3KQ0A

Crystal structure of human alpha1-acid glycoprotein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
b'EIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-acid glycoprotein 1
publication title The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 55
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3kq0A00
3I17A 1MVGA 3UEXA 2CBSA 4MVKA 1E02A 1YWAA 3HWGA 3I0AA 3U9PC 2L5PA 4M6SA 4DQ4A 4ARHA 3FR5A 3FENA 2YG2A 5HZQA 4ZH6A 1I4UA 3C78X 1E00A 4ORSA 4I3DA 1BWYA 2A0AA 3OJYC 4HFOA 4BQUA 4XMDA 2HZQA 3KFGA 2WEWA 1EIIA 3KFIA 4GKCA 3U03A 4OS0A 1UZ2X 4QAEA 3B2JA 1GT1A 3BY0A 4QGVA 2CBRA 4ZJ0A 1FEMA 1S44A 5KHPA 5L8OA 5LJBA 4A1HA 4NYRA 2A2GA 1ICMA 1YP6A 1KZXA 4D6AA 1GX9A 1MX8A 1N0SA 4R0BA 3WJBA 5CE4A 3TGBA 3UEUA 4YH0A 1IW2A 4Y0RA 1ERXA 3BSZE 4ZHFA 2QO6A 2GC9A 3PH6A 2R73A 4KIIA 3NADA 1LIFA 2K23A 4LZVA 4D6BA 2PY1A 1A57A 2AMMX 2AT0X 1NGLA 1QABE 4IB6A 4XMEA 5EPQA 1DZPA 2AKQA 2LB6A 3WJCA 1AELA 1HMRA 2W2FA 2CM9A 2WWPA 2Q4NA 1BSYA 1ERBA 3FA9A 5K06A 3O19A 1JZUA 4A60A 1NP1A 1BRQA 3AKMA 1LFOA 1QY0A 1LIDA 1SY1A 3DSZA 3VG5A 5IO7A 2AL0X 3FMZA 2FR2A 4QGWA 5EEEA 3P6GA 1O8VA 3T1DA 2ACOA 5BVQA 4TKHA 1SXYA 3NX1A 5F6BA 1ICNA 1HBPA 4PSQA 1CBRA 4OS8A 4QGXA 2QO4A 1KT7A 5L8NA 1GXAA 3FA7A 4GE1A 1EALA 4ZCBA 4NLJA 4ORUA 4WFUA 1BEBA 1YP7A 4AW8A 1LIEA 4IB9A 4ALOA 1GX8A 2Q39A 2QM9A 3ZUOA 2ALLX 3STNA 1JV4A 4ZR2A 2QO5A 2W2AA 3C77X 1EUOA 4AYHA 2WQAE 1FENA 2ACPX 2X46A 3TF6A 3HK1A 4NNTA 1ZNHA 3RSWA 5C0NA 3ELZA 1OBPA 2LFOA 4IBAA 4IB8A 2XKLA 4OMWA 3NQ3A 2A3FX 3WXQA 1E5PA 5LJCA 1DF3A 1X8NA 3FW4A 2Q9SA 2EU7X 1OEJA 3CMPA 2RCQA 3P6FA 5HA0A 1CBIA 2CZTA 1QY1A 2BLGA 4GH7A 1PBOA 2FS6A 3NP1A 2WUTA 1LKEA 1QFVA 4LKPA 3EBWA 5H9AA 1G5WA 1P6PA 2XSTA 4YGHA 4XMCA 1LIBA 5KIDA 3TGCA 4HPAA 3DTQA 1FTPA 5H9LA 1BM5A 3BX7A 1DV9A 1HMSA 3D96A 1YWDA 3P6EA 3CBCA 4QYNA 1SY2A 1MUPA 2AT5X 3B2LA 3EYCA 3FELA 3S26A 5D45A 5LKFA 1AQBA 2G7BA 4YDAA 5EZ2A 3O22A 2JOZA 3PH5A 5FAZA 2JU3A 4EXZA 5HTEA 5HZ8A 4N7DA 4GRJA 1TXLA 5LKEA 1IIUA 1ZNDA 2RCTA 4XMHA 5D47A 3KQ0A 3WBGA 5HTDA 1BJ7A 5BVSA 1SA8A 5EEDA 3BLGA 1EPBA 4Y0PA 2AH7X 4CK4A 4ZHHA 2MO5A 1SXUA 4XMFA 3HWFA 1CBSA 4HPBA 1GGLA 1X8OA 3UEVA 1X8PA 1SXXA 3K3LA 5DPQA 5B29A 3AKNA 1A2DA 2NNQA 4HPCA 5H9NA 4EEJA 1KZWA 1TW4A 1EIOA 3ELXA 5D8JA 3JS1A 2FWVA 5LJDA 4IB7A 1G74A 1E06A 1VYFA 1XKIA 2FS7A 5H8TA 3QKGA 4ORYA 2OFRX 2DM5A 2WR6A 1KOIA 3NX2A 2RA6A 2HMBA 2RD7C 1DC9A 4ORRA 5HZ6A 1EQDA 1X8UA 4I9RA 3STMX 3HWDA 2KTDA 1KXOA 5L8IA 4LKTA 1EW3A 4AZQA 1X8QA 3KZAA 1CJ5A 1DFVA 1YWBA 2NP1A 3WJFA 1GT4A 3APUA 1HN2A 5D48A 1OEEA 1I05A 1XCAA 4IAWA 1B0OA 4LZUA 1D2UA 2CM4A 4YGZA 3FA6A 2K62A 4AZPA 4AZNA 2KT4B 3B2HA 5FENA 2Q2PA 4MVLA 1JJJA 2HZRA 1KT3A 4YBUA 4IMOA 4YDBA 1FE3A 3IA8A 1QQSA 2N93A 3FEKA 1G85A 2OVAA 3G7XA 4ODDA 4YCEA 1G7NA 2R74A 1ZNKA 1MDCA 2A13A 2JU8A 2L68A 4NP1A 4YKMA 4ZH9A 3P6DA 5HCDC 3STKA 3EM0A 5HWZA 4ZHGA 1I04A 4DQ3A 2MM3A 2WQ9A 5JR8A 3BS2A 4ZHCA 2W2BA 3ZUIA 4NLIA 2FTBA 4YBPA 3PECA 3BRNA 4NYQA 4OS3A 1LNMA 1NP4A 5LJEA 1D3SA 4YCHA 1DZJA 1B8EA 3Q6LA 1KQWA 2JU7A 4BOEA 1IKJA 1KT4A 2HYSA 4I3CA 4AZOA 3BX8A 1PM1X 1TOUA 5HCCC 5HA1A 1CBQA 1VPRA 1BSOA 2G79A 4Y0QA 1ZNLA 1I06A 3PPTA 5LJGA 1OEKA 3P6CA 4ALBA 1BRPA 2R56A 5DG4A 4I3BA 3VG3A 4RUUA 1PEEA 4BVMA 1KGLA 1LICA 3FEPA 1LPJA 4O9SA 2A2UA 3RZYA 4TNNA 2F73A 2L67A 3L4RA 5F58A 2G78A 1BSQA 2WEXA 3D97A 4TLJA 3F8AA 1GKAB 3MBTA 5FFHA 3U0DA 4AZRA 5IO5A 1TOWA 1X71A 1VYGA 4ORXA 1LF7A 2FR3A 2HNXA 1Z24A 2OVDA 5H9KA 5EDBA 1TVQA 3PEDA 2ANSA 4ZGUA 1S2PA 2OVEA 2GJ5A 3EBKA 1ZNEA 4RUNA 1HBQA 1OPBA 1SY0A 1MX7A 4MVIA 3VG2A 2L9CA 4TQ2A 4YFQA 4YMYA 5LJKA 1YIVA 4UU2A 1ZNGA 3EMMA 5F1EA 4WBKA 4TKBA 3CR6A 2NNDA 4N7CA 3FA8A 5HZ9A 3VG7A 3CWKA 1GKAA 2O62A 3SAOA 4EDEA 4WFVA 3B2IA 2X45A 1DZMA 4GETA 1BBPA 3BU9A 2FRSA 3APXA 2Q2MA 3WJEA 1B4MA 1RLBE 3KFFA 3PP6A 1JBHA 3FW5A 4ZFXA 1T68X 1U17A 4TKJA 5HCEC 1AVGI 3TGAA 1KT5A 1OPAA 3F9DA 5HZ5A 5BVTA 5KICA 2IFBA 1BLRA 4ES7A 3IFBA 3VG4A 1EPAA 5EDCA 2GTFX 1L6MA 4UU3A 1FELA 1AB0A 1QG5A 1UREA 5AQ6A 5IO6A 2FLJA 1GM6A 1S7DA 1X89A 4QYPA 4AZMA 3GAQA 4Y0SA 1QWDA 4NNSA 1SY3A 2OFMX 3B2KA 1B56A 1O1UA 1U0XA 3D95A 3ZQ3A 4YFRA 1IFCA 1ALBA 3NQ9A 5B27A 2P8GA 4K19A 5F7GA 3FR2A 4EFGA 1HQPA 1HMTA 3BU1A 1IKEA 4IMNA 3NR3A 3P6HA 3FLLA 5D4AA 5LJHA 2OZQA 3CQNA 3CBSA 2NNEA 1JJXA 4OMXA 3BDRA 3NPOA 1KT6A 3VG6A 5HBSA 1EXSA 2POAA 3O2YA 3UEWA 2LBAA 1YWCA 2RQ0A 3C76X 4YKOA 3FIQA 4YFPA 1ACDA 2AT8X 3HWEA 2AT3X 3APWA 2HLVA 3APVA 1R0UA 3WJDA 1ML7A 2LBVA 1IFBA 1GT5A 3WVMA 3TZSA 4IAXA 1A18A 1YUPA 1U18A 4QZUA 1QFTA 2WSJA 4ORWA 4A8ZA 1GT3A 1H91A 1KQXA 4ZHDA 1JYDA 3FR4A 1PMPA 4GNYA 5F6ZA 1RBPA 1O1VA 4A1YA 1OBQA 2E4JA 1OBUA 5HAEA 2ASNX 4GNWA 4M7MA 4YGGA 2JN3A 3JSQA 4QZTA 1A3YA 4I9SA 1SXWA 1CRBA 2CZUA 2AT6X 3MVFA 4XMGA 2QOSC 3KFHA 1T0VA 1JYJA 1DZKA 1QY2A 1ZRYA 3WJGA 4TJZA 1T8VA 1ADLA 2FT9A 1FDQA 3CQRA 4HPDA 2MJIA 2LKKA
chains in the Genus database with same CATH superfamily
