3KPWA

Crystal structure of hpnmt in complex adohcy and 1-aminoisoquinoline
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kpwA00
3UJ7A 2ONZA 3CVOA 2ZIEA 2OYRA 3PB3A 1YB2A 3PTAA 4C07A 3M4XA 3E8SA 5FADA 4DQ0A 3VSEA 3EMDA 2P7HA 4E30A 5KQRA 2PVCA 5K01A 2ERCA 3MERA 2ZZMA 3GRYA 4IV0A 7MHTA 1X1BA 1XDZA 2P40A 4RYLA 2PV0A 3KQPA 5E8RA 1M6EX 3HCBA 4MWZA 4PONA 2H11A 2JH9A 2HWKA 2ZLBA 3HA3A 1VP3A 1NT2A 4LWOA 2ONYA 4RVFA 5DX8A 5G02A 3MTEA 3KR0A 5CD1A 3BGDA 3TPZA 2WK1A 4E33A 1KIAA 2IH2A 4PCAA 3M70A 4X63A 3T7TA 5LR6A 2NXEA 1VIDA 3BZBA 1NE2A 5LQCA 2IBTA 5JUWA 1QANA 1JSZA 4C04A 1EIZA 3M6VA 4K6MA 1JG4A 4FT4A 5EEHA 5KS2A 4QVKA 2NP7A 3KKZA 3DXXA 1U2ZA 1NKVA 5KYGA 1NV9A 2EFJA 1IY9A 5EEGA 3UJBA 3B7PA 2O57A 3KR9A 3LBYA 1MJFA 4PGGA 5HILA 4PWYA 5K09A 3GXOA 4YMHA 2NNWB 4PINA 1RI5A 5CVUA 4DCMA 3EVBA 3L8DA 3BKXA 4DF3A 4V0QA 1TW3A 3Q7EA 1G38A 3FPGA 3HEMA 2WA2A 3OFJA 2ZIGA 2FPOA 2AOTA 1AV6A 5D1NA 4WXHA 5HIKA 2EG5A 4E2WA 4ER0A 1L3CA 3KQSA 4WVLA 5ICCA 4XUCA 5EVJA 4CKEA 4PYQA 3M6XA 3KPUA 3VC2A 1VL5A 4HH4A 3HVKA 3V8VA 5CM2Z 4XUEA 4GUAA 3X0DA 3FYDA 2E5WA 1G8SA 1EQAA 3AXSA 3U81A 3KPJA 4E32A 4ER6A 4RTLA 3I53A 3HCEA 1RJFA 2B9EA 4GQBA 4QQNA 3RW9A 3P9NA 1SG9A 3LKZA 3OU7A 4AUKA 1F38A 4LWPA 1QAMA 2XVMA 4RVDA 1DL5A 3G89A 5DTRA 4F84A 3AXTA 1RI1A 1JQ3A 1SUIA 1UFKA 3BWBA 3B3FA 3I5UA 3MQ2A 3EVCA 3JWJA 5K05A 4IWNA 4FP9A 3D2LA 5GM1A 1V39A 3DOUA 3ELWA 2OZVA 4QVGA 2QM3A 3BWCA 3ERCA 4YUWA 2R3SA 4GBED 4YUYA 1XXLA 3OZRA 1VQ1A 4DMGA 3ELDA 5EMJA 3OZTA 5EIFA 2BM8A 3RODA 2EJUA 3LDFA 3PS9A 4BP1A 2OKCA 3GCZA 3GDHA 4CTKA 2Z6UA 3P9KA 3BWMA 3SX0A 3T7RA 5T67A 1VP9A 5T6BA 1B42A 2YX1A 3GRVA 3KR2A 3LSTA 4QPNA 3BGVA 4YV0A 5E2AA 1NW3A 1INLA 4CWAA 3R24A 3SMQA 5FA8A 3TOSA 1NW8A 1XDSA 1KPIA 3G5LA 1TPYA 2ADMA 3EEOA 2N47A 2H00A 3HCFA 5CUQA 4EK9A 2PXXA 5DTMA 5EQJB 4AZTA 5K0EA 3M6UA 10MHA 2Z6AA 3DXZA 3LCUA 3P2IA 2WA1A 4OBXA 4P7GA 4ER3A 2PX4A 5F2KA 3HTXA 1Q0TA 3G5TA 4PYMA 3LDGA 2YQZA 2AS0A 3KPVA 3KPWA 5DM1A 5T64A 3HA7A 3FTCA 2YXLA 4H0NA 4YMGA 3TLJA 2ZWAA 4GOND 1VPTA 2AVNA 1FBNA 3UJCA 3MHTA 2BR5A 2P8JA 3HCAA 2AOTB 2VDWA 5E9JA 4MTLA 5DWQA 2R6ZA 3THRA 2G71A 3GWZA 3KHKA 2NXCA 2OB2A 3EMBA 3LHDA 2JG3A 4P7JA 5LQNA 4G56A 1G55A 3E23A 5DPMA 4F85A 1KR5A 2CKDA 1KHHA 5K0JA 2AVDA 3AY0A 1JG2A 2DULA 4QDJA 3P97A 2JJQA 1M0EA 1Z3CA 1H1DA 4GEKA 4X60A 1QZZA 3AJDA 2B25A 1JR4A 2BZGA 3LBFA 3PFGA 3PVCA 5GIPE 2IH5A 3HCCA 3MGGA 5HOQA 3I58A 2YXDA 3UZUA 4RVHA 5CVVA 5CCBA 5E1OA 3FRIA 5CCXA 1KP9A 5F2OA 1YF3A 3EVGA 5HEKA 3LCVB 3I64A 2HTEA 3UJ6A 4PYKA 4X1OA 2XBMA 2ZZKA 5LQUA 2B3TA 3GIWA 4RTQA 4ISCA 2I9KA 1X1AA 4ZTBA 3BWYA 5LQAA 5FQNA 5EKXA 3GRZA 3LECA 5FHRA 2UZ4A 4GC9A 3THSA 1L1EA 5EKUA 1N7IA 4DZRA 1ORIA 4ER7A 5M5BA 5DTQA 4KDCA 4OX9Y 3G7UA 1XVAA 3P2KA 2P3OA 1NW6A 3UFBA 3FZGA 5HZMA 5IKMA 2C7RA 3NWEA 1O9GA 1WY7A 1Y8CA 3A7DA 4CXMA 3A4TA 1ZQ9A 1IXKA 5K0LA 3TM5A 3KQWA 4EKIA 3OU2A 1VBFA 5K0NA 3TRKA 2GLUA 2O07A 3CCFA 3P9IA 5FULA 4PCLA 3KU1A 4R8SA 4YUXA 3NVMB 4RSRA 4AZVA 2AOVA 2LD4A 2DPMA 3FPHA 2XYRA 3GRUA 1O54A 3IV6A 3ORHA 3P71T 4BLVA 4C4AA 3OE4A 1KYZA 4GOLD 5DT2A 5C1IA 3FUWA 2FK8A 4A6DA 2O05A 2IDKA 4DCGA 2FHPA 4C06A 1QAQA 3LKDA 4R8RA 4PYJA 2VP3A 3HNRA 2C7OA 3KPYA 3B89A 2ZFUA 3NJRA 4X61A 4U7TB 5ICFA 2HR1A 4B17A 2CWWA 4GOMD 4E2YA 2ZCJA 3FPFA 3OFKA 2G8NA 4GF5A 5DXAA 3NW9A 5DSXA 2GAFA 1T43A 3LGAA 5KQSA 2JH8A 4OQDA 1SUSA 2VDUE 3S68A 1R18A 2UYHA 1M6YA 1WZNA 3CBGA 3PX3A 3QOWA 1XDUA 1EJ0A 3BXOA 3DP7A 3IEIA 3FUTA 3SXJA 2AZTA 2PX5A 4AX8A 4KDRA 4OA5A 3H2BA 2QE6A 3IYLW 3DMFA 3SGLA 2ZBPA 2AOWA 3EGIA 1ZG3A 2ZIFA 4DA4A 2P41A 4KVZA 2EX4A 3TKYA 4YV1A 5LQKA 2OY0A 1D2HA 4LG1A 3REOA 1DUSA 2GS9A 3CJTA 2AN5A 3FUVA 2AOUA 2A14A 4HGYA 4PYLA 5K0GA 4RTKA 1TW2A 4CKCA 3HVJA 1RJDA 1ZGJA 2AN3A 2KW5A 3ANXA 3FPEA 3UJ9A 5KVAA 4RTOA 1BKYA 4MIKA 3C0KA 5DM0A 3UJ8A 5FTWA 1WG8A 2HNKA 3EVEA 2PT9A 3KQTA 3MTIA 4KWCA 1P39A 5HIJA 3EVFA 3IHTA 1QAOA 3NWBA 3M33A 2G72A 4YUVA 2PT6A 1R8YA 3KQQA 3A27A 3F4KA 3JWHA 5LSAA 1NBIA 3TM4A 2IH4A 3DR5A 5F2NA 4ATNA 5FA5A 2OBFA 5FQOA 5GIOE 3OCJA 5H02A 4M37A 2ZSUA 4RTRA 4X41A 1I4WA 3P2EA 4JXJA 1IM8A 3SM3A 2CL5A 3TKAA 2H1RA 3A26A 3FTFA 2P3LA 5U4XA 2IBSA 2BH2A 5C0OE 1JG1A 3FUXA 4FSDA 4C08A 4UOEA 2QRVA 4DM3A 2BR4A 2CMHA 2F8LA 3SSNA 3EGVA 3FRHA 2AOUB 4FSXA 2UYCA 2V7EA 1BOOA 5CVEA 2XYVA 4R05A 3KR1A 3KQOA 1KPGA 3NTVA 5CIYA 5HFJA 2PJDA 2IGTA 4M36A 3T0IA 4HC4A 1X1DA 3BUSA 4HSGA 3C6KA 1P91A 5BXYA 2YR0A 3ER8A 1R8XA 4FGZA 3CKKA 5EHIA 1ZHFA 9MHTA 1WXWA 3DULA 4HTFB 1SKMA 5GOZA 1N2XA 4YUZA 1VE3A 1WXXA 2P1DA 2YXEA 3LDUA 1EAMA 3GO4A 4HTFA 5LQJA 1EG2A 1NV8A 4AZWA 2FK7A 3DMGA 3GRRA 1JQEA 1SQFA 2P3QA 2C7QA 2UYOA 2VZ9A 3GU3A 3HVIA 5DRTA 5EGSA 4POOA 4HRAA 3KQVA 4P7FA 3C6MA 2Z6QA 1AQJA 2Y1WA 5P8WA 4GOOD 3K6RA 5EOVA 3GJYA 5C9ZA 2NXNA 2OO3A 3JWGA 1AQIA 1JG3A 1ZKDA 2VDVE 4R6WA 3MCZA 1HMYA 2B2CA 3FTDA 2I6GA 3FUUA 4HGZA 4M38A 5EZSA 5EIWA 4PIMA 2GH1A 4F86A 1FJXA 1RJEA 3KQMA 3EGEA 5K0CA 2O06A 3C3PA 3UJAA 1RI4A 3G2QA 5EMKA 5GINE 4QQKA 2FCAA 5IH3A 3BGIA 2G1PA 4RTJA 3C3YA 3MCTA 3B3GA 4RVGA 2OPBA 4EMSA 5E9QA 1L3IA 2ZULA 2OB1A 