3KQ4A

Structure of intrinsic factor-cobalamin bound to its receptor cubilin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
393
structure length
385
Chain Sequence
b'SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gastric intrinsic factor
publication title Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 114
structure length 385
sequence length 393
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3kq4A01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3kq4A02
2H6GB 3E33B 4GTSB 3HXEB 1H36A 4M76A 4GTVB 2WY8A 2SQCA 1O6QA 1TNOB 1N4PB 1N95B 1TN7B 3PZ3B 1KZOB 1QBQB 1DCEB 2V8JA 3DRAB 3HXBB 1H3CA 3HXCB 1W6JA 2PMVA 3DPYB 1GXMA 3DSTB 3SFYB 1H3AA 2V3NA 1O5MB 4LNVA 3RJ3A 4GTQB 1GXNA 5JPMB 1GSZA 3E32B 3PZ4B 3PZ2B 2BB5A 4ONTA 4YDOB 3SFXB 1KZPB 1SA5B 3DSXB 1HZFA 3DSUB 2B39A 1GHQA 1W6KA 3Q75B 4MBGB 3C72B 4KKJA 1D8DB 2V3PA 1JCSB 1SA4B 1LD7B 4BOKA 1NI1B 1O79A 1JCQB 2IEJB 4GTOB 4MU9A 3DSVB 4V1RA 3KLSA 2WY7A 4L9PB 2NOJA 4GTMB 4D4CA 1GXOA 1N4RB 2ZISB 4ZRPA 3D5RA 5AGDA 1TNYB 3U7ZA 1D8EB 1H37A 1FPPB 3E37B 2WINB 4ZRQA 3EU5B 3KSQB 1QSJA 2V8IA 1O6RA 2ZIRB 1UMPA 1O6HA 2H6HB 1TN8B 1H39A 4LNBB 2V8KA 1TNBB 5FO7B 5FOBB 3Q79B 5JPNB 3DSSB 4KKIA 4D4DA 4EHMB 3HXFB 1N4SB 2A73B 3D5SA 1S63B 1FT1B 1C3DA 1O1TB 3K7XA 3Q78B 3PZ1B 4FXKB 3HXDB 1N9AB 4D4AA 2H6IB 4YDEB 1TNUB 1O1SB 2H6FB 2XQWA 3Q7AB 3KSLB 3KQ4A 2F0YB 2PN5A 2GOXA 2WIIB 1TNZB 3E30B 3Q7FB 4GTTB 4C1SA 2BBCA 1JCRB 4FXGB 2XWBB 3OXUA 1N94B 2BB6A 2G02A 2I07B 1R76A 1X81B 2R2LB 1MZCB 1LD8B 1O1RB 3DSWB 3CU7A 4BOJA 4LNGB 2BEDB 1TN6B 3G6JB 4GTPB 5FO8B 4V1SA 1H3BA 1LTXB 2G0DA 4GTRB 2XWJB 1S64B 1H35A 3Q73B 3E34B 4D94A 3EUVB 3SQCA 4ZH1A 1SQCA 4D4BA 1N4QB 3OEDA 1FT2B 1QQFA 1NL4B 5FO9B
chains in the Genus database with same CATH superfamily
2FNJB 3DPDA 2VN4A 1YN4A 1HXAA 4ZRIA 1TNOB 2LXCA 3VQIA 3X0WA 1C3TA 1TJEA 1G9JA 3AE6B 1DOGA 4MH8A 3WKHA 3GS2A 4YSXB 2PMVA 1GXMA 2KVZA 5CD2A 3AE2B 3VH3B 1GXNA 3CIRB 2DX5B 4MGYE 1UG9A 3SFXB 1WRDB 3W1SC 4W9IA 1WM3A 1LXDA 3RX5A 3WIMA 1JCSB 2LGYA 2L76A 3Q8AA 3IHPC 1FM0D 2IGHA 4KDLB 2KFJA 1QILA 1YQ4B 2KT7A 3IBEA 2ONHA 2NOJA 1L7YA 3WIQA 4ZRKA 1VJKA 5BMGA 3R7QA 1P0RA 3DBLB 4ZYSA 1Z5SB 3OG5A 4BKSD 4ARCA 1CQVA 1IA6A 3SFEB 4DK5A 3FAHA 3W7UA 3GLYA 2AYOB 4GDKB 2ZW0A 4ICVA 1KSCA 3U8ZA 4HRSA 2M8SA 3APCA 3H7LA 1SSNA 3V6CB 3WIRA 1TT5B 3ALBA 3W5NA 1MG8A 1EO6A 4K81A 3VRAB 1TNZB 1GG3A 4IG7B 4JQWC 1JCRB 3CF6E 3ZJUA 1YQBA 2DZMA 3DWGC 1WRIA 2QJLA 1F9JA 3K9PB 4B6WA 2RDGA 2MBBB 1C1YB 2D5JA 1VZ6A 4CJ0A 2K8BA 3PO0A 3BYTB 1KRHA 2O6VB 3SEBA 1JRPA 1WZ0A 1HXGA 2MQJA 5C05A 2AFAA 4K1RB 1UGJA 4KGSA 1WGYA 2C7MB 4ASWC 4HVBA 5E6OA 3A33B 2BKRB 3W5VB 4KZ0A 1QQFA 3DQVA 1D5XC 1H8CA 3H3KA 1E0ZA 1RWHA 1MG4A 4EUTA 4MM3B 3VXWA 1RYJA 4RGNA 4MT5A 2V3SA 1KLGD 2PEAA 2RD0A 3CSTA 4LDTD 4KSLC 4L0GA 1V5DA 3W7WA 4LNKA 3EQAA 4OZCA 2UYZB 2MJEA 5DCNA 4LJOB 2JF4A 2L32A 1MHXA 2JPHA 2EMTA 1H13A 1T0QC 4GN1A 1UBIA 4NQLB 4E74A 3H7PA 2KTRA 3BIID 4URKA 3R2IA 3X17A 3N30A 3M63B 1WF9A 3M7CA 4XUVA 3KW5B 4ZRQA 2MJDA 5D2MB 4C56C 4GXBA 1O6RA 4W9KA 2KFKA 4FBJB 3HIZA 3QJZA 4MEMA 1TN8B 4LNBB 1UF0A 2EACA 3Q69A 1LQBA 3DSSB 2JXTA 2KN5A 4F10A 3AFJA 1SE3A 3AE9B 4W9EA 3K7XA 1HEZE 5JMDA 2JZPA 4JE3B 2JYTA 1A70A 1ZUD2 3GZKA 2XN9C 1GB4A 1OJMA 1D4BA 2GH4A 1TS5A 3TBLD 1GC6A 4C1SA 4YCRA 4G3XB 2INPE 2ZZPB 4RGTA 2EADA 4AOFA 2FCMA 5E6NA 1GC7A 2GBMA 3Q3MC 5TSSA 1X1MA 2RGKA 5M7IA 2REXA 3TL5A 5EASA 2ZCBA 1T0SC 3ENEA 2I1KA 3VR8B 3PZ7A 3S9VA 1UUPA 1WM2A 2JU6X 4IUMB 3E34B 5GY3A 1HM3A 3LYYA 1L2NA 2BPSA 1WGGA 2GBJA 3PLUA 3DBSA 1V8CA 2E24A 3ZDTA 3M77A 1XXGA 1L0VB 4ZHPA 2J0KA 2LHEA 2MWSB 4RGOS 4EE2A 1RWAA 5D6JB 1D3ZA 1V1PB 2CHXA 3EA6A 2VH2A 1QAZA 2C60A 3RZWC 2R2QA 4BOZB 4A55A 2MW5A 3HVDA 3EZ8A 3PYAA 2V4LA 1H3CA 3HXCB 5ILKA 4M0WA 3DSTB 1OJOA 2BYTA 5JPMB 3M01A 4ONTA 1KZPB 1FO3A 1HZFA 1HCUA 3RNGC 3VUWA 5IL8A 2KN4A 5KKBA 1V49A 1LD7B 1F9OA 2GOWA 2IEJB 2KWUB 2LRUA 1OQQA 4DHZE 1RWCA 2KYWA 4OVZA 2NTTA 2QDFA 4WQOB 4EKUA 2Y5BB 2DWQA 3ZTCA 3ZXRA 2KDEB 2CHZA 4GMVA 2SEBD 2JRHA 5DPTA 2DROA 3AE8B 4GDLB 1C82A 3T9LA 3ONSA 2JZ3B 4D4DA 2BWFA 1LOHA 3HXFB 3OWEB 4RM9A 4TQ0A 2WXGA 2VZKB 2D11A 4ZOHC 4N58A 1IP9A 5IM1A 2K3UA 2M17A 4I6PA 1QQRA 1N7PA 1T0RC 3VH4B 4NZLB 4PYUA 2ZVNA 2WXRA 2DZKA 3P4QB 2N9EB 2LVQA 3AV8A 3DBHI 3PSEB 3ON6A 2WXKA 5CHVC 2LWPA 1I8QA 3L0WB 2ZPYA 1N21A 1GB1A 1ZP0B 3C0RB 4P1CC 3ML8A 5IK6A 3VVWB 1TN6B 3AMZA 2WP9B 3CWIA 1KM7A 5T8IA 4D2KA 2KDFB 1TIFA 3LDZE 2O2VB 1I4PA 4WWNA 3V3XA 3NNBA 2X03A 1WX7A 4JWUC 2BS4B 2QHOA 1IS9A 1I4QA 1MPEA 3Q3FA 2D3GA 3W5MA 5CX3A 2BRVX 2EKIA 3DHGC 4W9DA 1TKYA 3QG0A 1KKTA 4PS3A 5IK0A 3ANJA 4MJSB 3W7XA 3BYYB 4BBNC 1TF4A 4C00A 4AJWA 2WXPA 1F9DA 5GXGB 2NPTA 2PVGC 1GSZA 1XW2A 1S3SG 2N1WA 1V7VA 3MC8A 2J7QB 4WQMA 2Y5CA 1HMUA 4BBNF 5LNK1 1OJNA 2KAJA 1ZDXA 1V5TA 3R3MA 1C4AA 4PS7A 3TF4A 2IO2B 4WJQA 4IM3A 3QXQA 3KLSA 1DGJA 5L95C 3P5PA 1P7EA 4GU2A 4FLHA 2HTME 3BY4B 4FUSA 1OTRB 3R66C 3NVYA 3WALA 3KSQB 1QSJA 1EWCA 2K6DB 4YTNB 3DWMA 1O6HA 4TSSA 5JXVA 2XK5A 2JUOA 1TNBB 5FOBB 3QHTA 1KFYB 1J19A 2AWTA 4EHMB 2N1VA 2NR2A 4IWQA 3AU4A 2RR9A 1H12A 1FPYA 5JHBA 2Y5PA 2PLPA 1WWTA 3BVMA 3AN1A 1SIJA 1XCQL 2HE7A 3PS6A 1TS3A 1A5RA 1QF6A 3M95A 3VTUA 3E9SA 3V61A 5CZLA 1EU3A 4ANVA 1N94B 2BB6A 4Q2BA 3M02A 3RSYA 3UGBB 4HROA 1FCEA 2BS2B 2W9NA 2ZCCA 3RX7A 2JSVX 2MBQA 3GZNI 5G2NA 4V1SA 3I3TB 4C7ZA 4QT9A 1DOXA 1E8YA 1N62A 3L54A 3OLMD 4D94A 3TEWA 3D3IA 2MP2A 1HM2A 3NZ3A 5BYRA 4BKSA 3WA0A 1EU4A 5HG2A 1P7FA 3VDZA 2E22A 3LXFA 1GAHA 4S0RA 1STEA 2FUHB 1ENFA 3KUDB 3HVZA 2FBAA 5FR3A 1DOYA 1C4PA 4W9GA 2V3NA 4DHJD 2DYBA 1N22A 3AE3B 1RQ5A 3PZ4B 1IGDA 2YVCA 3ETRA 1FNUA 3RENA 3E73A 1WU5A 3AB5A 4YWGG 1SB3C 4A3OA 1SA4B 3RNFC 2AHFA 1V81A 1CJEA 3PT2B 1E10A 4GB9A 4QAYA 1CEMA 2AEHA 4XGAB 2FAZA 3EC8A 4GTMB 1N4RB 2JT4B 4KTRA 2W55A 2CS4A 1P3QU 2GI9A 1RWSA 2BRPA 3ZGZA 2RDBC 1H37A 4IWOA 1RAXA 1JS4A 1ZE3D 4IM0A 1UNSA 1H39A 3AE1B 2BGFA 3VUYA 2NBVB 2JXXA 1WU4A 3M75A 4YSYB 5BYQA 3MC9A 4FXKB 1ZPSA 1HZ5A 3P2BA 2YEPF 2KC2A 2Z0DB 1AYXA 3Q7AB 5IKCM 2J5CA 2GOXA 1E7UA 2YEPB 3J9CA 3E30B 2M4NA 3Q7FB 4GTTB 1VR9A 2L8JA 2YLMA 1SEBD 2V1YA 4FJYA 4OVUA 1UZXB 3G4DA 3B1LX 2UU7A 2KD0A 3M62B 3P4SB 1TKEA 3ZRFA 1MHHE 2J0MA 1Q1OA 1G9GA 2LGSA 5IP4D 3OJ3A 5FO8B 4XYCA 3MJ5A 4MH0E 5H92C 1XWQA 3H7PB 2K22A 2W3SA 2KTRB 3PZDA 3UF8A 4D4BA 3ABVB 2L05A 4AS1A 1I7HA 1HE8A 4YXDB 3ZRCA 1ZGUB 3KYDD 2BYEA 2WXQA 2KFKB 1AW7A 2VH1A 5KHOA 3HXBB 3N3KB 1T0YA 2R61A 3L10B 1GPXA 4GTQB 4WU0A 1V1OA 1WJ4A 4YTMB 3VR9B 3ZLZA 3R8BA 5EDSA 4XWTA 1RRBA 3P63A 4DOEA 5JZEB 3C8YA 4WURA 3ZNHB 2JRIB 1JCQB 4DQOC 3PHWB 3RNBC 2DYOA 1JALA 2WDAA 4J5TA 4GL3A 1TY0A 4L9PB 1GNUA 1H14A 3AULA 3RMKC 5AZHA 1L0XB 4PYZA 3WANA 4MSQB 3TCAA 4DWFA 3PREA 4ANWA 1FPPB 4JIOU 2ZNVC 3KYCD 4HKQA 4HXDA 3M76A 1UMPA 4E1YA 5CTRC 1WXSA 2WYNA 5CHFA 2L7RA 2D2QA 2BQQA 3PRMB 1N4SB 4A20A 1KS8A 1C3DA 1V2YA 2ZNVB 4MGIE 3WKFA 2K6QA 4RF0A 1N61A 3V62A 1YN5A 4M0WB 4MELA 3SD5A 1SE2A 3BWUD 3V05A 3GT5A 3VXDA 1FAEA 4N59A 3DOWA 4II2B 2K25A 5FK9C 2D8LA 2LRWA 4ANXA 5ILHA 3BINA 2DENB 2XBBC 1ULVA 3V6EB 2R2LB 1KREA 3CU7A 1G87A 4BOJA 2A4ZA 5MPOA 3V60A 2W3RA 2M19A 4DODA 3RN9C 3PLVA 1ET9A 2H88B 1HX9A 1VCBA 2NVPA 2BYVE 5J18A 2DYMA 1N7QA 4AYRA 3SAEA 2VRRB 3S2AA 3CSFA 1NL4B 3H7SA 3JVZX 4HK2A 4M76A 3AEEB 1OQYA 2LGXA 1R4NI 3QFZA 2I1JA 3HK0A 2L83A 2H89B 3DPYB 1H3AA 3EU8A 4NNJB 1SJHD 1OEYJ 3SHQA 5EE1A 2A8ZA 4W9CA 1V5OA 4MBGB 3HM3A 