A0KA 4FS8A 3H75A 4WOPA 1N5DA 1OA0A 1AQYA 3MYRA 1MBZA 1SU4A 2DH5A 3OKCA 3TW4A 1DQNA 1TA4A 1NXVA 1G16A 1TM3E 3V8PA 3OM9A 5B7NA 2B1GA 3D7SA 1X8LA 2FAXA 4BKRA 3D6AA 1O87A 2J6HA 4FILA 2H2GA 3B60A 5DHFA 3IHWA 4NF2A 4Q4DA 4R68A 4M99A 3JATA 4BO6A 1K7YA 2Y68A 3IOCA 4MYCA 1NF8A 2G9ZA 1WDKA 3ZZMA 3UT5B 4WK6A 1E6CA 2WOOA 1OXXK 3ADDA 2Z30A 1OYVA 4ETMA 3OPYB 3ZLUA 2XZPA 3H0CA 3LT4A 2QI9F 2HRRA 2Y3IA 4QYIB 5DCLA 5FO0A 4UM9B 1T5LA 1H4VB 1B8PA 3WV5A 1G1MA 3QBJA 3R0IA 3VKGA 4FUQA 1OMOA 1T9BA 1ZGAA 2AW3A 3C74A 5DYWA 1PNVA 2HZ7A 1NU8A 4JKYA 1M8GA 4F3NA 4X92A 2ZUFA 1H8EA 4IF6A 3EWNA 4OQ4A 2ZYDA 4CIXA 2GF9A 3H13A 5FI3A 4MWSA 3TFWA 4B2PA 1EUDA 3X2FA 4BV9A 3EC2A 4CKWB 1FUYB 1THGA 2FW8A 4CNBA 1PBNA 2Q3HA 3QVJA 5H3CA 4X66B 1QONA 3PUWA 5JADA 3RK0A 4DBLE 1AZTA 1SXJC 2IYSA 4LK3A 4ZHQF 1CJVC 3KVYA 3JSXA 8AT1A 5EE1A 1SOVA 2CK3A 2WG1A 3FHLA 4NABA 1XZBA 2NV6A 1MJNA 2OM6A 4DJAA 1WF3A 1EINA 3WWOA 1ACJA 2VFAA 1IUOA 1UZUA 2YWEA 1P9WA 1T5IA 5FWAA 1EFVA 1QTNA 3CZPA 3PUHA 2AH5A 2GFQA 3CEMA 4MA4A 4UFNA 1V5WA 4YROA 3VRHA 5T64A 2Z1MA 4H08A 5I47A 3L0PA 2C84A 3O4VA 1GUBA 5FTWA 5LPNA 2QMHA 1P2UA 5AVJA 4E07A 2YV5A 3PT5A 3VVBA 3GMTA 1A8SA 1D2EA 1QH8A 5FBZA 1PJAA 4G4SO 3OOSA 4GOLD 1JILA 4HH3C 5BSKA 4RWEA 4LJYA 4PBRA 3DV0B 4QEZA 4I1PA 3RARA 3ASYA 3G0OA 2GEJA 4CV1A 3FNEA 1XCBA 1T8YA 3PQ2A 1R4NA 2C5BA 3H1EA 4DJDC 1MEJA 3BRQA 4OK3A 4L08A 4MR8B 1QXSA 1NC1A 5F7ZA 5GONF 2ZSBA 2O2SA 4J1NA 2LGJA 2AT1A 4ARUA 3FPGA 1RYZA 4EGAA 3HU5A 4LYHA 4OXQA 4TL9A 4XR4A 1XFAA 1VFNA 3GVCA 3VZDA 1LS6A 4D3DA 4TMTA 3C1OA 3OZEA 2J3QA 3A6GA 1G6KA 3LRPA 4HCJA 1V3QE 2WPDA 2X14A 4OY3A 4DSAA 2PZBA 1PGJA 2CXPA 4TLEA 1U2RA 5A9SB 3IPXA 3OE4A 3R23A 1G8JA 5KDLA 2Q7OE 5JJCA 1FQOA 4JEMA 4G84A 1K88A 4Z7QB 1YJAA 1AUPA 1EZZA 2BHNA 1KERA 1W93A 3DM9B 4GYWA 5AK5A 3RJMA 4CM5A 4EA8A 1KHTA 2QF7A 4TMWA 4L28A 1TQ4A 1DKRA 2V97A 3AL3A 1GRRA 4MV0A 2VR1A 3FOCA 4QLAA 5BVGA 5H68A 3GGOA 3X1WA 4OXRA 2NSJA 3NLLA 3T1YB 1SZDA 3DE3X 3PNLA 4NPAA 1CY2A 5JZ9A 5C53B 4YLEA 2Z9CA 3A3NA 3HU2A 4MWGA 1IZYA 1RXUA 2I76A 2Y1EA 4CWAA 3PXAA 1R0SA 4N0DA 4Q5IA 3KTAB 1Q57A 5EI5A 3ED1A 3VR1A 2P69A 3UXEA 2VDWB 3N87A 4HB0A 1GNVA 3PDWA 3QOWA 4ZDKA 3FTPA 1SZCA 5LBUA 4A36A 3RYTC 3BXHA 1N36B 1R9MA 5EE0A 4PLCA 4M8SA 5ARCA 1DJMA 1E7YA 2B2CA 3ITKA 2XX3A 3Q5GA 1OU4A 4JVOA 2C4WA 2JDIA 2PL5A 3M5PA 4KC0A 3SCZA 1X42A 4KJZA 1AU9A 3PRKE 4NYIR 1KJ9A 2XT6A 4FW9A 5AK6A 3U7IA 3O8RA 4CYMA 2E5WA 3VHXB 1GO2A 2FNAA 1VLLA 1E98A 1M2JA 2QL5A 3O2QB 2PPLA 2WIGA 2XJ4A 1KP3A 2Z5LA 5F2KA 4DCVA 4QUIA 5A4MS 2ZUEA 2R6FA 5ER9A 2FQ1A 4HH4A 2Q99A 2VATA 4IGIA 1NZDA 2X2OA 2OGZA 1NATA 1GXSB 4D80A 2BFMA 3AIOA 1JMYA 3GAZA 1JQBA 1P6XA 3AR4A 2GBPA 3FB4A 3E82A 3GCWA 1X14A 1ZD3A 3MT7A 4PLTA 5E4FA 1UBRS 1KBOA 2YH2A 5AI0A 1ULBA 2FR8C 1UXIA 4KBGA 2FUEA 4MVJP 3AERB 1L5SA 2MSEB 4LJSA 2RK3A 1T5SA 3RSFA 4Y1RA 1J8YF 4KOEC 5HZGA 3AXSA 3UXHA 1DVRA 3KXLA 2YIVX 1IYZA 2LE0A 3L7MA 5WRFA 3ESYA 3WXMA 4DIBA 1XALA 2WNHA 4UARA 4E5KA 5M7EA 1OW3B 4P93A 5LXTA 2PH1A 3L7YA 4NE9A 3HCOA 5REQA 3VR4D 3K71B 2Y1XA 5CLQA 5EPUA 4HRVA 1MQ9A 1OZGA 2DY1A 2C20A 2XDWA 3CO5A 3GZNB 3JWPA 1KSGA 2ONKA 4ZOLF 3UUEA 1WHTA 3B70A 5TGZA 3W7VA 4KDRA 1YR6A 3JYPA 5HQJA 3E4CA 5IFLA 1T9GR 2DR3A 1D2GA 3O5AA 4CMJA 1QFJA 2WWXA 3IDSA 1KAEA 2IV3A 2H4XA 4ZARA 5JFOA 3IKMB 1Z16A 