4DKJA 3LL7A 2IFTA 4E2XA 4R6XA 3NDJA 1X1CA 3G2PA 1ORHA 3BKWA 3R3HA 8MHTA 3G88A 2FRXA 4XUDA 4A6EA 1P1CA 3BT7A 2P7IA 2V74B 3FTEA 2PWYA 1EJ6A 2AN4A 2GB4A 4PIPA 1N7JA 3TFWA 2K4MA 3QOXA 2Y1XA 3CJQA 3O7WA 2I62A 1SQGA 1SVUA 3HCDA 3T7SA 3ELUA 3R0QA 5GP1A 4EQZA 3FYCA 3EEYA 3ID6C 4XCXA 3PLAE 5K0FA 2PY6A 4O29A 4QTTB 2QY6A 3E7PA 3LX6A 4V0RA 1O9HA 5DXJA 5FHQA 4LECA 3CC8A 5DRYA 3AWIA 5EG5A 2G70A 1NBHA 5CVJA 3SVZA 3UA4A 2EJTA 3UBTA 5E1DA 4OQEA 5DM4A 2GPYA 2B78A 2ZVJA 4OBWA 3RIEA 5K8VA 4KIFA 5E1MA 2ZW9A 4KIGA 2QYOA 4CTJA 1L9KA 2JHPA 2IDJA 2AR0A 1WS6A 5EHGA 2YVLA 5EMLA 5HIIA 2PSSA 5DLYA 1PRYA 1AF7A 5D1HA 2PGXA 5E1BA 1D2GA 3HP7A 1JTFA 4EKGA 1XCLA 4RWZA 2JHCA 3DUWA 1P1BA 3G8AA 4FZVA 3O31A 2P35A 2OXTA 1Q0SA 1R6AA 1UWVA 3NVKI 3UWPA 3DLIA 4RTMA 2PXAA 2ZWVA 5E9WA 3TR6A 4EVIA 4PNEA 3E05A 1BHJA 3GGDA 1G8AA 5GWXA 5DX0A 3Q87B 1YUBA 1YZHA 5ICGA 5K0BA 2O0LA 3MAGA 3PFHA 1KYWA 1FP1D 2FYTA 1R74A 4M7RA 2JHAA 2XYQA 3MB5A 4QPPA 4Y2HA 1JTEA 3UJDA 4RTPA 2CMGA 3OZSA 1G6Q1 3JWIA 3ME5A 5GM2A 1VLMA 4PYIA 1JSXA 4E70A 4E31A 4NECA 2Q41A 3CJRA 4ER5A 3P9CA 1L3BA 5HIMA 1BC5A 5B1SA 3EVZA 3G2OA 4BLUA 5FWAA 3I9FA 1XCJA 2NXJA 3NMUF 1PJZA 4MQ4A 2IP2A 2I7CA 1F3LA 3R6TA 1I9GA 4BP3A 1XTPA 5CVDA 5FWDA 3PX2A 5E2BA 1D2CA 1I1NA 4CKBA 5BW5A 2GA9A 2PXCA 5EC8A 3QV2A 2PX2A 3M6WA 2AOXA 1QYRA 3SSOA 3DLCA 4IV8A 4GC5A 4RX1A 4L7VA 4QDKA 3CGGA 4E2ZA 1RJGA 3LPMA 1MHTA 2ORED 3TMAA 4RTNA 3TQSA 1KXZA 5EPEA 3A7EA 2NYUA 3ELYA 1YFJA 3A25A 2ZBQA 4U7PB 3UA3A 1YZ3A 1JQDA 2BR3A 1FP2A 1HNNA 2YTZA 3WSTA 3DMHA 5K03A 3EPPA 1X19A 5BP7A 1R00A 3PT9A 2YUIA 3ER9A 4BLWA 1NW7A 4AZSA 4KW7A 5DX1A 4RTSA 2ZZNA 3OU6A 1UIRA 3OE5A 5FCDA 1RI2A 3OPNA 4OA8A 2BM9A 2UYQA 4IKPA 2PLWA 4FR0A 4Y30A 2HV9A 2XVAA 3SSMA 5BW4A 1DCTA 2QRVB 3P8ZA 5FUBA 5MHTA 1OR8A 5ICEA 3K0BA 4KRGA 5LQRA 3O4FA 5DSTA 5EZQA 4FT2A 5ERGB 1FPQA 3HM2A 5DM2A 4PYOA 2ESRA 2C7PA 3R9XB 2ZTHA 1NW5A 2PWPA 3HVHA 3V97A 3VYWA 3VC1A 3HA5A 2ZBRA 4BY9E 3G2MA 3G8BA 3KQYA 4PYNA 3GNLA 4C03A 2HMYB 3EVAA 2PX8A 4P58A 4YV2A 4MHTA 4Z2YA 2IIPA 2VS1A 2PKWA 5EMMA 1G60A 4RV9A 3DXYA 3FPJA 3DH0A 3LCCA 2IPXA 3SR4A 5JR3A 1KPHA 4C05A 1XJ5A 1ZGAA 3B5IA 4HG2A 4PGHA 2NP6A 3EVDA 4QTUB 1YFLA 2PBFA 3DTNA 4FS8A 3B3JA 4P7KA 5E8JA 3NDIA 1RI3A
chains in the Genus database with same CATH superfamily
2IS4A 1Z2PX 2QS9A 2I2CA 1H1LA 1E1CA 4DMLA 5F7XA 2PKYX 3PB3A 1JEDA 3AEUB 3QU5A 3QVKA 4KRXA 3TOZA 1TCAA 4PXAA 5JD4A 3WTCA 1ACJA 1K3FA 1K6JA 1RCUA 1WX1A 1G7SA 2OV2A 5K01A 5L40A 1ULZA 2EC5A 1TTPB 1EK2A 5LOVB 4OQNA 3NZEA 3WX0A 3GBPA 2XNJA 4V38A 4GRIA 5EIHA 3HCBA 3UAGA 1NJ8A 4ZCIA 3TLYA 3DE5X 3HUFA 3NOQA 1VP3A 4PZ0A 3TD9A 1XRRA 3W8RA 1I1QB 2PRZA 3A6DA 5DK4A 3GNQA 3AOEC 1UMDB 2F43B 3AZPA 3MOGA 4MRMA 3SZOA 3T34A 3WY9A 3DHNA 3TPZA 2OCYC 1KIAA 4L15A 2LCQA 1XTIA 5B58T 4E33A 4XQ0A 3R3YA 3UCEA 3WFZA 1ZM7A 1QV7A 4HK4A 1JG6A 4L5BA 4XEUA 2AI3A 4OJQA 4C04A 2FOXA 4KB5A 5P21A 2O3UA 2ZBGA 4JHXA 1E4VA 2Q28A 3N2KA 2JFUA 2QMEA 4ZVKA 1V5EA 3TZBA 1GZ3A 5D5HA 4PTZA 2HHAA 2NTYC 3CX3A 3L4BC 1C9NA 2V3VA 3RYCA 1XTJA 3VNRA 4EHIA 3L7YA 4W5NA 1Z6YA 5D3ZA 3WSWA 4EHKA 2MSKA 4ZT4A 4FWIB 3L0PA 4AZ3B 4EB3A 2HQRA 5J2UB 3TDNA 1FY2A 3WBJA 5IU6A 1UZNA 2BTQA 3BIFA 1PG0A 1CY4A 7GPBA 1NXQA 5CG1A 4OGFA 3SQDA 1YZKA 1GO2A 3RKRA 1J0AA 2YFHA 4D9EA 5KQLA 2EZ9A 3UT5B 4PSCA 1LDEA 3GLTA 2EG5A 4HFJA 1WDMA 1MCZA 4CUKA 3FPLA 4JHLA 2C0CA 1FIUA 3KYJB 4K1XA 3VYSB 3JD1A 2WTUA 2BELA 3I6ZA 5E0KB 1J06A 3WNVA 1P73A 1POWA 1UBCA 2WVGA 1UP6A 5CA0B 5TMPA 2C5HA 3BAFA 3BG5A 1J07A 3BILA 3ESZA 5BURA 3TG2A 3I42A 3RIGA 4L5CA 1RIFA 5GAJA 1XGKA 1WXDA 2WM2A 3QFHA 4IIFA 1ADJA 4MLCA 1ZN9A 4UD2A 3SYNA 3TI7A 4RVDA 1V5GA 3V4SA 3L7LA 1NBMA 3D1VA 5C7YA 4QTZA 4X6UA 4ND8A 2KM1A 4DCUA 1LUAA 5CFPA 3DZ8A 2RGDA 2MMGA 5IDQA 2COUA 4HN2A 4MGKR 4IWNA 1POXA 4F2WA 5JJCA 3M9WA 1SU8A 2XDAA 1EP2B 2ZKIA 2P2NA 2JLUA 2P91A 3L7CA 1FRFS 3PFBA 1TUEA 2FFAA 1WETA 1JVSA 1EVJA 3I8OA 4J2OA 3I83A 3R75A 4GMXA 2YIVX 1PW7A 1WULS 1SRQA 2YYSA 5FL7A 3FYUB 5AXBA 1KQ3A 1NIPA 1FE8A 1WMSA 1Y4SA 4G0QA 1OLOA 2DUMA 2HDHA 1PJ2A 3H5LA 3K0SA 4Q4HA 1WVMA 2XZPA 3E8XA 1U5AA 4YRTA 3B9BA 2CLLB 1U1EA 2WOJA 1GQYA 4GYWA 3WDLA 1ABBA 5AH0A 3T7CA 4MEAA 1M6WA 5B57C 4EK9A 5IT0A 3CRQA 5FWDA 1TKRA 3F6EX 2X0FA 4F7WA 3KT0A 4P33A 4ZO6A 2CHGA 1GADO 2H3EA 3E9EA 2HPZA 5K3CA 3RBXA 3V4VB 5KWIA 1C30B 1DAOA 2YQZA 3QWIA 4W82A 5SY4A 3EIXA 5T64A 2EYQA 3HA7A 2EJWA 3GNSA 4CMKA 5L8VA 3V1UA 4KR2A 3BREA 1KMNA 1VE7A 4E51A 4YRAA 2BGMA 3GFOA 2BN4A 3DZKA 3GOHA 1WLYA 2ZB3A 4QX6A 3E58A 1WVGA 3K70B 2FFJA 3D3QA 2G71A 3KHKA 4OSOA 4PAOA 3AIMA 3LHDA 4KUHA 4RSGA 2QPLA 2XIQA 5DPMA 4BB9A 2WD9A 4XD7A 3ZJUA 5LYJA 1IEWA 3GYBA 1KHHA 4IWYA 1SURA 1FXWA 2EFDB 3CUWA 1VIVA 3KQHA 1KJQA 3ZY6A 3I5YA 4JLUA 5JNWA 2Q1YA 2FZVA 2OZLA 2P9BA 3OICA 4NMXB 4QOSA 3RIHA 4BNIA 1RC0A 2PJUA 2PRJA 5KOHA 2AE2A 2OBMA 3GRAA 1Q1NA 1SZDA 1WEHA 2C3OA 1DLJA 3KDAA 1SD1A 1PFUA 2AEEA 4TRMA 4HZGA 4AJKA 1Z0FA 4N3GA 2FQYA 2OHIA 4NV0A 4HEJA 4L51A 1DX4A 3SQMA 1AGRA 1J8DA 1LPAB 5BSUA 9LDTA 1ES9A 3HDYA 4M88A 4E7OA 3P0HA 5JD6A 1CIJA 3NYRA 2E5FA 1BHSA 4V0SA 5BSVA 3MAAC 3OQMA 