3DVGX 3KH0A 4M02A 1J7BA 1QOBA 3L13A 1N5XA 5JH5C 1YN3A 3E6UA 1F2RC 3W7TA 5IO9A 4MU9A 2G45B 4IDIA 4EOYA 1QT9A 1V80A 3A0OA 2Z07A 3FILA 1J7AA 1FBOA 1OEYA 1NI2A 2A5UA 3WAMA 5KHQA 1VRAB 2L0FA 2KMMA 4XWWA 2JWZA 4GGQA 4HWIB 3A1QA 3ZIMA 4OK4A 1V6EA 1ZDVA 3MHSD 4HKZE 2IZVB 1K51A 2JVCA 1YNTE 1CK1A 3LB8C 3QCAA 3QX1A 1SF0A 2M56B 2V9HA 2RPVA 3N1YC 3IT4B 4FJVB 2KX0A 1OQRA 2RSUA 4NAWA 5FO7B 1YD8U 1WU6A 4TQ1A 2ZEQA 1K72A 1RWFA 1UD7A 1P98A 3Q78B 4RH6A 1PUTA 3QC8B 3IAS1 1AYFA 1Y8RC 1O1SB 4Z4LA 3H8HA 4HJKA 1L4ZB 2GZ6A 4N9F4 2NPTB 4NY0A 3QRYA 4ZHOA 4ITKA 4ZDVA 4MMHA 2HDEA 1QOGA 2CHWA 3M3JA 4K7SA 1D5ZC 4L23A 4I6NB 4KGRA 1N1BA 4IKGA 2IBIB 1WXVA 2WDVB 3T3NA 2G4SA 3IFWB 4YSZB 1FNWA 3APDA 2ACZB 2EAEA 1OFFA 3AECB 2INDC 2XK5B 1HTQA 1KZOB 2V8JA 1FO4A 3GE3C 5L83A 2DZIA 4ZH5A 4NPNA 1WE7A 2MBEA 5TR5A 2KNBA 4GIVA 1UWXA 4KGTA 1XLOA 1YIWA 2WLBA 2WDQB 2J4XA 3SDVA 4GAXA 3DHHC 5D3IB 1XLNA 2JF5A 2JJBA 2EMSA 4BFRA 2G3QB 2WYQA 1E9MA 1EM7A 4PT5A 2DAFA 3I63C 4LIXA 1NEKB 1E7VA 3D32A 3PRPB 4JLCA 1WZZA 4ICUA 4OJZA 1TYGB 1L1YA 2BS3B 5E6PA 1IGCA 1WXMA 2KVRA 3T33A 3PMMA 1WFYA 1WY8A 3ML9A 1J7CA 2KJ6A 2MP2B 1ET6A 2LHDA 3RCZA 3W1SA 2MHJA 2OJWA 2MA9B 2K5PA 3AU5A 1EF1A 3HXDB 3GE8C 2NS5A 4A6QA 2KX3A 5HI1A 3TJPA 1CB8A 1E90A 1WGKA 3CMMB 5C2TB 3O13A 4DBGA 2J52A 2QIEB 1TZOA 1AN8A 1X1IA 2GBRA 4K3CA 1DL2A 3DVNV 2UWQA 2G02A 1LXMA 1FXIA 3WKIA 1PQSA 1JWMD 3KVFB 2G1EA 4MSMB 3DSWB 3QK0A 4RNAA 5DGQA 2WX0A 3AE5B 2I2YA 1MI0A 4A9AA 1OJPA 3AH7A 4DDGD 3KLSX 2ZPNA 4C80A 5IKHA 2AL3A 3K11A 2AL6A 4WVAA 2Z8LA 3QSPA 4P7IA 2FUZA 2H6GB 2TSSA 4HDOA 1T5XD 1TS2A 4TXTA 4XDDA 5LLIA 3W1YA 1Z2MA 4P6VF 2PTLA 2SQCA 1MJDA 1V7XA 3UQBA 1N95B 1TN7B 4MMIA 1EUVB 3EECA 2KTFA 3RJ3A 4RNQA 3NHEB 4BKTA 3VRBB 3EUB2 3DBHB 4Q2JA 1SBBB 2M1MA 4DI5A 2J42A 2MBOA 4KTPA 1YQ3B 2KC1A 4S17A 5C1ZA 2WXJA 3RULA 2WXMA 4DDID 2B3AA 1UGMA 2WDRB 3SFDB 1WYWB 4ZRPA 4LCDE 5ILJA 1TNYB 3M78A 2KHWB 2WWZA 4E71A 2PE6B 2LUEA 2LGIA 1F1SA 4DXGA 2WINB 4ZG8A 2Y3AA 4HDQA 2H6HB 1M94A 3TEXA 2D3CA 4WWMA 5DPWA 2K8CA 2WXNA 4OW0A 1XEEA 3A4SC 2KWDA 3B2FA 4OZBA 3FC4A 2IY0B 1LFDA 2G9HD 3RD2A 4AWJA 4US9A 2XQWA 2F0YB 2WIIB 4AP4C 3DDCB 2DAJA 4LDTB 5D7GA 3SDRA 4WJPA 2NTSA 3QIJA 5BMIA 2D07B 3A4RA 4WVBA 3OXUA 2ONGA 1I4HA 2RGFA 4LK0M 1WX9A 3I5JC 2P0VA 2J53A 2AQ2B 5DHIA 1H3BA 2G0DA 3N0GA 1CLCA 3JW0X 4ZRJA 1Q10A 2XWJB 1S64B 2PVOD 3AEFB 4ANUA 3WCQA 1R7SA 3ZXVA 4ZH1A 4P16A 1L5PA 1FT2B 3W9CB 3QDEA 2KLCA 2RMMA 2PPHA 5G5HA 5HHDG 3BVZA 2D5GA 4GTVB 1ZKHA 4EZJA 3ZNGC 1WZ3A 5LXIB 3Q8FA 2YIKA 1V5CA 2MBHA 4NJCA 4LLGM 3E80A 1FP3A 3ANKA 3NS8A 1O5MB 4LNVA 2LJ5A 3H1UA 4AJYB 4CHKA 5JHAA 3CIHA 1W6KA 2JY6A 2N7EA 1F52A 2IGDA 1QKZA 1W3YA 3N9YC 2AX5A 4JX1C 3H2WA 1E5WA 2WXOA 1VD5A 5M7YA 2WU2B 1K8RB 2CU1A 3RNCC 2KO3A 3GZNB 2O6VD 3PYBA 1PDXA 1JROA 2WXLA 3G4FA 4GOCA 4BZAA 1FD6A 5IL3A 5JMFA 3VFKA 4ARIA 3KWLA 4XZ4A 3P4RB 1PGXA 5ILYA 3AE4B 3B9JA 3WUXA 2JYEA 5BMHA 4ACFA 2KWVB 4KV2A 2KQSA 2PW9A 1JCKB 3QARA 4REZA 1N20A 3L08A 1QZEA 1XLQA 3VTWA 3AEDB 3NG0A 1HN0A 5AZGA 2KMAA 3P42A 1J0MA 2N7JA 3PV1A 2L52A 3DBRI 3ZJVA 1WSPA 1GUAB 2Z59B 5IN7A 4JPSA 3VHTC 4Q88A 1X1HA 2ONQA 2HD5B 3BZDB 2IO1B 1HZ6A 1PGAA 4BKGA 4IC7B 2LXAA 4YDEB 1KFGA 4DXAB 3T8MA 1FMIA 3DCGA 2KXJA 3N1XC 4AYQA 2IPKD 3RRSA 2FCSA 2ZJDA 3R7RA 3NJTA 1RWGA 4L6XA 1YX6B 4FXGB 2FUTA 3M7EA 1D6EC 4IM2A 2WU5B 4L1BA 2D3AA 2HJ1A 4NJ6A 1RW9A 4LNGB 3Q8BA 5EAUA 4KZCA 2RI8A 4OZVA 5J17A 1LTXB 1NYQA 1R4MI 1TZ1A 3FILB 3QWZB 3ACTA 2G4DB 1WGHA 1C9FA 4EZKA 1SXTA 3NZUA 4HLEA 2KDIA 1L0YB 1HMWA 1V86A 2V4IB 1H36A 3U4EG 1BXTA 2M0AA 4NAWB 1DCEB 2PJHA 4PK1A 1XO3A 3SDUA 3U30A 5DPSA 2GRIA 1WX8A 4YDOB 2BB5A 4FA6A 4TUUA 4I6LB 4US8A 1ESFA 2JQRB 3VSMA 4DXFA 4W9JA 4LNFA 3RX8A 3MP9A 2N9KA 3RUIB 1WGDA 2E3TA 4V1RA 5C23A 2LVPA 1EGUA 4CQNA 5I4DA 3RZFA 2IDYA 3TSSA 3D5RA 4FULA 1LF6A 5AGDA 3JSVA 3S4AA 2L0TA 3AEAB 3U7ZA 1ISNA 2BT6A 2DHZA 1JWSD 3EGRA 1WH3A 2V8IA 3Q3OC 4FNVA 4WAAA 4WWPA 1GJZA 4KIKA 5IAAC 2DRRA 2W54A 2J0JA 3NOBA 2V8KA 2QEJC 3OJ4B 3HUIA 4RF1A 1NYRA 1IBXB 3S4BA 2KQ7A 1JWUD 3VTVA 3WAOA 4D4AA 4JWSC 3A3VA 5E6JA 2Q1FA 2LASA 1ROEA 1WR6E 2EELA 1GOZA 3N1ZC 1I42A 4XC2A 1C77A 2BVCA 1E7PB 1WMHA 1FEHA 2HTHA 1XWTA 4R3DA 4YTPB 4YL8A 2KDMA 3WC3A 2D10A 4M8MA 1R76A 4B95A 1L6VA 4W9LA 2W82A 2LI5A 4RM8A 2WDTB 2WX1A 2CQSA 5C3JB 1JWBD 5DGRA 4GTPB 4KDIC 2C7HA 5FKAC 2BRWA 1VZ7A 1K50A 2LUMA 3L4PA 1LF9A 1H35A 3DBLI 1SGHA 2QILA 1VZ8A 1UT9A 3VUXA 2K39A 1N7NA 1TY2A 2GB1A 1N4QB 3OEDA 2KJHB 2MRPA 2IYDB 1XF5L 3M74A 3P4PB 1WYGA 3HXEB 4X57B 3PVLA 2WY8A 2KMCA 2BWES 1O6QA 3Q6BA 1F0ZA 4N6EB 2WXHA 2K8HA 3IVFA 1IYFA 2VZKD 1J8CA 2LEKA 3DRAB 4TMAB 5D3DA 5G5GA 2B4FA 3SFYB 4WVCA 3LJ3A 4WWOA 2CKHB 3UI3A 3NS1A 2GLSA 2WS3B 3QWTA 1J0GA 1JWAD 4B0MA 3UIOB 3ZUNA 2KKCA 4M01A 1ZW7A 4G0NB 1SE9A 4O1NA 3DVNU 4G11A 1WE6A 1BMLC 4HEA1 1I35A 1S1QB 3PRZA 4D4CA 2D3BA 1TS4A 2ZISB 2ZVOA 2VN7A 5HFYA 3TEZA 4JGHB 3WIWA 1IUEA 2MJ3A 3L17A 3DHIC 1KWFA 4EEWA 2AHGA 2V0GA 1V9JA 2FIFA 2F6DA 3N32A 1HV6A 1KTKA 1KRFA 4CJ1A 2OEDA 1XLPA 3IG3A 4C4VA 1SIFA 4EFOA 2FV0A 1R4NB 1ZOYB 3E7JA 4PS8A 2KZRA 1LXKA 5CHWA 3SDTA 2ON8A 3Q14C 4F1SA 3Q8CA 4KSKC 3ZO5B 4K3BA 1YJIA 5AUIA 3X23A 1JW9D 3NRZA 2WNMA 4A8XC 1X9DA 4HJGE 4XE0A 1RM6C 4AYPA 2H6FB 3KSLB 4DHJB 5AUKA 1NDDA 3BVGA 2RI9A 2BBCA 1F2RI 1TKGA 4H2AA 1J0NA 4J3OD 1G6IA 1E8WA 1RLFA 1LD8B 2INCC 4FHJA 1N63A 1P1AA 3W2DA 2WXIA 5MEHA 1WR1A 3W5UB 3Q73B 2DNFA 4LNOA 1SQCA 2WGSA 1N7RA 3RFZB 4EZLA 2KOXA 2BF8B 2PIAA 2BTEA 2LMCA 2KANA 3PZ3B 4W9FA 5AEKB 1QBQB 2FCNA 4OK2A 2WHIA 3ZKJC 2QCZA 4HPMB 1WGRA 5IA7A 1NXCA 3MC0B 3A9JA 1KF6B 1L6UA 2DZJA 1WXQA 5G55A 1D8DB 2ZBLA 2IY1B 2NBWB 4WAFA 1FBWA 3KUZA 3M7LA 3DSVB 3MTNB 3M7BA 2KJRA 3I9V1 4FJQA 2K0PA 2MH7A 4K7UA 1D8EB 3O65B 2C9WB 3HRDD 3I57A 2I38A 3E37B 5EE9A 3ANIA 3A9KA 2BKFA 3T3OA 3U7DA 3IAM1 3N0FA 4ZYNA 3N20C 3RI7C 1I4XA 2SAKA 2QC8A 2C5LC 2JZZA 5D94A 5ILZA 1N23A 1I4GA 1N24A 1FT1B 1O1TB 1HA5A 3Q2AC 2E6XA 1N9AB 3LZ9A 1FMAD 4RMAA 2FUG1 2L3ZA 3HHMA 4HCPB 2MX2A 1YMHE 5H8YE 2NMQA 3PTFC 4DHZB 1KJTA 5IOIA 3BK1A 1D5MC 1NBFC 1IBXA 1C79A 1XT9B 1CMXB 3QAQA 5AZFA 1ZXHA 2XWBB 4YT0B 3UIPB 4CYEA 1X81B 2FUQA 1EF5A 1WI0A 1O1RB 2OOBB 2K1FA 1V7WA 3PZ8A 3ZW3A 5EE0A 1HQRD 1E6EB 4MGKE 3B08A 4GSWA 3EUVB 3VSNA 2CJNA 1XQQA 4L2YA 5GW7A 3ZNZB 1BT0A 1OGWA 4GDKA 2QNOA 1QOFA 3SDQA 1UWMA 1G6JA 4BOSC 3RT3B 3UQAA 4P1BC 1JRUA 4IW0A 1DYQA 1ZXIA 2LZ6A 4G50A 1WXAA 3RYTA 2DLBA 4Z4JA 4NJ7A 2GBNA 2N4FA 5DHKA 1KLVA 1LGRA 3AE7B 4RFBA 1SA5B 5FR6A 4CE7A 3ZVVA 1IPGA 3DSUB 3Q3NC 1Q5WB 3Q75B 3C72B 1X1JA 2MSED 4KKJA 3U52E 4TF4A 2KLGA 4B0EA 1XD3B 2X38A 4BOKA 1O79A 3VW5A 2N9PC 4GTOB 1N7OA 2N7DA 2O6VA 3SU8X 2WY7A 1FFVA 2XFGA 1EWYC 2NCNA 3WAPA 4AUQC 3QT9A 1YJ1A 2PKOA 1ACCA 3EU5B 1GAQB 1C78A 4FHKA 3NZSA 3GB1A 4LNNA 2FV1A 2Z0EB 4HPLB 1UELA 4OZAA 4JJJA 2R2OA 4B9KA 1Q0WB 3Q79B 3E56A 5JPNB 2WQYB 3DVGY 1E8ZA 3Q3JA 2XNAC 4IOIE 4MM3A 3NUHB 2RDHA 4MGZE 1GA2A 3PZ1B 5DPRA 3ECIA 4XDCA 3EFCA 1BUIC 3NVWA 4HCNB 4IWPA 4GLSC 3KQ4A 1KLUD 3ZYYX 1GAIA 3L16A 5ILDA 1NENB 2DBYA 2LGDA 2ZW1A 4A90A 3W7SA 3H9DA 1NC5A 1PYWD 4BAXA 1MZCB 1Y56A 1N5WA 4OHJA 4FADA 2FBWB 3R2TA 4MDKE 2CJOA 1SJED 1CZPA 2KK8A 4GTRB 3TUOA 2N0SB 3SQCA 1TGZB 2NVUI 3JSVB 4RGMA 2HJ8A 3QPFA 3AEGB 2QSDA 3EFUA 1HTOA 4GTSB 3JYUA 3MHZA 4F13A 2FIDA 4KIKB 4F7ZA 3AXCA 4EL8A 1N4PB 2IJ0A 1I4RA 3SDLC 3ZDMC 1YX5B 4AQ7A 4NAMA 1WIAA 1B1ZA 4C7YA 3M00A 3E32B 1LO5D 3PZ2B 4II3B 4UDUC 1HXYD 3FKYA 2RPQA 1FFUA 