1B74A 3O8OA 4OK5A 1R0ZA 1RLUA 3ZNOA 2HKIA 1KO7A 5FL7A 5KKNB 3NHAA 4DW8A 5L7YA 2JB9A 2QSJA 4RMHA 3STUA 1J2JA 5SICE 5H83A 4M21A 3ME5A 3DB2A 4R3UC 3ICCA 3ACDA 3QWIA 3MS2A 4KVFA 1XA0A 3BEDA 3ESXA 1YNSA 4B34A 4AYTA 4BWFB 1IG3A 2IQ5A 4JJIA 4NQZA 4WGGA 4EMTA 1PR3A 4P22A 3G9UA 5EFZA 2B6HA 1QKJA 4BC0A 4R1UA 5HBRA 2JLAA 3WDLA 4BNHA 2I6SA 3JZIA 4KTTE 2OQRA 1QZUA 5BV8A 4EMSA 4ED9A 3HM9A 1U2QA 1PSWA 1H42A 3GUYA 4CQNA 4IQGA 3ZBUA 3PR2B 4LZOA 3VO1A 1E5XA 1UR5A 1X1AA 4QUAA 1DIAA 1Z7WA 3C4JA 4ZCPA 3NAMA 4U8GA 3UOWA 4D9GA 1HXHA 3DWGA 3QU5A 5ED0A 1LI4A 1GZ4A 4PXAA 5HK8A 3ETDA 1K27A 5HZMA 5H7XA 2GXAA 2RJ3A 2WG0A 4QM6A 2OAQ1 1LK0A 2E4WA 3OOYA 4EO9A 1RRGA 1AQ6A 2PWBA 4P5PA 2XDQA 2I0FA 3VTKA 4HS9A 2CBXA 1NM5A 1NTOA 2JIZA 2WU1A 3BJRA 5T4FA 1XMJA 4WFJA 7ABPA 3G7NA 3H05A 2H00A 1JJIA 2FY8A 4Z51A 4LHXA 5TJ9A 5IAAA 3V34A 4X91A 2H65A 4YRFA 3USES 5K9ZA 3OBBA 3BZWA 1H22A 3HADA 4J6EA 3A1FA 2KQUA 3LPNA 4YV2A 3BHIA 3OCXA 4F1WA 4LF6B 4J94A 1PT6A 4IIHA 1FDOA 2NXCA 2PBZA 4OXXA 4I1IA 4Q34A 5ALGA 1Y4SA 4U6SA 5JJBA 3UJ8A 3TBHA 3EBOA 3A37A 2V7TA 1T2UA 3NAGA 2ZITA 3CM0A 1XZNA 2X1MA 2IBMA 1SUIA 2JFXA 4HAUA 1AHNA 1PUIA 3ZNNA 3MAAC 3LUHA 4FMCB 2LP4Y 4EZBA 1WUJS 2FZCA 1XZJA 721PA 5DW0A 1IUKA 1I32A 3HP7A 5K05A 5JXJA 3QXJA 1O6CA 3EGIA 1M1UA 4E5PA 4U0JA 3DE1X 3QLVC 3RQIA 2R6CA 3B20A 3FMPB 3VDMA 4C7MA 3MJ4A 3OJLA 3EXG2 4J0IA 2IYRA 3LIIA 5EIXA 4AMGA 2D6FA 1YONA 4MV7A 1I14A 2I4MA 3SJAA 5HQ3B 3S28A 4HG2A 3ZD9A 2VPPA 3TLMA 3F7OA 4OQFA 5CNJA 3V4OA 4XUGB 5ENVA 4YMUA 1TL7C 1P8JA 1JHMA 1M2EA 2E0IA 1YKFA 2JD2A 2ODWA 3W1WA 3WLRA 3HR4A 2OZLA 4QTYA 2OWDA 3U7HB 1TIPA 1ADBA 3VZSA 3CLSD 2O2JA 3U39A 4JL8A 5IDVA 1TAUA 3QJYA 4KMMA 4NENB 5SY4A 4MMXB 2AG6A 1V96A 4QXRA 3JD1A 4NFYA 1GA1A 4LAFA 4TXLA 2JVIA 2RJOA 5EHQA 1C7RA 1YAHA 2VQSA 2XB9A 2DKFA 2WE7A 4LOLA 1FLVA 3ZHXA 3CH4B 1H6AA 3ILHA 1M1YE 2JAHA 1CVRA 4MGIR 2Q5CA 3QENA 1CR2A 1LNQA 4K2HA 5KVVA 2RH9B 3K6KA 1W5AA 3VJLA 3IP9A 3VU9B 2MYTA 4MLDA 2QMZA 4ZICA 3W9UA 4QZVA 1AKWA 1BQ3A 3BSFA 1Z4IA 4IM7A 3B3FA 3ADOA 2YN4A 3AR5A 1UPAA 1RVV1 3PEFA 4G5YA 4G0ZA 3VVCA 5C18A 1WV1A 1FFHA 2WA2A 3AF2A 4NPHA 4KYVA 2IYFA 5JMOA 3A7DA 2Z8YA 4PC1A 1A9SA 3QI2A 1RP1A 3C3XA 5FBWB 1T36A 2B3TA 4NU8X 4G2TA 4NJMB 3RU3A 1HI9A 3GN1A 2Q4EA 1ADGA 5ICFA 3ZHYA 3KJNA 5LLTA 3C24A 1F2UB 1PEKE 1T1RA 1LB1B 2MSWA 2O4UX 1LVHA 2QN6A 3MSXA 3MUFA 3T4EA 1ZRSA 1TQHA 2J9ZB 4LYFA 4BYMA 2WHXA 2RARA 4ZIRB 2IYLD 1CLUA 1U28C 3NV9A 3QWAA 1QE3A 1R4ZA 1M0EA 1J99A 4EY5A 2PXHA 3P9ZA 3MOIA 5HCIA 4KV9A 4P4TA 3N9IA 3OIWA 4PHGA 1YBHA 2ILTA 2Y1FA 3KJQA 3ORHA 4MRSA 2Q3FA 2ONJA 5I8PA 4DHEA 1ZXBA 4WCVA 1VQ1A 1XVUA 4E5UA 1MN6A 2I2WA 4NESA 4UOQA 5ITZB 5JCJD 3N2IA 2VNIA 4N3CA 3I23A 4QQFA 3DTTA 5AI5A 4RULA 2G17A 1G8HA 1OBHA 1SPXA 2Z4TA 1DBWA 4HP8A 5FB3A 3DDSA 1P0FA 2Q4TA 1HTTA 2Q07A 3AY7A 3MTIA 2XB4A 1TD9A 3ESQA 3AEUA 3NOQA 3OETA 3R5TA 1L5KA 3SZGA 3I1IA 121PA 3WYAA 2B1JA 1KFJB 2QLMA 1XTVA 5JBNA 3OPMA 4FSHA 1WOMA 4Z4EA 4QTUB 3HA7A 1CJTC 2G09A 1CUYA 2OLKA 4EABA 4EMBA 5IT5A 3BIOA 1YZGA 3MCTA 3C43A 2CVZA 1O96A 3I04M 4JR1A 4EEZA 1IXZA 2IHJA 1L1QA 4Y0NA 2JCXA 5HJ2A 5J2UF 1XT6A 5DBFA 3U13A 2I80A 4PCLA 3VZPA 2FQYA 1DFGA 1DRVA 1ORIA 1Y3IA 2ETXA 4RKRA 2C4UA 4BLOA 2XXBA 4KNWA 1QPZA 2ZPAA 4QFBA 1QP8A 2QX7A 1ZFNA 3N2KA 4HXFB 1JJFA 4RA9B 2XKBA 4OQDA 1FY2A 