2BFFA 2R48A 4B44A 2WKWA 3GLGE 4F3RA 1NPYA 4U2GA 2LE0A 4F3CA 4FYKA 4QQ8A 4DV6B 3W5IA 4FFNA 2YVKA 3Q3HA 3BD7A 4KZKA 4OAOA 5KHOC 1FNBA 3GN2A 1JSRA 5E3HA 4U2CA 3K09C 3GCGA 3SLGA 4W5JA 3SU8A 3H2IA 3F4BA 1JILA 1YDWA 4F6CA 4OX9Y 4I50B 1XTTA 3E7XA 3OUZA 1ZWLA 3P45A 3PGXA 3QKWA 3HFSA 4OI1A 16PKA 1DKMA 4CXMA 4CM3A 1XWFA 4IVRA 3W5VA 2OD2A 1MIOA 1HYGA 2OWEA 3CVJA 4FINA 3IRUA 4K46A 3SEAA 1OUMA 1PL8A 2WIKA 3CCFA 3ETGA 3KNZA 4WCFC 2QOEA 3IVRA 4YUXA 3ADOA 2FH5B 4MO2A 1EUYA 5DYYA 1T29A 5IC5A 1F9AA 4K6CA 1YS9A 5C1IA 4NOJA 4RANA 4EQ6A 3NHRA 4H1WA 2HA2A 3QXGA 2CXPA 2VDNB 4YJ3F 3HE3A 3ODPA 4WX2B 5DM70 3BXEA 3U9TA 4XVUA 1XNQB 3LP6A 1A88A 4WUVA 3A1UA 1PJLA 1ZK0A 2CCKA 4N3BA 3K0CA 1OD6A 4RQAA 3I09A 4PAWA 3MQFA 3V8EA 2WBLC 2H1CA 3T54A 2VVTA 1IXYA 3HS3A 4W7SA 2QKYA 4AUMA 1Z62A 5B55A 1XWWA 1HLDA 1ZESA 4UDXX 2VDUE 4IMRA 1G6OA 2C5BA 5EHXA 4FUQA 5THKA 1AXGA 5M3BA 5K4HA 1B73A 1GNPA 4EJMA 1P9RA 3LOUA 3LK6A 4CKWB 4FMCF 3VSBA 1GKIA 1WB4A 2H9AA 1WKBA 2L19A 4DA4A 4K03A 4QEDA 3B70A 3LUGA 4Q48A 4X7BA 3CZPA 4YV1A 4MCJA 2PWZA 2OY0A 2X9NA 2PX6A 1KY2A 1DUSA 1P3JA 3CJTA 1BW9A 3O91A 2ZBDA 3T5PA 4MW1A 5CMLA 1PT6A 2ZS9A 4ZQHA 4LKOA 4DA8A 4H15A 1Y5MA 3UJ9A 5C5CA 4RDCA 4DBVO 1SVIA 3HYTA 3EFOB 3UV7A 4ESEA 5JDIC 1PJ8A 2B9VA 2XNCA 5JANA 3GJQA 4Y1RA 4I50F 5B7GA 3RFUA 1MAUA 1T2EA 3DOJA 3G23A 1H2BA 3D8NA 3M33A 2G72A 2RGCA 3LYLA 4WA8A 2AK2A 2O2XA 3DEIA 2HY7A 5D84A 2LV8A 1ZD4A 1Z5GA 3IDAA 5EXXA 5IUNC 1R3DA 3WWEA 5FQOA 3JARA 3CLUC 1T8YA 1GAWA 2ZSUA 3SKYA 1FTWA 1H2XA 2Z4TA 2ZUCA 4TN1A 4ARSA 1UBGA 3PHJA 4TTVA 3DV0B 4GG1A 6AT1A 3FI0A 2ODPA 2DCUA 4YPVA 1Z28A 1QC5B 2E49A 3O2SB 4UUMA 2AT1A 3H5TA 4AIRA 1JN0A 4R1UA 1VPEA 2IZ1A 1P3DA 2JW5A 4OMFG 3DVRX 5DLEA 2UYCA 1KMHA 4R84A 3RADC 3AL0C 2JGAA 2ZUVA 2VO1A 4S2EA 4LE2A 3TLGA 1BMDA 4ZHQA 4P0QB 1CHDA 2CMDA 3DFIA 4UDOA 4KIJA 4ZHQB 2R8PA 4WVFA 3B7GA 1ISJA 2D5LA 1EAYA 5J2UF 1D07A 4TLBA 1L4MA 5H4HA 4O1IA 3C5WP 3EIQA 2XT0A 1KI7A 3N2GA 4YP6A 1WXWA 4YUZA 1AURA 4WACA 4PNHA 4KV9A 4WNYA 2JLXA 2FK7A 3DMGA 2NXWA 2JVKA 5TNXA 3VC3A 2HF2A 2VZ9A 4UTVA 4KYVA 4IAOA 2FP4A 2HXGA 5I9LA 2Y99A 1GUZA 2IPLA 1NG1A 4KPUA 4YAGA 2XB2A 2HHCA 5DNAA 4HAVA 3STWA 1ABFA 3SJAA 1MXFA 4DADA 521PA 1EDZA 1IOVA 2OO3A 1JG3A 3BMOB 1KOJA 1MGPA 1S2MA 1N9GB 2JGMA 3GPBA 4WESB 5AHOA 4EARA 3PHHA 2RHHA 1NQUA 5DI3A 1GLNA 4L78A 1RE1A 721PA 3ICEA 4NYIQ 4LA4A 1TECE 5DI3B 1B14A 1PLKA 3OUTA 4QQKA 1E66A 2CHVA 2JLRA 4QXQA 1DHTA 5IH3A 2PXHA 4ZRNA 4URVR 2ZXEA 4LBWA 3NRJA 1HL3A 4BVJA 1L3IA 4AU1A 2HT6A 1QZTA 3N8IA 4GYJA 5EI5A 2CHFA 2B7LA 3QTBA 4RF3A 4RKRA 1A77A 3UK6A 4Z1MA 4E11A 2NO1A 3AONB 1YJ5A 1G5TA 3K2BA 2C1EA 1OA1A 3F3YA 4Y0VA 3TW4A 1TKBA 5DTIA 2XZDA 2X8WA 5KTKA 2W4QA 4AC9A 6REQB 2P7IA 5AM5A 1YDFA 3LRPA 1XEXA 1O96B 2WM3A 3W5SA 1JQBA 1E2DA 4JC4A 3TFWA 3TL2A 1DCMA 1M8JA 3LAWA 4D81A 2HQBA 3HCDA 3GJTA 2DVMA 2TECE 2BE9A 3K0CC 3R0QA 4N3AA 1HEIA 4N8DA 3VUFA 3G1UA 1Z8HA 1I80A 3JQEA 4V3CA 1V11B 2G1JA 5TMEA 1NN5A 4LE0A 3JVUA 2WAYA 4LECA 4P34A 1OZ0A 2I03A 1NBHA 1RE0A 2O0KA 2V8BA 5CVJA 3ZVNA 4N41A 1XTBA 1LGYA 3T1YB 5BWOA 1P45A 2Z8XA 4LC0A 3W3AD 2XGGA 2IUEA 3QLVA 1YMQA 3HZHA 2HEIA 5FOVA 1OY1A 1NLUA 5F1YA 3TSWA 2ZYVX 3AUTA 2Z5VA 1GCIA 1QVAA 3RH0A 4UFNA 3IPYA 1Q2UA 4BCBA 1XL1A 1U0GA 1OYWA 1E20A 3ONFA 1WTCA 4JBXA 4KQFA 4XH9B 1N8TA 1JTFA 4OQXA 1RHUA 4FZVA 5A3QA 2EZUA 3TR0A 3T3PB 2HK8A 2HO5A 1R6AA 4FGJA 4O4LF 1V8OA 1C9MA 1MJNA 2CN1A 3ZWXA 5JH7A 1QQAA 2R6DA 5DO9A 3VZRA 3PNSA 4G4SO 4EG6A 4BE9A 4JVMA 1Y4UA 4LQLA 4MIOA 2QW8A 1IG3A 3ZHYA 4IICA 2PMDA 2WF5A 2IHJA 1LBHA 2FYTA 2HCRA 3H65A 1RHQA 3TUIC 1W5TA 2QR3A 5C5IA 3Q4GA 4M8KA 4IDHA 5I9NA 2P78A 2X4GA 1KDRA 3RROA 1K7XB 5FNVA 2OBLA 2BP7B 1QJCA 2DR3A 3RBVA 4E31A 2E5LB 1SJ9A 4DQUA 4M22A 1USWA 3I2IA 1Q21A 1XZBA 3K35A 5B1SA 5IASA 5TPWB 3IJ5A 4IJWA 4WCFA 1LSOA 1C0KA 1C8BA 2IP2A 3FLEA 3F7TA 4G36A 3O8OB 1OI3A 3RSCA 2YDYA 3S7TA 2IOQA 3OH8A 3RR2A 3ZWNA 1UKEA 4KTVE 4NNPA 4YX9A 1A0OA 3MMNA 4B7UA 2AOXA 4ZYZA 3E03A 4J90A 3JZDA 4NJOA 2OZKA 2P9QA 3SNHA 3EQ9A 1OLUA 4EP1A 3QXSA 1E1RA 4KQ2A 1BFKA 5KBYA 5ALDA 1RRGA 3NUQA 2OK7A 3GA0A 4J43A 1KXZA 1SU6A 4TS1A 4KAJA 5HBGA 3RRBA 5BWCA 4US1R 4U39A 2B0JA 3R8CA 1ACLA 1NY6A 1YBFA 2ZWOA 3A25A 3F8SA 1CY7A 1U8EA 4FBMA 4Z3DA 3C3MA 3LVBA 1VCIA 3U4IA 3MNFA 2BY4A 3PT9A 1YRHA 3WJ2A 3ELBA 2Q6TA 4Q3OA 1D5CA 1DBRA 2I34A 5BV2P 2IS1A 1EFRA 1GQSA 2CZQA 4G5OA 1BCSA 4P83A 1E59A 3FROA 4RIFA 2WM9B 1NFRA 3GHHA 1YRYE 3S6JA 1ZAYA 2YWGA 1K7EB 1U2PA 1JAHA 1E3WB 3QVUA 3PUKA 5LP6B 2SECE 1P1KA 3DUFA 2A5DA 3I72A 5KZMB 5EYPB 4MKZA 5B1IA 1LFAA 2JCBA 2QJRA 3T4XA 1KFCB 5JI2E 2IUYA 5D2CA 4JLVA 1S1MA 1XAIA 2ZTHA 4IDFA 2QWXA 1YASA 5NLLA 1NVMB 2FZ4A 1P8AA 3V97A 3D8HA 1CB0A 3ACBA 2O2EA 3T5AA 3GQVA 1RYEA 2CJFA 1W36C 3AO0B 1G7TA 1M1ZA 4LJKA 4UHKA 2FHSA 4FMBB 2V97A 3SD7A 2HMYB 4GX5A 3ZXUB 2A1UB 5DBIA 4DBLE 1XPRA 2XWBF 4HB0A 1DAIA 3SBEA 3ZHXA 3Q9UA 1XJ5A 4PGHA 1TYCA 3WKBA 2ZIXA 4U6SA 3RVQA 4DXAA 3D31A 1WHSA 3QP9A 1V6CA 3O7MA 4DIBA 3KVOA 3KKKA 1J2RA 1KF0A 4IVQA 4Z9FA 3FFWA 3UGKA 2L69A 3KYIB 2KJQA 2X1LA 4CEJA 2IHVA 2YIMA 3MD0A 4RABA 4QJ3A 5B36A 