2MCNB 1UH6A 1WMHB 1FRRA 1C76A 4OVVA 3AEBB 3NFVA 4XX5A 4JL9A 1L4DB 3C19A 3S4CA 4FJZA 2M0XA 1K53A 1QLBB 2KWCA 3VAWA 3ZJTA 5BO4B 5ILIA 5EATA 3P5RA 2LVOA 4A3PA 2L1AA 4W9HA 1DOIA 3QQ8B 1FCLA 1V1PA 5GZKA 2EABA 1PGBA 1JQ4A 1KSDA 3QXFA 4LNIA 4WJOA 1T3QA 4NEIA 1TBEA 2DRQA 1FNVA 4E3CA 2A73B 2L00B 2CR5A 1N60A 4WH4A 1YJJA 1TNUB 4LJPB 3AFLA 3ZTDA 3HM6X 3WKGA 1MVKA 3B0AA 2PN5A 2ICIA 4OZWA 1N6ZA 3TEYA 5J2RA 2ZZRA 1TTNA 1VDVA 3TIXA 5CA3A 3PHXB 1T6BX 5GMVA 3ACSA 3RNAC 1FXTB 3SR6A 4FXCA 2OJRA 3B2GA 4K7WA 2BEDB 2KQ4X 4WIPA 2B76B 1FO2A 4KVGB 4TV3A 2OKXA 3PGEA 1NI3A 1U4AA 2MLBA 3AI5A 3GP7A 4GDLA 1FXAA 3TMPB 2CQTA 2XEWA 3P2CA 2MEKA 3DBRB 1L2AA 1SE4A 3E33B 5IK9A 4BVUC 3KUCB 4M00A 4C4VB 2Q5WD 4NQKE 1M4VA 2GMIC 3ZNID 3UINB 3AM9A 3QFYA 4J6IA 2FCQA 1W6JA 1AARA 5E2JA 2AQ3B 3P1MA 2JX5A 3GOEA 2BYFA 3ZQ4A 3DSXB 1WJ6A 2WCOA 1YOVB 2B39A 1F1HA 1GHQA 1UBQA 3IT6B 1QOAA 3A1QB 1PFDA 1E8XA 3NY5A 2V3PA 1N1ZA 3M73A 3OAWA 4KX6B 1NI1B 2INNE 1VD2A 1F77A 3RPFC 1FCCC 4USAA 1GXOA 1R4MB 2O2VA 4RCOA 4HPPA 4M8NA 1FIQA 4MACA 1H4RA 3S4DA 1RFAA 3KWVA 1JMLA 3MJWA 2EKEC 2ASQA 3Q8EA 2KDBA 4AYOA 3H6NA 2N9LA 1KOTA 3APFA 2ZIRB 2CU3A 1H54A 4CO7A 4MJSA 4KKIA 2KACA 1B9RA 3U2SC 2QMTA 3D5SA 1S63B 4WJNA 2N9XA 3M72A 5IKAA 1NVID 2LJIA 2AQ1B 3QA8A 3IXSA 1MFWA 4FN2A 2H6IB 2LD9A 2FE8A 2LFIA 3PPAA 1RFKA 1HXCA 1IA7A 2K9XA 1WJUA 3NVZA 2WXFA 5HKHA 1K52A 3A9JB 1FRDA 3K9OB 3QT3A 2NBUA 1GLMA 5EE3A 2IGGA 2I07B 2X8XX 1KH0A 3MFGA 1LM8B 1AWDA 1WJNA 1F9GA 1XCTL 1P9DU 2C7NB 2JWUA 3URYA 3G6JB 2OHFA 1C4CA 4TKNA 4LTUA 3EHVA 2DRSA 2PE9A 5BYSA 4F8CB 2IO0B 1V97A 2GBKA 3NVVA 3BK2A 3M71A 5LXHA 1VLBA 1AGMA 2BW2A 3RNEC 2JG0A 3A9KB 2IO3B 5FO9B
chains in the Genus database with same CATH topology
2H6GB 2PIAA 2TSSA 1T5XD 1GAHA 4TXTA 2VN4A 1STEA 1TS2A 1YN4A 3LXFA 4P6VF 1ENFA 2SQCA 2PTLA 1V7XA 2BTEA 1TNOB 2LMCA 3VQIA 3HVZA 1TJEA 1N95B 1TN7B 2FBAA 3PZ3B 5FR3A 1G9JA 1QBQB 3AE6B 1DOYA 1DOGA 1C4PA 4MH8A 3WKHA 3GS2A 4YSXB 2PMVA 1GXMA 2V3NA 5CD2A 3RJ3A 3AE2B 1GXNA 3AE3B 3CIRB 1RQ5A 3PZ4B 1UG9A 3VRBB 3SFXB 1NXCA 1IGDA 3MC0B 3EUB2 4Q2JA 3ETRA 1FNUA 1SBBB 1KF6B 1L6UA 3RENA 3E73A 1WU5A 1WXQA 3AB5A 4YWGG 3RX5A 1D8DB 2J42A 1JCSB 1SB3C 4KTPA 2ZBLA 1SA4B 3Q8AA 1YQ3B 1FM0D 2IGHA 4WAFA 2AHFA 1FBWA 1CJEA 1E10A 3M7LA 1CEMA 3DSVB 2WXJA 2WXMA 2WDRB 1QILA 3M7BA 1YQ4B 5BMGA 3SFDB 2NOJA 4GTMB 3WIQA 1IBXB 1N4RB 4ZRPA 1VJKA 4KTRA 3I9V1 2W55A 2K0PA 1TNYB 3M78A 2GI9A 1RWSA 1D8EB 2MH7A 4ZYSA 3ZGZA 3HRDD 1H37A 3I57A 2I38A 3E37B 2LGIA 5EE9A 4DXGA 1JS4A 2WINB 3ANIA 4ZG8A 1ZE3D 2Y3AA 4ARCA 3T3OA 1CQVA 1IA6A 3IAM1 3SFEB 2H6HB 1I4XA 2SAKA 1UNSA 3FAHA 3TEXA 1H39A 3AE1B 3W7UA 4WWMA 3GLYA 4GDKB 2ZW0A 1KSCA 1WU4A 1I4GA 2WXNA 4OW0A 1XEEA 1FT1B 1O1TB 3M75A 1HA5A 4YSYB 5BYQA 2KWDA 4HRSA 4FXKB 1ZPSA 1HZ5A 2E6XA 3B2FA 4OZBA 1N9AB 3FC4A 1FMAD 2FUG1 2YEPF 3H7LA 2G9HD 1SSNA 3WIRA 4US9A 2XQWA 1AYXA 3Q7AB 3W5NA 1YMHE 2F0YB 2WIIB 2GOXA 2YEPB 2NMQA 5H8YE 3VRAB 3BK1A 1D5MC 1TNZB 3E30B 3Q7FB 4GTTB 3SDRA 3J9CA 5D7GA 1VR9A 1JCRB 2NTSA 3ZJUA 3DWGC 1IBXA 1SEBD 5BMIA 1WRIA 1C79A 4WVBA 1ZXHA 2XWBB 3OXUA 2QJLA 1I4HA 4YT0B 2RDGA 1X81B 4LK0M 2D5JA 1VZ6A 2P0VA 1TKEA 4CJ0A 1MHHE 1O1RB 2J53A 3P4SB 1V7WA 2AQ2B 3PO0A 3PZ8A 5EE0A 1G9GA 3BYTB 1KRHA 3SEBA 1HQRD 5FO8B 1JRPA 1E6EB 1H3BA 2G0DA 1CLCA 3MJ5A 5H92C 1Q10A 2XWJB 1S64B 2PVOD 1XWQA 3AEFB 3EUVB 2K22A 2AFAA 1R7SA 2W3SA 3WCQA 4ZH1A 2CJNA 1UGJA 4KGSA 4D4BA 3ABVB 4L2YA 4P16A 5GW7A 1L5PA 3W5VB 1I7HA 4AS1A 1FT2B 3W9CB 1QQFA 2QNOA 4YXDB 3QDEA 1QOFA 3SDQA 1UWMA 1D5XC 2RMMA 5G5HA 5HHDG 2WXQA 3BVZA 2D5GA 4GTVB 3H3KA 1DYQA 1E0ZA 1ZXIA 3Q8FA 2YIKA 1AW7A 1V5CA 2DLBA 3HXBB 4LLGM 4Z4JA 4NJCA 5C3JB 1FP3A 3ANKA 4MM3B 1O5MB 4LNVA 1RYJA 2R61A 4MT5A 4RGNA 1GPXA 4GTQB 4WU0A 1KLGD 3AE7B 1V1OA 4RFBA 1SA5B 4YTMB 3VR9B 4CE7A 3R8BA 4L0GA 3DSUB 1V5DA 3CIHA 1W6KA 3W7WA 3EQAA 3Q75B 4XWTA 3C72B 2IGDA 4OZCA 4KKJA 1QKZA 2MJEA 3P63A 3U52E 4DOEA 2AX5A 3N9YC 4TF4A 2JF4A 4JX1C 4B0EA 3C8YA 4WURA 2L32A 2X38A 3H2WA 4BOKA 1O79A 3VW5A 1JCQB 2WXOA 4DQOC 1VD5A 4GTOB 5M7YA 1MHXA 2WU2B 2DYOA 1H13A 1JALA 4J5TA 4GL3A 2WY7A 3PYBA 4L9PB 1FFVA 1JROA 1PDXA 1TY0A 2WXLA 1FD6A 2XFGA 1H14A 1EWYC 4ARIA 3KWLA 3P4RB 3BIID 1PGXA 1L0XB 3R2IA 3X17A 3AE4B 3QT9A 3B9JA 1FPPB 3M7CA 4XUVA 3WUXA 1ACCA 2JYEA 2PKOA 5BMHA 4ZRQA 2MJDA 3EU5B 1GAQB 4C56C 1C78A 2PW9A 1JCKB 4REZA 4HKQA 3GB1A 3M76A 1O6RA 1XLQA 1UMPA 2FV1A 3AEDB 4OZAA 2WYNA 4JJJA 1TN8B 4LNBB 3P42A 2EACA 3Q79B 3E56A 2N7JA 3Q69A 5JPNB 3DSSB 2WQYB 2L52A 2JXTA 2XNAC 3ZJVA 1WSPA 4IOIE 1N4SB 3AFJA 4JPSA 1KS8A 3NUHB 1SE3A 1C3DA 4Q88A 2ONQA 2RDHA 3AE9B 1GA2A 3K7XA 3BZDB 3PZ1B 1HEZE 3WKFA 1HZ6A 1PGAA 4RF0A 1N61A 4YDEB 1KFGA 1YN5A 2JZPA 4JE3B 4XDCA 2JYTA 1BUIC 1A70A 3NVWA 1SE2A 1ZUD2 3GZKA 2XN9C 3BWUD 4GLSC 3V05A 1FMIA 3KQ4A 3GT5A 1KLUD 3ZYYX 1GAIA 2GH4A 3VXDA 1TS5A 1D4BA 1FAEA 4AYQA 2IPKD 4N59A 4C1SA 3RRSA 1NENB 2DBYA 5FK9C 2D8LA 4YCRA 2INPE 4L6XA 2ZW1A 4A90A 4FXGB 3W7SA 1NC5A 4RGTA 2EADA 3M7EA 1ULVA 2R2LB 1D6EC 1PYWD 4L1BA 2WU5B 5TSSA 1MZCB 1Y56A 1N5WA 2RGKA 5M7IA 4OHJA 1KREA 3CU7A 1G87A 4LNGB 4BOJA 2FBWB 5MPOA 3Q8BA 3R2TA 2W3RA 2CJOA 2RI8A 1SJED 4DODA 2M19A 1LTXB 3VR8B 1ET9A 1NYQA 3S9VA 1CZPA 1UUPA 2H88B 3FILB 2JU6X 3PZ7A 4GTRB 3TUOA 3ACTA 2NVPA 2N0SB 2DYMA 3E34B 5GY3A 3LYYA 1C9FA 3SQCA 4RGMA 1SXTA 3QPFA 4AYRA 3SAEA 3AEGB 2QSDA 1V8CA 1NL4B 3M77A 1XXGA 1L0YB 1L0VB 4ZHPA 2LHEA 4RGOS 4GTSB 4EE2A 2V4IB 4M76A 1H36A 1V1PB 3AEEB 3MHZA 3U4EG 1BXTA 3EA6A 3QFZA 4EL8A 1N4PB 2M0AA 2IJ0A 1I4RA 4NAWB 2L83A 4A55A 3HVDA 1DCEB 3EZ8A 3PYAA 4AQ7A 1H3CA 3HXCB 4M0WA 2H89B 4NAMA 3DSTB 3DPYB 2BYTA 1XO3A 3SDUA 1H3AA 3EU8A 1B1ZA 4C7YA 1SJHD 2GRIA 5EE1A 5JPMB 2A8ZA 3E32B 4YDOB 3PZ2B 2BB5A 4ONTA 1LO5D 1KZPB 4US8A 1FO3A 1HZFA 1HCUA 1ESFA 2JQRB 4MBGB 4DXFA 2KN4A 4UDUC 3RX8A 3MP9A 1HXYD 2N9KA 5KKBA 1FFUA 1J7BA 1QOBA 1LD7B 1N5XA 1F9OA 1FRRA 1YN3A 3E6UA 2IEJB 3W7TA 1C76A 1F2RC 4MU9A 2E3TA 3AEBB 4IDIA 4V1RA 1L4DB 1QT9A 1OQQA 2Z07A 3FILA 4CQNA 1J7AA 3S4CA 1FBOA 2IDYA 3TSSA 5I4DA 3D5RA 1K53A 1LF6A 5AGDA 1QLBB 1VRAB 3S4AA 2KMMA 3AEAB 3U7ZA 4OVZA 4XWWA 3ZJTA 2BT6A 3P5RA 2L1AA 1ZDVA 2NTTA 1JWSD 1DOIA 3EGRA 2DWQA 4HKZE 2V8IA 1K51A 1YNTE 2SEBD 1FCLA 1CK1A 3LB8C 1V1PA 5GZKA 1GB4A 1SF0A 2DROA 2EABA 1PGBA 2M56B 3AE8B 2RPVA 1JQ4A 3IT4B 1KSDA 2DRRA 3QXFA 2W54A 4GDLB 1OQRA 2V8KA 5FO7B 1T3QA 2DRQA 1WU6A 4D4DA 1FNVA 4TQ1A 3HXFB 2A73B 2QEJC 1K72A 3HUIA 1N60A 3OWEB 4RF1A 1NYRA 3Q78B 4TQ0A 3S4BA 4RH6A 4WH4A 1YJJA 2VZKB 2WXGA 1JWUD 1PUTA 4ZOHC 4D4AA 4JWSC 4N58A 3A3VA 3IAS1 5E6JA 1AYFA 1TNUB 2K3UA 1ROEA 1O1SB 4Z4LA 1QQRA 1GOZA 2EELA 3WKGA 1MVKA 3H8HA 1L4ZB 4NZLB 1C77A 2GZ6A 1E7PB 2PN5A 2WXRA 3P4QB 2ICIA 3TEYA 1FEHA 1XWTA 3AV8A 4R3DA 3QRYA 4YTPB 2ZZRA 1VDVA 4ZHOA 4ITKA 3ON6A 2WXKA 2KDMA 5CA3A 3WC3A 1T6BX 2HDEA 3ACSA 1QOGA 1R76A 1ZP0B 1GB1A 1L6VA 4FXCA 2W82A 3SR6A 4XDDA 3B2GA 4WIPA 2BEDB 1D5ZC 1TN6B 2B76B 2CQSA 2KQ4X 2WP9B 3CWIA 1JWBD 3AMZA 5DGRA 4L23A 4GTPB 5T8IA 4KGRA 1FO2A 4IKGA 5FKAC 4D2KA 2OKXA 1VZ7A 1NI3A 1K50A 1I4PA 2LUMA 2WDVB 3L4PA 3V3XA 1LF9A 1H35A 3T3NA 2QILA 1VZ8A 1UT9A 3GP7A 1FXAA 2CQTA 4JWUC 2BS4B 3P2CA 1TY2A 1N4QB 3OEDA 2GB1A 2MEKA 4YSZB 1IS9A 1FNWA 1I4QA 1XF5L 1MPEA 1L2AA 3M74A 2ACZB 1SE4A 3P4PB 3E33B 3W5MA 2EAEA 3HXEB 1OFFA 1WYGA 2EKIA 2WY8A 1O6QA 3AECB 1F0ZA 2Q5WD 4N6EB 2WXHA 1TKYA 3QG0A 1M4VA 1KKTA 2VZKD 2LEKA 3AM9A 1KZOB 3QFYA 2V8JA 3ANJA 3DRAB 4TMAB 1FO4A 5D3DA 3W7XA 1W6JA 