5MDHA 1J8MF 2VYQA 4LXIA 4RYLA 1IJFA 2CNBA 3Q7TA 4GX2A 4J49A 4PSKA 3G2PA 4LYYA 3W5VA 3QUQA 2JGJA 3AT1A 1EFTA 5JD4A 1XZDA 1XX6A 3BEOA 4P9NA 1JX6A 3GI1A 4DZTA 4A8HA 3AILA 1DELA 3K20A 5KQGA 5JTUA 1GUYA 3FOWA 2FRDC 3EOBI 2IU6A 2B20A 2EKDA 1VRVA 1CVLA 4KDEA 3U7FB 3EHEA 3AHIA 4LGYA 4EL5A 3CJRA 4BX8A 5LMCA 3IOYA 5AMXA 5DE3A 3U61B 3U4AA 3M6IA 2D5BA 5CDHA 3JX9A 1RBMA 2QR5A 5IT0A 2PKRA 1J1ZA 4GQBA 2PUEA 5G3YA 5JS2A 4RD1A 5BN5A 2HJVA 5DLYA 5B30A 3B3AA 2B4QA 2VUIB 3OQVA 1VJ0A 2DWCA 1N57A 2NV2B 3KQSA 4QBFA 4XE5A 4YXWA 4RKQA 5CK4A 3RJTA 2XQKA 1M7BA 4K3UA 1U6JA 1UPCA 3LDUA 3FSEA 1JMVA 2Z3ZA 4KEAA 5AM1A 1OH8A 2JJQA 2PO7A 3HCNA 4ZREA 2C3PA 4P1ZA 2GSDA 3QSYA 2DEUA 2NP7A 1GPAA 1KY2A 1AKEA 2PRYA 4OYLA 3B85A 1E0KA 2ZJ0A 3EFOB 1O54A 2O2YA 3HXOA 1BC5A 1HT0A 4TV9B 4MZXA 4I4IA 3U4DA 1P7ZA 5IABA 2D7DA 4CZ2A 4INJA 2IDJA 3PPXA 1H5QA 4LDZA 4DHWA 4HV4A 3EF0A 5BV1A 1UDBA 1S3SA 2FQXA 4GSYA 2Q1XA 4B6JA 5AW7A 1R37A 3S2EA 2GEVA 1MAHA 1WD7A 1YGYA 2NO0A 4MV6A 4BGEA 3AY6A 1KO5A 3UMFA 3I5AA 4FHEA 5DPMA 4EATA 5EJFA 2P4QA 1F12A 4O4HF 5C8XA 2C4TA 1EGHA 1JKIA 3EPRA 1DI0A 1JJ7A 3EB9A 4OSPA 3GF4A 1UT5A 1IC6A 3VJMA 1XL0A 1YUNA 4O2BB 3KOMA 3NEJA 2XWPA 2R8YA 2NXNA 1NQ5A 2R6GA 3FUCA 4CG3A 2Q2QA 1UQRA 4O4JA 2XUDA 3G88A 2OD9A 1QANA 4ENVA 3Q7RA 1ZUNA 4MS1B 4RQTA 3JVVA 3BB3A 1I3CA 1ZL2A 4HGPA 1A9RA 3VPSA 1E4YA 3C8HA 4MMZB 4R05A 5JZMA 1N7HA 3MWEA 1H4SA 1YBVA 4A6PA 1KOLA 1BEEA 5FLKA 4DQKA 4A8JB 1IK6A 4WV3A 1L5GB 3RYHA 1K0UA 3ONDA 4LRUA 3UVEA 3L4BA 2YNMC 5F9HA 4QUHA 1G9XA 3CF4A 4NCHA 5HRAA 1KMQA 5IFKA 1JWLA 5A6SB 4ZTZB 1PWEA 2CHQA 3OUUA 4ZMSA 2PQ0A 3OE1A 1KE1A 4RTRA 4V0SA 4FE7A 2G82A 2CMDA 3Q6MA 2Q8NA 3ZCQA 2AK2A 3FCYA 3OOJA 1QKKA 4TLLB 4TWZA 4RV9A 2IXEA 1E3DA 2OORC 2COKA 4X5OA 3ZEIA 2RBKA 4XOIA 3NDPA 3NEAA 5DEOA 1V16A 2W6ZA 3E18A 3GJ5A 2YXDA 3LA6A 3UAVA 1RAFA 1ZPDA 1NVAA 1SD1A 3AW8A 3ZWOA 3WKEA 1U0LA 2IUSA 3HUDA 4A2WA 5DCUA 4O5OA 3ZHZA 1FJHA 2BMFA 4IDFA 3C3JA 1B1CA 1RI1A 3EF3A 3R5HA 4MPTA 1WUKS 1A0OA 3UN1A 1T4DA 4KFCA 1VMEA 2JVKA 2ZDHA 1RWKA 4FOSA 4HR7A 5C32A 4WOJA 1AY0A 3UC9A 4B6OA 2P9BA 2WIJA 3QPUA 5IXYA 1RZRD 3VSCA 3SYNA 2QD5A 3UUWA 2WLSA 3BIFA 1PFVA 3QNWA 1F9EA 4M1EA 2YV1A 1PT7A 3R3XA 3WK8A 1A8IA 7MDHA 1OX6A 1W36C 3JZFA 4HNVA 1FDTA 3UHAA 3G0DA 4N5NA 5HTKA 5M34A 1YVPA 3RR2A 2X4DA 3H18A 3Q7IA 3W06A 2QK4A 4V0NA 5HR5A 1G2IA 1AB5A 4ZCIA 5KI6A 1EE1A 4KFUA 1RWQA 1SCDA 4I4LA 2IXAA 4R1OA 1YO6A 1ZY2A 4IKOA 2RI0A 3PIDA 4JT2A 5SZKB 1KNXA 5LM3A 1KP2A 4S35A 1QGED 2NZYA 2P5YA 4HVCA 4WJKB 1HOTA 4DCPA 2Z4RA 4FQ5A 4IDNA 3IUJA 3LOPA 3CEAA 3V42A 3N2EA 1ILWA 1WD5A 1I3OA 2ZIWB 4RAOA 2CFIA 4GD3Q 4WVLA 2ZJAA 3N5CA 4R7ZA 2R4UA 4XWTA 4D9KA 4F96A 1FS6A 5BP7A 1B93A 1JAZA 4JD5A 3CRQA 1DRUA 4ONEA 3LL7A 1OKKD 3O7MA 1EEHA 4KYIB 5C8DA 4I4TF 4TL6A 3HV2A 3K9NA 3BD9A 3MTEA 4C21A 4D8VA 4K40A 2I3DA 2WYHA 2C29D 4WMLA 2VYND 5ALPA 3ZLBA 4B4OA 2VDJA 4DLXA 4B3MB 3E5RA 1KAOA 1I6WA 1QJCA 1RKXA 3CLKA 2FF7A 5DM60 1CEEA 3WL7A 3WYBA 3ZGLA 2PUGA 3TVYA 2XZTA 3IMKA 5IJXA 1T8WA 2YINC 1XZEA 2FETA 3GPBA 4MKGA 3SYTA 2VDPB 2RHMA 5AKGA 3H99A 5ALVA 5ALWA 1TF7A 4FJ0A 2BTEA 4ZV4A 4X6UA 4H4EA 2Y0CA 4UEWA 1RJ9A 2H54A 5BN3A 2HJHA 1JR6A 2CMFA 1BX0A 3MJFA 3UQZA 16PKA 2GPJA 2WM8A 5DOVA 2DPMA 1C3JA 2HQSA 3WSVA 3JYNA 3AG5A 3GRPA 1GUAA 5EXSA 2MR6A 1Q1EA 3NANA 2X5OA 