3FIDA 4NV7A 3I17A 3JQOA 1MVGA 1NC9A 1SWHA 2CBSA 3UEXA 3X00A 4MVKA 1E02A 1YWAA 3HWGA 1STSB 3I0AA 4EKVA 3U9PC 2L5PA 1RXJA 4M6SA 3RKGA 4ARHA 2RTMA 1SWGA 3FR5A 4DQ4A 5AEOA 3FENA 2YG2A 5HZQA 4ZH6A 1I4UA 3C78X 1E00A 2IZHB 4ORSA 4I3DA 4PJ2A 1BWYA 2A0AA 3OJYC 4HFOA 5B11O 4BQUA 2JMBA 3HOLA 4XMDA 2HZQA 3KFGA 2WEWA 3VE1A 1EIIA 3KFIA 4GKCA 3U03A 2X8SA 1UZ2X 2MF6A 4L1NA 1SWLA 3B2JA 4OS0A 4QAEA 1GT1A 3BY0A 4QGVA 2CBRA 1HXZA 1VWOB 2RTCB 4ZJ0A 1FEMA 1S44A 5KHPA 4CPHA 1RXHA 5L8OA 5LJBA 4A1HA 4NYRA 2A2GA 1ICMA 3HTYA 4KC7A 1YP6A 2OYBO 2IZJA 1KZXA 3S60A 3ZWEA 4D6AA 1GX9A 1MX8A 1N0SA 4R0BA 2OY8A 2Y3FA 3WJBA 5CE4A 3TGBA 1Y53X 3UEUA 4CDDA 1KL3A 4YH0A 1IW2A 1SWDA 4GK9A 4Y0RA 3ZI8A 1ERXA 3BSZE 2G8CO 3EC5A 4ZHFA 2QO6A 2RTDB 2GC9A 2X34A 3PH6A 3P24A 5B5FA 2R73A 4KIIA 3Q34A 2DJGA 3D9WA 3NADA 4CSBA 1LIFA 2K23A 4LZVA 3HPEA 2PY1A 4D6BA 3KVNA 2IZBA 2OL6O 1A57A 2AMMX 2AT0X 4C5PA 1NGLA 2Z4HA 2Y32A 1QABE 4IB6A 4XMEA 4Z2VA 5EPQA 1DZPA 2AKQA 2LB6A 3WJCA 1UYNX 1AELA 1HMRA 2W2FA 2CM9A 2WWPA 2Q4NA 1K24A 1BSYA 1ERBA 1STPA 4YVBA 3FA9A 1LUQA 5K06A 1DF8A 1VWIB 1Y0GA 3WYQA 3O19A 4O4XA 4CPEA 1VYOA 1JZUA 3PQUA 4A60A 1NP1A 1BRQA 3AKMA 1VWEB 4MISA 1LFOA 3OBLA 1QY0A 1LIDA 1SY1A 3DSZA 3EW2A 3VG5A 4EQAC 2AL0X 5IO7A 3FMZA 4QRLA 2FR2A 4QGWA 5EEEA 3P6GA 1O8VA 3T1DA 2ACOA 3H3IA 1SWNA 1VWLB 5BVQA 4TKHA 1SXYA 3NX1A 5F6BA 1ICNA 1HBPA 4PSQA 4Z2OA 1CBRA 1NQNA 4GGZA 4OS8A 4QGXA 2QO4A 1KT7A 2PI3O 4BX7A 5L8NA 3RE5A 1GXAA 3FA7A 4GE1A 4GZVA 1B4MA 4I60A 1EALA 4ZCBA 4NLJA 4ORUA 4WFUA 1LELA 1BEBA 1SRJA 1YP7A 4AW8A 1LIEA 4IB9A 4ALOA 4GDZA 1GX8A 1VWRB 2Q39A 5B10O 2QM9A 3ZUOA 3ZW0A 2ALLX 2AVIA 1W6FA 4GGTA 1JV4A 2ZSCA 3STNA 4ZR2A 1HY2A 2QO5A 3RDQA 2W2AA 3C77X 3VPJE 3ZZVA 4O49A 1EUOA 3FYFA 4AYHA 2WQAE 1NBXA 2BC3A 4JHQA 3SZIA 1FENA 3WYPA 2GTLN 2RTEB 2ACPX 2X46A 3TF6A 3HK1A 1N9YA 3OD9A 3MG5A 4DNEA 4NNTA 1ZNHA 3RSWA 4Y59A 3SLTA 5C0NA 3ELZA 1OBPA 2LFOA 1SWTA 4IBAA 4IB8A 2RTNB 2XKLA 3NQ3A 4OMWA 2FHLA 2BS6A 2A3FX 3WXQA 1E5PA 5LJCA 1DF3A 1X8NA 3FW4A 2Q9SA 2EU7X 2VFBA 1OEJA 5L3YA 1SWFA 5AJCA 1DV9A 2C1QA 3CMPA 2RCQA 3P6FA 5HA0A 1PTSA 1CBIA 1N7YA 4I6SA 2CZTA 3SLOA 2IZDB 1QY1A 2BLGA 4GH7A 1PBOA 2FS6A 1STRB 3NP1A 2WUTA 5AJBA 3CKFA 4IABA 1LKEA 1RSUB 2RTQB 1QFVA 4LKPA 3EBWA 5H9AA 1G5WA 2VDFA 1P6PA 3GE2A 2XSTA 2I5VO 4YGHA 3T2WA 1W5RA 4XMCA 4GDAA 4Z27A 1SMPI 1LIBA 5KIDA 3TGCA 4HPAA 3DTQA 1FTPA 5H9LA 1BM5A 1SWEA 3BX7A 3T2XA 1HMSA 3D96A 1I78A 1YWDA 1SWCA 3P6EA 5CHKA 3SOTA 3CBCA 4GJSA 4HWMA 1SY2A 1MUPA 1SWAA 2AT5X 3B2LA 3EYCA 3FELA 4O3ZA 4QYNA 5D45A 3S26A 3NQKA 5LKFA 1AQBA 2LA7A 2X4MA 1VWFB 2G7BA 4O4UA 4YDAA 4U9CA 5EZ2A 3O22A 2JOZA 3PH5A 5FAZA 2JU3A 4EXZA 4JO6A 5HTEA 3SZJA 4LQZA 2OVSA 5HZ8A 4N7DA 4GRJA 4FGIB 1TXLA 4QQ1A 5LKEA 1SREA 1IIUA 1ZNDA 2RCTA 4XMHA 5D47A 2IZAA 3KQ0A 3WBGA 3V8UA 4BCSA 5HTDA 1BJ7A 5B5GA 3PDFA 1SA8A 5BVSA 1VWMB 4FBVA 5EEDA 3NBXX 2FKGA 2JW1A 3BLGA 1EPBA 1JJUA 4ID2A 4O4OA 4Y0PA 4O4SA 2AH7X 2GTLM 3RDXA 4CK4A 4ZHHA 2RTFB 3QQ2A 4GU8A 2MO5A 2IZLB 4Z28A 1SXUA 4XMFA 3HWFA 1CBSA 4HPBA 2X56A 5CSEA 1GGLA 1X8OA 3UEVA 1X8PA 1SXXA 3K3LA 4OKAA 4IRWA 5DPQA 1VWKB 5B29A 3AKNA 4BX7B 1A2DA 2NNQA 4HPCA 5H9NA 4EEJA 2YMSA 1KZWA 3SZHA 1TW4A 1EIOA 3ELXA 2KTSA 5D8JA 3JS1A 1SWSA 2FWVA 1VWJB 4JGLA 3RBYA 5LJDA 2A5BA 4IB7A 1G74A 5FQ7E 1E06A 1VYFA 1XKIA 2FS7A 5H8TA 3QKGA 2BS5A 1SWBA 4ORYA 2OFRX 1KL5A 4U8UO 5K67A 2DM5A 2WR6A 3T6FA 2GH7A 1KOIA 5B3MO 3NX2A 3ZW0B 1NDJA 3VHIA 2RA6A 2HMBA 3T6LA 2RD7C 1DC9A 4ORRA 1KL4A 5HZ6A 1JMZA 5B2AO 1EQDA 5JD2A 1X8UA 2QCBA 1KFFA 4I9RA 3STMX 3HWDA 3VGWA 2KTDA 1KXOA 1SRGA 5L8IA 4LKTA 1EW3A 4AZQA 1X8QA 3KZAA 2RTAA 1CJ5A 1DFVA 1YWBA 2NP1A 3WJFA 1GT4A 4MVEA 3MX7A 3APUA 1HN2A 2JGSA 1OEEA 5D48A 3VE2A 1I05A 1XCAA 4IAWA 1B0OA 4LZUA 1D2UA 2CM4A 4YGZA 3FA6A 2K62A 4AZPA 4AZNA 2KT4B 2QMIA 3B2HA 3AEHA 5FENA 1SRHA 2Q2PA 4BGFA 4GUZA 1VWBB 1JMXA 4MVLA 1JJJA 5IRUA 2HZRA 1KT3A 1AVDA 1E2TA 4IMOA 4YBUA 4YDBA 3WZQA 1FE3A 3IA8A 3RE6A 1QQSA 1WBIA 2N93A 3FEKA 1G85A 2OVAA 2M4LA 3G7XA 4ODDA 5FQ8E 5IRWA 1SWQA 1VWHB 4YCEA 1WUBA 3UAQA 1G7NA 2R74A 4Y5DA 1ZNKA 1GX3A 1MDCA 1LCZA 2A13A 2JU8A 3D4RA 2L68A 4NP1A 4YKMA 4GGRA 4ZH9A 3P6DA 2RTJA 5HCDC 3STKA 2RTHB 3EM0A 5HWZA 1SWPA 4ZHGA 1I04A 2HKDA 2QOMA 4DQ3A 2MM3A 2WQ9A 1N9MA 5BYPA 3LV4A 4BBOA 3BS2A 4ZHCA 5JR8A 2W2BA 3ZUIA 1N43A 1MEPA 3VHHA 1SWRA 2FGSA 2FTBA 1JQPA 3F6ZB 4NLIA 3RDMA 3VHMA 4DCBA 1EI5A 4YBPA 3PECA 3BRNA 2IZKA 2IZEB 4NYQA 4OS3A 3S5XA 2CAMA 1SWOA 1LNMA 1NP4A 3E3CA 3RDSA 5LJEA 1Y9LA 1SRFA 4FBOA 1D3SA 4GJVA 1UYOX 3WZOA 4YCHA 1AVEA 3SLJA 1DZJA 1B8EA 3Q6LA 3RY1A 4BJ8A 1KQWA 3ZW1A 2JU7A 2RN4A 2RTGB 4BOEA 1NQMA 2I5ZO 1IKJA 1KT4A 2HYSA 4I3CA 4AZOA 3BX8A 1LDQA 1PM1X 4Z2PA 4MEEA 3WZPA 1TOUA 5HCCC 5HA1A 4Z6JA 1CBQA 1VPRA 2MHDA 1BSOA 1MM9A 2G79A 1ZNLA 1I06A 2Y3EA 3PPTA 2UYWA 4Y0QA 4KCAA 5LJGA 1OEKA 3P6CA 4ALBA 1BRPA 2R56A 4JNJA 4I3BA 5DG4A 3VG3A 4RUUA 1PEEA 4BVMA 1KGLA 3S5VA 1LICA 3FEPA 1LPJA 2IZIA 4O9SA 2A2UA 3RZYA 4TNNA 1RXKA 2F73A 2L67A 2OF9A 3L4RA 5F58A 2G78A 1VWPB 4COTA 1BSQA 3P02A 1VWAB 2WEXA 3D97A 4TLJA 3RY2A 3F8AA 3WOVA 1GKAB 3PQSA 3MBTA 2ZAGA 5FFHA 3U0DA 1W4TA 4AZRA 4INNA 5IO5A 2OL7A 1TOWA 2IZGB 1X71A 4ON1A 1VYGA 1SLGB 4ORXA 1LF7A 2FR3A 2HNXA 1Z24A 2OVDA 5H9KA 4CDEA 1JIWI 5K68A 5CYBA 1TVQA 4WHIA 3PEDA 2F09A 2ANSA 2VFCA 5EDBA 4ZGUA 4CV7A 1S2PA 2OVEA 2GJ5A 2RTKA 1ZNEA 2OFAA 1HBQA 3EBKA 1OPBA 4RUNA 1MOYA 4BX6A 1SY0A 1MX7A 4MVIA 4U8UN 3VG2A 2L9CA 4FBRA 2OF8A 4YFQA 4TQ2A 4YMYA 5LJKA 1YIVA 2X55A 4UU2A 2BT9A 2DJFA 1ZNGA 2AF5A 2C1SA 3EMMA 2G5LA 1VWCB 5F1EA 3RDOA 4WBKA 4TKBA 3CR6A 5IXGA 2KW1A 2NNDA 4N7CA 2X32A 3FA8A 4BX5A 5HZ9A 3VG7A 3CWKA 1GKAA 2O62A 2OL8O 3SAOA 4EDEA 4WFVA 3B2IA 4CPFA 2X45A 1I9HA 1DZMA 1VWGB 1BBPA 1K3BA 3BU9A 4GETA 2FRSA 3APXA 2Q2MA 2A5CA 1PBYA 3WJEA 1RLBE 2MWHA 1SLFB 3KFFA 3FW5A 3PP6A 4ZFXA 1JBHA 4GD9A 1T68X 1U17A 4TKJA 5HCEC 4CDCA 1SWUA 1Y55X 1VWNB 4O3WA 1AVGI 3TGAA 1KT5A 1OPAA 3F9DA 5HZ5A 5BVTA 5KICA 2IFBA 1MK5A 4KT5A 4O3XB 4ML7B 1BLRA 4ES7A 3IFBA 5IRAA 3VG4A 1EPAA 1FJ1E 2RTOB 5EDCA 2GTFX 1HXLA 1L6MA 4A8ZA 3N91A 4UU3A 1FELA 1AB0A 1QG5A 4CPIA 1UREA 5AQ6A 5IO6A 2FLJA 1GM6A 1S7DA 