1VYVA 2NUAA 4RPKA 4DMUB 1K8XB 3JWEA 3MT0A 2ZZMA 7MHTA 4RYLA 4A6PA 2BISA 1HE8B 3C3DA 1QIEA 4KVGA 2YWJA 1PL6A 4J07A 2HWKA 4G65A 1NPDA 2W2TA 3A2KA 2D4HA 3U80A 1M5UA 2GI4A 2JFXA 4HAIA 4B4WA 4KP7A 3W1WA 2IH2A 2YOGA 1T4CB 1ZN2A 1KZHA 1I0IA 1PBTA 2FI1A 2H4HA 4IJUA 3B9QA 4JJFA 3OZCA 4DPMA 1TEVA 3DQPA 4MR8B 3FR8A 1GGNA 4CR6A 5JUWA 3SDZA 4NDZA 2CNLA 2XJ4A 1MO3A 3CNEA 3Q3VA 4KSCA 4ZV7A 4B4KA 2PFSA 3RTEA 1PR4A 1RLIA 2NP7A 3KLNA 5TC4A 2GUWA 3WC4A 4WJLA 3R5KA 5IVIA 2O57A 1RYDA 3QPAA 1A96A 1KJJA 4P84A 4PPNA 1RIIA 4CFYA 2DHRA 4RJ2A 4DCMA 3ILSA 4PO1A 1SHLA 3L8DA 3KVRA 1GGJA 5DK6A 3HYNA 3V1NA 3MTDA 3AF3A 4W8GA 3FPGA 5EJIA 4BTLA 3I45A 3PR1A 5JXGA 1OFGA 2WA2A 1ML3A 1U90A 2ECQA 1Z2OX 4X94A 4YPOA 4XVQA 2P6NA 5D1NA 2AG8A 1JXOA 1L5YA 2X4LA 3BC1A 5C1DA 5LMCA 1E2LA 3UB4A 1GTJ1 1VL5A 4C5BA 1T2VA 3BH6A 2FXVA 4UCXA 4RHXA 4S1VA 5JMOA 4EFLA 1Q6YA 1J9GA 1ELOA 2AX4A 3AUJB 5K2OA 3WTBA 3U81A 5JECA 1D4FA 2QTMA 4OYYA 4L0CA 4QQNA 2VYQA 1G8GA 3A11A 4O4HA 3BCUA 2JI9A 3KALA 1ZZEA 2W2MA 3VR4A 1QAMA 4BB0A 5KSZA 1X8KA 2JAQA 3EWNA 3G89A 4J3FA 1R4ZA 1V7ZA 5DTRA 5BUSA 3PDUA 5I6DA 4XR9A 1ZINA 2WE8A 2GASA 1Y7PA 3ZJ5A 2G5PA 2I22A 3ZY5A 2RGEA 2V6FA 3AIIA 4F3NA 4MVJP 4ZJZA 4IV5A 3RRYA 3H1AA 2VPWA 4U6QA 1U3FA 4DV1B 4MWCA 4JKIA 2ZIZA 4PBTA 2RE8A 1KP3A 4R1QA 3U7GA 1H4VB 2W7TA 4U7FA 4JSYA 3B13B 1JFRA 3OX1A 3SHVA 3UAYA 1IAQA 4L76A 1QVWA 4C0AC 3C3CA 2D6FA 1EINA 3LDHA 3LHSA 4JASB 2OQRA 1F14A 5JNVA 2A0YA 1VP9A 1EK5A 3C4QA 2PMWB 3L4KA 1M2OA 3CZQA 1RCTE 1CJUC 2RSLA 3AP3A 1WBBA 3BH7A 4MV7A 1INLA 3UHFA 3CE9A 4UEQA 4CWAA 4UHFA 3ZYCA 3SS9X 3IIKA 2PKEA 4X6YA 3OTQA 3RS7A 2VJYA 4CNQA 4GI5A 4DRZA 3AVOA 4QFDA 1NWCA 4OUKX 1VZ2A 1OKKD 2VHCA 5BUZA 2DP4E 3I92A 2Q9CA 2XY4A 4P1ZA 4A03A 1Z22A 4XX0A 3L2OB 2QX7A 3LDGA 4TYMA 4Q9HA 5TS2A 4OTZA 1LF0A 2HHLA 2JFWA 3SXPA 5TQ0A 1UBLS 2H6EA 2BT4A 1CJBA 3HDTA 2JH3A 3JVEA 4H0NA 3R7AA 1UFRA 1TVKA 5E7JA 4RQTA 1Y33E 3DJFA 3MHTA 1VYUA 2M9MA 3MT8A 1NTRA 2JB9A 3QLJA 1JS1X 4MUNA 1I4OA 4MYTA 4XOUA 5I9TA 4BFLA 3COWA 1CDZA 2O3TA 3EG9B 4ZGGA 3HBAA 4H3HB 1M2VA 4F85A 1ADBA 1Z6QA 1KR5A 4TLMB 4HF7A 3T12A 1HQYE 3T8YA 4BHTA 4L75A 4Y2UA 3UN1A 5BYBA 4I81A 2QTNA 5EJ2A 1Z3CA 1H1DA 1RYMA 4PR0A 3LBFA 2Y3IA 1U3VA 1PU2A 1YKFA 3L06A 2QSUA 2BFBB 2C92A 1T1EA 1Z5PA 2C9BA 1N7HA 2QE7A 4DCOA 4EY8A 1XRPA 2PG3A 4HI0E 1T8UA 5HQTA 1HDYA 4DV7B 3O4IA 4YIKA 3GLFE 3O75A 3WBFA 3IKTA 5CAEB 1AXRA 1SHTX 1Z29A 1FL9A 1L4NA 3LCVB 4H7HA 4ACBA 4OGWA 1U3GA 1PE0A 3KFXA 3JQCA 2CBXA 4GX1A 4M1SA 1OZGA 4DLTA 5JY6A 1COWA 1FP4B 1K9VF 5AK6A 1ZM9A 1E2PA 3DZDA 4BATA 2D2VA 1F1JA 1AQ6A 3E9YA 1FQWA 3NTQA 1U1GA 4Y6OA 1RXVA 2YYAA 3SZ3A 3UV6A 3C3EA 1GU0A 4I2NA 4MV3A 1U63A 1MC5A 1U4NA 2VUSA 1TCVA 3HJUA 4M8LA 4YFVA 4ZOEA 5EHNA 3VO8A 3IBYA 4BIMA 1B8PA 1UK7A 4KDCA 2PMBA 4N40A 3IP1A 3UFBA 1DC8A 4N5HX 2QTGA 4NYIR 3VR6A 5K0TA 3ZOZA 4G9GA 4UU8A 3IT2A 2XMBA 3DGEC 3PPYA 5HKAA 2J0SA 1JLHA 3NONA 1GIAA 2I1QA 1TVEA 3A4NA 3GPDG 4YCMA 2CSXA 4KXNA 3UIEA 4HTAA 1P8JA 3WHPA 2O07A 3HDVA 2ZS7A 3VNBA 5AW8A 5CK4A 3L8YA 2G6TA 3CTMA 3HNPA 5IDWA 1RWVA 4M0EA 3VOAA 5J63A 4OHWA 1CJKC 2B7CA 2FK8A 2IGBA 2O05A 2QUKA 2REXB 3EOAI 4NWIA 5FJJA 5BSMA 2PZLA 2VP4A 3D59A 1ZMRA 4DCGA 4A4DA 1X8LA 4DWWA 1C80A 4ETWA 1V26A 5JNSA 2JA1A 2JEOA 3W05A 5LKAA 4UU7A 4LF9B 3H2HA 3UAWA 4BX0A 1Z45A 4FUTA 1M5TA 3GFGA 2X0NA 3RHFA 5SV2A 3RWOA 3CEPB 4EMBA 3LWZA 2LZ0A 3PNLA 2UZIR 2BFWA 3AWDA 4BX2A 4YAUA 1NBOA 3ZHZA 2C8VA 3CX6A 1AGPA 3TQQA 3G0GA 3O93A 3NALA 4AAYA 2ZIXB 4YI5A 1MP0A 3CLSC 3F0TA 3DMFA 5KNBH 1XJWA 1VJCA 4GPZA 3NGLA 1QJ4A 2R7LA 1R0LA 3ADKA 4GYKA 2CUKA 1G19A 4HBGA 3VDXA 4TYQA 5LQKA 4K81B 2O5RA 2XH8A 2ASEA 4TS3A 5HRCA 4MB2A 2NAFA 3BSFA 3E9DA 2IYLD 2GJ4A 3PT5A 5FBVB 1RADA 4ZK6A 1UK6A 1NFFA 1TT5A 1UEXC 5JU6A 5A9SA 3WV4A 2JIMA 3A1EA 1H4QA 4LV5B 4B5LA 4RYDA 1MQ9A 4C3ZA 1Z73A 1UH5A 3O9VA 1M10A 3EGDB 3WGZA 3MGKA 3OG9A 1E3MA 3ZLUA 3EVEA 4LJYA 3KQTA 3VMMA 2DLNA 4X1KA 1OBCA 3MIZA 4OIFA 4CG1A 1CY0A 5FB3A 2ZJFA 5JJBA 4M7WA 4ZT2A 1VM6A 1JKJB 3OQHA 1F4VA 2YQ4A 2O3QA 1NBIA 4I8IA 1RHJA 1QQTA 1F0KA 3OM8A 4CV1A 1J2JA 1J1ZA 4XWWA 4K9LA 3GEDA 2C2WA 2X5JO 3WYCA 5C53B 4X41A 2FKNA 4ZHSA 1LPNA 4JBYA 5E3JA 1JFVA 5C46F 3VOSA 5M2QA 2E4UA 2W6NA 5U4XA 2CDRA 4NMMA 3NHKA 1H5QA 1EP1B 1OXUA 2ONKA 2NX2A 1YBHA 2PL1A 3DKIA 3PI6A 4N7BA 4XI9A 2CY0A 1G6HA 3G9QA 4NPCA 1E7YA 3S0JA 5F3WB 4DWVA 4FSXA 1T0HB 1ZZGA 2B34A 1E2MA 2CNWA 3II6X 3Q98A 5T4BA 5DCLA 2OOSA 2QQFA 1D0SA 1MFPA 1QXSA 1S8NA 3EA0A 3M2TA 4IJ5A 4EGSA 5CFZA 2ZI5A 1U2DC 3WK8A 1ZXBA 1QB8A 2MMCA 3LBAA 3PG5A 1L5NA 2C00A 4DIKA 5CXXA 2FY8A 1QH1B 2HPHA 1UANA 5SZJA 4EUFA 4XASA 2YR0A 2XMPA 1V25A 2CLKB 4B6OA 2IITA 5T8KC 5KNCD 3CKKA 4ZXFA 1TK9A 2XR1A 1H85A 3RU3A 2NYAA 3E9RA 3BHIA 1DFHA 1BMTA 4BC1A 2O6HA 1BHO1 1C4KA 2PBRA 2PKXA 4OF4A 4WKCA 4AZWA 4R31A 4IG9A 2P3QA 3EAGA 2D2IA 4RK1A 3WFIA 2C2HA 3QMMA 4MPDA 3PE4A 4PICA 4TT3D 5K45A 1NOIA 2DM6A 1YI1A 5LMUB 2GTPA 2HSJA 5DNCA 3O90A 3IEVA 2D1FA 1O9BA 4UHDA 5EOVA 1EEXB 4H60A 3RG8A 1B26A 2FMKA 5IFKA 4DJTA 1ZJJA 2B2CA 5EZSA 1AUXA 1QH9A 4Y9DA 2LBPA 3VPSA 1F2UA 1O4WA 1WIWA 2I4LA 1TVCA 