2B4FA 4ZH5A 3BYYB 5G5GA 1TF4A 4WVCA 3SFYB 5E2JA 2AQ3B 2WXPA 1F9DA 3P1MA 2JX5A 5GXGB 3UI3A 3NS1A 1UWXA 2PVGC 4KGTA 1GSZA 3ZQ4A 2WS3B 1XLOA 1XW2A 3QWTA 3DSXB 1JWAD 4B0MA 1V7VA 2B39A 1GHQA 2WDQB 2WLBA 3IT6B 1QOAA 4WQMA 1PFDA 2J4XA 2Y5CA 4O1NA 3SDVA 2V3PA 5D3IB 3M73A 1BMLC 4HEA1 5LNK1 2KAJA 1XLNA 2JJBA 1ZDXA 4KX6B 1NI1B 1C4AA 2INNE 3TF4A 1F77A 3QXQA 1E9MA 3RPFC 3KLSA 1EM7A 1FCCC 4PT5A 4D4CA 1TS4A 4USAA 1GXOA 2ZISB 4LIXA 1DGJA 4RCOA 3P5PA 2VN7A 5HFYA 3TEZA 1P7EA 1FIQA 3WIWA 1IUEA 2MJ3A 1NEKB 4MACA 2HTME 5EE3A 1WZZA 4FUSA 3S4DA 1KWFA 1TYGB 1JMLA 2AHGA 1L1YA 3KWVA 2V0GA 3NVYA 2F6DA 1KTKA 2BS3B 3KSQB 1QSJA 1KRFA 4AYOA 3Q8EA 4CJ1A 1EWCA 2N9LA 1IGCA 1XLPA 2OEDA 4YTNB 3DWMA 2ZIRB 3T33A 3PMMA 2CU3A 1O6HA 4TSSA 5JXVA 1H54A 2FV0A 1ZOYB 1J7CA 1ET6A 2LHDA 1TNBB 5FOBB 1KFYB 3W1SA 4KKIA 2KACA 1B9RA 4EHMB 3U2SC 2QMTA 3D5SA 1S63B 3SDTA 2ON8A 3M72A 2K5PA 1H12A 1NVID 2LJIA 2Y5PA 2AQ1B 3Q8CA 3HXDB 1YJIA 5AUIA 1JW9D 2PLPA 1WWTA 3IXSA 3NRZA 4A6QA 2WNMA 5HI1A 2H6IB 1X9DA 4HJGE 4XE0A 4A8XC 2FE8A 3BVMA 1WGKA 3AN1A 5C2TB 1RM6C 4AYPA 2LFIA 2H6FB 1SIJA 1RFKA 1XCQL 3KSLB 3O13A 5AUKA 1IA7A 1TS3A 2J52A 2K9XA 1QF6A 2QIEB 3NVZA 1TZOA 3BVGA 1AN8A 2WXFA 2RI9A 2BBCA 1K52A 1F2RI 1FRDA 3E9SA 3QT3A 1DL2A 5CZLA 1GLMA 1EU3A 1TKGA 2IGGA 4H2AA 1N94B 2BB6A 2G02A 2I07B 4Q2BA 3WKIA 1FXIA 1KH0A 3MFGA 1JWMD 4J3OD 1G6IA 2G1EA 3RSYA 1AWDA 1LD8B 3DSWB 4HROA 1FCEA 2BS2B 4RNAA 1XCTL 5DGQA 1N63A 3RX7A 2JSVX 2JWUA 3AE5B 3URYA 3G6JB 2WXIA 3W2DA 2I2YA 4V1SA 2OHFA 1C4CA 4C7ZA 4LTUA 5MEHA 4QT9A 2DRSA 3W5UB 1MI0A 5BYSA 1DOXA 4A9AA 1N62A 3AH7A 3Q73B 4D94A 3KLSX 1V97A 3NVVA 3TEWA 3D3IA 1SQCA 3BK2A 3M71A 4C80A 3K11A 3NZ3A 1VLBA 1AGMA 5BYRA 2BW2A 4WVAA 2JG0A 2Z8LA 1EU4A 3RFZB 5HG2A 3QSPA 1P7FA 2FUZA 5FO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6G B;  3E33 B;  4GTS B;  3HXE B;  1H36 A;  4M76 A;  4GTV B;  2WY8 A;  2SQC A;  1O6Q A;  1TNO B;  1N4P B;  1N95 B;  1TN7 B;  3PZ3 B;  1KZO B;  1QBQ B;  1DCE B;  2V8J A;  3DRA B;  3HXB B;  1H3C A;  3HXC B;  1W6J A;  2PMV A;  3DPY B;  1GXM A;  3DST B;  3SFY B;  1H3A A;  2V3N A;  1O5M B;  4LNV A;  3RJ3 A;  4GTQ B;  1GXN A;  5JPM B;  1GSZ A;  3E32 B;  3PZ4 B;  3PZ2 B;  2BB5 A;  4ONT A;  4YDO B;  3SFX B;  1KZP B;  1SA5 B;  3DSX B;  1HZF A;  3DSU B;  2B39 A;  1GHQ A;  1W6K A;  3Q75 B;  4MBG B;  3C72 B;  4KKJ A;  1D8D B;  2V3P A;  1JCS B;  1SA4 B;  1LD7 B;  4BOK A;  1NI1 B;  1O79 A;  1JCQ B;  2IEJ B;  4GTO B;  4MU9 A;  3DSV B;  4V1R A;  3KLS A;  2WY7 A;  4L9P B;  2NOJ A;  4GTM B;  4D4C A;  1GXO A;  1N4R B;  2ZIS B;  4ZRP A;  3D5R A;  5AGD A;  1TNY B;  3U7Z A;  1D8E B;  1H37 A;  1FPP B;  3E37 B;  2WIN B;  4ZRQ A;  3EU5 B;  3KSQ B;  1QSJ A;  2V8I A;  1O6R A;  2ZIR B;  1UMP A;  1O6H A;  2H6H B;  1TN8 B;  1H39 A;  4LNB B;  2V8K A;  1TNB B;  5FO7 B;  5FOB B;  3Q79 B;  5JPN B;  3DSS B;  4KKI A;  4D4D A;  4EHM B;  3HXF B;  1N4S B;  2A73 B;  3D5S A;  1S63 B;  1FT1 B;  1C3D A;  1O1T B;  3K7X A;  3Q78 B;  3PZ1 B;  4FXK B;  3HXD B;  1N9A B;  4D4A A;  2H6I B;  4YDE B;  1TNU B;  1O1S B;  2H6F B;  2XQW A;  3Q7A B;  3KSL B;  3KQ4 A;  2F0Y B;  2PN5 A;  2GOX A;  2WII B;  1TNZ B;  3E30 B;  3Q7F B;  4GTT B;  4C1S A;  2BBC A;  1JCR B;  4FXG B;  2XWB B;  3OXU A;  1N94 B;  2BB6 A;  2G02 A;  2I07 B;  1R76 A;  1X81 B;  2R2L B;  1MZC B;  1LD8 B;  1O1R B;  3DSW B;  3CU7 A;  4BOJ A;  4LNG B;  2BED B;  1TN6 B;  3G6J B;  4GTP B;  5FO8 B;  4V1S A;  1H3B A;  1LTX B;  2G0D A;  4GTR B;  2XWJ B;  1S64 B;  1H35 A;  3Q73 B;  3E34 B;  4D94 A;  3EUV B;  3SQC A;  4ZH1 A;  1SQC A;  4D4B A;  1N4Q B;  3OED A;  1FT2 B;  1QQF A;  1NL4 B;  5FO9 B; 
#chains in the Genus database with same CATH topology
 2FNJ B;  3DPD A;  2VN4 A;  1YN4 A;  1HXA A;  4ZRI A;  1TNO B;  2LXC A;  3VQI A;  3X0W A;  1C3T A;  1TJE A;  1G9J A;  3AE6 B;  1DOG A;  4MH8 A;  3WKH A;  3GS2 A;  4YSX B;  2PMV A;  1GXM A;  2KVZ A;  5CD2 A;  3AE2 B;  3VH3 B;  1GXN A;  3CIR B;  2DX5 B;  4MGY E;  1UG9 A;  3SFX B;  1WRD B;  3W1S C;  4W9I A;  1WM3 A;  1LXD A;  3RX5 A;  3WIM A;  1JCS B;  2LGY A;  2L76 A;  3Q8A A;  3IHP C;  1FM0 D;  2IGH A;  4KDL B;  2KFJ A;  1QIL A;  1YQ4 B;  2KT7 A;  3IBE A;  2ONH A;  2NOJ A;  1L7Y A;  3WIQ A;  4ZRK A;  1VJK A;  5BMG A;  3R7Q A;  1P0R A;  3DBL B;  4ZYS A;  1Z5S B;  3OG5 A;  4BKS D;  4ARC A;  1CQV A;  1IA6 A;  3SFE B;  4DK5 A;  3FAH A;  3W7U A;  3GLY A;  2AYO B;  4GDK B;  2ZW0 A;  4ICV A;  1KSC A;  3U8Z A;  4HRS A;  2M8S A;  3APC A;  3H7L A;  1SSN A;  3V6C B;  3WIR A;  1TT5 B;  3ALB A;  3W5N A;  1MG8 A;  1EO6 A;  4K81 A;  3VRA B;  1TNZ B;  1GG3 A;  4IG7 B;  4JQW C;  1JCR B;  3CF6 E;  3ZJU A;  1YQB A;  2DZM A;  3DWG C;  1WRI A;  2QJL A;  1F9J A;  3K9P B;  4B6W A;  2RDG A;  2MBB B;  1C1Y B;  2D5J A;  1VZ6 A;  4CJ0 A;  2K8B A;  3PO0 A;  3BYT B;  1KRH A;  2O6V B;  3SEB A;  1JRP A;  1WZ0 A;  1HXG A;  2MQJ A;  5C05 A;  2AFA A;  4K1R B;  1UGJ A;  4KGS A;  1WGY A;  2C7M B;  4ASW C;  4HVB A;  5E6O A;  3A33 B;  2BKR B;  3W5V B;  4KZ0 A;  1QQF A;  3DQV A;  1D5X C;  1H8C A;  3H3K A;  1E0Z A;  1RWH A;  1MG4 A;  4EUT A;  4MM3 B;  3VXW A;  1RYJ A;  4RGN A;  4MT5 A;  2V3S A;  1KLG D;  2PEA A;  2RD0 A;  3CST A;  4LDT D;  4KSL C;  4L0G A;  1V5D A;  3W7W A;  4LNK A;  3EQA A;  4OZC A;  2UYZ B;  2MJE A;  5DCN A;  4LJO B;  2JF4 A;  2L32 A;  1MHX A;  2JPH A;  2EMT A;  1H13 A;  1T0Q C;  4GN1 A;  1UBI A;  4NQL B;  4E74 A;  3H7P A;  2KTR A;  3BII D;  4URK A;  3R2I A;  3X17 A;  3N30 A;  3M63 B;  1WF9 A;  3M7C A;  4XUV A;  3KW5 B;  4ZRQ A;  2MJD A;  5D2M B;  4C56 C;  4GXB A;  1O6R A;  4W9K A;  2KFK A;  4FBJ B;  3HIZ A;  3QJZ A;  4MEM A;  1TN8 B;  4LNB B;  1UF0 A;  2EAC A;  3Q69 A;  1LQB A;  3DSS B;  2JXT A;  2KN5 A;  4F10 A;  3AFJ A;  1SE3 A;  3AE9 B;  4W9E A;  3K7X A;  1HEZ E;  5JMD A;  2JZP A;  4JE3 B;  2JYT A;  1A70 A;  1ZUD 2;  3GZK A;  2XN9 C;  1GB4 A;  1OJM A;  1D4B A;  2GH4 A;  1TS5 A;  3TBL D;  1GC6 A;  4C1S A;  4YCR A;  4G3X B;  2INP E;  2ZZP B;  4RGT A;  2EAD A;  4AOF A;  2FCM A;  5E6N A;  1GC7 A;  2GBM A;  3Q3M C;  5TSS A;  1X1M A;  2RGK A;  5M7I A;  2REX A;  3TL5 A;  5EAS A;  2ZCB A;  1T0S C;  3ENE A;  2I1K A;  3VR8 B;  3PZ7 A;  3S9V A;  1UUP A;  1WM2 A;  2JU6 X;  4IUM B;  3E34 B;  5GY3 A;  1HM3 A;  3LYY A;  1L2N A;  2BPS A;  1WGG A;  2GBJ A;  3PLU A;  3DBS A;  1V8C A;  2E24 A;  3ZDT A;  3M77 A;  1XXG A;  1L0V B;  4ZHP A;  2J0K A;  2LHE A;  2MWS B;  4RGO S;  4EE2 A;  1RWA A;  5D6J B;  1D3Z A;  1V1P B;  2CHX A;  3EA6 A;  2VH2 A;  1QAZ A;  2C60 A;  3RZW C;  2R2Q A;  4BOZ B;  4A55 A;  2MW5 A;  3HVD A;  3EZ8 A;  3PYA A;  2V4L A;  1H3C A;  3HXC B;  5ILK A;  4M0W A;  3DST B;  1OJO A;  2BYT A;  5JPM B;  3M01 A;  4ONT A;  1KZP B;  1FO3 A;  1HZF A;  1HCU A;  3RNG C;  3VUW A;  5IL8 A;  2KN4 A;  5KKB A;  1V49 A;  1LD7 B;  1F9O A;  2GOW A;  2IEJ B;  2KWU B;  2LRU A;  1OQQ A;  4DHZ E;  1RWC A;  2KYW A;  4OVZ A;  2NTT A;  2QDF A;  4WQO B;  4EKU A;  2Y5B B;  2DWQ A;  3ZTC A;  3ZXR A;  2KDE B;  2CHZ A;  4GMV A;  2SEB D;  2JRH A;  5DPT A;  2DRO A;  3AE8 B;  4GDL B;  1C82 A;  3T9L A;  3ONS A;  2JZ3 B;  4D4D A;  2BWF A;  1LOH A;  3HXF B;  3OWE B;  4RM9 A;  4TQ0 A;  2WXG A;  2VZK B;  2D11 A;  4ZOH C;  4N58 A;  1IP9 A;  5IM1 A;  2K3U A;  2M17 A;  4I6P A;  1QQR A;  1N7P A;  1T0R C;  3VH4 B;  4NZL B;  4PYU A;  2ZVN A;  2WXR A;  2DZK