1X89A 1RAVA 2RTLA 5F2BA 3EW1A 4QYPA 3GAQA 3FDCA 4Y0SA 5FQ6E 3ZW2A 4AZMA 2FKJA 1QWDA 4OELA 4NNSA 3ZW1B 1SY3A 1LCWA 2OFMX 1B56A 3B2KA 1O1UA 1U0XA 3D95A 3ZQ3A 1SLEB 1SWJA 4YFRA 1IFCA 2BHVA 1ALBA 4QNIA 1VWQB 2RTRB 3NQ9A 5B27A 2Z4IA 2P8GA 2WPUA 4K19A 3AUMO 3FR2A 5F7GA 1HQPA 4EFGA 2OY1O 3MM0A 1HMTA 3BU1A 1IKEA 2IZFB 3NR3A 4IMNA 3P6HA 3FLLA 2A8GA 5D4AA 2OZQA 1LCVA 2X8TA 3CBSA 2NNEA 3CQNA 5LJHA 1JJXA 4U8UM 2BSZA 4CDFA 2ZAIA 3WZNA 1Y52X 3BDRA 4OMXA 3NPOA 1KT6A 4KH8A 3VG6A 5HBSA 2FHNX 3RDUA 1EXSA 2POAA 3O2YA 3PK2A 2LBAA 1YWCA 2RQ0A 3C76X 4YKOA 3FIQA 3UEWA 4YFPA 1ACDA 4B55A 3HOEA 2KD2A 2AT8X 2UZ2A 3HWEA 4MIRA 2AT3X 1HQQA 3APWA 1RSTB 2HLVA 2RTIB 2RTPB 3APVA 4ZGFA 1R0UA 3WJDA 1ML7A 4FQBB 2LBVA 1IFBA 1GT5A 3WVMA 3TZSA 4IAXA 1A18A 4KC8A 1SRIA 2OFBA 1Y9TA 1YUPA 1U18A 4QZUA 1N4JA 1QFTA 2C4IA 1SLDB 2WSJA 4I95A 4ORWA 1GT3A 1H91A 1KQXA 3OE3A 1JYDA 4U3QA 4ZHDA 3FR4A 2IZCB 1PMPA 4GNYA 1OSPO 5F6ZA 1RBPA 1O1VA 4A1YA 1OBQA 2E4JA 1OBUA 4OEMA 5HAEA 4BX6B 2ASNX 4GNWA 2OY7A 4M7MA 2X8FA 2RTBB 4U46A 4YGGA 2JN3A 3JSQA 1SWKA 3LTWA 4NV8A 4QZTA 1A3YA 4I9SA 1SXWA 1CRBA 2CZUA 2AT6X 3MVFA 4XMGA 1IJ8A 2QOSC 3KFHA 1T0VA 1JYJA 1DZKA 2OY5O 3LHNA 1QY2A 1ZRYA 3WJGA 4TJZA 4NW4A 4CPHB 1T8VA 1ADLA 2F01A 2FT9A 4L3RA 4BX5B 2GTLO 4O3YA 1FDQA 3CQRA 1LDOA 3CKGA 4HPDA 3VU1A 1VWDB 2MJIA 3RWXA 2LKKA
chains in the Genus database with same CATH topology
3I17A 3JQOA 1MVGA 3UEXA 2CBSA 4MVKA 1E02A 1YWAA 3HWGA 3I0AA 3U9PC 2L5PA 4M6SA 3RKGA 4DQ4A 4ARHA 3FR5A 5AEOA 3FENA 2YG2A 5HZQA 4ZH6A 1I4UA 3C78X 1E00A 4ORSA 4I3DA 4PJ2A 1BWYA 2A0AA 3OJYC 4HFOA 4BQUA 2JMBA 3HOLA 4XMDA 2HZQA 3KFGA 2WEWA 3VE1A 1EIIA 3KFIA 4GKCA 3U03A 2X8SA 1UZ2X 4L1NA 4OS0A 3B2JA 4QAEA 1GT1A 3BY0A 4QGVA 2CBRA 4ZJ0A 1FEMA 1S44A 5KHPA 5L8OA 5LJBA 4A1HA 4NYRA 2A2GA 1ICMA 3HTYA 4KC7A 1YP6A 1KZXA 3S60A 3ZWEA 4D6AA 1GX9A 1MX8A 1N0SA 4R0BA 3WJBA 5CE4A 3TGBA 3UEUA 4YH0A 1IW2A 4Y0RA 4GK9A 3ZI8A 1ERXA 3BSZE 4ZHFA 2QO6A 2GC9A 3PH6A 3P24A 2R73A 4KIIA 3NADA 4CSBA 1LIFA 2K23A 4LZVA 4D6BA 2PY1A 1A57A 2AMMX 2AT0X 1NGLA 2Z4HA 1QABE 4IB6A 4XMEA 5EPQA 1DZPA 2AKQA 2LB6A 3WJCA 1AELA 1HMRA 2W2FA 2CM9A 2WWPA 2Q4NA 1BSYA 1ERBA 3FA9A 5K06A 3O19A 4O4XA 1JZUA 3PQUA 4A60A 1NP1A 1BRQA 3AKMA 4MISA 1LFOA 3OBLA 1QY0A 1LIDA 1SY1A 3DSZA 3VG5A 4EQAC 5IO7A 2AL0X 3FMZA 4QRLA 2FR2A 4QGWA 5EEEA 3P6GA 1O8VA 3T1DA 2ACOA 3H3IA 5BVQA 4TKHA 1SXYA 3NX1A 5F6BA 1ICNA 1HBPA 4PSQA 1CBRA 4OS8A 4QGXA 2QO4A 1KT7A 5L8NA 1GXAA 3FA7A 4GE1A 4GZVA 1EALA 4ZCBA 4NLJA 4ORUA 4WFUA 1BEBA 1YP7A 4AW8A 1LIEA 4IB9A 4ALOA 4GDZA 1GX8A 2Q39A 2QM9A 3ZUOA 3ZW0A 2ALLX 3STNA 1JV4A 4ZR2A 2QO5A 2W2AA 3C77X 3VPJE 3ZZVA 4O49A 1EUOA 3FYFA 4AYHA 2WQAE 1FENA 2GTLN 2ACPX 2X46A 3TF6A 3HK1A 3OD9A 4NNTA 1ZNHA 3RSWA 5C0NA 3ELZA 1OBPA 2LFOA 4IBAA 4IB8A 2XKLA 4OMWA 3NQ3A 2BS6A 2A3FX 3WXQA 1E5PA 5LJCA 1DF3A 1X8NA 3FW4A 2Q9SA 2EU7X 1OEJA 5AJCA 3CMPA 2RCQA 3P6FA 5HA0A 1CBIA 4I6SA 2CZTA 1QY1A 2BLGA 4GH7A 1PBOA 2FS6A 3NP1A 2WUTA 5AJBA 4IABA 1LKEA 1QFVA 4LKPA 3EBWA 5H9AA 1G5WA 1P6PA 3GE2A 2XSTA 4YGHA 4XMCA 1SMPI 1LIBA 5KIDA 3TGCA 4HPAA 3DTQA 1FTPA 5H9LA 1BM5A 3BX7A 1DV9A 1HMSA 3D96A 1YWDA 3P6EA 3SOTA 3CBCA 4HWMA 1SY2A 1MUPA 2AT5X 4QYNA 3B2LA 3EYCA 3FELA 4O3ZA 5D45A 3S26A 3NQKA 5LKFA 1AQBA 2LA7A 4O4UA 2G7BA 4YDAA 4U9CA 5EZ2A 3O22A 2JOZA 3PH5A 5FAZA 2JU3A 4EXZA 5HTEA 4LQZA 2OVSA 5HZ8A 4N7DA 4GRJA 4FGIB 1TXLA 4QQ1A 5LKEA 1IIUA 1ZNDA 2RCTA 4XMHA 5D47A 3KQ0A 3WBGA 3V8UA 5HTDA 1BJ7A 5BVSA 1SA8A 4FBVA 5EEDA 3NBXX 2JW1A 3BLGA 1EPBA 4ID2A 4O4OA 4Y0PA 4O4SA 2AH7X 2GTLM 4CK4A 4ZHHA 4GU8A 2MO5A 1SXUA 4XMFA 3HWFA 1CBSA 4HPBA 1GGLA 1X8OA 3UEVA 1X8PA 1SXXA 3K3LA 5DPQA 5B29A 3AKNA 1A2DA 2NNQA 4HPCA 5H9NA 4EEJA 2YMSA 1KZWA 1TW4A 1EIOA 3ELXA 2KTSA 5D8JA 3JS1A 2FWVA 3RBYA 4JGLA 5LJDA 4IB7A 1G74A 5FQ7E 1E06A 1VYFA 1XKIA 2FS7A 5H8TA 3QKGA 2BS5A 4U8UO 4ORYA 2OFRX 2DM5A 2WR6A 1KOIA 3ZW0B 3NX2A 2RA6A 2HMBA 2RD7C 1DC9A 4ORRA 5HZ6A 1EQDA 1X8UA 4I9RA 3STMX 3HWDA 2KTDA 1KXOA 5L8IA 4LKTA 1EW3A 4AZQA 1X8QA 3KZAA 1CJ5A 1DFVA 1YWBA 2NP1A 3WJFA 1GT4A 4MVEA 3MX7A 3APUA 1HN2A 5D48A 1OEEA 3VE2A 1I05A 1XCAA 4IAWA 1B0OA 4LZUA 1D2UA 2CM4A 4YGZA 3FA6A 2K62A 4AZPA 4AZNA 2KT4B 2QMIA 3B2HA 5FENA 2Q2PA 4MVLA 1JJJA 2HZRA 1KT3A 4YBUA 4IMOA 4YDBA 1FE3A 3IA8A 1QQSA 2N93A 3FEKA 1G85A 2OVAA 2M4LA 3G7XA 4ODDA 5FQ8E 4YCEA 3UAQA 1G7NA 2R74A 1ZNKA 1MDCA 2A13A 2JU8A 3D4RA 2L68A 4NP1A 4YKMA 4ZH9A 3P6DA 5HCDC 3STKA 3EM0A 5HWZA 4ZHGA 1I04A 4DQ3A 2MM3A 2WQ9A 5BYPA 3LV4A 5JR8A 3BS2A 4ZHCA 2W2BA 3ZUIA 3F6ZB 2FTBA 4NLIA 4YBPA 1EI5A 3PECA 3BRNA 4NYQA 4OS3A 3S5XA 1LNMA 1NP4A 3E3CA 5LJEA 1Y9LA 4FBOA 1D3SA 4YCHA 1DZJA 1B8EA 3Q6LA 1KQWA 3ZW1A 2JU7A 2RN4A 4BOEA 1IKJA 1KT4A 2HYSA 4I3CA 4AZOA 3BX8A 1PM1X 1TOUA 5HCCC 5HA1A 1CBQA 1VPRA 2MHDA 1BSOA 2G79A 4Y0QA 1ZNLA 1I06A 3PPTA 4KCAA 5LJGA 1OEKA 3P6CA 4ALBA 1BRPA 2R56A 5DG4A 4I3BA 3VG3A 4RUUA 1PEEA 4BVMA 1KGLA 3S5VA 1LICA 3FEPA 1LPJA 4O9SA 2A2UA 3RZYA 4TNNA 2F73A 2L67A 3L4RA 5F58A 2G78A 4COTA 1BSQA 3P02A 2WEXA 3D97A 4TLJA 3F8AA 3WOVA 1GKAB 3PQSA 3MBTA 2ZAGA 5FFHA 3U0DA 4AZRA 4INNA 5IO5A 1TOWA 1X71A 4ON1A 1VYGA 4ORXA 1LF7A 2FR3A 2HNXA 1Z24A 2OVDA 5H9KA 1JIWI 5CYBA 1TVQA 4WHIA 3PEDA 2F09A 2ANSA 5EDBA 4ZGUA 4CV7A 1S2PA 2OVEA 2GJ5A 3EBKA 1ZNEA 4RUNA 1HBQA 1OPBA 1SY0A 1MX7A 4MVIA 4U8UN 3VG2A 2L9CA 4FBRA 4YFQA 4TQ2A 4YMYA 5LJKA 1YIVA 4UU2A 2BT9A 1ZNGA 3EMMA 5F1EA 4WBKA 4TKBA 3CR6A 2KW1A 2NNDA 4N7CA 3FA8A 5HZ9A 3VG7A 3CWKA 1GKAA 2O62A 3SAOA 4EDEA 4WFVA 3B2IA 2X45A 1DZMA 4GETA 1BBPA 3BU9A 2FRSA 3APXA 