2NSDA 4H0FA 4I1IA 4UE3S 5FV7A 3T4PA 4I14A 4RTJA 5FWYB 3FFXA 4DMCA 1Z8DA 3C6ZA 4ABTA 1QZUA 4KQJA 1MZPA 2YMQA 1H05A 2J30A 3DOFA 4B74A 4D0LB 4DB2A 3I76A 5CBPA 3VU3A 1H2ZA 3TECE 4CEIA 3SLRA 8MHTA 5BMVB 1QFYA 2DUJA 2HRBA 3GUZA 3OM0A 5ESXA 1PR5A 1ETHA 3L8ZA 4GL4A 4H18A 1EJ6A 2HMVA 3N1UA 3C85A 1N7JA 2E6KA 3R09A 1C3JA 1CDEA 2Z0MA 1OHHD 4JOSA 3R9IA 4KMOA 5JXJA 4E5KA 2H0AA 1P4JA 4LYJA 4NBTA 5TQ0B 4F60A 1SQGA 2H9IA 5BPFA 2DT8A 1FLAA 2IP1A 4XCXA 4MS1B 1SQ5A 4CIBA 5JY1A 4E07A 2QXTA 2PVSA 3UA4A 4J7CA 4QPDA 6ADHA 3DM5A 4HXEB 3IOMA 4FFSA 1M2VB 3FDJA 4C6SA 1BNCA 2CFCA 2ZVJA 3CS3A 5E7MA 4DNPA 1JSLA 5E6SA 2V5AA 1QHIA 4G8JA 1BGWA 4IIVA 4H17A 1EDOA 5HSGA 2B4KA 5DOVA 4AJ1A 1R16A 1OAOC 1JTVA 4PRYA 3GLUA 5ITSA 1X13A 1IZZA 3D64A 4MWTA 1AZSC 1JHOA 2A5FA 2P68A 3CH6A 3ZWCA 5JS7A 1AF7A 4B71A 2XDWA 5ARDA 1Z25A 3IMGA 3NEJA 5CLJA 3Q10A 1CEQA 1RZ3A 1CUUA 2O8VA 2Z2IA 3JQ7A 5EHQA 3PEWA 2J8ZA 3VR0A 2PSEA 4QWMA 1MA3A 2BFMA 3T3HA 3ADDA 2ZWVA 3QVSA 4B2YA 3FZYA 4L16A 4PAGA 4FGSA 1ZR2A 1O5TA 2OUKA 2W6PA 5GONA 3G9XA 5KUTA 1XK7A 5JRJA 4QPPA 1EMDA 2XUDA 5FUMA 3SF8A 5LDGA 3KOZA 2Y1GA 2H7VA 3WICA 5KQGA 4OLBA 4P4SA 4B47A 4M0UA 5INTA 5KKAA 3GEBA 3UMFA 2C9OA 1PR0A 4KN9S 3L7MA 2XOXA 4ER5A 2UUAB 4BN5A 4N7MA 2FN3A 3WLHA 2HIAA 1H8HA 5CYFA 5BUQA 4FJ1A 2PUGA 2J0UA 1JR6A 1MT0A 1Z74A 2ZRFA 1Y48E 3OT1B 1F3LA 4G0OA 4ZV9A 4Z1OA 1I0LA 2XCTB 4H3VA 4I4TF 2KBEA 2YW2A 4N5NA 1VHDA 1DAFA 4UUNA 4MWSA 2C84A 3RAEC 3RASA 4B84A 2VBGA 1C8LA 2BGUA 3GJ4A 3VR3D 2C8KA 4LY0A 2PRIA 4OMUA 2R66A 1Z7EA 3EUAA 4Z4HA 4NCKA 2XAUA 3JTEA 5TDHA 2DPGA 3RS8A 4R71A 1CUDA 2ICAA 3N8HA 3Q7TA 5F1PA 2PMCA 4FEAA 3FAZA 3ZBQA 5F76A 4LOAA 4UVDA 5KYTA 5KMGA 2J9GA 4N8EA 3O4RA 3UUEA 2NSHA 3CLUD 2J7KA 2WAXA 4A2CA 2X23A 1W34A 4Q66C 4JJZA 5DXFA 4TYNA 3HXOA 5LBIA 3VJLA 1EBUA 1JPUA 1JRLA 3I0MA 4BMPB 1XVLA 4HWGA 2CFTA 2W8BB 3MS4A 1WSWA 2X1MA 2J6HA 1G291 1G1AA 1CERA 1XLUA 1U4OA 2RHWA 5DX1A 3EQ7A 2ZZNA 1PNRA 3DMRA 3W3AH 5EWMB 1C9DB 1R6XA 1GPH1 2AC7A 1JH9A 1NMXA 1UBUS 3AK4A 3L1HA 4WSOA 1U3TA 4XGIA 2J0VA 4R2LA 2VRWA 3RT9A 2PUVA 3OWHA 4FDUA 4G2TA 4MV8A 4I6GA 4WV3A 3LRXA 4O8ZA 4WBSA 4MAMA 4JCCA 3QVGA 1YS7A 4HQLA 1EI9A 3OP4A 2GCEA 1FFWA 3KLOA 1BG6A 4PYOA 3R7WA 2C7PA 2PIDA 2QZPA 5KYVA 2ETXA 2RI6A 3GRKA 5LCXA 1MMFB 4F21A 5LWHA 3L92A 1O8BA 3IVXA 1LLFA 4H1UA 4H7IA 4PFSA 3EVAA 3D2BA 4PZYA 3WK4A 3G7NA 2IIPA 1OC4A 5A4MS 3ESRA 4PGMA 1CRZA 1BRMA 2F9MA 3DFKA 2B4RO 4IIHA 2WIJA 2BF4A 1JEQA 4L4ZA 2E4XA 4F6LA 2ZETA 4N0MA 2NZVG 1JKJA 3QYPA 1EVIA 1N2CE 2WV9A 4KKVA 1LEHA 3FHOA 3RRZA 1SVLA 4UPVA 3GLIE 4Y7DA 1ZVJA 3RUAA 3PDJA 4GXNA 1YVPA 1J8FA 2OSBA 4R40A 1WCWA 4GKAA 1N3IA 1UJ2A 4ENTA 3IQHX 1BXRA 4OK6A 1RJWA 2HU7A 4UNSA 1PFYA 1VPVA 2OBYA 3UK1A 2VNHA 4OXNA 4PONA 3PIIA 2JH9A 5FNVF 4D3FA 4EBBA 1M0WA 4HFNA 3OWXA 3MYRA 1SC4A 1VGRA 3UW3A 5EXTA 5BNZA 3UHOA 1TOAA 4GR5A 5LQCA 2IBTA 2G4VA 5CJ2A 4RHCA 1QK5A 3N59A 4J1QA 4E5MA 2DPYA 4WECA 2PD6A 3M1IA 1IHPA 2I4NA 3CLRC 4DWOA 5C8YA 4O4IA 3I6BA 2P90A 4YMHA 2HWUA 4CVNA 1BIFA 1AKWA 3OKPA 2JGKA 1WB9A 2AQHA 4CV0A 1TCUA 4JV5B 1YQ9A 2Y2UA 2BDUA 4WOCA 3UMCA 5FH9A 3ULKA 2Q2OA 2W93A 4NENB 1UK8A 4MW9A 4U0KA 4P81A 1TM3E 1QOQB 1N6HA 1FZQA 3QVXA 5BNFA 1EE2A 4P3PA 4MVCA 1IZ0A 2BSXA 1WY5A 2XLCA 2PZKA 2EGGA 1BDBA 4QHTA 4XUCA 1RXIA 2W0SA 5EVJA 3SOZA 2VATA 1GHTA 1TM1E 3CM0A 3U48A 5L45A 3EX7C 3ETLA 4PGFA 4Q4HB 2YIDA 2QX4A 2D5BA 3MJRA 3HSKA 3K4HA 3LCJA 4HADA 3W79A 3OQVA 2IU6A 4E32A 1XR3A 3WMRA 3WKAA 1ZUNB 5LBTA 1QVRA 3WMGA 3EGWA 4M1QA 5IVDA 4B6GA 4C30A 4LRYA 4JYCA 1EDEA 1ZOLA 5LIRA 2B4TO 2XWQA 4Y6RA 3RUHA 4D5EA 5CDHA 2AMLA 4Y9RA 1AS3A 4ZODA 3PRHA 1R9JA 4PHCA 5IX8A 3L9XA 3SX4A 1M33A 3BFPA 3AI3A 3HZZA 4R3UC 3H2GA 4RK5A 1D0VA 4EG0A 1JIKA 1B8OA 3N3AC 3OZRA 2HCTA 4K7JA 3ZBTA 1XAGA 2CHQA 3LUJA 1CUXA 2NO5A 4W8OA 1KMHB 1TD9A 4GPEA 1XLVA 2WJ4A 5JALA 2OKCA 4TT8A 3DLPX 4HLCA 5B5SA 3BWMA 2OG1A 5EQFA 4X1YA 3VYRB 5K8JB 2YX1A 4DRXA 3TRFA 1V9LA 4M7OA 3L84A 2CCGA 2VWHA 4KMMA 1B2RA 4XYLA 5CFOA 1TPYA 4IW3B 1M74A 3QWAA 1GQOA 1FU8A 1JV2B 2R86A 4OQQA 3EH2A 3MWDA 4QYXA 2P65A 1TJ4A 2GCNA 1IBMB 5KSYA 4LSWA 1IL0A 3MWDB 4C3UA 2Y1CA 1V1MA 2VT2A 4NCIA 3KPWA 2D5IA 3G8YA 3PLNA 5LWQA 4JP5A 1D5WA 1GVNB 1DCKA 5IVHA 1F9EA 1O77A 4N0PA 1FDSA 2VDWA 3KAJA 1GTL1 2CFOA 4MTLA 3D1LA 3PEYA 3FAKA 3OJLA 1YQDA 4LPKA 1PJCA 4C6RA 4F3KA 1RBYA 1CVLA 1Z0KA 3D7MA 5B3LA 2JG3A 1G55A 3E23A 1O0CA 4WZZA 4XGNA 1YT5A 4COKA 4D4MA 1GPDG 1NR1A 3KXPA 4A82A 2Q8PA 2VBFA 3QEAZ 1GV1A 1ESNA 1JIVA 4WGFA 3RS9A 3OKAA 2NPIA 3LQ1A 3P52A 4I99A 4JXKA 5EIBD 3SC6A 3SYLA 4COOA 4D57A 3B9PA 2QW0X 3KXLA 2FEXA 1Q0RA 4PN3A 3FRIA 3QEMA 3GT0A 5IUKC 3T1OA 3UJNA 1Z34A 4KFSA 3D4IA 4XGRA 1T9AA 1N92A 3MLEA 5TE9A 5TXGA 5HUQA 2C83A 1X7XA 1XEXB 1DVRA 1LPSA 2KE5A 1CR1A 2ZDHA 3JCZA 4FGLA 4Z9AA 1X86B 2UVDA 1UWLA 4X1OA 1SKYB 3RFTA 3RSZA 4HNHA 1E5QA 3DXFA 1I3NA 2B2NA 1TT7A 1KMQA 2DJ5A 4ZN6A 1X1AA 3PA6A 5JHHB 1HE1C 3PPVA 2OV6A 5JSHA 6NULA 4TQUS 3C45A 4UE6A 4BNUA 3C5VA 1ZMXA 3K1AB 2HF8A 3DKVA 3R3JA 1CZRA 1TRKA 4LBZA 4UMDA 4AG6A 5DTQA 4ER7A 3QBTA 5KPDA 3N0XA 3ZV7A 5IWAB 2P3OA 5J4VA 3PE3A 4DPKA 4UXIA 