3SKVA 2HF2A 3A1VA 3QG1A 4KO8A 1HMPA 1N5MA 4JC4A 4OAQA 3DLIA 1OT5A 4JJ7A 4ZA2A 5LNK1 1B6SA 5C31A 1MAUA 3BGSA 4TPKA 3QBEA 2VTEA 1PL6A 4BFZA 3JRXA 4QPCA 2Y6VA 3AR7A 5DNAA 2NQ2C 1EFVB 3RTAA 2E21A 2WFLB 2QUHA 1R0CA 3A28A 1PAUA 5BO5A 4C1NA 3WX0A 2HYDA 2XIQA 3WNBA 4R1PA 1J70A 4G1MB 8ATCA 3CPSA 4IUYA 2P3QA 2Q0QA 2GAOA 2I9KA 1DO8A 2LIPA 5CR9A 3T7KA 1JHRA 4ZEOA 3EVCA 3GPCA 4I1OA 1LBEA 4W5HA 1ZOOA 3EULA 4MW1A 5C1BA 1A98A 3VR0A 3DBRB 5JSFA 1M1YA 4ZVSA 3CONA 1PR6A 1KI9A 4R1TA 1QPGA 3U80A 1ONSA 1M2VA 4ITVA 4CMIA 3E3OA 3C3KA 4TKMA 4FNOA 1S3FA 1SMKA 2X9VA 4QDUA 1JQEA 3BMOA 1ZJ6A 4RDXA 3GFQA 4EEXA 4R9VA 5KWJA 4RK5A 4C2UA 1E9AA 2JEOA 3SMVA 2OSBA 4FPXA 4FSDA 2Y66A 4DMFA 1P9NA 4HNUA 1R10A 3TSCA 4B6EA 1O6FA 4IXNA 2PH5A 3F3YA 3GEIA 2VRCA 4XFJA 1RR6A 4F85A 2BGRA 1EM6A 3G2LA 3PPYA 3D6FA 4NZNA 4CM1A 4DPMA 3D8UA 5JY6A 3I3OA 2PE5A 2BD0A 5GINE 4R2LA 1PVDA 3DAGA 4GRAA 3O4RA 1EFHA 3RU2A 4BP3A 2Z3WA 3P9SA 1YE8A 1GGVA 1C7QA 2FZGA 3E9DA 3ROXA 1RXWA 1PIWA 3IESA 1MNQA 3MAJA 4B5KA 2PR7A 4Z86A 1R3DA 1SXQA 2AFVA 2C4KA 3H9EO 1X1QA 4KQHA 3WXBA 1UPXA 4DIOA 2CDCA 2XSZA 2ZUSA 3E9QA 3KAPA 3CW9A 4AKEA 2FWNA 3IA2A 2BH2A 3GEDA 2FWIA 4IG4A 3IJPA 3Q8XB 5DX1A 5K0JA 2F1KA 3IQFA 4ZZIA 5AVWA 5JU6A 2BSQA 1J21A 4ZVVA 3MYYA 3TW8B 3SHWA 4EW1A 4JR2A 1YQXA 3A0RB 4L74A 2JLYA 2ECPA 3OZGA 1EX9A 2A84A 3LW7A 3LX8A 3VYUB 3GNSA 5DX8A 3KBOA 1V9LA 2SBTA 2XYRA 4FDTA 4CT0A 3FTFA 1FJ2A 5CLIA 1K1EA 2GN0A 4H1VA 3O4JA 3P5BA 1RKBA 2CGEA 1I7PA 3CH6A 4GLLA 4Y2HA 3O8NA 1F51E 2ZS9A 2XF2A 3I6IA 4JJ8A 4MWTA 5DNVA 1IH8A 3I5YA 2IP2A 3CRZA 3FW1A 2D1TA 1OSNA 5TC4A 3OIDA 5CG1A 4UHFA 5JNWA 1RM4A 4KR2A 1R0KA 2AKAB 4AJOA 1A9ZA 1RQLA 1UZLA 4BFLA 5KTYA 1BRMA 5CX1B 2NIPA 4WESB 3ZI7A 2PKXA 3GVXA 4JOQA 4PPNA 2MINB 4QFMA 3PDCA 4RVFA 3FIJA 5EMNA 5JQGB 4U7WA 4KQ9A 3WL6A 2PV7A 4GPBA 3R6TA 4IOJA 1E4OA 2R7AA 1LQ2A 4LTDA 4HNTA 2J3KA 5KU7A 1CUXA 2OCYC 1TO2E 1UDWA 1YJ8A 4WUTA 5L3RA 3TLYA 1F5SA 2H2AA 3V8QA 1WMDA 4BJ3A 4LVNA 4ZYYA 3OKAA 3EEFA 4I9HA 5DVZA 2FZVA 2I71A 4EG3A 1XCOA 4A27A 4D92A 2NP6A 1SKBA 1QRSA 2Z2ZA 3X1YA 1L7RA 1X38A 3HB5X 2W2MA 1SELA 3WRWA 1VBMA 3ZIDA 3I8SA 1IPHA 4EENA 3KPWA 4O4IF 1KAHA 3WGOA 1EG2A 2O1EA 3BJZA 3OM1A 4ZOLB 1ZIPA 3NBMA 1SZJG 1XZFA 1NONA 2A1UA 3CCFA 4I50A 1GL9B 1TRHA 2XUQA 2GAIA 3W5HA 4B82A 2JC3A 1WUIS 2P7HA 1XU9A 2IZ7A 4YI5A 1Z18A 3WLAA 1ID1A 4TZ6A 3QMPA 1YBAA 2OXIA 4OU5A 2Z2KA 1HFKA 4LOIA 3A6PC 4TT8A 4A0GA 2BFDB 1YQGA 1M54A 1LVGA 1PD1A 1UIRA 2HJWA 2WHQA 4U39A 1RYBA 2F48A 1M8PA 3GPDG 2XOEA 4YRBA 1CPYA 2ZQYA 2I03A 3O4GA 4UPEA 2P2LA 5DN6D 2HXGA 3EPLA 4IHJF 3BIWA 1A9XB 4DIDA 3AIIA 4HB2A 4JB8A 3Q8KA 2X5XA 1SBYA 1XTPA 2XPCA 3WLEA 1IHXA 3QFCA 3V6LA 3QE4A 1PVVA 1JZTA 3G68A 1YS1X 4JFRA 4MYHA 2RIRA 5JVDA 5KX5F 4BE4A 2AFIA 2FPRA 4IFBA 2NQ8A 2QTFA 4IZIA 2CVPA 4J4HA 2DOKA 5T4EA 3TZHA 4L78A 1CJSA 1MW9X 2B7LA 2VNKA 4XQ0A 5GM1A 3ZDRA 4PHTA 5I8ZA 3JWHA 1OJLA 1E18A 3KOWA 3GP3A 3TQRA 1TIBA 5G1PA 3HVKA 5BOVA 3O74A 3PTLA 3H5WA 3G0HA 2VSOA 5LP6B 2JK1A 4I46A 2X8JA 1XMIA 1JAHA 4DLPA 1GZ7A 5EZQA 1UMDA 3QQ5A 3WISA 2JGIA 1L1RA 4X20A 1XTRA 1WQ1R 2J4FA 3V1TC 4JJKA 5CEEA 3MBKA 1XCGB 2HMAA 1XZIA 1ZEMA 4M3NA 5JNSA 1HT2E 5IW8A 1ONBA 1VMKA 3A9UA 4K0RA 1L4NA 5JCPA 3MJHA 2E6UX 1DE0A 2HQ1A 2PYZA 4TTJA 4Y9DA 3ZS9A 3HEMA 1TYBE 1VGRA 3IEIA 5K0CA 1UXKA 2I7VA 