2Q2MA 3WJEA 1B4MA 1RLBE 2MWHA 3KFFA 3PP6A 3FW5A 1JBHA 4ZFXA 1T68X 1U17A 4TKJA 5HCEC 4O3WA 1AVGI 3TGAA 1KT5A 1OPAA 3F9DA 5HZ5A 5BVTA 5KICA 2IFBA 4KT5A 4O3XB 4ML7B 1BLRA 4ES7A 3IFBA 3VG4A 1EPAA 5EDCA 2GTFX 1L6MA 3N91A 4UU3A 1FELA 1AB0A 1QG5A 1UREA 5AQ6A 5IO6A 2FLJA 1GM6A 1S7DA 1X89A 4QYPA 3ZW2A 3GAQA 4Y0SA 5FQ6E 4AZMA 1QWDA 4NNSA 3ZW1B 1SY3A 2OFMX 3B2KA 1B56A 1O1UA 1U0XA 3D95A 3ZQ3A 4YFRA 1IFCA 2BHVA 1ALBA 4QNIA 3NQ9A 5B27A 2Z4IA 2P8GA 4K19A 5F7GA 3FR2A 4EFGA 1HQPA 1HMTA 3BU1A 1IKEA 4IMNA 3NR3A 3P6HA 3FLLA 5D4AA 5LJHA 2OZQA 2X8TA 3CQNA 3CBSA 2NNEA 1JJXA 4U8UM 2ZAIA 4OMXA 3BDRA 3NPOA 1KT6A 4KH8A 3VG6A 5HBSA 1EXSA 2POAA 3O2YA 3UEWA 2LBAA 1YWCA 2RQ0A 3C76X 4YKOA 3FIQA 4YFPA 1ACDA 3HOEA 2KD2A 2AT8X 3HWEA 4MIRA 2AT3X 3APWA 2HLVA 4ZGFA 3APVA 1R0UA 3WJDA 1ML7A 4FQBB 2LBVA 1IFBA 1GT5A 3WVMA 3TZSA 4IAXA 1A18A 4KC8A 1Y9TA 1YUPA 1U18A 4QZUA 1QFTA 2WSJA 4ORWA 4I95A 4A8ZA 1GT3A 1H91A 1KQXA 3OE3A 1JYDA 4U3QA 4ZHDA 3FR4A 1PMPA 4GNYA 5F6ZA 1RBPA 1O1VA 4A1YA 1OBQA 2E4JA 1OBUA 5HAEA 2ASNX 4GNWA 4M7MA 2X8FA 4YGGA 2JN3A 3JSQA 4QZTA 1A3YA 4I9SA 1SXWA 1CRBA 2CZUA 2AT6X 3MVFA 4XMGA 2QOSC 3KFHA 1T0VA 1JYJA 1DZKA 3LHNA 1QY2A 1ZRYA 3WJGA 4TJZA 4NW4A 1T8VA 1ADLA 2FT9A 4L3RA 2GTLO 4O3YA 1FDQA 3CQRA 4HPDA 3VU1A 2MJIA 3RWXA 2LKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I17 A;  1MVG A;  3UEX A;  2CBS A;  4MVK A;  1E02 A;  1YWA A;  3HWG A;  3I0A A;  3U9P C;  2L5P A;  4M6S A;  4DQ4 A;  4ARH A;  3FR5 A;  3FEN A;  2YG2 A;  5HZQ A;  4ZH6 A;  1I4U A;  3C78 X;  1E00 A;  4ORS A;  4I3D A;  1BWY A;  2A0A A;  3OJY C;  4HFO A;  4BQU A;  4XMD A;  2HZQ A;  3KFG A;  2WEW A;  1EII A;  3KFI A;  4GKC A;  3U03 A;  4OS0 A;  1UZ2 X;  4QAE A;  3B2J A;  1GT1 A;  3BY0 A;  4QGV A;  2CBR A;  4ZJ0 A;  1FEM A;  1S44 A;  5KHP A;  5L8O A;  5LJB A;  4A1H A;  4NYR A;  2A2G A;  1ICM A;  1YP6 A;  1KZX A;  4D6A A;  1GX9 A;  1MX8 A;  1N0S A;  4R0B A;  3WJB A;  5CE4 A;  3TGB A;  3UEU A;  4YH0 A;  1IW2 A;  4Y0R A;  1ERX A;  3BSZ E;  4ZHF A;  2QO6 A;  2GC9 A;  3PH6 A;  2R73 A;  4KII A;  3NAD A;  1LIF A;  2K23 A;  4LZV A;  4D6B A;  2PY1 A;  1A57 A;  2AMM X;  2AT0 X;  1NGL A;  1QAB E;  4IB6 A;  4XME A;  5EPQ A;  1DZP A;  2AKQ A;  2LB6 A;  3WJC A;  1AEL A;  1HMR A;  2W2F A;  2CM9 A;  2WWP A;  2Q4N A;  1BSY A;  1ERB A;  3FA9 A;  5K06 A;  3O19 A;  1JZU A;  4A60 A;  1NP1 A;  1BRQ A;  3AKM A;  1LFO A;  1QY0 A;  1LID A;  1SY1 A;  3DSZ A;  3VG5 A;  5IO7 A;  2AL0 X;  3FMZ A;  2FR2 A;  4QGW A;  5EEE A;  3P6G A;  1O8V A;  3T1D A;  2ACO A;  5BVQ A;  4TKH A;  1SXY A;  3NX1 A;  5F6B A;  1ICN A;  1HBP A;  4PSQ A;  1CBR A;  4OS8 A;  4QGX A;  2QO4 A;  1KT7 A;  5L8N A;  1GXA A;  3FA7 A;  4GE1 A;  1EAL A;  4ZCB A;  4NLJ A;  4ORU A;  4WFU A;  1BEB A;  1YP7 A;  4AW8 A;  1LIE A;  4IB9 A;  4ALO A;  1GX8 A;  2Q39 A;  2QM9 A;  3ZUO A;  2ALL X;  3STN A;  1JV4 A;  4ZR2 A;  2QO5 A;  2W2A A;  3C77 X;  1EUO A;  4AYH A;  2WQA E;  1FEN A;  2ACP X;  2X46 A;  3TF6 A;  3HK1 A;  4NNT A;  1ZNH A;  3RSW A;  5C0N A;  3ELZ A;  1OBP A;  2LFO A;  4IBA A;  4IB8 A;  2XKL A;  4OMW A;  3NQ3 A;  2A3F X;  3WXQ A;  1E5P A;  5LJC A;  1DF3 A;  1X8N A;  3FW4 A;  2Q9S A;  2EU7 X;  1OEJ A;  3CMP A;  2RCQ A;  3P6F A;  5HA0 A;  1CBI A;  2CZT A;  1QY1 A;  2BLG A;  4GH7 A;  1PBO A;  2FS6 A;  3NP1 A;  2WUT A;  1LKE A;  1QFV A;  4LKP A;  3EBW A;  5H9A A;  1G5W A;  1P6P A;  2XST A;  4YGH A;  4XMC A;  1LIB A;  5KID A;  3TGC A;  4HPA A;  3DTQ A;  1FTP A;  5H9L A;  1BM5 A;  3BX7 A;  1DV9 A;  1HMS A;  3D96 A;  1YWD A;  3P6E A;  3CBC A;  4QYN A;  1SY2 A;  1MUP A;  2AT5 X;  3B2L A;  3EYC A;  3FEL A;  3S26 A;  5D45 A;  5LKF A;  1AQB A;  2G7B A;  4YDA A;  5EZ2 A;  3O22 A;  2JOZ A;  3PH5 A;  5FAZ A;  2JU3 A;  4EXZ A;  5HTE A;  5HZ8 A;  4N7D A;  4GRJ A;  1TXL A;  5LKE A;  1IIU A;  1ZND A;  2RCT A;  4XMH A;  5D47 A;  3KQ0 A;  3WBG A;  5HTD A;  1BJ7 A;  5BVS A;  1SA8 A;  5EED A;  3BLG A;  1EPB A;  4Y0P A;  2AH7 X;  4CK4 A;  4ZHH A;  2MO5 A;  1SXU A;  4XMF A;  3HWF A;  1CBS A;  4HPB A;  1GGL A;  1X8O A;  3UEV A;  1X8P A;  1SXX A;  3K3L A;  5DPQ A;  5B29 A;  3AKN A;  1A2D A;  2NNQ A;  4HPC A;  5H9N A;  4EEJ A;  1KZW A;  1TW4 A;  1EIO A;  3ELX A;  5D8J A;  3JS1 A;  2FWV A;  5LJD A;  4IB7 A;  1G74 A;  1E06 A;  1VYF A;  1XKI A;  2FS7 A;  5H8T A;  3QKG A;  4ORY A;  2OFR X;  2DM5 A;  2WR6 A;  1KOI A;  3NX2 A;  2RA6 A;  2HMB A;  2RD7 C;  1DC9 A;  4ORR A;  5HZ6 A;  1EQD A;  1X8U A;  4I9R A;  3STM X;  3HWD A;  2KTD A;  1KXO A;  5L8I A;  4LKT A;  1EW3 A;  4AZQ A;  1X8Q A;  3KZA A;  1CJ5 A;  1DFV A;  1YWB A;  2NP1 A;  3WJF A;  1GT4 A;  3APU A;  1HN2 A;  5D48 A;  1OEE A;  1I05 A;  1XCA A;  4IAW A;  1B0O A;  4LZU A;  1D2U A;  2CM4 A;  4YGZ A;  3FA6 A;  2K62 A;  4AZP A;  4AZN A;  2KT4 B;  3B2H A;  5FEN A;  2Q2P A;  4MVL A;  1JJJ A;  2HZR A;  1KT3 A;  4YBU A;  4IMO A;  4YDB A;  1FE3 A;  3IA8 A;  1QQS A;  2N93 A;  3FEK A;  1G85 A;  2OVA A;  3G7X A;  4ODD A;  4YCE A;  1G7N A;  2R74 A;  1ZNK A;  1MDC A;  2A13 A;  2JU8 A;  2L68 A;  4NP1 A;  4YKM A;  4ZH9 A;  3P6D A;  5HCD C;  3STK A;  3EM0 A;  5HWZ A;  4ZHG A;  1I04 A;  4DQ3 A;  2MM3 A;  2WQ9 A;  5JR8 A;  3BS2 A;  4ZHC A;  2W2B A;  3ZUI A;  4NLI A;  2FTB A;  4YBP A;  3PEC A;  3BRN A;  4NYQ A;  4OS3 A;  1LNM A;  1NP4 A;  5LJE A;  1D3S A;  4YCH A;  1DZJ A;  1B8E A;  3Q6L A;  1KQW A;  2JU7 A;  4BOE A;  1IKJ A;  1KT4 A;  2HYS A;  4I3C A;  4AZO A;  3BX8 A;  1PM1 X;  1TOU A;  5HCC C;  5HA1 A;  1CBQ A;  1VPR A;  1BSO A;  2G79 A;  4Y0Q A;  1ZNL A;  1I06 A;  3PPT A;  5LJG A;  1OEK A;  3P6C A;  4ALB A;  1BRP A;  2R56 A;  5DG4 A;  4I3B A;  3VG3 A;  4RUU A;  1PEE A;  4BVM A;  1KGL A;  1LIC A;  3FEP A;  1LPJ A;  4O9S A;  2A2U A;  3RZY A;  4TNN A;  2F73 A;  2L67 A;  3L4R A;  5F58 A;  2G78 A;  1BSQ A;  2WEX A;  3D97 A;  4TLJ A;  3F8A A;  1GKA B;  3MBT A;  5FFH A;  3U0D A;  4AZR A;  5IO5 A;  1TOW A;  1X71 A;  1VYG A;  4ORX A;  1LF7 A;  2FR3 A;  2HNX A;  1Z24 A;  2OVD A;  5H9K A;  5EDB A;  1TVQ A;  3PED A;  2ANS A;  4ZGU A;  1S2P A;  2OVE A;  2GJ5 A;  3EBK A;  1ZNE A;  4RUN A;  1HBQ A;  1OPB A;  1SY0 A;  1MX7 A;  4MVI A;  3VG2 A;  2L9C A;  4TQ2 A;  4YFQ A;  4YMY A;  5LJK A;  1YIV A;  4UU2 A;  1ZNG A;  3EMM A;  5F1E A;  4WBK A;  4TKB A;  3CR6 A;  2NND A;  4N7C A;  3FA8 A;  5HZ9 A;  3VG7 A;  3CWK A;  1GKA A;  2O62 A;  3SAO A;  4EDE A;  4WFV A;  3B2I A;  2X45 A;  1DZM A;  4GET A;  1BBP A;  3BU9 A;  2FRS A;  3APX A;  2Q2M A;  3WJE A;  1B4M A;  1RLB E;  3KFF A;  3PP6 A;  1JBH A;  3FW5 A;  4ZFX A;  1T68 X;  1U17 A;  4TKJ A;  5HCE C;  1AVG I;  3TGA A;  1KT5 A;  1OPA A;  3F9D A;  5HZ5 A;  5BVT A;  5KIC A;  2IFB A;  1BLR A;  4ES7 A;  3IFB A;  3VG4 A;  1EPA A;  5EDC A;  2GTF X;  1L6M A;  4UU3 A;  1FEL A;  1AB0 A;  1QG5 A;  1URE A;  5AQ6 A;  5IO6 A;  2FLJ A;  1GM6 A;  1S7D A;  1X89 A;  4QYP A;  4AZM A;  3GAQ A;  4Y0S A;  1QWD A;  4NNS A;  1SY3 A;  2OFM X;  3B2K A;  1B56 A;  1O1U A;  1U0X A;  3D95 A;  3ZQ3 A;  4YFR A;  1IFC A;  1ALB A;  3NQ9 A;  5B27 A;  2P8G A;  4K19 A;  5F7G A;  3FR2 A;  4EFG A;  1HQP A;  1HMT A;  3BU1 A;  1IKE A;  4IMN A;  3NR3 A;  3P6H A;  3FLL A;  5D4A A;  5LJH A;  2OZQ A;  3CQN A;  3CBS A;  2NNE A;  1JJX A;  4OMX A;  3BDR A;  3NPO A;  1KT6 A;  3VG6 A;  5HBS A;  1EXS A;  2POA A;  3O2Y A;  3UEW A;  2LBA A;  1YWC A;  2RQ0 A;  3C76 X;  4YKO A;  3FIQ A;  4YFP A;  1ACD A;  2AT8 X;  3HWE A;  2AT3 X;  3APW A;  2HLV A;  3APV A;  1R0U A;  3WJD A;  1ML7 A;  2LBV A;  1IFB A;  1GT5 A;  3WVM A;  3TZS A;  4IAX A;  1A18 A;  1YUP A;  1U18 A;  4QZU A;  1QFT A;  2WSJ A;  4ORW A;  4A8Z A;  1GT3 A;  1H91 A;  1KQX A;  4ZHD A;  1JYD A;  3FR4 A;  1PMP A;  4GNY A;  5F6Z A;  1RBP A;  1O1V A;  4A1Y A;  1OBQ A;  2E4J A;  1OBU A;  5HAE A;  2ASN X;  4GNW A;  4M7M A;  4YGG A;  2JN3 A;  3JSQ A;  4QZT A;  1A3Y A;  4I9S A;  1SXW A;  1CRB A;  2CZU A;  2AT6 X;  3MVF A;  4XMG A;  2QOS C;  3KFH A;  1T0V A;  1JYJ A;  1DZK A;  1QY2 A;  1ZRY A;  3WJG A;  4TJZ A;  1T8V A;  1ADL A;  2FT9 A;  1FDQ A;  3CQR A;  4HPD A;  2MJI A;  2LKK A; 
#chains in the Genus database with same CATH topology
 3FID A;  4NV7 A;  3I17 A;  3JQO A;  1MVG A;  1NC9 A;  1SWH A;  2CBS A;  3UEX A;  3X00 A;  4MVK A;  1E02 A;  1YWA A;  3HWG A;  1STS B;  3I0A A;  4EKV A;  3U9P C;  2L5P A;  1RXJ A;  4M6S A;  3RKG A;  4ARH A;  2RTM A;  1SWG A;  3FR5 A;  4DQ4 A;  5AEO A;  3FEN A;  2YG2 A;  5HZQ A;  4ZH6 A;  1I4U A;  3C78 X;  1E00 A;  2IZH B;  4ORS A;  4I3D A;  4PJ2 A;  1BWY A;  2A0A A;  3OJY C;  4HFO A;  5B11 O;  4BQU A;  2JMB A;  3HOL A;  4XMD A;  2HZQ A;  3KFG A;  2WEW A;  3VE1 A;  1EII A;  3KFI A;  4GKC A;  3U03 A;  2X8S A;  1UZ2 X;  2MF6 A;  4L1N A;  1SWL A;  3B2J A;  4OS0 A;  4QAE A;  1GT1 A;  3BY0 A;  4QGV A;  2CBR A;  1HXZ A;  1VWO B;  2RTC B;  4ZJ0 A;  1FEM A;  1S44 A;  5KHP A;  4CPH A;  1RXH A;  5L8O A;  5LJB A;  4A1H A;  4NYR A;  2A2G A;  1ICM A;  3HTY A;  4KC7 A;  1YP6 A;  2OYB O;  2IZJ A;  1KZX A;  3S60 A;  3ZWE A;  4D6A A;  1GX9 A;  1MX8 A;  1N0S A;  4R0B A;  2OY8 A;  2Y3F A;  3WJB A;  5CE4 A;  3TGB A;  1Y53 X;  3UEU A;  4CDD A;  1KL3 A;  4YH0 A;  1IW2 A;  1SWD A;  4GK9 A;  4Y0R A;  3ZI8 A;  1ERX A;  3BSZ E;  2G8C O;  3EC5 A;  4ZHF A;  2QO6 A;  2RTD B;  2GC9 A;  2X34 A;  3PH6 A;  3P24 A;  5B5F A;  2R73 A;  4KII A;  3Q34 A;  2DJG A;  3D9W A;  3NAD A;  4CSB A;  1LIF A;  2K23 A;  4LZV A;  3HPE A;  2PY1 A;  4D6B A;  3KVN A;  2IZB A;  2OL6 O;  1A57 A;  2AMM X;  2AT0 X;  4C5P A;  1NGL A;  2Z4H A;  2Y32 A;  1QAB E;  4IB6 A;  4XME A;  4Z2V A;  5EPQ A;  1DZP A;  2AKQ A;  2LB6 A;  3WJC A;  1UYN X;  1AEL A;  1HMR A;  2W2F A;  2CM9 A;  2WWP A;  2Q4N A;  1K24 A;  1BSY A;  1ERB A;  1STP A;  4YVB A;  3FA9 A;  1LUQ A;  5K06 A;  1DF8 A;  1VWI B;  1Y0G A;  3WYQ A;  3O19 A;  4O4X A;  4CPE A;  1VYO A;  1JZU A;  3PQU A;  4A60 A;  1NP1 A;  1BRQ A;  3AKM A;  1VWE B;  4MIS A;  1LFO A;  3OBL A;  1QY0 A;  1LID A;  1SY1 A;  3DSZ A;  3EW2 A;  3VG5 A;  4EQA C;  2AL0 X;  5IO7 A;  3FMZ A;  4QRL A;  2FR2 A;  4QGW A;  5EEE A;  3P6G A;  1O8V A;  3T1D A;  2ACO A;  3H3I A;  1SWN A;  1VWL B;  5BVQ A;  4TKH A;  1SXY A;  3NX1 A;  5F6B A;  1ICN A;  1HBP A;  4PSQ A;  4Z2O A;  1CBR A;  1NQN A;  4GGZ A;  4OS8 A;  4QGX A;  2QO4 A;  1KT7 A;  2PI3 O;  4BX7 A;  5L8N A;  3RE5 A;  1GXA A;  3FA7 A;  4GE1 A;  4GZV A;  1B4M A;  4I60 A;  1EAL A;  4ZCB A;  4NLJ A;  4ORU A;  4WFU A;  1LEL A;  1BEB A;  1SRJ A;  1YP7 A;  4AW8 A;  1LIE A;  4IB9 A;  4ALO A;  4GDZ A;  1GX8 A;  1VWR B;  2Q39 A;  5B10 O;  2QM9 A;  3ZUO A;  3ZW0 A;  2ALL X;  2AVI A;  1W6F A;  4GGT A;  1JV4 A;  2ZSC A;  3STN A;  4ZR2 A;  1HY2 A;  2QO5 A;  3RDQ A;  2W2A A;  3C77 X;  3VPJ E;  3ZZV A;  4O49 A;  1EUO A;  3FYF A;  4AYH A;  2WQA E;  1NBX A;  2BC3 A;  4JHQ A;  3SZI A;  1FEN A;  3WYP A;  2GTL N;  2RTE B;  2ACP X;  2X46 A;  3TF6 A;  3HK1 A;  1N9Y A;  3OD9 A;  3MG5 A;  4DNE A;  4NNT A;  1ZNH A;  3RSW A;  4Y59 A;  3SLT A;  5C0N A;  3ELZ A;  