A;  3P4Q B;  2N9E B;  2LVQ A;  3AV8 A;  3DBH I;  3PSE B;  3ON6 A;  2WXK A;  5CHV C;  2LWP A;  1I8Q A;  3L0W B;  2ZPY A;  1N21 A;  1GB1 A;  1ZP0 B;  3C0R B;  4P1C C;  3ML8 A;  5IK6 A;  3VVW B;  1TN6 B;  3AMZ A;  2WP9 B;  3CWI A;  1KM7 A;  5T8I A;  4D2K A;  2KDF B;  1TIF A;  3LDZ E;  2O2V B;  1I4P A;  4WWN A;  3V3X A;  3NNB A;  2X03 A;  1WX7 A;  4JWU C;  2BS4 B;  2QHO A;  1IS9 A;  1I4Q A;  1MPE A;  3Q3F A;  2D3G A;  3W5M A;  5CX3 A;  2BRV X;  2EKI A;  3DHG C;  4W9D A;  1TKY A;  3QG0 A;  1KKT A;  4PS3 A;  5IK0 A;  3ANJ A;  4MJS B;  3W7X A;  3BYY B;  4BBN C;  1TF4 A;  4C00 A;  4AJW A;  2WXP A;  1F9D A;  5GXG B;  2NPT A;  2PVG C;  1GSZ A;  1XW2 A;  1S3S G;  2N1W A;  1V7V A;  3MC8 A;  2J7Q B;  4WQM A;  2Y5C A;  1HMU A;  4BBN F;  5LNK 1;  1OJN A;  2KAJ A;  1ZDX A;  1V5T A;  3R3M A;  1C4A A;  4PS7 A;  3TF4 A;  2IO2 B;  4WJQ A;  4IM3 A;  3QXQ A;  3KLS A;  1DGJ A;  5L95 C;  3P5P A;  1P7E A;  4GU2 A;  4FLH A;  2HTM E;  3BY4 B;  4FUS A;  1OTR B;  3R66 C;  3NVY A;  3WAL A;  3KSQ B;  1QSJ A;  1EWC A;  2K6D B;  4YTN B;  3DWM A;  1O6H A;  4TSS A;  5JXV A;  2XK5 A;  2JUO A;  1TNB B;  5FOB B;  3QHT A;  1KFY B;  1J19 A;  2AWT A;  4EHM B;  2N1V A;  2NR2 A;  4IWQ A;  3AU4 A;  2RR9 A;  1H12 A;  1FPY A;  5JHB A;  2Y5P A;  2PLP A;  1WWT A;  3BVM A;  3AN1 A;  1SIJ A;  1XCQ L;  2HE7 A;  3PS6 A;  1TS3 A;  1A5R A;  1QF6 A;  3M95 A;  3VTU A;  3E9S A;  3V61 A;  5CZL A;  1EU3 A;  4ANV A;  1N94 B;  2BB6 A;  4Q2B A;  3M02 A;  3RSY A;  3UGB B;  4HRO A;  1FCE A;  2BS2 B;  2W9N A;  2ZCC A;  3RX7 A;  2JSV X;  2MBQ A;  3GZN I;  5G2N A;  4V1S A;  3I3T B;  4C7Z A;  4QT9 A;  1DOX A;  1E8Y A;  1N62 A;  3L54 A;  3OLM D;  4D94 A;  3TEW A;  3D3I A;  2MP2 A;  1HM2 A;  3NZ3 A;  5BYR A;  4BKS A;  3WA0 A;  1EU4 A;  5HG2 A;  1P7F A;  3VDZ A;  2E22 A;  3LXF A;  1GAH A;  4S0R A;  1STE A;  2FUH B;  1ENF A;  3KUD B;  3HVZ A;  2FBA A;  5FR3 A;  1DOY A;  1C4P A;  4W9G A;  2V3N A;  4DHJ D;  2DYB A;  1N22 A;  3AE3 B;  1RQ5 A;  3PZ4 B;  1IGD A;  2YVC A;  3ETR A;  1FNU A;  3REN A;  3E73 A;  1WU5 A;  3AB5 A;  4YWG G;  1SB3 C;  4A3O A;  1SA4 B;  3RNF C;  2AHF A;  1V81 A;  1CJE A;  3PT2 B;  1E10 A;  4GB9 A;  4QAY A;  1CEM A;  2AEH A;  4XGA B;  2FAZ A;  3EC8 A;  4GTM B;  1N4R B;  2JT4 B;  4KTR A;  2W55 A;  2CS4 A;  1P3Q U;  2GI9 A;  1RWS A;  2BRP A;  3ZGZ A;  2RDB C;  1H37 A;  4IWO A;  1RAX A;  1JS4 A;  1ZE3 D;  4IM0 A;  1UNS A;  1H39 A;  3AE1 B;  2BGF A;  3VUY A;  2NBV B;  2JXX A;  1WU4 A;  3M75 A;  4YSY B;  5BYQ A;  3MC9 A;  4FXK B;  1ZPS A;  1HZ5 A;  3P2B A;  2YEP F;  2KC2 A;  2Z0D B;  1AYX A;  3Q7A B;  5IKC M;  2J5C A;  2GOX A;  1E7U A;  2YEP B;  3J9C A;  3E30 B;  2M4N A;  3Q7F B;  4GTT B;  1VR9 A;  2L8J A;  2YLM A;  1SEB D;  2V1Y A;  4FJY A;  4OVU A;  1UZX B;  3G4D A;  3B1L X;  2UU7 A;  2KD0 A;  3M62 B;  3P4S B;  1TKE A;  3ZRF A;  1MHH E;  2J0M A;  1Q1O A;  1G9G A;  2LGS A;  5IP4 D;  3OJ3 A;  5FO8 B;  4XYC A;  3MJ5 A;  4MH0 E;  5H92 C;  1XWQ A;  3H7P B;  2K22 A;  2W3S A;  2KTR B;  3PZD A;  3UF8 A;  4D4B A;  3ABV B;  2L05 A;  4AS1 A;  1I7H A;  1HE8 A;  4YXD B;  3ZRC A;  1ZGU B;  3KYD D;  2BYE A;  2WXQ A;  2KFK B;  1AW7 A;  2VH1 A;  5KHO A;  3HXB B;  3N3K B;  1T0Y A;  2R61 A;  3L10 B;  1GPX A;  4GTQ B;  4WU0 A;  1V1O A;  1WJ4 A;  4YTM B;  3VR9 B;  3ZLZ A;  3R8B A;  5EDS A;  4XWT A;  1RRB A;  3P63 A;  4DOE A;  5JZE B;  3C8Y A;  4WUR A;  3ZNH B;  2JRI B;  1JCQ B;  4DQO C;  3PHW B;  3RNB C;  2DYO A;  1JAL A;  2WDA A;  4J5T A;  4GL3 A;  1TY0 A;  4L9P B;  1GNU A;  1H14 A;  3AUL A;  3RMK C;  5AZH A;  1L0X B;  4PYZ A;  3WAN A;  4MSQ B;  3TCA A;  4DWF A;  3PRE A;  4ANW A;  1FPP B;  4JIO U;  2ZNV C;  3KYC D;  4HKQ A;  4HXD A;  3M76 A;  1UMP A;  4E1Y A;  5CTR C;  1WXS A;  2WYN A;  5CHF A;  2L7R A;  2D2Q A;  2BQQ A;  3PRM B;  1N4S B;  4A20 A;  1KS8 A;  1C3D A;  1V2Y A;  2ZNV B;  4MGI E;  3WKF A;  2K6Q A;  4RF0 A;  1N61 A;  3V62 A;  1YN5 A;  4M0W B;  4MEL A;  3SD5 A;  1SE2 A;  3BWU D;  3V05 A;  3GT5 A;  3VXD A;  1FAE A;  4N59 A;  3DOW A;  4II2 B;  2K25 A;  5FK9 C;  2D8L A;  2LRW A;  4ANX A;  5ILH A;  3BIN A;  2DEN B;  2XBB C;  1ULV A;  3V6E B;  2R2L B;  1KRE A;  3CU7 A;  1G87 A;  4BOJ A;  2A4Z A;  5MPO A;  3V60 A;  2W3R A;  2M19 A;  4DOD A;  3RN9 C;  3PLV A;  1ET9 A;  2H88 B;  1HX9 A;  1VCB A;  2NVP A;  2BYV E;  5J18 A;  2DYM A;  1N7Q A;  4AYR A;  3SAE A;  2VRR B;  3S2A A;  3CSF A;  1NL4 B;  3H7S A;  3JVZ X;  4HK2 A;  4M76 A;  3AEE B;  1OQY A;  2LGX A;  1R4N I;  3QFZ A;  2I1J A;  3HK0 A;  2L83 A;  2H89 B;  3DPY B;  1H3A A;  3EU8 A;  4NNJ B;  1SJH D;  1OEY J;  3SHQ A;  5EE1 A;  2A8Z A;  4W9C A;  1V5O A;  4MBG B;  3HM3 A;  3DVG X;  3KH0 A;  4M02 A;  1J7B A;  1QOB A;  3L13 A;  1N5X A;  5JH5 C;  1YN3 A;  3E6U A;  1F2R C;  3W7T A;  5IO9 A;  4MU9 A;  2G45 B;  4IDI A;  4EOY A;  1QT9 A;  1V80 A;  3A0O A;  2Z07 A;  3FIL A;  1J7A A;  1FBO A;  1OEY A;  1NI2 A;  2A5U A;  3WAM A;  5KHQ A;  1VRA B;  2L0F A;  2KMM A;  4XWW A;  2JWZ A;  4GGQ A;  4HWI B;  3A1Q A;  3ZIM A;  4OK4 A;  1V6E A;  1ZDV A;  3MHS D;  4HKZ E;  2IZV B;  1K51 A;  2JVC A;  1YNT E;  1CK1 A;  3LB8 C;  3QCA A;  3QX1 A;  1SF0 A;  2M56 B;  2V9H A;  2RPV A;  3N1Y C;  3IT4 B;  4FJV B;  2KX0 A;  1OQR A;  2RSU A;  4NAW A;  5FO7 B;  1YD8 U;  1WU6 A;  4TQ1 A;  2ZEQ A;  1K72 A;  1RWF A;  1UD7 A;  1P98 A;  3Q78 B;  4RH6 A;  1PUT A;  3QC8 B;  3IAS 1;  1AYF A;  1Y8R C;  1O1S B;  4Z4L A;  3H8H A;  4HJK A;  1L4Z B;  2GZ6 A;  4N9F 4;  2NPT B;  4NY0 A;  3QRY A;  4ZHO A;  4ITK A;  4ZDV A;  4MMH A;  2HDE A;  1QOG A;  2CHW A;  3M3J A;  4K7S A;  1D5Z C;  4L23 A;  4I6N B;  4KGR A;  1N1B A;  4IKG A;  2IBI B;  1WXV A;  2WDV B;  3T3N A;  2G4S A;  3IFW B;  4YSZ B;  1FNW A;  3APD A;  2ACZ B;  2EAE A;  1OFF A;  3AEC B;  2IND C;  2XK5 B;  1HTQ A;  1KZO B;  2V8J A;  1FO4 A;  3GE3 C;  5L83 A;  2DZI A;  4ZH5 A;  4NPN A;  1WE7 A;  2MBE A;  5TR5 A;  2KNB A;  4GIV A;  1UWX A;  4KGT A;  1XLO A;  1YIW A;  2WLB A;  2WDQ B;  2J4X A;  3SDV A;  4GAX A;  3DHH C;  5D3I B;  1XLN A;  2JF5 A;  2JJB A;  2EMS A;  4BFR A;  2G3Q B;  2WYQ A;  1E9M A;  1EM7 A;  4PT5 A;  2DAF A;  3I63 C;  4LIX A;  1NEK B;  1E7V A;  3D32 A;  3PRP B;  4JLC A;  1WZZ A;  4ICU A;  4OJZ A;  1TYG B;  1L1Y A;  2BS3 B;  5E6P A;  1IGC A;  1WXM A;  2KVR A;  3T33 A;  3PMM A;  1WFY A;  1WY8 A;  3ML9 A;  1J7C A;  2KJ6 A;  2MP2 B;  1ET6 A;  2LHD A;  3RCZ A;  3W1S A;  2MHJ A;  2OJW A;  2MA9 B;  2K5P A;  3AU5 A;  1EF1 A;  3HXD B;  3GE8 C;  2NS5 A;  4A6Q A;  2KX3 A;  5HI1 A;  3TJP A;  1CB8 A;  1E90 A;  1WGK A;  3CMM B;  5C2T B;  3O13 A;  4DBG A;  2J52 A;  2QIE B;  1TZO A;  1AN8 A;  1X1I A;  2GBR A;  4K3C A;  1DL2 A;  3DVN V;  2UWQ A;  2G02 A;  1LXM A;  1FXI A;  3WKI A;  1PQS A;  1JWM D;  3KVF B;  2G1E A;  4MSM B;  3DSW B;  3QK0 A;  4RNA A;  5DGQ A;  2WX0 A;  3AE5 B;  2I2Y A;  1MI0 A;  4A9A A;  1OJP A;  3AH7 A;  4DDG D;  3KLS X;  2ZPN A;  4C80 A;  5IKH A;  2AL3 A;  3K11 A;  2AL6 A;  4WVA A;  2Z8L A;  3QSP A;  4P7I A;  2FUZ A;  2H6G B;  2TSS A;  4HDO A;  1T5X D;  1TS2 A;  4TXT A;  4XDD A;  5LLI A;  3W1Y A;  1Z2M A;  4P6V F;  2PTL A;  2SQC A;  1MJD A;  1V7X A;  3UQB A;  1N95 B;  1TN7 B;  4MMI A;  1EUV B;  3EEC A;  2KTF A;  3RJ3 A;  4RNQ A;  3NHE B;  4BKT A;  3VRB B;  3EUB 2;  3DBH B;  4Q2J A;  1SBB B;  2M1M A;  4DI5 A;  2J42 A;  