4X95A 4IIEA 3OJCA 3R6DA 3HFJA 2CNKA 3O6VA 3UA3A 1I01A 1LY1A 4MV8A 3KSRA 2CXTA 1F8YA 2BEWA 5JMTA 5EGNA 1J1IA 1S2IA 3GU3A 2WSSD 3W5BA 4ESVA 1YE5A 1YOVA 3H5NA 1ESNA 3PHCA 2ZB2A 3PVSA 2OZLB 1ZH2A 1GCUA 2CKMA 2PNFA 1MG5A 4BX9A 1LC3A 2CHVA 1U5BB 3I01A 4RCVA 1L5MA 1Q21A 3R3HA 5H9VA 3SE7A 3WLTA 4BMVA 5A0TA 3PC6A 3KHSA 3PGKA 4J1SA 1WP4A 3VI4B 2I1LA 2QDKA 4C06A 1YR1A 5AW5A 3MGCA 5KTPA 4X6XA 4Z53A 1XIVA 3RJ9A 2IDZA 2B83A 2XCSB 4M0DA 2FZKA 4NMMA 3TGLA 2CVQA 3CY6A 1Z6PA 1DIGA 4LJKA 4PCUA 1OLOA 1NVUQ 2WINI 2VDVE 2GA9A 2AI1A 1OWNA 4PBTA 3TZKA 4DV1B 2PMFA 3ELYA 5JZSA 4ZJZA 1UFVA 2P5UA 3HZZA 3E81A 4IDBA 3ZTTA 5KC8A 4Q1DA 3OVMA 4RZ2A 4CT5A 3NT4A 3KB8A 4O4JB 4YJ3F 1P33A 3N8KA 4K9MA 1LD3A 4GZ3A 3VZBA 3M4ZA 3FKQA 3DE7X 3NORA 4UOZA 3SVTA 1P2BA 4Q4JA 5LDGA 4E4TA 1C1DA 2C5EA 4TUYF 1GZ6A 4X1IA 4XYLA 4YAKA 1LTHR 1ZIDA 4WKNA 2PPVA 2WMOB 4RSRA 1DEHA 4X0EA 3PQCA 4QHTA 2GF0A 4ALIA 2HHHB 5U4QA 2FN4A 2VEDA 4E94A 1ZGHA 1YI1A 2OO5C 4FTWA 2GBLA 1A7AA 1Y7LA 4QOEA 3WWDA 4FZJA 1AK1A 3HCCA 3KRTA 1NDQA 1IONA 4MUXA 3A1SA 4PTYA 4U9UA 4BN0A 4D9NA 5BV0A 2Y1WA 3GV0A 5DRTA 4UVEA 1X87A 5DT2A 3ZIAA 1LW7A 3A36A 2ISCA 3HDHA 2P9ZA 4B7AA 1Y6GA 2YXPX 5HBGA 1PTJC 4EELA 4MIOA 4BNTA 1UDAA 1FLDA 4FGUA 2NVUA 2OHFA 4IWXA 2B7BA 1CDZA 3HDQA 3NFYA 1E58A 2B9VA 4WLEA 4DBZA 2Z6UA 2BCGY 4MUBA 1T4CA 4V0RA 4DR7B 4FZRA 5G1OA 5CT8A 3EGOA 3Q41A 4EUNA 4W5NA 3OPQA 3A05A 4KFRA 1WO8A 3LCCA 3R0VA 2IOHA 1E5TA 3KVRA 4WSOA 521PA 1JVNA 1YKSA 2JGFA 4W9NA 3AR2A 4HWGA 3DCJA 1B6TA 3I2KA 5NULA 3B78A 1XU7A 4DA0A 3A3OA 1K6MA 2VAPA 1CQWA 1ZCBA 3TEFA 5DM70 4K1XA 4KG7A 2WY2D 3WGMA 1JR2A 5BYBA 5KX5A 1T0IA 3GFVA 3UZUA 3EXIB 4BWYA 3KQNA 4CMIB 1PR9A 1ZK1A 5EE5B 1NV8A 8MHTA 3R6LA 4OIMA 5DMHA 2PKQO 3SYLA 2HCJB 3IP1A 1BEZA 2P6OA 2WJ6A 3DT6A 4HUJA 4U7FA 5JSZB 2XMRA 2J41A 3DPUA 3F97A 4IIBA 4NZYA 4WCFA 1Q16A 2I54A 4IDHA 4GW3A 4XIIA 4DLZA 1B0UA 3U09A 3DE2X 1I2AA 3DT9A 4XVQA 5IN5A 2Q3JA 2QR3A 2W93A 2OPBA 3TRFA 2A86A 1JHZA 1RLMA 4OB8A 4YCLA 2PQ2A 4XX0B 3LTEA 4BAZA 1AKRA 2XCTB 1RADA 3K4QA 4BPRA 4LX8A 2UXDB 2C9BA 3B48A 3B52X 3TSWA 3WK4A 1SCAA 1JG6A 4PGGA 4NVRA 1RW4A 2QA5A 1TKBA 1VDMA 1ZG3A 1E1DA 4YALA 2O2XA 2BH9A 4NXMB 5IPFA 3UH1A 2EEPA 1TRKA 3TE6A 1IHDA 1YRYE 2XW6A 1XVTA 4H1UA 4IIJA 4J0KA 5CNIA 1EUCB 2ZVQX 3BQ9A 3OLZA 3VR6H 1P31A 4TWJA 3LP8A 1I5RA 1KXJA 4OFXA 2RH5A 2ZUWA 3S8YA 2VTBA 6REQB 1EQUA 5AM2A 4FXOA 1OWPA 4M8NE 2EJVA 4ZAVA 2ZRKA 4P4LA 1LDNA 1XKLA 1Z5VA 1VSUA 1VYVA 3B82A 4PV7A 2JPDA 4FDLA 4DC1A 2VL7A 3CBQA 4E6EA 6CHYA 4C14A 1P7VA 5FWDA 4ALLA 2BDEA 4B7UA 5FL3A 3AZPA 4KPUB 3G2QA 3K73O 3WE7A 4PSUA 1F2DA 1SJ9A 2WJGA 3RSHA 3PC7A 3NFRA 4YRNA 1K7CA 4U63A 4EYOA 5AW3A 1Z08A 2HX1A 3TE7A 3ZNPA 1DJOA 4MA5A 4TXJA 4A6DA 1Z4KA 3I1YA 4B8YA 3M6VA 1DV1A 4G0QA 4UZFA 1XRPA 2ZUCA 5FP0A 5K4GA 3JTMA 4Q01A 2FPXA 1BHJA 4KLCA 1J07A 3Q7QA 4OJTA 2V7GA 5DU2A 2FXVA 2G4CA 3I6MA 4E2XA 5LCXA 2A9PA 2OBMA 4HYTA 1OYYA 3JQ9C 2H1VA 2JLXA 2G9UA 4KLNA 4BBAA 3AVYA 4BZZA 3TLGA 4YCBA 3RHSA 4GWKA 1AZSC 2JHAA 2F8SA 1JQAA 3ZE0B 4MVCA 4GMDA 4X97A 4XA8A 1DIOB 1P5JA 1KVUA 3EXFA 2F1RA 4CM8B 1DZIA 5KNDH 4OD0A 1DC6A 1N8KA 4GLOA 1UJNA 4U7JA 2ACVA 4YI3A 5AT1A 3K1AB 5FL7D 5FA6A 2X6TA 2I6QA 1R12A 2V7UA 2G1PA 1KJNA 3QE9Y 2FOLA 4INAA 2ZRDA 3LCRA 3GBSA 1NI4A 5K0EA 2WD7B 3BXPA 3RYHB 1Q2XA 2D7JA 2JLRA 