1OBP A;  2LFO A;  1SWT A;  4IBA A;  4IB8 A;  2RTN B;  2XKL A;  3NQ3 A;  4OMW A;  2FHL A;  2BS6 A;  2A3F X;  3WXQ A;  1E5P A;  5LJC A;  1DF3 A;  1X8N A;  3FW4 A;  2Q9S A;  2EU7 X;  2VFB A;  1OEJ A;  5L3Y A;  1SWF A;  5AJC A;  1DV9 A;  2C1Q A;  3CMP A;  2RCQ A;  3P6F A;  5HA0 A;  1PTS A;  1CBI A;  1N7Y A;  4I6S A;  2CZT A;  3SLO A;  2IZD B;  1QY1 A;  2BLG A;  4GH7 A;  1PBO A;  2FS6 A;  1STR B;  3NP1 A;  2WUT A;  5AJB A;  3CKF A;  4IAB A;  1LKE A;  1RSU B;  2RTQ B;  1QFV A;  4LKP A;  3EBW A;  5H9A A;  1G5W A;  2VDF A;  1P6P A;  3GE2 A;  2XST A;  2I5V O;  4YGH A;  3T2W A;  1W5R A;  4XMC A;  4GDA A;  4Z27 A;  1SMP I;  1LIB A;  5KID A;  3TGC A;  4HPA A;  3DTQ A;  1FTP A;  5H9L A;  1BM5 A;  1SWE A;  3BX7 A;  3T2X A;  1HMS A;  3D96 A;  1I78 A;  1YWD A;  1SWC A;  3P6E A;  5CHK A;  3SOT A;  3CBC A;  4GJS A;  4HWM A;  1SY2 A;  1MUP A;  1SWA A;  2AT5 X;  3B2L A;  3EYC A;  3FEL A;  4O3Z A;  4QYN A;  5D45 A;  3S26 A;  3NQK A;  5LKF A;  1AQB A;  2LA7 A;  2X4M A;  1VWF B;  2G7B A;  4O4U A;  4YDA A;  4U9C A;  5EZ2 A;  3O22 A;  2JOZ A;  3PH5 A;  5FAZ A;  2JU3 A;  4EXZ A;  4JO6 A;  5HTE A;  3SZJ A;  4LQZ A;  2OVS A;  5HZ8 A;  4N7D A;  4GRJ A;  4FGI B;  1TXL A;  4QQ1 A;  5LKE A;  1SRE A;  1IIU A;  1ZND A;  2RCT A;  4XMH A;  5D47 A;  2IZA A;  3KQ0 A;  3WBG A;  3V8U A;  4BCS A;  5HTD A;  1BJ7 A;  5B5G A;  3PDF A;  1SA8 A;  5BVS A;  1VWM B;  4FBV A;  5EED A;  3NBX X;  2FKG A;  2JW1 A;  3BLG A;  1EPB A;  1JJU A;  4ID2 A;  4O4O A;  4Y0P A;  4O4S A;  2AH7 X;  2GTL M;  3RDX A;  4CK4 A;  4ZHH A;  2RTF B;  3QQ2 A;  4GU8 A;  2MO5 A;  2IZL B;  4Z28 A;  1SXU A;  4XMF A;  3HWF A;  1CBS A;  4HPB A;  2X56 A;  5CSE A;  1GGL A;  1X8O A;  3UEV A;  1X8P A;  1SXX A;  3K3L A;  4OKA A;  4IRW A;  5DPQ A;  1VWK B;  5B29 A;  3AKN A;  4BX7 B;  1A2D A;  2NNQ A;  4HPC A;  5H9N A;  4EEJ A;  2YMS A;  1KZW A;  3SZH A;  1TW4 A;  1EIO A;  3ELX A;  2KTS A;  5D8J A;  3JS1 A;  1SWS A;  2FWV A;  1VWJ B;  4JGL A;  3RBY A;  5LJD A;  2A5B A;  4IB7 A;  1G74 A;  5FQ7 E;  1E06 A;  1VYF A;  1XKI A;  2FS7 A;  5H8T A;  3QKG A;  2BS5 A;  1SWB A;  4ORY A;  2OFR X;  1KL5 A;  4U8U O;  5K67 A;  2DM5 A;  2WR6 A;  3T6F A;  2GH7 A;  1KOI A;  5B3M O;  3NX2 A;  3ZW0 B;  1NDJ A;  3VHI A;  2RA6 A;  2HMB A;  3T6L A;  2RD7 C;  1DC9 A;  4ORR A;  1KL4 A;  5HZ6 A;  1JMZ A;  5B2A O;  1EQD A;  5JD2 A;  1X8U A;  2QCB A;  1KFF A;  4I9R A;  3STM X;  3HWD A;  3VGW A;  2KTD A;  1KXO A;  1SRG A;  5L8I A;  4LKT A;  1EW3 A;  4AZQ A;  1X8Q A;  3KZA A;  2RTA A;  1CJ5 A;  1DFV A;  1YWB A;  2NP1 A;  3WJF A;  1GT4 A;  4MVE A;  3MX7 A;  3APU A;  1HN2 A;  2JGS A;  1OEE A;  5D48 A;  3VE2 A;  1I05 A;  1XCA A;  4IAW A;  1B0O A;  4LZU A;  1D2U A;  2CM4 A;  4YGZ A;  3FA6 A;  2K62 A;  4AZP A;  4AZN A;  2KT4 B;  2QMI A;  3B2H A;  3AEH A;  5FEN A;  1SRH A;  2Q2P A;  4BGF A;  4GUZ A;  1VWB B;  1JMX A;  4MVL A;  1JJJ A;  5IRU A;  2HZR A;  1KT3 A;  1AVD A;  1E2T A;  4IMO A;  4YBU A;  4YDB A;  3WZQ A;  1FE3 A;  3IA8 A;  3RE6 A;  1QQS A;  1WBI A;  2N93 A;  3FEK A;  1G85 A;  2OVA A;  2M4L A;  3G7X A;  4ODD A;  5FQ8 E;  5IRW A;  1SWQ A;  1VWH B;  4YCE A;  1WUB A;  3UAQ A;  1G7N A;  2R74 A;  4Y5D A;  1ZNK A;  1GX3 A;  1MDC A;  1LCZ A;  2A13 A;  2JU8 A;  3D4R A;  2L68 A;  4NP1 A;  4YKM A;  4GGR A;  4ZH9 A;  3P6D A;  2RTJ A;  5HCD C;  3STK A;  2RTH B;  3EM0 A;  5HWZ A;  1SWP A;  4ZHG A;  1I04 A;  2HKD A;  2QOM A;  4DQ3 A;  2MM3 A;  2WQ9 A;  1N9M A;  5BYP A;  3LV4 A;  4BBO A;  3BS2 A;  4ZHC A;  5JR8 A;  2W2B A;  3ZUI A;  1N43 A;  1MEP A;  3VHH A;  1SWR A;  2FGS A;  2FTB A;  1JQP A;  3F6Z B;  4NLI A;  3RDM A;  3VHM A;  4DCB A;  1EI5 A;  4YBP A;  3PEC A;  3BRN A;  2IZK A;  2IZE B;  4NYQ A;  4OS3 A;  3S5X A;  2CAM A;  1SWO A;  1LNM A;  1NP4 A;  3E3C A;  3RDS A;  5LJE A;  1Y9L A;  1SRF A;  4FBO A;  1D3S A;  4GJV A;  1UYO X;  3WZO A;  4YCH A;  1AVE A;  3SLJ A;  1DZJ A;  1B8E A;  3Q6L A;  3RY1 A;  4BJ8 A;  1KQW A;  3ZW1 A;  2JU7 A;  2RN4 A;  2RTG B;  4BOE A;  1NQM A;  2I5Z O;  1IKJ A;  1KT4 A;  2HYS A;  4I3C A;  4AZO A;  3BX8 A;  1LDQ A;  1PM1 X;  4Z2P A;  4MEE A;  3WZP A;  1TOU A;  5HCC C;  5HA1 A;  4Z6J A;  1CBQ A;  1VPR A;  2MHD A;  1BSO A;  1MM9 A;  2G79 A;  1ZNL A;  1I06 A;  2Y3E A;  3PPT A;  2UYW A;  4Y0Q A;  4KCA A;  5LJG A;  1OEK A;  3P6C A;  4ALB A;  1BRP A;  2R56 A;  4JNJ A;  4I3B A;  5DG4 A;  3VG3 A;  4RUU A;  1PEE A;  4BVM A;  1KGL A;  3S5V A;  1LIC A;  3FEP A;  1LPJ A;  2IZI A;  4O9S A;  2A2U A;  3RZY A;  4TNN A;  1RXK A;  2F73 A;  2L67 A;  2OF9 A;  3L4R A;  5F58 A;  2G78 A;  1VWP B;  4COT A;  1BSQ A;  3P02 A;  1VWA B;  2WEX A;  3D97 A;  4TLJ A;  3RY2 A;  3F8A A;  3WOV A;  1GKA B;  3PQS A;  3MBT A;  2ZAG A;  5FFH A;  3U0D A;  1W4T A;  4AZR A;  4INN A;  5IO5 A;  2OL7 A;  1TOW A;  2IZG B;  1X71 A;  4ON1 A;  1VYG A;  1SLG B;  4ORX A;  1LF7 A;  2FR3 A;  2HNX A;  1Z24 A;  2OVD A;  5H9K A;  4CDE A;  1JIW I;  5K68 A;  5CYB A;  1TVQ A;  4WHI A;  3PED A;  2F09 A;  2ANS A;  2VFC A;  5EDB A;  4ZGU A;  4CV7 A;  1S2P A;  2OVE A;  2GJ5 A;  2RTK A;  1ZNE A;  2OFA A;  1HBQ A;  3EBK A;  1OPB A;  4RUN A;  1MOY A;  4BX6 A;  1SY0 A;  1MX7 A;  4MVI A;  4U8U N;  3VG2 A;  2L9C A;  4FBR A;  2OF8 A;  4YFQ A;  4TQ2 A;  4YMY A;  5LJK A;  1YIV A;  2X55 A;  4UU2 A;  2BT9 A;  2DJF A;  1ZNG A;  2AF5 A;  2C1S A;  3EMM A;  2G5L A;  1VWC B;  5F1E A;  3RDO A;  4WBK A;  4TKB A;  3CR6 A;  5IXG A;  2KW1 A;  2NND A;  4N7C A;  2X32 A;  