2MBO A;  4KTP A;  1YQ3 B;  2KC1 A;  4S17 A;  5C1Z A;  2WXJ A;  3RUL A;  2WXM A;  4DDI D;  2B3A A;  1UGM A;  2WDR B;  3SFD B;  1WYW B;  4ZRP A;  4LCD E;  5ILJ A;  1TNY B;  3M78 A;  2KHW B;  2WWZ A;  4E71 A;  2PE6 B;  2LUE A;  2LGI A;  1F1S A;  4DXG A;  2WIN B;  4ZG8 A;  2Y3A A;  4HDQ A;  2H6H B;  1M94 A;  3TEX A;  2D3C A;  4WWM A;  5DPW A;  2K8C A;  2WXN A;  4OW0 A;  1XEE A;  3A4S C;  2KWD A;  3B2F A;  4OZB A;  3FC4 A;  2IY0 B;  1LFD A;  2G9H D;  3RD2 A;  4AWJ A;  4US9 A;  2XQW A;  2F0Y B;  2WII B;  4AP4 C;  3DDC B;  2DAJ A;  4LDT B;  5D7G A;  3SDR A;  4WJP A;  2NTS A;  3QIJ A;  5BMI A;  2D07 B;  3A4R A;  4WVB A;  3OXU A;  2ONG A;  1I4H A;  2RGF A;  4LK0 M;  1WX9 A;  3I5J C;  2P0V A;  2J53 A;  2AQ2 B;  5DHI A;  1H3B A;  2G0D A;  3N0G A;  1CLC A;  3JW0 X;  4ZRJ A;  1Q10 A;  2XWJ B;  1S64 B;  2PVO D;  3AEF B;  4ANU A;  3WCQ A;  1R7S A;  3ZXV A;  4ZH1 A;  4P16 A;  1L5P A;  1FT2 B;  3W9C B;  3QDE A;  2KLC A;  2RMM A;  2PPH A;  5G5H A;  5HHD G;  3BVZ A;  2D5G A;  4GTV B;  1ZKH A;  4EZJ A;  3ZNG C;  1WZ3 A;  5LXI B;  3Q8F A;  2YIK A;  1V5C A;  2MBH A;  4NJC A;  4LLG M;  3E80 A;  1FP3 A;  3ANK A;  3NS8 A;  1O5M B;  4LNV A;  2LJ5 A;  3H1U A;  4AJY B;  4CHK A;  5JHA A;  3CIH A;  1W6K A;  2JY6 A;  2N7E A;  1F52 A;  2IGD A;  1QKZ A;  1W3Y A;  3N9Y C;  2AX5 A;  4JX1 C;  3H2W A;  1E5W A;  2WXO A;  1VD5 A;  5M7Y A;  2WU2 B;  1K8R B;  2CU1 A;  3RNC C;  2KO3 A;  3GZN B;  2O6V D;  3PYB A;  1PDX A;  1JRO A;  2WXL A;  3G4F A;  4GOC A;  4BZA A;  1FD6 A;  5IL3 A;  5JMF A;  3VFK A;  4ARI A;  3KWL A;  4XZ4 A;  3P4R B;  1PGX A;  5ILY A;  3AE4 B;  3B9J A;  3WUX A;  2JYE A;  5BMH A;  4ACF A;  2KWV B;  4KV2 A;  2KQS A;  2PW9 A;  1JCK B;  3QAR A;  4REZ A;  1N20 A;  3L08 A;  1QZE A;  1XLQ A;  3VTW A;  3AED B;  3NG0 A;  1HN0 A;  5AZG A;  2KMA A;  3P42 A;  1J0M A;  2N7J A;  3PV1 A;  2L52 A;  3DBR I;  3ZJV A;  1WSP A;  1GUA B;  2Z59 B;  5IN7 A;  4JPS A;  3VHT C;  4Q88 A;  1X1H A;  2ONQ A;  2HD5 B;  3BZD B;  2IO1 B;  1HZ6 A;  1PGA A;  4BKG A;  4IC7 B;  2LXA A;  4YDE B;  1KFG A;  4DXA B;  3T8M A;  1FMI A;  3DCG A;  2KXJ A;  3N1X C;  4AYQ A;  2IPK D;  3RRS A;  2FCS A;  2ZJD A;  3R7R A;  3NJT A;  1RWG A;  4L6X A;  1YX6 B;  4FXG B;  2FUT A;  3M7E A;  1D6E C;  4IM2 A;  2WU5 B;  4L1B A;  2D3A A;  2HJ1 A;  4NJ6 A;  1RW9 A;  4LNG B;  3Q8B A;  5EAU A;  4KZC A;  2RI8 A;  4OZV A;  5J17 A;  1LTX B;  1NYQ A;  1R4M I;  1TZ1 A;  3FIL B;  3QWZ B;  3ACT A;  2G4D B;  1WGH A;  1C9F A;  4EZK A;  1SXT A;  3NZU A;  4HLE A;  2KDI A;  1L0Y B;  1HMW A;  1V86 A;  2V4I B;  1H36 A;  3U4E G;  1BXT A;  2M0A A;  4NAW B;  1DCE B;  2PJH A;  4PK1 A;  1XO3 A;  3SDU A;  3U30 A;  5DPS A;  2GRI A;  1WX8 A;  4YDO B;  2BB5 A;  4FA6 A;  4TUU A;  4I6L B;  4US8 A;  1ESF A;  2JQR B;  3VSM A;  4DXF A;  4W9J A;  4LNF A;  3RX8 A;  3MP9 A;  2N9K A;  3RUI B;  1WGD A;  2E3T A;  4V1R A;  5C23 A;  2LVP A;  1EGU A;  4CQN A;  5I4D A;  3RZF A;  2IDY A;  3TSS A;  3D5R A;  4FUL A;  1LF6 A;  5AGD A;  3JSV A;  3S4A A;  2L0T A;  3AEA B;  3U7Z A;  1ISN A;  2BT6 A;  2DHZ A;  1JWS D;  3EGR A;  1WH3 A;  2V8I A;  3Q3O C;  4FNV A;  4WAA A;  4WWP A;  1GJZ A;  4KIK A;  5IAA C;  2DRR A;  2W54 A;  2J0J A;  3NOB A;  2V8K A;  2QEJ C;  3OJ4 B;  3HUI A;  4RF1 A;  1NYR A;  1IBX B;  3S4B A;  2KQ7 A;  1JWU D;  3VTV A;  3WAO A;  4D4A A;  4JWS C;  3A3V A;  5E6J A;  2Q1F A;  2LAS A;  1ROE A;  1WR6 E;  2EEL A;  1GOZ A;  3N1Z C;  1I42 A;  4XC2 A;  1C77 A;  2BVC A;  1E7P B;  1WMH A;  1FEH A;  2HTH A;  1XWT A;  4R3D A;  4YTP B;  4YL8 A;  2KDM A;  3WC3 A;  2D10 A;  4M8M A;  1R76 A;  4B95 A;  1L6V A;  4W9L A;  2W82 A;  2LI5 A;  4RM8 A;  2WDT B;  2WX1 A;  2CQS A;  5C3J B;  1JWB D;  5DGR A;  4GTP B;  4KDI C;  2C7H A;  5FKA C;  2BRW A;  1VZ7 A;  1K50 A;  2LUM A;  3L4P A;  1LF9 A;  1H35 A;  3DBL I;  1SGH A;  2QIL A;  1VZ8 A;  1UT9 A;  3VUX A;  2K39 A;  1N7N A;  1TY2 A;  2GB1 A;  1N4Q B;  3OED A;  2KJH B;  2MRP A;  2IYD B;  1XF5 L;  3M74 A;  3P4P B;  1WYG A;  3HXE B;  4X57 B;  3PVL A;  2WY8 A;  2KMC A;  2BWE S;  1O6Q A;  3Q6B A;  1F0Z A;  4N6E B;  2WXH A;  2K8H A;  3IVF A;  1IYF A;  2VZK D;  1J8C A;  2LEK A;  3DRA B;  4TMA B;  5D3D A;  5G5G A;  2B4F A;  3SFY B;  4WVC A;  3LJ3 A;  4WWO A;  2CKH B;  3UI3 A;  3NS1 A;  2GLS A;  2WS3 B;  3QWT A;  1J0G A;  1JWA D;  4B0M A;  3UIO B;  3ZUN A;  2KKC A;  4M01 A;  1ZW7 A;  4G0N B;  1SE9 A;  4O1N A;  3DVN U;  4G11 A;  1WE6 A;  1BML C;  4HEA 1;  1I35 A;  1S1Q B;  3PRZ A;  4D4C A;  2D3B A;  1TS4 A;  2ZIS B;  2ZVO A;  2VN7 A;  5HFY A;  3TEZ A;  4JGH B;  3WIW A;  1IUE A;  2MJ3 A;  3L17 A;  3DHI C;  1KWF A;  4EEW A;  2AHG A;  2V0G A;  1V9J A;  2FIF A;  2F6D A;  3N32 A;  1HV6 A;  1KTK A;  1KRF A;  4CJ1 A;  2OED A;  1XLP A;  3IG3 A;  4C4V A;  1SIF A;  4EFO A;  2FV0 A;  1R4N B;  1ZOY B;  3E7J A;  4PS8 A;  2KZR A;  1LXK A;  5CHW A;  3SDT A;  2ON8 A;  3Q14 C;  4F1S A;  3Q8C A;  4KSK C;  3ZO5 B;  4K3B A;  1YJI A;  5AUI A;  3X23 A;  1JW9 D;  3NRZ A;  2WNM A;  4A8X C;  1X9D A;  4HJG E;  4XE0 A;  1RM6 C;  4AYP A;  2H6F B;  3KSL B;  4DHJ B;  5AUK A;  1NDD A;  3BVG A;  2RI9 A;  2BBC A;  1F2R I;  1TKG A;  4H2A A;  1J0N A;  4J3O D;  1G6I A;  1E8W A;  1RLF A;  1LD8 B;  2INC C;  4FHJ A;  1N63 A;  1P1A A;  3W2D A;  2WXI A;  5MEH A;  1WR1 A;  3W5U B;  3Q73 B;  2DNF A;  4LNO A;  1SQC A;  2WGS A;  1N7R A;  3RFZ B;  4EZL A;  2KOX A;  2BF8 B;  2PIA A;  2BTE A;  2LMC A;  2KAN A;  3PZ3 B;  4W9F A;  5AEK B;  1QBQ B;  2FCN A;  4OK2 A;  2WHI A;  3ZKJ C;  2QCZ A;  4HPM B;  1WGR A;  5IA7 A;  1NXC A;  3MC0 B;  3A9J A;  1KF6 B;  1L6U A;  2DZJ A;  1WXQ A;  5G55 A;  1D8D B;  2ZBL A;  2IY1 B;  2NBW B;  4WAF A;  1FBW A;  3KUZ A;  3M7L A;  3DSV B;  3MTN B;  3M7B A;  2KJR A;  3I9V 1;  4FJQ A;  2K0P A;  2MH7 A;  4K7U A;  1D8E B;  3O65 B;  2C9W B;  3HRD D;  3I57 A;  2I38 A;  3E37 B;  5EE9 A;  3ANI A;  3A9K A;  2BKF A;  3T3O A;  3U7D A;  3IAM 1;  3N0F A;  4ZYN A;  3N20 C;  3RI7 C;  1I4X A;  2SAK A;  2QC8 A;  2C5L C;  2JZZ A;  5D94 A;  5ILZ A;  1N23 A;  1I4G A;  1N24 A;  1FT1 B;  1O1T B;  1HA5 A;  3Q2A C;  2E6X A;  1N9A B;  3LZ9 A;  1FMA D;  4RMA A;  2FUG 1;  2L3Z A;  3HHM A;  4HCP B;  2MX2 A;  1YMH E;  5H8Y E;  2NMQ A;  3PTF C;  4DHZ B;  1KJT A;  5IOI A;  3BK1 A;  1D5M C;  1NBF C;  1IBX A;  1C79 A;  1XT9 B;  1CMX B;  3QAQ A;  5AZF A;  1ZXH A;  2XWB B;  4YT0 B;  3UIP B;  4CYE A;  1X81 B;  2FUQ A;  1EF5 A;  1WI0 A;  1O1R B;  2OOB B;  2K1F A;  1V7W A;  3PZ8 A;  3ZW3 A;  5EE0 A;  1HQR D;  1E6E B;  4MGK E;  3B08 A;  4GSW A;  3EUV B;  3VSN A;  2CJN A;  1XQQ A;  4L2Y A;  5GW7 A;  3ZNZ B;  1BT0 A;  1OGW A;  4GDK A;  2QNO A;  1QOF A;  3SDQ A;  1UWM A;  1G6J A;  4BOS C;  3RT3 B;  3UQA A;  4P1B C;  1JRU A;  4IW0 A;  1DYQ A;  1ZXI A;  2LZ6 A;  4G50 A;  1WXA A;  3RYT A;  2DLB A;  4Z4J A;  4NJ7 A;  2GBN A;  2N4F A;  5DHK A;  1KLV A;  1LGR A;  3AE7 B;  4RFB A;  1SA5 B;  5FR6 A;  4CE7 A;  3ZVV A;  1IPG A;  3DSU B;  3Q3N C;  1Q5W B;  3Q75 B;  3C72 B;  1X1J A;  2MSE D;  4KKJ A;  3U52 E;  4TF4 A;  2KLG A;  4B0E A;  1XD3 B;  2X38 A;  4BOK A;  1O79 A;  3VW5 A;  2N9P C;  4GTO B;  1N7O A;  2N7D A;  2O6V A;  3SU8 X;  2WY7 A;  1FFV A;  2XFG A;  1EWY C;  2NCN A;  3WAP A;  4AUQ C;  3QT9 A;  1YJ1 A;  2PKO A;  1ACC A;  3EU5 B;  1GAQ B;  1C78 A;  4FHK A;  3NZS A;  3GB1 A;  