2VYVD 3QPDA 3CQ9A 1K7XB 4ZEVA 1MOSA 5IVDA 4MI1A 3PS9A 2D3TA 5JYBA 5JCOA 1FMCA 4Y9TA 2NTYC 2DYKA 2PLNA 1OX4B 5IZCA 1DC7A 2JW5A 1RIFA 3SC2B 1FP6A 4GXTA 5J4HA 4FHDA 1GAXA 2GCGA 1Z83A 4CLEA 1M7HA 1NOKA 4R98A 1UF9A 3I0ZA 1GGHA 2R1ZA 3ZHOA 1A9TA 1M2FA 1X3LA 1QG0A 3KBBA 4EF5A 2FG5A 3HDVA 5B2FA 5JZOA 2CDNA 3PHBE 1TCBA 1U2ZA 1U0RA 3DVLA 4ESEA 2ZI3A 1G21E 2AG0A 2VJOA 3FDXA 3QYPA 4JUCA 1Z3CA 5CEJA 4QT4A 4JXZA 1J06A 1YKGA 2KHZA 1Z7GA 1COWD 2VDMB 3FLMA 5IK2D 1UFOA 4HDKB 2VYFA 1MP0A 1OXBB 1JDBB 1UODA 3HBNA 4IXTA 5G41A 1ZCFA 3I9JA 5G2OA 4NS1A 1A1SA 5JVDB 4W5QA 2Y2UA 3CEJA 4RD4A 3ER8A 1OGIA 3G1TA 5H5JA 3FLAA 3GLHE 1NUUA 3L7BA 5AOBA 1YR3A 4IILA 5AKKA 3QK7A 1JR3A 5E6SB 4RXMA 1LPAB 4UQOA 3PD0A 5H80A 4HWRA 1GFWA 5BW4A 2GEUA 1E3EA 2ZYHA 4OHVA 1FP7A 3B6IA 5HW0A 2XYHA 4F72A 4ZCMA 3UMVA 2I5PO 2PQMA 1E3WB 4YO7A 4HNGA 4KK3A 3HGMA 1RQ7A 3IXMA 3ANYB 2DM6A 3QVVA 4PAOA 2QTTA 3GT4A 2WC1A 3R20A 4Q37A 5H3HA 3FVVA 3OZUA 4MS1A 3MUEA 4F71A 3ZJTA 3MRSA 2HA0A 3PBKA 4IVPA 5FWXA 3K0AA 4ICIA 4MGYR 1JIQA 4N3NA 2EBFX 1XVVA 2OHGA 1BCRA 1K0FA 2MYUA 1JB9A 1FFGA 2AEFA 2G6TA 1J0XO 3JQQA 1HUQA 1CP3A 2EX0A 5C8YA 3A3KA 5G4KB 1QIHA 1U5CA 3KT3A 3MWDA 3THRA 4C04A 4D0NA 2ZIXB 2UZ3A 1AIPA 1RBQA 4FINA 4YPFA 1M2KA 4JP3A 2ODEA 4F3YA 2ZETA 3RYCB 3SNHA 4EP1A 4J2TA 3SQNA 3S1SA 4D26A 4Z9FA 4GF5A 4CUJA 3K1TA 5E4JA 1U8UA 3AKDA 3I2FA 4JC8A 4G63A 2WMDA 4HDNB 3RIYA 1KZ6A 3MRXA 2GXSA 3A4VA 4YDRA 1X3SA 2KX7A 2CV2A 3DONA 3OZWA 4TWAA 1H69A 4B4DA 5CB0A 1LEHA 2EEZA 4UAGA 1YD7A 1DTEA 3FTNA 3ZCTA 2DBVO 2MDTA 3WGKA 3IE1A 2HWXA 4JWTA 5TMPA 1OWLA 1CFJA 1GL7A 1LV7A 3PFIA 1N2CA 3AY0A 5D51S 1X7WA 5L4NA 1YT5A 5F4ZA 3K96A 4UNNA 1JSLA 4RJTA 4DGQA 1LC0A 4BJ6A 4ID9A 2ZT7A 2FEXA 3WGIA 5B4UA 1PNQA 5JEEA 1YASA 3QF4A 3FUWA 3B6KA 4J0HA 3KFLA 2M98A 1OLUA 4QYSA 3KELA 5JS6A 1AC5A 4B7XA 2CXRA 2PZFA 4Y6LA 5EHIA 3MB5A 5IX8A 3E7XA 1CERA 2H52A 1I3KA 3DNMA 4JB3A 1VJGA 2O3SA 3K1JA 3ZGXA 3AIMA 4UEQA 3LJKA 3SQXA 2XADA 3COVA 4WKCA 4DDWA 3JPWA 1NVTA 4YP0A 3WFZA 2JD0A 2EFHB 1T9ZA 2CL0X 3IIJA 4Z4HA 4H31A 5E6SA 5LSAA 1JGTA 3NJRA 2HBQA 3V2HA 2OBBA 3L7OA 2DZDA 4DQDA 1XU4A 4ZAYA 3AVVA 2J9FB 2W6PA 3N5KA 3AR9A 4H59A 3K4HA 5IC4A 1FW6A 2QROA 1DCTA 5IKOA 4P8RA 3T1HB 1TW3A 4ND6A 3DTVB 4R1QA 2OZVA 2QZPA 3A0UA 4NR0A 4QNRA 3FZYA 1T3GA 4RMJA 1QSGA 3PHLA 1I30A 4WZAA 4IS2A 5FORA 1IM2A 1UBOS 1NJ1A 4HTFB 1JSRA 2ACKA 2EGUA 4RZIA 3SQLA 3WP1B 1L4KA 4XPIA 1ZH6A 4KQMA 4RH0A 3TOCA 4TS1A 1VP3A 1Z39A 4LMBA 1IJBA 2HSJA 4PCVA 3C16C 4QJ3A 4LQLA 2BONA 1CUVA 2PUBA 1U1CA 1OKKA 4P36A 1HLPA 2VCYA 1XZKA 1RPJA 3R0QA 4NS4A 3SZ3A 1Z6ZA 5A7HA 1DIBA 3QKTA 4EQ6B 4C4ZA 3SZLA 1DDGA 3KCQA 4P4UA 1TK3A 1V7CA 1ZK0A 3OT5A 2V96A 3IH5A 4L5YA 4R0MA 3EGVA 4RA6B 2XE8A 2XODA 4FGZA 3OZSA 4WDQA 2BKEA 4KIWA 5DOZA 4JB2A 1YK0A 5FTMA 4N47A 1T26A 1TD1A 1USWA 3PFNA 4JI7B 3KTOA 3CUVA 4MVJI 1C9NA 2WM3A 1ZGJA 1RWBA 3DYVA 4WZBA 4CPDA 1US8A 1RLOA 3BMNB 3ICEA 2ROQA 2YQ4A 3D3NA 3CN9A 3ZY6A 1YA8A 2EKBA 3OJEA 3PEUA 4QPDA 4JI2B 3NVKI 3S1AB 4P0QB 3ELUA 2V1UA 4D25A 1S2MA 1C3VA 1O58A 3FMVA 4OSEA 5B3KA 1EUQA 2JAPA 2R7LA 2BBTA 1O9HA 2JJMA 3ENKA 1SBNE 3HFSA 3RBVA 3WJ2A 3WK7A 1TT5B 5JUWA 4YCCA 4Q3NA 3CVUA 2HIGA 2P6MA 3K6JA 2HMSA 2Q1UA 2ZYWX 4II2A 2ZJ8A 1GLGA 4KUGA 1ZRMA 3DDOA 2SKCA 4R2IA 5JANA 1PHRA 2RGEA 2V03A 2JHGA 3UMRA 4F9FA 