3FA8 A;  4BX5 A;  5HZ9 A;  3VG7 A;  3CWK A;  1GKA A;  2O62 A;  2OL8 O;  3SAO A;  4EDE A;  4WFV A;  3B2I A;  4CPF A;  2X45 A;  1I9H A;  1DZM A;  1VWG B;  1BBP A;  1K3B A;  3BU9 A;  4GET A;  2FRS A;  3APX A;  2Q2M A;  2A5C A;  1PBY A;  3WJE A;  1RLB E;  2MWH A;  1SLF B;  3KFF A;  3FW5 A;  3PP6 A;  4ZFX A;  1JBH A;  4GD9 A;  1T68 X;  1U17 A;  4TKJ A;  5HCE C;  4CDC A;  1SWU A;  1Y55 X;  1VWN B;  4O3W A;  1AVG I;  3TGA A;  1KT5 A;  1OPA A;  3F9D A;  5HZ5 A;  5BVT A;  5KIC A;  2IFB A;  1MK5 A;  4KT5 A;  4O3X B;  4ML7 B;  1BLR A;  4ES7 A;  3IFB A;  5IRA A;  3VG4 A;  1EPA A;  1FJ1 E;  2RTO B;  5EDC A;  2GTF X;  1HXL A;  1L6M A;  4A8Z A;  3N91 A;  4UU3 A;  1FEL A;  1AB0 A;  1QG5 A;  4CPI A;  1URE A;  5AQ6 A;  5IO6 A;  2FLJ A;  1GM6 A;  1S7D A;  1X89 A;  1RAV A;  2RTL A;  5F2B A;  3EW1 A;  4QYP A;  3GAQ A;  3FDC A;  4Y0S A;  5FQ6 E;  3ZW2 A;  4AZM A;  2FKJ A;  1QWD A;  4OEL A;  4NNS A;  3ZW1 B;  1SY3 A;  1LCW A;  2OFM X;  1B56 A;  3B2K A;  1O1U A;  1U0X A;  3D95 A;  3ZQ3 A;  1SLE B;  1SWJ A;  4YFR A;  1IFC A;  2BHV A;  1ALB A;  4QNI A;  1VWQ B;  2RTR B;  3NQ9 A;  5B27 A;  2Z4I A;  2P8G A;  2WPU A;  4K19 A;  3AUM O;  3FR2 A;  5F7G A;  1HQP A;  4EFG A;  2OY1 O;  3MM0 A;  1HMT A;  3BU1 A;  1IKE A;  2IZF B;  3NR3 A;  4IMN A;  3P6H A;  3FLL A;  2A8G A;  5D4A A;  2OZQ A;  1LCV A;  2X8T A;  3CBS A;  2NNE A;  3CQN A;  5LJH A;  1JJX A;  4U8U M;  2BSZ A;  4CDF A;  2ZAI A;  3WZN A;  1Y52 X;  3BDR A;  4OMX A;  3NPO A;  1KT6 A;  4KH8 A;  3VG6 A;  5HBS A;  2FHN X;  3RDU A;  1EXS A;  2POA A;  3O2Y A;  3PK2 A;  2LBA A;  1YWC A;  2RQ0 A;  3C76 X;  4YKO A;  3FIQ A;  3UEW A;  4YFP A;  1ACD A;  4B55 A;  3HOE A;  2KD2 A;  2AT8 X;  2UZ2 A;  3HWE A;  4MIR A;  2AT3 X;  1HQQ A;  3APW A;  1RST B;  2HLV A;  2RTI B;  2RTP B;  3APV A;  4ZGF A;  1R0U A;  3WJD A;  1ML7 A;  4FQB B;  2LBV A;  1IFB A;  1GT5 A;  3WVM A;  3TZS A;  4IAX A;  1A18 A;  4KC8 A;  1SRI A;  2OFB A;  1Y9T A;  1YUP A;  1U18 A;  4QZU A;  1N4J A;  1QFT A;  2C4I A;  1SLD B;  2WSJ A;  4I95 A;  4ORW A;  1GT3 A;  1H91 A;  1KQX A;  3OE3 A;  1JYD A;  4U3Q A;  4ZHD A;  3FR4 A;  2IZC B;  1PMP A;  4GNY A;  1OSP O;  5F6Z A;  1RBP A;  1O1V A;  4A1Y A;  1OBQ A;  2E4J A;  1OBU A;  4OEM A;  5HAE A;  4BX6 B;  2ASN X;  4GNW A;  2OY7 A;  4M7M A;  2X8F A;  2RTB B;  4U46 A;  4YGG A;  2JN3 A;  3JSQ A;  1SWK A;  3LTW A;  4NV8 A;  4QZT A;  1A3Y A;  4I9S A;  1SXW A;  1CRB A;  2CZU A;  2AT6 X;  3MVF A;  4XMG A;  1IJ8 A;  2QOS C;  3KFH A;  1T0V A;  1JYJ A;  1DZK A;  2OY5 O;  3LHN A;  1QY2 A;  1ZRY A;  3WJG A;  4TJZ A;  4NW4 A;  4CPH B;  1T8V A;  1ADL A;  2F01 A;  2FT9 A;  4L3R A;  4BX5 B;  2GTL O;  4O3Y A;  1FDQ A;  3CQR A;  1LDO A;  3CKG A;  4HPD A;  3VU1 A;  1VWD B;  2MJI A;  3RWX A;  2LKK A; 
#chains in the Genus database with same CATH homology
 3I17 A;  3JQO A;  1MVG A;  3UEX A;  2CBS A;  4MVK A;  1E02 A;  1YWA A;  3HWG A;  3I0A A;  3U9P C;  2L5P A;  4M6S A;  3RKG A;  4DQ4 A;  4ARH A;  3FR5 A;  5AEO A;  3FEN A;  2YG2 A;  5HZQ A;  4ZH6 A;  1I4U A;  3C78 X;  1E00 A;  4ORS A;  4I3D A;  4PJ2 A;  1BWY A;  2A0A A;  3OJY C;  4HFO A;  4BQU A;  2JMB A;  3HOL A;  4XMD A;  2HZQ A;  3KFG A;  2WEW A;  3VE1 A;  1EII A;  3KFI A;  4GKC A;  3U03 A;  2X8S A;  1UZ2 X;  4L1N A;  4OS0 A;  3B2J A;  4QAE A;  1GT1 A;  3BY0 A;  4QGV A;  2CBR A;  4ZJ0 A;  1FEM A;  1S44 A;  5KHP A;  5L8O A;  5LJB A;  4A1H A;  4NYR A;  2A2G A;  1ICM A;  3HTY A;  4KC7 A;  1YP6 A;  1KZX A;  3S60 A;  3ZWE A;  4D6A A;  1GX9 A;  1MX8 A;  1N0S A;  4R0B A;  3WJB A;  5CE4 A;  3TGB A;  3UEU A;  4YH0 A;  1IW2 A;  4Y0R A;  4GK9 A;  3ZI8 A;  1ERX A;  3BSZ E;  4ZHF A;  2QO6 A;  2GC9 A;  3PH6 A;  3P24 A;  2R73 A;  4KII A;  3NAD A;  4CSB A;  1LIF A;  2K23 A;  4LZV A;  4D6B A;  2PY1 A;  1A57 A;  2AMM X;  2AT0 X;  1NGL A;  2Z4H A;  1QAB E;  4IB6 A;  4XME A;  5EPQ A;  1DZP A;  2AKQ A;  2LB6 A;  3WJC A;  1AEL A;  1HMR A;  2W2F A;  2CM9 A;  2WWP A;  2Q4N A;  1BSY A;  1ERB A;  3FA9 A;  5K06 A;  3O19 A;  4O4X A;  1JZU A;  3PQU A;  4A60 A;  1NP1 A;  1BRQ A;  3AKM A;  4MIS A;  1LFO A;  3OBL A;  1QY0 A;  1LID A;  1SY1 A;  3DSZ A;  3VG5 A;  4EQA C;  5IO7 A;  2AL0 X;  3FMZ A;  4QRL A;  2FR2 A;  4QGW A;  5EEE A;  3P6G A;  1O8V A;  3T1D A;  2ACO A;  3H3I A;  5BVQ A;  4TKH A;  1SXY A;  3NX1 A;  5F6B A;  1ICN A;  1HBP A;  4PSQ A;  1CBR A;  4OS8 A;  4QGX A;  2QO4 A;  1KT7 A;  5L8N A;  1GXA A;  3FA7 A;  4GE1 A;  4GZV A;  1EAL A;  4ZCB A;  4NLJ A;  4ORU A;  4WFU A;  1BEB A;  1YP7 A;  4AW8 A;  1LIE A;  4IB9 A;  4ALO A;  4GDZ A;  1GX8 A;  2Q39 A;  2QM9 A;  3ZUO A;  3ZW0 A;  2ALL X;  3STN A;  1JV4 A;  4ZR2 A;  2QO5 A;  2W2A A;  3C77 X;  3VPJ E;  3ZZV A;  4O49 A;  1EUO A;  3FYF A;  4AYH A;  2WQA E;  1FEN A;  2GTL N;  2ACP X;  2X46 A;  3TF6 A;  3HK1 A;  3OD9 A;  4NNT A;  1ZNH A;  3RSW A;  5C0N A;  3ELZ A;  1OBP A;  2LFO A;  4IBA A;  4IB8 A;  2XKL A;  4OMW A;  3NQ3 A;  2BS6 A;  2A3F X;  3WXQ A;  1E5P A;  5LJC A;  1DF3 A;  1X8N A;  3FW4 A;  2Q9S A;  2EU7 X;  1OEJ A;  5AJC A;  3CMP A;  2RCQ A;  3P6F A;  5HA0 A;  1CBI A;  4I6S A;  2CZT A;  1QY1 A;  2BLG A;  4GH7 A;  1PBO A;  2FS6 A;  3NP1 A;  2WUT A;  5AJB A;  4IAB A;  1LKE A;  1QFV A;  4LKP A;  3EBW A;  5H9A A;  1G5W A;  1P6P A;  3GE2 A;  2XST A;  4YGH A;  4XMC A;  1SMP I;  1LIB A;  5KID A;  3TGC A;  4HPA A;  3DTQ A;  1FTP A;  5H9L A;  1BM5 A;  3BX7 A;  1DV9 A;  1HMS A;  3D96 A;  1YWD A;  3P6E A;  3SOT A;  3CBC A;  