4LNN A;  2FV1 A;  2Z0E B;  4HPL B;  1UEL A;  4OZA A;  4JJJ A;  2R2O A;  4B9K A;  1Q0W B;  3Q79 B;  3E56 A;  5JPN B;  2WQY B;  3DVG Y;  1E8Z A;  3Q3J A;  2XNA C;  4IOI E;  4MM3 A;  3NUH B;  2RDH A;  4MGZ E;  1GA2 A;  3PZ1 B;  5DPR A;  3ECI A;  4XDC A;  3EFC A;  1BUI C;  3NVW A;  4HCN B;  4IWP A;  4GLS C;  3KQ4 A;  1KLU D;  3ZYY X;  1GAI A;  3L16 A;  5ILD A;  1NEN B;  2DBY A;  2LGD A;  2ZW1 A;  4A90 A;  3W7S A;  3H9D A;  1NC5 A;  1PYW D;  4BAX A;  1MZC B;  1Y56 A;  1N5W A;  4OHJ A;  4FAD A;  2FBW B;  3R2T A;  4MDK E;  2CJO A;  1SJE D;  1CZP A;  2KK8 A;  4GTR B;  3TUO A;  2N0S B;  3SQC A;  1TGZ B;  2NVU I;  3JSV B;  4RGM A;  2HJ8 A;  3QPF A;  3AEG B;  2QSD A;  3EFU A;  1HTO A;  4GTS B;  3JYU A;  3MHZ A;  4F13 A;  2FID A;  4KIK B;  4F7Z A;  3AXC A;  4EL8 A;  1N4P B;  2IJ0 A;  1I4R A;  3SDL C;  3ZDM C;  1YX5 B;  4AQ7 A;  4NAM A;  1WIA A;  1B1Z A;  4C7Y A;  3M00 A;  3E32 B;  1LO5 D;  3PZ2 B;  4II3 B;  4UDU C;  1HXY D;  3FKY A;  2RPQ A;  1FFU A;  2MCN B;  1UH6 A;  1WMH B;  1FRR A;  1C76 A;  4OVV A;  3AEB B;  3NFV A;  4XX5 A;  4JL9 A;  1L4D B;  3C19 A;  3S4C A;  4FJZ A;  2M0X A;  1K53 A;  1QLB B;  2KWC A;  3VAW A;  3ZJT A;  5BO4 B;  5ILI A;  5EAT A;  3P5R A;  2LVO A;  4A3P A;  2L1A A;  4W9H A;  1DOI A;  3QQ8 B;  1FCL A;  1V1P A;  5GZK A;  2EAB A;  1PGB A;  1JQ4 A;  1KSD A;  3QXF A;  4LNI A;  4WJO A;  1T3Q A;  4NEI A;  1TBE A;  2DRQ A;  1FNV A;  4E3C A;  2A73 B;  2L00 B;  2CR5 A;  1N60 A;  4WH4 A;  1YJJ A;  1TNU B;  4LJP B;  3AFL A;  3ZTD A;  3HM6 X;  3WKG A;  1MVK A;  3B0A A;  2PN5 A;  2ICI A;  4OZW A;  1N6Z A;  3TEY A;  5J2R A;  2ZZR A;  1TTN A;  1VDV A;  3TIX A;  5CA3 A;  3PHX B;  1T6B X;  5GMV A;  3ACS A;  3RNA C;  1FXT B;  3SR6 A;  4FXC A;  2OJR A;  3B2G A;  4K7W A;  2BED B;  2KQ4 X;  4WIP A;  2B76 B;  1FO2 A;  4KVG B;  4TV3 A;  2OKX A;  3PGE A;  1NI3 A;  1U4A A;  2MLB A;  3AI5 A;  3GP7 A;  4GDL A;  1FXA A;  3TMP B;  2CQT A;  2XEW A;  3P2C A;  2MEK A;  3DBR B;  1L2A A;  1SE4 A;  3E33 B;  5IK9 A;  4BVU C;  3KUC B;  4M00 A;  4C4V B;  2Q5W D;  4NQK E;  1M4V A;  2GMI C;  3ZNI D;  3UIN B;  3AM9 A;  3QFY A;  4J6I A;  2FCQ A;  1W6J A;  1AAR A;  5E2J A;  2AQ3 B;  3P1M A;  2JX5 A;  3GOE A;  2BYF A;  3ZQ4 A;  3DSX B;  1WJ6 A;  2WCO A;  1YOV B;  2B39 A;  1F1H A;  1GHQ A;  1UBQ A;  3IT6 B;  1QOA A;  3A1Q B;  1PFD A;  1E8X A;  3NY5 A;  2V3P A;  1N1Z A;  3M73 A;  3OAW A;  4KX6 B;  1NI1 B;  2INN E;  1VD2 A;  1F77 A;  3RPF C;  1FCC C;  4USA A;  1GXO A;  1R4M B;  2O2V A;  4RCO A;  4HPP A;  4M8N A;  1FIQ A;  4MAC A;  1H4R A;  3S4D A;  1RFA A;  3KWV A;  1JML A;  3MJW A;  2EKE C;  2ASQ A;  3Q8E A;  2KDB A;  4AYO A;  3H6N A;  2N9L A;  1KOT A;  3APF A;  2ZIR B;  2CU3 A;  1H54 A;  4CO7 A;  4MJS A;  4KKI A;  2KAC A;  1B9R A;  3U2S C;  2QMT A;  3D5S A;  1S63 B;  4WJN A;  2N9X A;  3M72 A;  5IKA A;  1NVI D;  2LJI A;  2AQ1 B;  3QA8 A;  3IXS A;  1MFW A;  4FN2 A;  2H6I B;  2LD9 A;  2FE8 A;  2LFI A;  3PPA A;  1RFK A;  1HXC A;  1IA7 A;  2K9X A;  1WJU A;  3NVZ A;  2WXF A;  5HKH A;  1K52 A;  3A9J B;  1FRD A;  3K9O B;  3QT3 A;  2NBU A;  1GLM A;  5EE3 A;  2IGG A;  2I07 B;  2X8X X;  1KH0 A;  3MFG A;  1LM8 B;  1AWD A;  1WJN A;  1F9G A;  1XCT L;  1P9D U;  2C7N B;  2JWU A;  3URY A;  3G6J B;  2OHF A;  1C4C A;  4TKN A;  4LTU A;  3EHV A;  2DRS A;  2PE9 A;  5BYS A;  4F8C B;  2IO0 B;  1V97 A;  2GBK A;  3NVV A;  3BK2 A;  3M71 A;  5LXH A;  1VLB A;  1AGM A;  2BW2 A;  3RNE C;  2JG0 A;  3A9K B;  2IO3 B;  5FO9 B; 
#chains in the Genus database with same CATH homology
 2H6G B;  2PIA A;  2TSS A;  1T5X D;  1GAH A;  4TXT A;  2VN4 A;  1STE A;  1TS2 A;  1YN4 A;  3LXF A;  4P6V F;  1ENF A;  2SQC A;  2PTL A;  1V7X A;  2BTE A;  1TNO B;  2LMC A;  3VQI A;  3HVZ A;  1TJE A;  1N95 B;  1TN7 B;  2FBA A;  3PZ3 B;  5FR3 A;  1G9J A;  1QBQ B;  3AE6 B;  1DOY A;  1DOG A;  1C4P A;  4MH8 A;  3WKH A;  3GS2 A;  4YSX B;  2PMV A;  1GXM A;  2V3N A;  5CD2 A;  3RJ3 A;  3AE2 B;  1GXN A;  3AE3 B;  3CIR B;  1RQ5 A;  3PZ4 B;  1UG9 A;  3VRB B;  3SFX B;  1NXC A;  1IGD A;  3MC0 B;  3EUB 2;  4Q2J A;  3ETR A;  1FNU A;  1SBB B;  1KF6 B;  1L6U A;  3REN A;  3E73 A;  1WU5 A;  1WXQ A;  3AB5 A;  4YWG G;  3RX5 A;  1D8D B;  2J42 A;  1JCS B;  1SB3 C;  4KTP A;  2ZBL A;  1SA4 B;  3Q8A A;  1YQ3 B;  1FM0 D;  2IGH A;  4WAF A;  2AHF A;  1FBW A;  1CJE A;  1E10 A;  3M7L A;  1CEM A;  3DSV B;  2WXJ A;  2WXM A;  2WDR B;  1QIL A;  3M7B A;  1YQ4 B;  5BMG A;  3SFD B;  2NOJ A;  4GTM B;  3WIQ A;  1IBX B;  1N4R B;  4ZRP A;  1VJK A;  4KTR A;  3I9V 1;  2W55 A;  2K0P A;  1TNY B;  3M78 A;  2GI9 A;  1RWS A;  1D8E B;  2MH7 A;  4ZYS A;  3ZGZ A;  3HRD D;  1H37 A;  3I57 A;  2I38 A;  3E37 B;  2LGI A;  5EE9 A;  4DXG A;  1JS4 A;  2WIN B;  3ANI A;  4ZG8 A;  1ZE3 D;  2Y3A A;  4ARC A;  3T3O A;  1CQV A;  1IA6 A;  3IAM 1;  3SFE B;  2H6H B;  1I4X A;  2SAK A;  1UNS A;  3FAH A;  3TEX A;  1H39 A;  3AE1 B;  3W7U A;  4WWM A;  3GLY A;  4GDK B;  2ZW0 A;  1KSC A;  1WU4 A;  1I4G A;  2WXN A;  4OW0 A;  1XEE A;  1FT1 B;  1O1T B;  3M75 A;  1HA5 A;  4YSY B;  5BYQ A;  2KWD A;  4HRS A;  4FXK B;  1ZPS A;  1HZ5 A;  2E6X A;  3B2F A;  4OZB A;  1N9A B;  3FC4 A;  1FMA D;  2FUG 1;  2YEP F;  3H7L A;  2G9H D;  1SSN A;  3WIR A;  4US9 A;  2XQW A;  1AYX A;  3Q7A B;  3W5N A;  1YMH E;  2F0Y B;  2WII B;  2GOX A;  2YEP B;  2NMQ A;  5H8Y E;  3VRA B;  3BK1 A;  1D5M C;  1TNZ B;  3E30 B;  3Q7F B;  4GTT B;  3SDR A;  3J9C A;  5D7G A;  1VR9 A;  1JCR B;  2NTS A;  3ZJU A;  3DWG C;  1IBX A;  1SEB D;  5BMI A;  1WRI A;  1C79 A;  4WVB A;  1ZXH A;  2XWB B;  3OXU A;  2QJL A;  1I4H A;  4YT0 B;  2RDG A;  1X81 B;  4LK0 M;  2D5J A;  1VZ6 A;  2P0V A;  1TKE A;  4CJ0 A;  1MHH E;  1O1R B;  2J53 A;  3P4S B;  1V7W A;  2AQ2 B;  3PO0 A;  3PZ8 A;  5EE0 A;  1G9G A;  3BYT B;  1KRH A;  3SEB A;  1HQR D;  5FO8 B;  1JRP A;  1E6E B;  1H3B A;  2G0D A;  1CLC A;  3MJ5 A;  5H92 C;  1Q10 A;  2XWJ B;  1S64 B;  2PVO D;  1XWQ A;  3AEF B;  3EUV B;  2K22 A;  2AFA A;  1R7S A;  2W3S A;  3WCQ A;  4ZH1 A;  2CJN A;  1UGJ A;  4KGS A;  4D4B A;  3ABV B;  4L2Y A;  4P16 A;  5GW7 A;  1L5P A;  3W5V B;  1I7H A;  4AS1 A;  1FT2 B;  3W9C B;  1QQF A;  2QNO A;  4YXD B;  3QDE A;  1QOF A;  3SDQ A;  1UWM A;  1D5X C;  2RMM A;  5G5H A;  5HHD G;  2WXQ A;  3BVZ A;  2D5G A;  4GTV B;  3H3K A;  1DYQ A;  1E0Z A;  1ZXI A;  3Q8F A;  2YIK A;  1AW7 A;  1V5C A;  2DLB A;  3HXB B;  4LLG M;  4Z4J A;  4NJC A;  5C3J B;  1FP3 A;  3ANK A;  4MM3 B;  1O5M B;  4LNV A;  1RYJ A;  2R61 A;  4MT5 A;  4RGN A;  1GPX A;  4GTQ B;  4WU0 A;  1KLG D;  3AE7 B;  1V1O A;  4RFB A;  1SA5 B;  4YTM B;  3VR9 B;  4CE7 A;  3R8B A;  4L0G A;  3DSU B;  1V5D A;  3CIH A;  1W6K A;  3W7W A;  3EQA A;  3Q75 B;  4XWT A;  3C72 B;  2IGD A;  4OZC A;  4KKJ A;  1QKZ A;  2MJE A;  3P63 A;  3U52 E;  4DOE A;  2AX5 A;  3N9Y C;  4TF4 A;  2JF4 A;  4JX1 C;  4B0E A;  3C8Y A;  4WUR A;  2L32 A;  2X38 A;  3H2W A;  4BOK A;  1O79 A;  3VW5 A;  1JCQ B;  2WXO A;  4DQO C;  1VD5 A;  4GTO B;  5M7Y A;  1MHX A;  2WU2 B;  2DYO A;  1H13 A;  1JAL A;  4J5T A;  4GL3 A;  2WY7 A;  3PYB A;  4L9P B;  1FFV A;  1JRO A;  1PDX A;  1TY0 A;  2WXL A;  1FD6 A;  2XFG A;  1H14 A;  1EWY C;  4ARI A;  3KWL A;  3P4R B;  3BII D;  1PGX A;  1L0X B;  3R2I A;  3X17 A;  3AE4 B;  3QT9 A;  3B9J A;  1FPP B;  3M7C A;  4XUV A;  3WUX A;  1ACC A;  2JYE A;  2PKO A;  5BMH