3K0EA 2QSUA 3KDPA 1VLHA 3ZHTA 4F12A 3THYA 4Y1EA 3K8QA 2ZRPA 3C3CA 4P31A 4BB5A 2Y27A 3FHTA 1HDGO 3P2JA 3JWIA 3SVZA 1USVA 2BEWB 3NHUA 2RDMA 4HNHA 5D5QA 1YV9A 1GYQA 1D5CA 2ZSFA 2ZG6A 2VQDA 1T29A 4U4AA 1R6VA 2ZZMA 1MC5A 3U4GA 4CTNA 4G24A 5L8VA 2VJKA 2H5JA 2VYVA 4JZKA 5HCNA 3PX7A 1P77A 3BWYA 5JOQA 2QLFA 3MW8A 4D3ZA 1I4EB 1OVGA 5BSWA 2M6RA 4CF3A 1LUAA 1BDJA 1NVDA 4KPFC 1HDXA 4CMKA 1T8RA 3CLRC 3BHNA 3PSHA 3T5GA 1H2ZA 3A14A 3NIDB 2HHAA 1G7TA 1ODKA 3SHOA 3HI6A 2FLVA 1N2BA 5DRYA 2P3LA 4G01B 2IYQA 2WP8J 3HJCA 2X2EA 1U4SA 1OH7A 2IVFA 2QAJA 1BHSA 3DXYA 3AI1A 3CW8X 3FFAA 3I92A 1IMOA 2WVGA 4IUDS 3EPHA 4UPVA 2OMEA 1K7SN 1KGSA 3AVTA 4F4UA 3ICQB 4JU9A 2XWSA 1H2EA 1XJQA 1NASA 2D54A 5A4FS 4UTNA 2D1FA 2AC4A 1Y7TA 2DU8A 2PL9A 3GXOA 3PGJA 4W1SA 5AKIA 2J9FA 4GOJA 2NO7A 4M8LA 3RV3A 3OAAD 4O63O 2YZ7A 4NZPA 4F5EA 5J1TB 4XD7A 3O8CA 5HILA 4RDHA 1PL7A 3DJYA 1T3HA 4R9RA 2O7RA 2R00C 3VXKA 2HEIA 5ALEA 1Z2AA 1M66A 4UQPA 4O4JF 4QL3A 2RB4A 3MSCA 5HKAA 1JKJB 2Y9PB 4DAEA 1RJEA 4Q48A 1JDJA 4IDPA 2O9JA 4Z4IA 4TSFA 1EWYA 2NPOA 2QAGA 2ZJ5A 1LNSA 4JLMA 3T3HA 1E4VA 3JRWA 2ZU0C 4TKVB 5DW3A 2FUCA 3EN0A 1OYOA 1MB3A 2OHXA 2KMLA 5AOVA 1JQ3A 3ZOKA 4XWKA 5JNLA 1QLHA 4C03A 1II8B 5EJGA 3T34A 1RP7A 3JALA 2VBGA 3LBAA 3L0ZA 4ZQCB 4DUZB 1USGA 1JPNA 2V5AA 1KI7A 3AETB 4NKRA 4Y9UA 4YGYA 4EYEA 4S1PA 1JLMA 4R8VA 3ONWA 1YRBA 2FCAA 3EOAI 1TLLA 4BNKA 1ACLA 1ZLYA 2REXB 5AH0A 2FFBA 1DBQA 1TMGE 4QUKA 1W87A 2HSGA 2V54A 3GEEA 4YONB 3NNNA 1Q0ZA 2VT2A 3RV4A 1GCIA 3GZNA 4YUAA 4JJGA 1O77A 2ZDGA 1C29B 1CRLA 5CUQA 1MX3A 5EVJA 3HE3A 2Z6VA 1WPRA 4F38A 1ZWLA 3VYWA 4ZHQA 3LLUA 3TB6A 1NI3A 3EXHC 2Q62A 2DQKA 2O6LA 1P9LA 4EGCB 1QBGA 3KQWA 5B37A 2WTAA 3CZQA 1O1YA 1P4AA 3G2IA 3T94A 3ZCRA 3AXTA 4J76A 4PQYA 1ZH8A 1SCQA 4JYAB 3OZVA 1UBGA 1F8GA 2NO4A 4C6TB 1OUMA 2VK1A 4UVHA 3K2QA 3SJBA 4EI2A 1E92A 4L8VA 2Q5LA 2H16A 2PG3A 4IQ8A 1DO2A 1TK9A 3D1VA 5AJZA 3UYKA 1EBBA 2Q3EA 5K01A 2Y1DA 2FPIA 4OQPA 5KQLA 1SBHA 3ZX5A 5FYDA 4MKZA 2W6MA 3D4PA 3CNNA 3LZCA 3O8DA 1JYFA 1TQ6A 4LE1A 1QWOA 4TVOA 3AR6A 1NVKA 4CL8A 2HLDA 1R6AA 4J75A 3ERCA 1SXIA 1QHGA 2YY5A 2VSNA 3ICPA 2W0SA 2A0YA 4TWIA 1F06A 5BWMA 2DFTA 3PI7A 5HKLA 1EWRA 4YV7A 3CT6A 1DG1G 5J40A 2WIDA 5EE9A 1E0DA 4Q3OA 4H1HA 3K70B 1OHHD 4MWBA 3S55A 5C5CA 2DHEA 3BTUA 4H6XA 1X0XA 3IAUA 4HNSA 3FSGA 4P3XA 4IIXA 2ZM5A 1A8PA 3OEWA 4XCQA 4BO9A 4EL0A 4J0CA 2YWFA 2HN9A 2R66A 4GSKA 3TLXA 2VZEA 4MULA 3M2TA 5LP6C 2Q1TA 1YVEI 4YACA 1I1QB 4F8YA 3KOYA 5C4IA 4HDKA 1ORHA 3GO4A 3U44B 3ZEAA 2CLCX 3DZFA 4MTCA 1JKMA 5K2MA 3MQFA 4F21A 4Z54A 1QS0A 2WIKA 4NYMR 3EMKA 5IH7A 1ZNXA 3D0RA 1VB3A 3KLOA 4LHYA 3RKRA 1J7JA 2HU8A 5EA2A 5FOVA 1V9SA 5JZBA 2J48A 3OCUA 2ADOA 1XZGA 1FBNA 4AX4A 4LS3A 5A4KA 4DUYB 3RRMA 3M2PA 3R4VA 4KMSA 3CX6A 2G9NA 3TS1A 1BVHA 3QXXA 4OHKA 1AA9A 1CUWA 1A82A 5CGZA 4JN6B 4K6FA 5FNVF 5KAMA 2FE4A 2H63A 2R2AA 4IWYA 4ZK2A 1MG0A 1RJ9B 2GCOA 3OTWA 4L9WA 3RUFA 3OO1A 1L5OA 3L7JA 4BFCA 1CY0A 2YUIA 4RKFA 4PZZA 3GW8A 5CFLA 5IKMA 3WLQA 1KEVA 2GPYA 1SEVA 3EIUA 3ODGA 1ICIA 4DG8A 2H18A 3AEZA 4K9QA 1Z74A 1ZM3A 3TJRA 3RRNA 3P9KA 1XWIA 1JT9A 2QP3A 4PR3A 3NHWA 2YN0A 3HHEA 1Y8RB 2G76A 4PG7A 4RGBA 2MHCA 3FROA 1Z2EA 2AVNA 2IPXA 3ZHQA 5E6UA 1U8ZA 3KWMA 1DZ3A 4QPZA 4RHEA 4RZSA 4YUVA 3SHFA 1GDDA 2CEKA 3LPDA 2MYPA 5BWBA 5JCOC 5IM5A 1YTUA 2CVHA 