4HWM A;  1SY2 A;  1MUP A;  2AT5 X;  4QYN A;  3B2L A;  3EYC A;  3FEL A;  4O3Z A;  5D45 A;  3S26 A;  3NQK A;  5LKF A;  1AQB A;  2LA7 A;  4O4U A;  2G7B A;  4YDA A;  4U9C A;  5EZ2 A;  3O22 A;  2JOZ A;  3PH5 A;  5FAZ A;  2JU3 A;  4EXZ A;  5HTE A;  4LQZ A;  2OVS A;  5HZ8 A;  4N7D A;  4GRJ A;  4FGI B;  1TXL A;  4QQ1 A;  5LKE A;  1IIU A;  1ZND A;  2RCT A;  4XMH A;  5D47 A;  3KQ0 A;  3WBG A;  3V8U A;  5HTD A;  1BJ7 A;  5BVS A;  1SA8 A;  4FBV A;  5EED A;  3NBX X;  2JW1 A;  3BLG A;  1EPB A;  4ID2 A;  4O4O A;  4Y0P A;  4O4S A;  2AH7 X;  2GTL M;  4CK4 A;  4ZHH A;  4GU8 A;  2MO5 A;  1SXU A;  4XMF A;  3HWF A;  1CBS A;  4HPB A;  1GGL A;  1X8O A;  3UEV A;  1X8P A;  1SXX A;  3K3L A;  5DPQ A;  5B29 A;  3AKN A;  1A2D A;  2NNQ A;  4HPC A;  5H9N A;  4EEJ A;  2YMS A;  1KZW A;  1TW4 A;  1EIO A;  3ELX A;  2KTS A;  5D8J A;  3JS1 A;  2FWV A;  3RBY A;  4JGL A;  5LJD A;  4IB7 A;  1G74 A;  5FQ7 E;  1E06 A;  1VYF A;  1XKI A;  2FS7 A;  5H8T A;  3QKG A;  2BS5 A;  4U8U O;  4ORY A;  2OFR X;  2DM5 A;  2WR6 A;  1KOI A;  3ZW0 B;  3NX2 A;  2RA6 A;  2HMB A;  2RD7 C;  1DC9 A;  4ORR A;  5HZ6 A;  1EQD A;  1X8U A;  4I9R A;  3STM X;  3HWD A;  2KTD A;  1KXO A;  5L8I A;  4LKT A;  1EW3 A;  4AZQ A;  1X8Q A;  3KZA A;  1CJ5 A;  1DFV A;  1YWB A;  2NP1 A;  3WJF A;  1GT4 A;  4MVE A;  3MX7 A;  3APU A;  1HN2 A;  5D48 A;  1OEE A;  3VE2 A;  1I05 A;  1XCA A;  4IAW A;  1B0O A;  4LZU A;  1D2U A;  2CM4 A;  4YGZ A;  3FA6 A;  2K62 A;  4AZP A;  4AZN A;  2KT4 B;  2QMI A;  3B2H A;  5FEN A;  2Q2P A;  4MVL A;  1JJJ A;  2HZR A;  1KT3 A;  4YBU A;  4IMO A;  4YDB A;  1FE3 A;  3IA8 A;  1QQS A;  2N93 A;  3FEK A;  1G85 A;  2OVA A;  2M4L A;  3G7X A;  4ODD A;  5FQ8 E;  4YCE A;  3UAQ A;  1G7N A;  2R74 A;  1ZNK A;  1MDC A;  2A13 A;  2JU8 A;  3D4R A;  2L68 A;  4NP1 A;  4YKM A;  4ZH9 A;  3P6D A;  5HCD C;  3STK A;  3EM0 A;  5HWZ A;  4ZHG A;  1I04 A;  4DQ3 A;  2MM3 A;  2WQ9 A;  5BYP A;  3LV4 A;  5JR8 A;  3BS2 A;  4ZHC A;  2W2B A;  3ZUI A;  3F6Z B;  2FTB A;  4NLI A;  4YBP A;  1EI5 A;  3PEC A;  3BRN A;  4NYQ A;  4OS3 A;  3S5X A;  1LNM A;  1NP4 A;  3E3C A;  5LJE A;  1Y9L A;  4FBO A;  1D3S A;  4YCH A;  1DZJ A;  1B8E A;  3Q6L A;  1KQW A;  3ZW1 A;  2JU7 A;  2RN4 A;  4BOE A;  1IKJ A;  1KT4 A;  2HYS A;  4I3C A;  4AZO A;  3BX8 A;  1PM1 X;  1TOU A;  5HCC C;  5HA1 A;  1CBQ A;  1VPR A;  2MHD A;  1BSO A;  2G79 A;  4Y0Q A;  1ZNL A;  1I06 A;  3PPT A;  4KCA A;  5LJG A;  1OEK A;  3P6C A;  4ALB A;  1BRP A;  2R56 A;  5DG4 A;  4I3B A;  3VG3 A;  4RUU A;  1PEE A;  4BVM A;  1KGL A;  3S5V A;  1LIC A;  3FEP A;  1LPJ A;  4O9S A;  2A2U A;  3RZY A;  4TNN A;  2F73 A;  2L67 A;  3L4R A;  5F58 A;  2G78 A;  4COT A;  1BSQ A;  3P02 A;  2WEX A;  3D97 A;  4TLJ A;  3F8A A;  3WOV A;  1GKA B;  3PQS A;  3MBT A;  2ZAG A;  5FFH A;  3U0D A;  4AZR A;  4INN A;  5IO5 A;  1TOW A;  1X71 A;  4ON1 A;  1VYG A;  4ORX A;  1LF7 A;  2FR3 A;  2HNX A;  1Z24 A;  2OVD A;  5H9K A;  1JIW I;  5CYB A;  1TVQ A;  4WHI A;  3PED A;  2F09 A;  2ANS A;  5EDB A;  4ZGU A;  4CV7 A;  1S2P A;  2OVE A;  2GJ5 A;  3EBK A;  1ZNE A;  4RUN A;  1HBQ A;  1OPB A;  1SY0 A;  1MX7 A;  4MVI A;  4U8U N;  3VG2 A;  2L9C A;  4FBR A;  4YFQ A;  4TQ2 A;  4YMY A;  5LJK A;  1YIV A;  4UU2 A;  2BT9 A;  1ZNG A;  3EMM A;  5F1E A;  4WBK A;  4TKB A;  3CR6 A;  2KW1 A;  2NND A;  4N7C A;  3FA8 A;  5HZ9 A;  3VG7 A;  3CWK A;  1GKA A;  2O62 A;  3SAO A;  4EDE A;  4WFV A;  3B2I A;  2X45 A;  1DZM A;  4GET A;  1BBP A;  3BU9 A;  2FRS A;  3APX A;  2Q2M A;  3WJE A;  1B4M A;  1RLB E;  2MWH A;  3KFF A;  3PP6 A;  3FW5 A;  1JBH A;  4ZFX A;  1T68 X;  1U17 A;  4TKJ A;  5HCE C;  4O3W A;  1AVG I;  3TGA A;  1KT5 A;  1OPA A;  3F9D A;  5HZ5 A;  5BVT A;  5KIC A;  2IFB A;  4KT5 A;  4O3X B;  4ML7 B;  1BLR A;  4ES7 A;  3IFB A;  3VG4 A;  1EPA A;  5EDC A;  2GTF X;  1L6M A;  3N91 A;  4UU3 A;  1FEL A;  1AB0 A;  1QG5 A;  1URE A;  5AQ6 A;  5IO6 A;  2FLJ A;  1GM6 A;  1S7D A;  1X89 A;  4QYP A;  3ZW2 A;  3GAQ A;  4Y0S A;  5FQ6 E;  4AZM A;  1QWD A;  4NNS A;  3ZW1 B;  1SY3 A;  2OFM X;  3B2K A;  1B56 A;  1O1U A;  1U0X A;  3D95 A;  3ZQ3 A;  4YFR A;  1IFC A;  2BHV A;  1ALB A;  4QNI A;  3NQ9 A;  5B27 A;  2Z4I A;  2P8G A;  4K19 A;  5F7G A;  3FR2 A;  4EFG A;  1HQP A;  1HMT A;  3BU1 A;  1IKE A;  4IMN A;  3NR3 A;  3P6H A;  3FLL A;  5D4A A;  5LJH A;  2OZQ A;  2X8T A;  3CQN A;  3CBS A;  2NNE A;  1JJX A;  4U8U M;  2ZAI A;  4OMX A;  3BDR A;  3NPO A;  1KT6 A;  4KH8 A;  3VG6 A;  5HBS A;  1EXS A;  2POA A;  3O2Y A;  3UEW A;  2LBA A;  1YWC A;  2RQ0 A;  3C76 X;  4YKO A;  3FIQ A;  4YFP A;  1ACD A;  3HOE A;  2KD2 A;  2AT8 X;  3HWE A;  4MIR A;  2AT3 X;  3APW A;  2HLV A;  4ZGF A;  3APV A;  1R0U A;  3WJD A;  1ML7 A;  4FQB B;  2LBV A;  1IFB A;  1GT5 A;  3WVM A;  3TZS A;  4IAX A;  1A18 A;  4KC8 A;  1Y9T A;  1YUP A;  1U18 A;  4QZU A;  1QFT A;  2WSJ A;  4ORW A;  4I95 A;  4A8Z A;  1GT3 A;  1H91 A;  1KQX A;  3OE3 A;  1JYD A;  4U3Q A;  4ZHD A;  3FR4 A;  1PMP A;  4GNY A;  5F6Z A;  1RBP A;  1O1V A;  4A1Y A;  1OBQ A;  2E4J A;  1OBU A;  5HAE A;  2ASN X;  4GNW A;  4M7M A;  2X8F A;  4YGG A;  2JN3 A;  3JSQ A;  4QZT A;  1A3Y A;  4I9S A;  1SXW A;  1CRB A;  2CZU A;  2AT6 X;  3MVF A;  4XMG A;  2QOS C;  3KFH A;  1T0V A;  1JYJ A;  1DZK A;  3LHN A;  1QY2 A;  1ZRY A;  3WJG A;  4TJZ A;  4NW4 A;  1T8V A;  1ADL A;  2FT9 A;  4L3R A;  2GTL O;  4O3Y A;  1FDQ A;  3CQR A;  4HPD A;  3VU1 A;  2MJI A;  3RWX A;  2LKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...