A;  4ZRQ A;  2MJD A;  3EU5 B;  1GAQ B;  4C56 C;  1C78 A;  2PW9 A;  1JCK B;  4REZ A;  4HKQ A;  3GB1 A;  3M76 A;  1O6R A;  1XLQ A;  1UMP A;  2FV1 A;  3AED B;  4OZA A;  2WYN A;  4JJJ A;  1TN8 B;  4LNB B;  3P42 A;  2EAC A;  3Q79 B;  3E56 A;  2N7J A;  3Q69 A;  5JPN B;  3DSS B;  2WQY B;  2L52 A;  2JXT A;  2XNA C;  3ZJV A;  1WSP A;  4IOI E;  1N4S B;  3AFJ A;  4JPS A;  1KS8 A;  3NUH B;  1SE3 A;  1C3D A;  4Q88 A;  2ONQ A;  2RDH A;  3AE9 B;  1GA2 A;  3K7X A;  3BZD B;  3PZ1 B;  1HEZ E;  3WKF A;  1HZ6 A;  1PGA A;  4RF0 A;  1N61 A;  4YDE B;  1KFG A;  1YN5 A;  2JZP A;  4JE3 B;  4XDC A;  2JYT A;  1BUI C;  1A70 A;  3NVW A;  1SE2 A;  1ZUD 2;  3GZK A;  2XN9 C;  3BWU D;  4GLS C;  3V05 A;  1FMI A;  3KQ4 A;  3GT5 A;  1KLU D;  3ZYY X;  1GAI A;  2GH4 A;  3VXD A;  1TS5 A;  1D4B A;  1FAE A;  4AYQ A;  2IPK D;  4N59 A;  4C1S A;  3RRS A;  1NEN B;  2DBY A;  5FK9 C;  2D8L A;  4YCR A;  2INP E;  4L6X A;  2ZW1 A;  4A90 A;  4FXG B;  3W7S A;  1NC5 A;  4RGT A;  2EAD A;  3M7E A;  1ULV A;  2R2L B;  1D6E C;  1PYW D;  4L1B A;  2WU5 B;  5TSS A;  1MZC B;  1Y56 A;  1N5W A;  2RGK A;  5M7I A;  4OHJ A;  1KRE A;  3CU7 A;  1G87 A;  4LNG B;  4BOJ A;  2FBW B;  5MPO A;  3Q8B A;  3R2T A;  2W3R A;  2CJO A;  2RI8 A;  1SJE D;  4DOD A;  2M19 A;  1LTX B;  3VR8 B;  1ET9 A;  1NYQ A;  3S9V A;  1CZP A;  1UUP A;  2H88 B;  3FIL B;  2JU6 X;  3PZ7 A;  4GTR B;  3TUO A;  3ACT A;  2NVP A;  2N0S B;  2DYM A;  3E34 B;  5GY3 A;  3LYY A;  1C9F A;  3SQC A;  4RGM A;  1SXT A;  3QPF A;  4AYR A;  3SAE A;  3AEG B;  2QSD A;  1V8C A;  1NL4 B;  3M77 A;  1XXG A;  1L0Y B;  1L0V B;  4ZHP A;  2LHE A;  4RGO S;  4GTS B;  4EE2 A;  2V4I B;  4M76 A;  1H36 A;  1V1P B;  3AEE B;  3MHZ A;  3U4E G;  1BXT A;  3EA6 A;  3QFZ A;  4EL8 A;  1N4P B;  2M0A A;  2IJ0 A;  1I4R A;  4NAW B;  2L83 A;  4A55 A;  3HVD A;  1DCE B;  3EZ8 A;  3PYA A;  4AQ7 A;  1H3C A;  3HXC B;  4M0W A;  2H89 B;  4NAM A;  3DST B;  3DPY B;  2BYT A;  1XO3 A;  3SDU A;  1H3A A;  3EU8 A;  1B1Z A;  4C7Y A;  1SJH D;  2GRI A;  5EE1 A;  5JPM B;  2A8Z A;  3E32 B;  4YDO B;  3PZ2 B;  2BB5 A;  4ONT A;  1LO5 D;  1KZP B;  4US8 A;  1FO3 A;  1HZF A;  1HCU A;  1ESF A;  2JQR B;  4MBG B;  4DXF A;  2KN4 A;  4UDU C;  3RX8 A;  3MP9 A;  1HXY D;  2N9K A;  5KKB A;  1FFU A;  1J7B A;  1QOB A;  1LD7 B;  1N5X A;  1F9O A;  1FRR A;  1YN3 A;  3E6U A;  2IEJ B;  3W7T A;  1C76 A;  1F2R C;  4MU9 A;  2E3T A;  3AEB B;  4IDI A;  4V1R A;  1L4D B;  1QT9 A;  1OQQ A;  2Z07 A;  3FIL A;  4CQN A;  1J7A A;  3S4C A;  1FBO A;  2IDY A;  3TSS A;  5I4D A;  3D5R A;  1K53 A;  1LF6 A;  5AGD A;  1QLB B;  1VRA B;  3S4A A;  2KMM A;  3AEA B;  3U7Z A;  4OVZ A;  4XWW A;  3ZJT A;  2BT6 A;  3P5R A;  2L1A A;  1ZDV A;  2NTT A;  1JWS D;  1DOI A;  3EGR A;  2DWQ A;  4HKZ E;  2V8I A;  1K51 A;  1YNT E;  2SEB D;  1FCL A;  1CK1 A;  3LB8 C;  1V1P A;  5GZK A;  1GB4 A;  1SF0 A;  2DRO A;  2EAB A;  1PGB A;  2M56 B;  3AE8 B;  2RPV A;  1JQ4 A;  3IT4 B;  1KSD A;  2DRR A;  3QXF A;  2W54 A;  4GDL B;  1OQR A;  2V8K A;  5FO7 B;  1T3Q A;  2DRQ A;  1WU6 A;  4D4D A;  1FNV A;  4TQ1 A;  3HXF B;  2A73 B;  2QEJ C;  1K72 A;  3HUI A;  1N60 A;  3OWE B;  4RF1 A;  1NYR A;  3Q78 B;  4TQ0 A;  3S4B A;  4RH6 A;  4WH4 A;  1YJJ A;  2VZK B;  2WXG A;  1JWU D;  1PUT A;  4ZOH C;  4D4A A;  4JWS C;  4N58 A;  3A3V A;  3IAS 1;  5E6J A;  1AYF A;  1TNU B;  2K3U A;  1ROE A;  1O1S B;  4Z4L A;  1QQR A;  1GOZ A;  2EEL A;  3WKG A;  1MVK A;  3H8H A;  1L4Z B;  4NZL B;  1C77 A;  2GZ6 A;  1E7P B;  2PN5 A;  2WXR A;  3P4Q B;  2ICI A;  3TEY A;  1FEH A;  1XWT A;  3AV8 A;  4R3D A;  3QRY A;  4YTP B;  2ZZR A;  1VDV A;  4ZHO A;  4ITK A;  3ON6 A;  2WXK A;  2KDM A;  5CA3 A;  3WC3 A;  1T6B X;  2HDE A;  3ACS A;  1QOG A;  1R76 A;  1ZP0 B;  1GB1 A;  1L6V A;  4FXC A;  2W82 A;  3SR6 A;  4XDD A;  3B2G A;  4WIP A;  2BED B;  1D5Z C;  1TN6 B;  2B76 B;  2CQS A;  2KQ4 X;  2WP9 B;  3CWI A;  1JWB D;  3AMZ A;  5DGR A;  4L23 A;  4GTP B;  5T8I A;  4KGR A;  1FO2 A;  4IKG A;  5FKA C;  4D2K A;  2OKX A;  1VZ7 A;  1NI3 A;  1K50 A;  1I4P A;  2LUM A;  2WDV B;  3L4P A;  3V3X A;  1LF9 A;  1H35 A;  3T3N A;  2QIL A;  1VZ8 A;  1UT9 A;  3GP7 A;  1FXA A;  2CQT A;  4JWU C;  2BS4 B;  3P2C A;  1TY2 A;  1N4Q B;  3OED A;  2GB1 A;  2MEK A;  4YSZ B;  1IS9 A;  1FNW A;  1I4Q A;  1XF5 L;  1MPE A;  1L2A A;  3M74 A;  2ACZ B;  1SE4 A;  3P4P B;  3E33 B;  3W5M A;  2EAE A;  3HXE B;  1OFF A;  1WYG A;  2EKI A;  2WY8 A;  1O6Q A;  3AEC B;  1F0Z A;  2Q5W D;  4N6E B;  2WXH A;  1TKY A;  3QG0 A;  1M4V A;  1KKT A;  2VZK D;  2LEK A;  3AM9 A;  1KZO B;  3QFY A;  2V8J A;  3ANJ A;  3DRA B;  4TMA B;  1FO4 A;  5D3D A;  3W7X A;  1W6J A;  2B4F A;  4ZH5 A;  3BYY B;  5G5G A;  1TF4 A;  4WVC A;  3SFY B;  5E2J A;  2AQ3 B;  2WXP A;  1F9D A;  3P1M A;  2JX5 A;  5GXG B;  3UI3 A;  3NS1 A;  1UWX A;  2PVG C;  4KGT A;  1GSZ A;  3ZQ4 A;  2WS3 B;  1XLO A;  1XW2 A;  3QWT A;  3DSX B;  1JWA D;  4B0M A;  1V7V A;  2B39 A;  1GHQ A;  2WDQ B;  2WLB A;  3IT6 B;  1QOA A;  4WQM A;  1PFD A;  2J4X A;  2Y5C A;  4O1N A;  3SDV A;  2V3P A;  5D3I B;  3M73 A;  1BML C;  4HEA 1;  5LNK 1;  2KAJ A;  1XLN A;  2JJB A;  1ZDX A;  4KX6 B;  1NI1 B;  1C4A A;  2INN E;  3TF4 A;  1F77 A;  3QXQ A;  1E9M A;  3RPF C;  3KLS A;  1EM7 A;  1FCC C;  4PT5 A;  4D4C A;  1TS4 A;  4USA A;  1GXO A;  2ZIS B;  4LIX A;  1DGJ A;  4RCO A;  3P5P A;  2VN7 A;  5HFY A;  3TEZ A;  1P7E A;  1FIQ A;  3WIW A;  1IUE A;  2MJ3 A;  1NEK B;  4MAC A;  2HTM E;  5EE3 A;  1WZZ A;  4FUS A;  3S4D A;  1KWF A;  1TYG B;  1JML A;  2AHG A;  1L1Y A;  3KWV A;  2V0G A;  3NVY A;  2F6D A;  1KTK A;  2BS3 B;  3KSQ B;  1QSJ A;  1KRF A;  4AYO A;  3Q8E A;  4CJ1 A;  1EWC A;  2N9L A;  1IGC A;  1XLP A;  2OED A;  4YTN B;  3DWM A;  2ZIR B;  3T33 A;  3PMM A;  2CU3 A;  1O6H A;  4TSS A;  5JXV A;  1H54 A;  2FV0 A;  1ZOY B;  1J7C A;  1ET6 A;  2LHD A;  1TNB B;  5FOB B;  1KFY B;  3W1S A;  4KKI A;  2KAC A;  1B9R A;  4EHM B;  3U2S C;  2QMT A;  3D5S A;  1S63 B;  3SDT A;  2ON8 A;  3M72 A;  2K5P A;  1H12 A;  1NVI D;  2LJI A;  2Y5P A;  2AQ1 B;  3Q8C A;  3HXD B;  1YJI A;  5AUI A;  1JW9 D;  2PLP A;  1WWT A;  3IXS A;  3NRZ A;  4A6Q A;  2WNM A;  5HI1 A;  2H6I B;  1X9D A;  4HJG E;  4XE0 A;  4A8X C;  2FE8 A;  3BVM A;  1WGK A;  3AN1 A;  5C2T B;  1RM6 C;  4AYP A;  2LFI A;  2H6F B;  1SIJ A;  1RFK A;  1XCQ L;  3KSL B;  3O13 A;  5AUK A;  1IA7 A;  1TS3 A;  2J52 A;  2K9X A;  1QF6 A;  2QIE B;  3NVZ A;  1TZO A;  3BVG A;  1AN8 A;  2WXF A;  2RI9 A;  2BBC A;  1K52 A;  1F2R I;  1FRD A;  3E9S A;  3QT3 A;  1DL2 A;  5CZL A;  1GLM A;  1EU3 A;  1TKG A;  2IGG A;  4H2A A;  1N94 B;  2BB6 A;  2G02 A;  2I07 B;  4Q2B A;  3WKI A;  1FXI A;  1KH0 A;  3MFG A;  1JWM D;  4J3O D;  1G6I A;  2G1E A;  3RSY A;  1AWD A;  1LD8 B;  3DSW B;  4HRO A;  1FCE A;  2BS2 B;  4RNA A;  1XCT L;  5DGQ A;  1N63 A;  3RX7 A;  2JSV X;  2JWU A;  3AE5 B;  3URY A;  3G6J B;  2WXI A;  3W2D A;  2I2Y A;  4V1S A;  2OHF A;  1C4C A;  4C7Z A;  4LTU A;  5MEH A;  4QT9 A;  2DRS A;  3W5U B;  1MI0 A;  5BYS A;  1DOX A;  4A9A A;  1N62 A;  3AH7 A;  3Q73 B;  4D94 A;  3KLS X;  1V97 A;  3NVV A;  3TEW A;  3D3I A;  1SQC A;  3BK2 A;  3M71 A;  4C80 A;  3K11 A;  3NZ3 A;  1VLB A;  1AGM A;  5BYR A;  2BW2 A;  4WVA A;  2JG0 A;  2Z8L A;  1EU4 A;  3RFZ B;  5HG2 A;  3QSP A;  1P7F A;  2FUZ A;  5FO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...