4V3BA 4L8FA 2GLXA 5FJIA 3TNYA 3VSCA 5G1NA 3OX3A 3SZUA 5A5DA 4U2BA 1SCUB 2Y1EA 4YP0A 3EZ2A 1A8PA 3PC6A 1EXVA 1MA0A 3FCXA 3P4UA 4H27A 2RKBA 1CD5A 3TRKA 1V9SA 2X13A 4H6XA 2WUFA 4R8SA 5AOCA 5BR7A 2GBPA 2AOVA 2GHTA 3DEAA 4HLUA 4LRTB 5J5VA 3WE7A 5ARBA 5A0VA 3TW0A 4W1PA 1FOEB 4GOLD 1PZFA 2YS7A 3DBHB 3QX7A 5T4HA 4FD3A 1T26A 5BQFA 5JCPA 4MPJA 3GPCA 4I0WB 4BFVA 1SVKA 4UASA 3RANA 4CLRA 2PD4A 2AC2A 3F8WA 3JWPA 3RYIB 2QX9A 2A8YA 4KQXA 2VP3A 4TV9B 2PIAA 4FFOA 2R8ZA 1SCDA 4GMDA 3RYIA 3VV3A 5FWNA 2GFQA 2NU7B 1OOEA 4ZYLA 5EA2A 3X1YA 3MFQA 2XXBA 1G5RA 1YXMA 2X5NA 3B82A 5HBRA 3RGGA 5AVXA 1FUIA 1X77A 1EBFA 4WFIA 4X62B 3S2EA 3I4CA 4PO9A 5TMBA 1FNSA 5DIFA 1QKJA 1E0DA 4ZP1A 1W46A 2ZI9A 5TLSA 4JBNA 3PR3A 1GA1A 4R98A 2RGNC 1PJRA 4PLPA 1RWQA 4BV3A 4TKVA 3RHSA 5IHPA 1JLSA 1NOKA 4LRUA 1IQPA 2M6LA 1X2EA 3WDKA 1AC5A 1LSUA 2C57A 4KNVA 3H3XA 1N25A 2N1BA 2QK4A 1ZGBA 4IIGA 4Y2PA 5T3YA 2A78A 3IEKA 5SZKB 1TCBA 4KI0A 2CC2A 4RZHA 5HMLA 4BV8A 4GIBA 3BMOA 4DCSA 3T1HB 1QTIA 1THTA 5FV4A 2BEVA 1LLDA 5C31A 5FD8A 1ZJWA 2V7TA 5BMOA 1DI0A 2VAPA 4IDCA 5ERYA 3B53X 3JTMA 2R8YA 2JGDB 1ZNWA 5FTWA 3UJ8A 1CW2B 3ECCA 1GR1A 1P39A 3G6WA 2RGWA 1DQNA 2IEIA 3ZZNA 1N77A 1HFWA 3WWPA 2I8CA 2ID4A 1U28C 2JGFA 5IANA 2C97A 3O73A 5DGHA 4ACAA 4JXXA 1N2CB 1HDOA 1BMFD 2CVFA 3N3BC 1T1GA 4II2A 1JZSA 2AXPA 4TVSA 3DAFA 3D6TB 3I32A 2C4UA 1AE1A 1RQXA 2R6HA 2RGAA 3REFA 1FU7A 3GIDA 2DH5A 1KE2A 2Q2WA 3RU7A 4U3JB 4CR7A 3QWBA 4KC0A 2CL5A 4U00A 4BZXA 4OO3A 4F9EA 1QPBA 4BO7A 1L0BA 2NSJA 2J45A 2Q3HA 3G9ZA 1IHDA 4OXQA 3FOBA 4Y1GA 2VNIA 1VHLA 3LC7O 4DLPA 3IOEA 1YC2A 1QG6A 1PSZA 2ZJ1A 5ALNA 1XZDA 1JA0A 4AT1A 3FZQA 3NH6A 5CNKA 1DJLA 1NHWA 1P2BA 1WDLA 3J81k 1GNRA 2M2IA 3PGKA 4Z9BA 1KK1A 1ZYUA 2JIZA 3H6GA 4QNMA 4QREA 5AJZA 3H16A 3LXMA 3SYKA 3G2KA 4L74A 2EKZA 3VH4A 2VPYA 3MTAA 5BWLA 2VCHA 3OEEA 3F7NA 1IN7A 4UNNA 5K6RA 2DU8A 1V8PA 3IVCA 4JELA 1HDXA 1E9RA 2R84A 4CM9D 3FPAA 2G77B 5AM1A 5LA6A 2OM2A 2ZSFA 4YCJA 5KAPA 1W85B 1ISSA 5HQ3A 3OHPA 1NAHA 1OH5A 3URKA 2UYOA 3IAXA 3NHWA 4Z0NA 2D0PB 3TOVA 1I2BA 2WFLB 3FYUC 1MC1A 1B0ZA 1EGAA 4X91A 2VAWA 7REQA 2UZ0A 4J1SA 2SCUB 3KE9A 3EXAA 4YECA 4OLAA 2DFPA 3QUCA 3AEKB 3VKUA 4R6WA 2JJYA 1VCNA 2YRFA 2ZSIA 4XEHA 1M34E 5BRJA 2NG1A 4QUAA 4HLDA 1SKAA 3ZBUA 4YP5A 4F86A 1XL0A 3L8GA 1U7OA 3FYHA 3ASZA 2B94A 5TQ2A 5H1YA 2FNAA 3ICPA 4C4XA 1SXQA 4AS3A 1E64A 2NNLD 2WTEA 2VHTA 5D01A 5L3SA 2P9YA 4EB6B 5ENDA 4ZJYA 1WCIA 1XKXA 5JYBA 3G2PA 3PUYA 4V1CI 4MKXA 3IDFA 1V1JA 1VIAA 3EG5A 3ROZA 4AJ4A 1LSJA 2QL6A 1GV0A 2WSIA 3BERA 1GN9A 1VL2A 3JQAA 4L5IA 4YAKA 5KNBD 2RDMA 1N1DA 2XSZA 2ZRPA 3VAZA 4CQNA 3DL7A 2BOVA 1CIPA 1VA4A 1QH8B 4DABA 1E9BA 1NKTA 3DE1X 4ZAGA 5BSKA 1TX4B 3DZJA 3T7SA 2WTNA 3DE6X 4OBEA 4YHHB 4JZYA 1TA4A 1DBQA 3AF0A 2XT9A 2PY6A 4MUYA 4LW8A 1WUYA 1SXPA 3EARA 4V0NA 4YRRA 3NIBA 3AWIA 4WDRA 5EG5A 1U8UA 2AI1A 3PXAA 3AERA 2ZTMA 2YY6A 3UBTA 1PFKA 4F46A 2CNKA 4NYMR 1U81A 4HQ0A 4OQEA 5B1HA 2DFVA 5K8VA 1G20E 3CB4A 3JRNA 2G09A 2OORC 4ZCPA 4N18A 1BCSB 1VG1A 3THYA 2A92A 1OYVA 1SVNA 1XMJA 3HDQA 5EHGA 1ZN7A 4OHMA 2ZRMA 5ES4B 1OREA 5K0ZA 1PRYA 1PTKA 3T1VA 5JAMA 3FSRA 1QIGA 1YDMA 1Z5UA 4BO5A 8AT1A 3R1IA 3RAPR 3LC0A 1WB5A 3HC7A 3V4FA 3I3SR 4UNQA 3PF9A 1MD9A 1YQGA 2EJCA 5FTMA 4BVBA 1GZ4A 2DRIA 3HKCB 4X3PA 4E03A 5A1TA 5AUPB 5J47A 1A4IA 2HBRA 3NVKI 4BNTA 1PVDA 1FNCA 2D2XA 2IVFA 1JIIA 3DA8A 1GA6A 5C5DA 121PA 3AHHA 4WZBB 3WYNA 2DECA 5ALUA 4GD3Q 3CN7A 1NF2A 1J99A 2ZRQA 1GCGA 4CQMB 4XLZA 2WSSD 4YJGA 1K3UB 4JC8A 3NBZC 2XWJI 1PS0A 4YGYA 4EB6A 1DJPA 1R5JA 3HN2A 2P4EA 5JYCA 3EQ2A 3EBPA 1GL9B 3DNFA 5D5QA 2HF7A 1IONA 3M81A 1Y1SA 2FB9A 4MYHA 2JVIA 4BO0A 5COQA 4R9SA 4UEOA 4BE4A 5AKGA 5ALEA 5JMTA 4BO2A 1PO7A 2LPMA 3IKJA 3QTTA 3R0ZA 3TAXA 1MABB 2HRDA 1W2HA 1K08A 3K73O 2GCGA 1QRAA 4JOQA 1DKRA 5BSEA 2RGXA 4TLAA 1ZH4A 4RNDB 5J2TA 3X1DA 1A9XA 1MO6A 2EHDA 3UJPA 4D9MA 2Q4TA 3D8TA 2X1HA 3I5MA 5LB2A 6LDHA 5I51A 3QW4B 1DS6A 4V0ME 3W04A 3TSZA 1FW6A 4NU6A 1N6IA 4WWHA 4MWOA 2MU1A 4FN4A 5JRDS 4D8VA 1R50A 4FSHA 2BUAA 4B09A 1GL6A 1Z5ZA 1SVSA 4RM2A 3RSQA 1N5KA 3KSDO 1YB5A 3WSTA 2R96A 2DSTA 3ZZUA 1JLKA 3CZ9A 4EZEA 3PFIA 4KXQA 2F4VB 1WZCA 2FPGB 4BLWA 3AEXA 2YZ7A 3IUQA 4W9NA 3ZV6A 1XMQB 3E53A 3RWBA 2IPMA 1USVA 1Y6QA 2G82A 2H8GA 3OE5A 3K5IA 1LTQA 2YN4A 4M1TA 1C7EA 5DCYA 5L3QB 3SCZA 2YVUA 1I14A 1ZGCA 5HG0A 1U0EA 4GGPA 4HJXA 5H82A 1N33B 5LQRA 1U7UA 2WUEA 4PVDA 4YDSA 5C3UA 4DDHA 2A3RA 3HLKA 5PNTA 1X38A 3ZDCA 4HHEA 4HQKA 4Z7JA 1I1HA 3RSHA 2GZHA 4IO1A 5KNLA 2CJWA 1VGVA 4EMUA 4YRDA 1P5JA 2EWVA 3C7CB 5HUHA 3LMKA 2IYRA 2IHZA 5ALQA 1IM2A 5HRAA 2DTDA 4YMSA 1TYDE 2IXFA 1HFEL 3N75A 4H77A 4LDNA 1GG2A 1U28A 2XA9A 1B43A 3FFBA 1SH7A 2HRCA 4Q6WA 3DXYA 3FPJA 4BFTA 4CJXA 3L0CA 2Z09A 4OFWA 5BUCA 5KJFA 4KE9A 4Y9SA 4DQLA 1L7XA 1JR2A 3JALB 3QJGA 4I3HA 4LFBB 4FS8A 4WGGA 2AZDA 3RVJA 1R66A 3C74A 4KLCA 1ZD9A 3TSOA 4I3GA 5LUAA 1RWBA 3HGMA 2Q3BA 4ANFA 4MYRA 2YFYA 1VLVA 3PR2B 1Y6JA 1E6MA 4NE9A 5BQXA 4RIEA 3KKPA 3KIPA 1QRSA 4Z4GA 5CPFA 2O8NA 4D99A 4DMRA 1XN1A 2RHJA 1XDZA 3BA6A 4MH0R 1PVOA 1K88A 1J21A 4C7KA 4MV1A 1UKAA 1SUWA 2BKEA 