2HW8A 3U4IA 1QE5A 2NSYA 1EVZA 1TYEB 1YU9A 2Q2WA 3MJEA 2J7PD 3VSAA 1N1MA 5KYXA 5JXIA 13PKA 2UZ4A 4L8YA 1JQ5A 3TR6A 1HNNA 3ITDA 1QO9A 3PNOA 1QYWA 1JAIA 2HCFA 2PWAA 1JSZA 3H4IA 4JLPA 4MRNA 4DBLC 4DY6A 1JG4A 2EYQA 3FUUA 4FBLA 1ZP6A 4ABYA 2BCEA 3M4XA 5KSYA 2VDNB 1T1SA 5FPHA 3Q6NA 4BLUA 1A9QA 1P72A 2YDXA 2DX7A 1DIHA 4FMCF 5ALXA 5JAUA 5LWQA 2ON6A 3KV1A 2IX9A 2V8OA 4XD2A 5K0FA 2VH5R 5KSZA 1KR2A 3E48A 5KYXB 2YWRA 3DDCA 4BVLA 2EKZA 4I2VA 1G20A 4U3JA 3EGDA 5CVJA 3ECAA 1GPMA 1YOVB 4XVHA 3C3AA 1DQYA 1R4MB 4OBBA 1UC8A 3IAHA 4EVIA 1LK7A 4HX5A 4TZ0A 1XB2A 4LFBB 4IH4A 4D41A 3BWCA 3NUQA 5I7OA 1ZDMA 4LVCA 3ZS8A 3C6XA 1K8YB 2C5HA 3DAOA 3KKEA 4GMXA 3COPA 2IZ1A 4MCIA 4RCYA 1ZNQO 1Z36A 3IQEA 3P5SA 4NK4A 3LQYA 3TL3A 4BNMA 4HAOA 3ABOB 4UUNA 3I9LA 2HMUA 1CUIA 3RC7A 4D1YA 3I4FA 3R3JA 3UJ6A 1CNFA 1YVRA 2HPAA 2ZS8A 1K2VN 1YHNA 3JQDA 3Q2OA 5B58T 1GNTA 2FP4A 4S2EA 4ZRMA 5GOZA 4D79A 1BE8A 4DIMA 2XMBA 3WNCA 2V7EA 3EIFA 2C42A 1KEEB 2VDWA 2PRJA 1JTEA 1JEEA 1H1TA 3LHKA 3LX5A 4D9BA 1XMVA 4OP2A 4B3DA 1QGUB 1P5FA 1RACA 2RHJA 3JVUA 1XYVA 4MW9A 2WPNA 3T0IA 2RGNC 1M2GA 2QL7A 2EZ8A 3Q1KA 3MZ0A 1PQPA 4P84A 5EN4A 4UMVA 5SZIA 3ORFA 1TT5A 2D62A 2VP9A 4JBIA 5DIFA 1EB9A 2ZBRA 2P68A 4CLXA 1QYVA 4MO9A 4ERXA 1HSZA 1B00A 4MB0A 4B3HA 1F0KA 2KS6A 4ZALA 3U31A 3JTEA 1GQQA 2XVZA 4C76A 3GLFB 3WGNA 2R1TB 2B2NA 3J7TA 3UJ7A 2AR9A 2PU5A 1NHWA 2BFEA 3DBHA 3OEHA 3QKWA 1LSOA 1NXXA 3MXTA 2AJBA 3G9QA 3PL1A 4LXXA 3JQAD 4QOIA 5F5LA 4U2FA 5HE9A 5LQMA 1QRDA 3TI9A 3VPAA 1KRXA 2X8BA 4TX1A 3UATA 1V25A 1DQZA 4URWR 1YDWA 1P7YA 4IRMA 4LSMA 2YCBA 2PSHA 3GGSA 1F0YA 2FP3A 2DRIA 4Q6BA 3GDGA 1R00A 5FULA 3CF6R 1UK9A 2GBGA 2DWPA 5C4MA 2FN9A 3OUZA 3VKFA 1UT8A 4EQ6A 2QD4A 3DFFA 1R9GA 2PN1A 4BE9A 1G2QA 3TRDA 2V5UA 1PF7E 3GZJA 4G85A 1EZ1A 4LZLA 4BV3A 1DQPA 1TCUA 1VE5A 1Z0JA 2VUTA 2EJUA 3LGXA 1P1JA 1Y9ZA 3DMYA 1OA1A 3BL5A 3UK1A 4PYIA 3ZBQA 4PNEA 5IAGA 2QE7A 1CRQA 3NB0A 1V41E 3UAGA 3TXAA 2N0SA 4BEVA 3I6BA 2PD6A 1S9DA 3M83A 5D3KA 3UYLA 4GLBA 3HVRA 1U1FA 4WLNA 3CLVA 3FCAA 1EHCA 4P5EA 1KMHB 2ZR8A 4JLVA 1DMSA 4I9GA 2BTQB 3PDJA 4CEJB 4UTVA 1EB8A 1N1EA 2WU3A 5JAMA 3RS2A 5LJIA 4H1WA 1X19A 2BC9A 2PGXA 3H8JA 1J9ZA 1XMPA 2GBCA 3GCDA 5FOTA 4B6QA 4OXKA 1GSIA 1AZLA 4XM2A 2GHRA 4Y6OA 4Z0TA 2HDHA 2ODTX 4R9UC 5DGIA 5H4GA 3EVGA 3L4SO 2AQ8A 2J32A 3R44A 1W59A 2DFKB 3FTDA 1KJYA 2DG2A 3G79A 3RVNA 5C7LO 1OBVA 1MO4A 1ZCJA 4JROA 1ICEA 3C8UA 3JR7A 1DAGA 1QE0A 2A9OA 2XR1A 3K9QO 4KX3A 5E8RA 1AHIA 2GK4A 4J1TA 2CV1A 4H3KB 3ZCPA 4F4JA 1D2AA 4MB6A 3ANXA 4NOKA 4E03A 2QPLA 4I8XA 1JG7A 2VWHA 3DR3A 1VP9A 3TCKA 3ZXXA 4FGJA 3K5PA 1AXGA 4O4LB 4CUKA 4YV1A 2YZGA 2YX1A 2XJ9A 5D84A 3C3EA 2VHWA 2Y76A 4LNHA 3EDRA 2Q9CA 4XGKA 4G41A 5D87A 1QDEA 4UBJA 5LMZA 1PR5A 1PG2A 2CMHA 1P7PA 4E70A 1E1RA 2RGYA 1QCZA 2QVXX 3KC2A 3S4YA 3ZWAA 4DCJA 4J3FA 3RGWS 4NH0A 4MZDA 4CIDA 4ND2A 3BE5A 1Z4MA 4A5OA 1IN8A 1CWUA 2VHJA 2H51A 4LOHA 2SCUA 4NNPA 4WFIA 3TEJA 1N8SA 1YCDA 5E2IA 3VNBA 5FNVA 2XT0A 3NDBB 5G0SA 3W78A 1CZHA 1JFSA 1PWZA 2YOHA 5EJAA 1T9HA 1UJCA 3TYXA 5A0VA 4MITA 4RA9A 3H2ZA 3QU9A 5JFTA 4KSYA 2OFFA 1WG8A 3T5CA 4XRGA 2X0NA 2XAAA 3SU8A 1NDUA 1PJTA 4C08A 1M74A 1N6PA 2J30A 1PNRA 2IEGA 4KK4A 1R6UA 3DMGA 1V1MB 4UE2A 4LF9B 3PR3A 1DAFA 1MJHA 2QY9A 3OLYA 1UP4A 1Q84A 4TXHA 4I08A 3IKTA 2W6QA 3VNUA 2VPX<