3FDZA 4UTZA 1FTYA 3O8QB 3NTUA 3CH5A 4CCSA 1SQ6A 4FOLA 3WQRA 4CIXA 4HQNA 3PHBE 1UOPA 2WK1A 1FRZA 1UBOS 4OJMX 4DMKA 1C3OA 1R4MB 1NGSA 3EEFA 5LR6A 4KNWA 3H83A 3TTVA 3V4OA 1YULA 4DOMA 3UJ3X 2ACKA 3WL8A 2VSNA 4QL3A 3T7KA 3OA0A 2GLTA 3V9AA 3NOVA 2FFHA 3QU7A 4DTCA 3NT4A 4CM1A 1QDLB 3NWOA 5EEGA 3N2KB 1OLSA 3PQ4A 4L8YA 3N86A 4TMZA 1VLHA 2J3HA 1WW8A 1RI5A 2Q5FA 3P9SA 4GFDA 4PC2A 2UXBB 2SHKA 1G38A 1DC7A 3T9AA 1N1EA 2BHLA 2EX1A 2L0XA 1P9LA 4AYWA 2CLSA 3H1PA 4RIGA 3ZU5A 3NGMA 1AGNA 1IVSA 2WILA 1KARA 4ZI7B 3DVAA 2JFOA 2QG4A 3DL0A 4IDQA 2DWUA 1R1DA 1RQGA 4HATA 2ABWA 5MN6A 1V95A 2JLQA 4UZEA 1NC1A 4CKEA 5C52B 2J4FA 3PC4A 1PKEA 1UP7A 2VNJA 3RM3A 1JT9A 3EXEA 3K0EA 3SHOA 3ROFA 1GGFA 1YIAA 1Y1QA 1EVQA 4D6XA 2ZTUA 1GGKA 3MRSA 4P9NA 4QYTA 3IOCA 5I8PA 2VJMA 4EJSB 1F51E 2I4MA 2I6TA 2VTVA 4OI4A 5TQ2B 1XBTA 3RT7A 1E6EA 4BPRA 3P9NA 2IYFA 2HU5A 2VJMB 1Y8QB 1IWOA 4OLJA 2PGLA 3JQ8A 4LWZA 3W8FA 4BTVA 4TMWA 4BO3A 3BRSA 4AN4A 4F2HA 3I6QA 5I9SA 2HMAA 3QHAA 5A5GA 1NUSA 4DNXA 5K05A 4FMDB 3AHGA 3VRHA 1CUVA 1W8IA 1ZJZA 2G08A 4BX8A 1T9ZA 3GEMA 4PG8A 3OZXA 1N57A 3N28A 1XF9A 2IY8A 2Q1WA 4NJMA 1I32A 2C77A 3L8CA 5F9HA 3A1DA 3KETA 4YQFA 3LDFA 3M3DA 3R40A 4NE7A 1THGA 1TLTA 4CTKA 1Z08A 3ZIAA 3C15C 1QE5A 1U3UA 2P9ZA 4QDTA 2GCPA 5EAIA 3HB1A 2J9YB 1JGTA 4TWAA 5AJTA 1QP7A 4NX2A 2GA8A 2Q5EA 2Q0QA 5AXCA 4DA7A 4RS3A 5DE3A 1PEYA 2B20A 4HY3A 3NAZA 4HDCA 1HQDA 4LWQA 2OXIA 4C4OA 2F4NA 3FE2A 4I9HA 2PXXA 5DHRA 3HUTA 2I67A 3MCUA 1CZLA 3C8HA 4IGIA 3HJGA 3E9MA 4HVLA 1XSEA 2WA1A 4UHCA 1T8PA 5L95A 4NH0A 1JEEA 3A9WA 1E5TA 1GPNA 3NBAA 3O8LA 4NBNA 5AIAA 4OHUA 2J0QA 5K3SA 1I7SB 2GHQA 2VWGA 3RNLA 2YBDA 4CCWA 2WFAA 3ESXA 2Q3MA 2ZRGA 3KCQA 5I7WA 1JF8A 4NAHA 1YQWA 1GNSA 4WLFA 5DU2A 3TJRA 3MS2A 2NO4A 1G20B 5KVVA 1NSYA 3Q3GE 1ZM3A 5B2EA 1SHKA 3NEYA 2O6LA 2Y0CA 4G56A 3ESBA 3IHLA 1Q3TA 3QVJA 1RD4A 4LX8A 5BSTA 3BTSA 3ZEAA 4D1YA 4DM4A 4YMWA 1J97A 2O0JA 3D6HA 1NDQA 2Y9MB 5AM2A 2AFHA 1QK4A 4W5RA 1IN6A 4RJLA 2YWBA 1J2YA 4X84A 2QRJA 3FKSD 3RBAA 3ZK9A 3QXXA 3K5WA 4CU5A 1L4LA 2JVJA 3I58A 4WQMA 2RAPA 3E4DA 1T3TA 3TH5A 5LJIA 1XOIA 4QEKA 3KT8A 1CSEE 2VG8A 8GPBA 4MJLA 4K5QA 4RVHA 2M98A 3OBBA 2D8MA 3GFTA 2I2DA 1GTZA 2GD0A 2I7XA 3JZFA 4PLHA 2GZSA 5EWJA 4M0CA 1MABA 5CHYA 4ZVRA 5HOEA 3BIOA 4MI9A 4YWHA 2FSVA 3QLUC 2X41A 3T5GA 1H0RA 4WBXC 1EUDA 3WXBA 3VZPA 2ZM6B 3OM1A 4PSDA 5LQUA 2XRZA 1YONA 3O83A 4PQEA 1EE9A 2IS6A 5DHPA 1JR3D 2VCYA 2UZ4A 1H1TA 5HQJA 4JMPA 2VJDA 3N07A 4M54A 4Q4AA 1AZTA 3WBKA 2O5VA 2WYIA 2XE4A 3K31A 4GGMX 2PYIA 4PLVA 2GQ0A 3H3JA 4C7BA 2W2LA 3EWSA 1M34B 1DJMA 1XTVA 1NRIA 2BEJA 5IKMA 3DZCA 5JJ5A 4ZEOA 4MITA 3BXGA 3LBHA 3OD1A 1S3GA 2YVAA 4PU0A 2C4HA 3IDQA 5TGZA 1XQVA 2QYSA 4GMFA 3RS2A 1I3MA 1XPUA 2RFLA 4ZCMA 4CL2A 3T35A 3AI7A 4H08A 1E9AA 4UEJA 3AKDA 4RJTA 5TMDA 4RSRA 3NHBA 4LRQA 4MUBA 2AD1A 4KSYA 4KQHA 1N0VC 3FUWA 2XWSA 3A0RB 1IMJA 1LJ8A 1YZTA 5TR9A 1ZD1A 1PF7E 2B3DA 2R2GA 5LDHA 4G0NA 3NM6B 3TX2A 2OENG 4IMPA 5FR2A 4EUEA 2XOKD 2D7DA 1TZKA 3HNRA 4DVGA 2B92A 1SMKA 3IMKA 5ICFA 1G2QA 3K3PA 1FVFA 1Z0SA 5EUCA 3R74A 5KTRA 3ORRA 4WH0A 2OD9A 2VPPA 3B2NA 4XYGA 5LXTA 3SHFA 1R18A 4YP7A 3ZQUA 2UYHA 1KJZA 1PKXA 5AM4A 1XQ9A 3D0KA 3D7RA 2BFOA 1EUCA 3HUUA 5C1PA 3EDMA 1UPFA 4EGQA 1ECFA 1KO5A 3OPVA 2ZSDA 4IR7A 5LM3A 1FX0B 3FVTA 4AD8A 1VKHA 1YCHA 1UZMA 3O94A 3W6UA 2C5AA 4BRUA 2D0OB 3HYRA 1FLDA 3L5OA 1UDBA 2I2WA 3K0FB 3P19A 4HS9A 1Z5NA 1EFPB 2F8SA 3FPEA 1V5IA 1FQOA 4PZAA 5AT1A 4Q9JA 1PQPA 1ZN8A 1C1XB 1AKYA 1HDGO 4WXYB 4CPDA 2FPPB 3FMFA 3G0OA 4X44A 1KQNA 3NTLA 1SELA 3ZH2A 3L0BA 3SP1A 3CVXA 5LNK1 2WSMA 1R0RE 3EVFA 2P5SA 4OB8A 2FPMA 1QCDA 3SS7X 3S8YA 2PUCA 1HG0A 3DS8A 3ZTYA 3KQQA 1L7OA 2RHDA 4KIUA 2VYFA 5BVGA 5CBPB 2FSSA 1JEYB 2OO7A 2P6MA 1JDZA 3EQZA 4TL7A 5H02A 1E2HA 4OGKA 3RUDA 4HEA6 1O57A 3F6RA 4OAPA 1QC5A 1JPNA 3D3WA 3LE8A 2FEMA 4PTLA 2CV0A 4WBNB 1XJ0A 1KGSA 1MR3F 3C7KA 4D92A 2VHQA 1SOVA 1QGZA 3GLFA 2R8EA 1C7QA 2AOUB 3L6RA 1M76A 3DBLA 3FD8A 1UBJS 3ZHQA 2JIBA 2VEDA 3HFJA 3PA8A 1XXHA 4Q1VA 4G8DA 5CIYA 5HFJA 5EZ5A 1EEHA 2Y1FA 2CFSA 4LYHA 1SHZA 2Q6LA 1PK8A 4FQ7A 4HSGA 5BNTA 3QXJA 4BRZA 1RRCA 4WK0B 4KH0A 3N2GB 1DBPA 1NMEA 4QICA 4F8YA 1ZJ4A 2DT5A 4B2IA 4LNUB 5KNDA 4I5DA 1D1PA 4RF5A 4EVSA 2PUBA 2AUMA 3D02A 3I01M 3TDMA 3SS8A 3TBKA 5A02A 2B21A 2F59A 3MWGA 4INPA 4QFCA 2WNIA 1U0TA 2C03A 4NEHB 4WN9B 3CVUA 4LIPD 3BD8A 2QP9X 3JPWA 4W9RA 4L9WA 4BBZA 2G9VA 4WN9A 4M0MA 2YHIA 1R4NB 4Q0MA 3HVIA 3ZZMA 1W4ZA 3B60A 3IS3A 1QLHA 3LS2A 3LY8A 4QJ5A 2A33A 2BZ0A 4PCVA 1N1MA 2AV6A 4DARA 3X2FA 1V16B 1MUUA 1YZYA 3GJYA 4PZUA 1P9OA 4E7PA 4PZ9A 4AZVA 2IYWA 4YV7A 2V5VA 4M38A 3CR7A 3KTAA 5LZ5A 3VNQA 2X4DA 3WQHA 5KX5F 4CODB 4GZ6A 4FHDA 1TIKA 2O06A 3NBMA 4RK4A 1RI4A 1SNYA 3F2IA 4AW9A 3ZHCA 3IHKA 1SULA 4LQCA 1KJYA 4NBLA 4CMJA 2O8CA 1R3UA 2ZWPA 3D4PA 1XZQA 1HYHA 3T9CA 5B7PA 3WA6A 2OCXA 2REOA 3DZGA 3FNEA 4DAEA 1FNMA 4DEYA 2O8CB 3CGWA 4RWEA 2HJ9A 3I3OA 3LL7A 2JJ2D 2VPZA 2AQ8A 1RPAA 2OC4A 2VXBA 1ORHA 2J7PD 2HMTA 2AXQA 2H1WA 4JX9A 4N7RA 1W1UA 2V9CA 5AVJA 3BJZA 5FA6A 1P1CA 4IBOA 3UC5A 2XXAA 3FTEA 5LN1A 1E9FA 2WWIA 1E96A 5DVZA 1QBKC 1CJSA 1OFIA 4HVTA 1JLLB 1HH4A 3C7TA 3AL2A 1PJ4A 3GVHA 2E4VA 3L04A 2PS1A 1E7RA 1Z68A 3LNCA 4KRYA 4PO8A 4QULA 3LXXA 2GFIA 3ENZA 3FYCA 3NBQA 4OUDB 1KERA 1NNI1 2HGSA 4Z6KA 2A9OA 3E7PA 4LJAA 1KS2A 3B1XA 3QENA 3CC8A 4EAQA 2QN3A 3AMVA 2G70A 4ENWA 3SY8A 3TJZA 4Y1FA 5GZ6A 1G3UA 5DM4A 4X90A 3L1IA 5KSPA 2V0GA 3WJ1A 4KIFA 4IGAA 3JATA 3OFND 5CDFE 4NPHA 1L9KA 3GUYA 4JJ8A 1P2TA 1W2GA 3K5HA 5I01A 2BYTA 4C7OA 1FFCA 1XD8A 1PFQA 3GNTA 3N5KA 2AB0A 4A26A 6REQA 3IP7A 3Q0TA 1W9MA 5LA6B 3PGJA 1VJ0A 4D7AA 3AF4A 2BKUA 1E9SA 3B52X 2WWGA 2G9ZA 3PZRA 3GVXA 3NFRA 4QFMA 1ND5A 1P1RA 4UXJA 4B6QA 4KI7A 5BW8A 1DLIA 4Q4JB 1XE3A 1CUFA 1WR8A 2DUWA 4JP1A 3DEJA 3UOGA 4S1WA 4B3HA 1EUDB 5JCOC 1TAGA 2WTAA 2SCUA 1WZEA 3MAGA 7AT1A 5EIFA 4K6HA 1UPCA 5JDCA 1J5XA 5EJFA 2B61A 1PGPA 2IKQA 2W2NA 3H9UA 1IRIA 3MSCA 3H1GA 4PYIA 3TNFA 1U8XX 3WLKX 5HX7A 2QUAA 4J76A 1JEOA 1ZRMA 4MICA 5JYEA 2FZLA 1Y8QA 1P77A 3ETHA 4KACA 3WYBA 4EZBA 3NTRA 2IUUA 4QVIA 4IZIA 3BGOS 4L3VA 4RV5A 3I9FA 1A72A 2ZB4A 1PJZA 4ZU1X 3VISA 3ET4A 1M1NB 2E4WA 4GM0A 3TNLA 4ALIA 2GN9A 1NVUQ 3PGA1 3U7RA 2IZ7A 1OXVA 4MPTA 1VSUA 4RQBA 4OKNA 3DTYA 1R64A 1BVHA 1QZXA 3F49S 4QGHA 4YREA 3STUA 4YAIA 3V2GA 4JDPA 1W19A 1YWGO 3KYDB 4HSEA 2C82A 1GTG1 2AXEA 4L7VA 1RJGA 3IO3A 1IAVA 3ABSB 1XRLA 4KQ9A 2CXUA 4Q1FA 3ITNA 1F0NA 2V7XA 1X1RA 2WF7A 2WHEA 1YVUA 4R5MA 1M2FA 5JQGF 2FUKA 3MXTA 2FEPA 2ZJ3A 3RIYA 2ZSBA 5HJEA 1L4HA 4HGPA 3K9FC 2FFBA 4W7IA 3B2EA 3T7IA 5JZ9A 1A7AA 1U8AA 4FI3C 4BQQA 2Y67A 2NPOA 1X19A 1A7UA 1A9ZA 1PBNA 4J0KA 1DMSA 4PZEA 4TUYF 4W99A 4E5UA 1R6UA 4UU0A 5JVDF 4ZVUA 2Y71A 4BNZA 1BDIA 2EARA 1JQJC 1IIBA 3GRPA 1YACA 1RI2A 2I2FA 2BM9A 5A4KA 4I36A 2X9QA 4OXKA 3VQTA 3PQ8A 1L4BA 1G8HA 5B4UA 1I10A 1NM5A 2AE1A 1OR8A 3QBJA 2NU6B 3BMCB 1M2HA 2WABA 3K0BA 4UHEA 3BRWD 5AVKA 1GRNA 3DTVD 2QLJA 3HM2A 3I0ZA 4TGLA 2D4AA 5J1TB 2ESRA 2MR5A 2ZITA 5A4IS 1ZDMA 2IZ6A 1JXAA 3EIHA 4N54A 2F3QA 3P1JA 2FZCA 2J31A 4LSMA 4OQYA 5AHRA 3SKXA 3ZCRA 4CIAA 1AV7A 3VU9B 1N6KA 3WIVA 1LCIA 3JASA 4I46A 2FFRA 2YJ5A 3ANNA 4RMNA 1M2GA 4UEKA 4TWIA 2VRCD 4G5XA 1KYQA 2YYZA 3EFOA 3KTFA 4MS3B 4J4TA 4N8SA 2ISCA 1DZ3A 5IP5A 2GHRA 1VJ1A 1NVKA 1UBRS 2IPXA 4HDQB 4JP3A 4WNAA 1P5HA 3ZCSA 3RC1A 1FJHA 3GI1A 3JQPA 4QUIA 2GNAA 1T9HA 3EMKA 3EVDA 2FUEA 4XWYA 4YMIA 3RREA 1VG8A 1PGJA 1IMOA 5JV5A 3QBDA 4R4JA 4D3YA 2XB4A 4TYWA 1BWPA 4GS5A 3T7JA 1TVMA 2IC5A 4C07A 2NU9A 5KDOA 1K27A 3FTQA 4YHBA 5F4BA 4JQYA 3MERA 2AN9A 4UOZA 1X1BA 1UEJA 3SEQA 4CLEA 4KBFA 1YCGA 1SU4A 1LJUA 1UKVY 3FHCB 2NTVA 3N2EA 5E2IA 2LUOA 2QVXX 5BQOA 1FFYA 1XYVA 1O97D 1C1DB 3QW2A 2VOEA 1GA4A 2R4QA 1KDPA 1T2FA 5E7IA 4S1PA 5AK4A 3QBEA 1R0XA 1OA0A 2H5JA 1F0PA 1L8QA 3NAGA 1T6BY 3TRDA 4UTPA 1KI6B 2R6FA 3B7PA 2BBSA 2XB6A 2PH3A 2ZIWB 2FOIA 3GAMA 3KR9A 3KC2A 3QU9A 4JLOA 4PWYA 4ROTA 4RD4A 4BFWA 2QR2A 3B3AA 3DAOA 5CVUA 4MUAA 4KQMA 4ITUA 4OXRA 4Q7LA 5JBNA 2VNKA 3MT9A 4ARBA 3S8EA 1GOTA 3IAS1 5JZMA 1WPRA 3EZXA 2POCA 2YHIB 4NBVA 3R7NA 4C3VA 3FGZA 2QN8A 3VR5D 4BQNA 1O89A 3UWKA 2IYQA 2BGTA 5BYJA 1WM1A 2IYTA 3I6YA 4YJ2F 3VAYA 1OTYA 3HVKA 3ZPXA 1TZMA 2WF9A 5HWSA 5IM4F 1MEEA 3ITEA 4P31A 5JCJD 1YUMA 5DGDA 1XIVA 2H3HA 2PGJA 3KO8A 2VQ3A 1NR5A 1H69A 1L5HB 3L05A 2WFMA 4KLAA 4FYHA 3WWDA 4DBLC 1P1JA 2V7PA 3GWGA 1UJNA 3AXTA 5A4JA 3K1JA 4UXHA 2XOEA 1SOUA 4LJSA 2G5GX 4X7PA 4JI6B 3UVEA 3CONA 1LVGA 1ZUIA 2BKVA 3ML1A 2P30A 1RYNA 2OGZA 1NI5A 1V3UA 1IB0A 1ADCA 4V2UA 1V4NA 1QF9A 3FNHA 3BWEA 4GMGA 4NMHA 3VO1A 4NBUA 1HQCA 1U3CA 1VYTA 2I54A 1US8A 3GFSA 3NBYC 3ZZ0A 3ZG6A 2XMQA 1H2EA 1AZLA 2EERA 4Y67A 1ZP6A 2YCLA 4N76A 5AVOA 4E6EA 1B15A 1M5RA 4H1TA 3UPUA 1H66A 3U7JA 5JVDA 3IH5A 4P4TA 1TYZA 1XVUA 4B35A 2I2BA 5TVGA 1JWLA 3R4VA 2WJPA 4O2LA 1XDSA 1IQRA 1GSAA 1Z4OA 4L27A 2R97A 3JQ6A 1P0IA 1GL3A 2H00A 3GH1A 3Q7QA 4Q3NA 4YLGA 3WNQA 3QEMB 4LHXA 2QXUA 4URFA 5IN5A 1T6XA 2I7VA 4DLYA 2E82A 5CB4B 2GM9A 5EQTA 3U6BA 3HTXA 1TU4A 2MSLA 4H4CA 3EAQA 5KTYA 2YV1A 4PXSA 4OIMA 3ICVA 3SK0A 4JT2A 2ZWAA 3TLJA 4UFPA 1TUBB 1DWOA 3A4VA 4EI9A 2WTXA 3CLKA 3EG9A 1T0JB 1AK9A 4N1AA 1VMAA 4V0LA 4CQLA 1CRLA 1C3VA 1QH0A 1T3ZA 2JBAB 1GGMA 2QSZA 2W6IA 4DSTA 3HJTA 2QL5A 1T2AA 4J1TC 1FS4A 2JI4A 1E7SA 4XPIB 2AIRA 3FETA 5B7QA 3HXKA 3WVNA 3U4GA 3WLFA 1JG2A 3ZVLA 1SEPA 1PWXA 1M0EA 4U9IS 4FPXA 2I65A 1E79A 1Y8ZA 4X60A 2QGNA 3AJDA 2NU8A 1SXIA 1PR9A 1JPVA 3MGGA 5DNEA 2R6R1 3BXPA 3QFCA 4AX4A 4GI1A 3ESDA 3QMPA 1VI2A 1OIWA 2BEUB 4BGIA 3EF0A 1R6TA 1UDCA 1CC1S 3MGCA 4Y6GB 2C4WA 5FI5A 3L82B 2C98A 1SCQA 3RJZA 3AW8A 1OFVA 4Q16A 3DT9A 2DZDA 5IS2A 4MDFA 2C4MA 1XPJA 5CD9A 3EUEA 1IG0A 2CDCA 4NHOA 1QV9A 4TVKA 2VP9A 3C70A 4MRAA 2BGWA 4OAQA 5ELMA 4A10A 1YJBA 3DG9A 4DREA 3R3XA 5KC9A 1OVMA 1QO0A 2V6JA 5EKDA 2O8BB 5FQNA 2KHZA 4XARA 3IP6A 3NHSA 1PW5A 1YB4A 3BGWA 1N7IA 3IP3A 3G3EA 3E3LA 3WQBA 4YRNA 4DG9A 1YA8A 3HGQA 4Y6QA 2ARKA 1U8YA 1XVAA 2A9QA 4KXMA 1W4RA 3ZD6A 2C7RA 4JNCA 3TPFA 2VA9A 1Y8CA 3BWVA 3A4TA 2ILTA 3HVUA 4I55B 2RC5A 2UZAA 5CFQA 1IZ9A 5JNUA 2BDEA 2ZRIA 3MJCA 2CF6A 3TM5A 1XZIA 2EOAA 2VJQA 3LKBA 1AY0A 4Q7JB 1PJTA 2Z58A 1YJXA 1TJPB 4BAZA 2IWRA 3KQKA 1ZU5A 1RRPA