3KQ4A

Structure of intrinsic factor-cobalamin bound to its receptor cubilin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
393
structure length
385
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gastric intrinsic factor
publication title Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 114
structure length 385
sequence length 393
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3kq4A01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3kq4A02
3SFXB 1O6QA 4GTOB 1H3CA 3HXFB 2I07B 2WY8A 5AGDA 4D4DA 3DSSB 2G0DA 1C3DA 2SQCA 2BEDB 1TNOB 1LD8B 1SA5B 1O1RB 3Q75B 3DSXB 2B39A 1GXOA 3Q79B 4GTTB 3SQCA 4KKIA 4EHMB 1O6HA 3KLSA 1GHQA 1NI1B 1H36A 1KZPB 2PN5A 3HXCB 4GTVB 1TN7B 4YDEB 2H6IB 4D4CA 5FO9B 1HZFA 3E34B 1N94B 4GTPB 3Q73B 1QSJA 3D5SA 3KSQB 4GTSB 1FT1B 3E32B 3DSTB 4ONTA 4D94A 4LNBB 1FPPB 2NOJA 4KKJA 2R2LB 1H39A 3U7ZA 4FXKB 1N4RB 1KZOB 5FOBB 1H3BA 4L9PB 2XWBB 1H35A 4MU9A 3HXBB 1DCEB 4C1SA 1O6RA 1N4PB 4MBGB 3PZ3B 1O5MB 4GTQB 5JPNB 3KSLB 2H6HB 4BOKA 1O1TB 3DSUB 1NL4B 1H3AA 2WINB 3OEDA 1TNZB 2BB5A 2WIIB 2ZISB 3E33B 2V8IA 3PZ4B 1O79A 3Q78B 3DSWB 3CU7A 5JPMB 1GXMA 3EUVB 1MZCB 3DSVB 1GXNA 1TN6B 4GTRB 1S64B 1UMPA 2IEJB 1X81B 1TNBB 3E30B 1TNUB 2V3PA 4V1SA 2ZIRB 1W6KA 3OXUA 1LTXB 1N9AB 4BOJA 5FO8B 1R76A 3E37B 3RJ3A 3PZ2B 1H37A 3C72B 4ZRQA 1QBQB 4ZH1A 1N4SB 1JCSB 4ZRPA 3Q7AB 3PZ1B 4LNGB 2BBCA 1SA4B 3EU5B 4GTMB 4LNVA 1JCRB 1D8EB 1JCQB 3SFYB 1TN8B 3KQ4A 2A73B 4V1RA 1O1SB 3HXDB 1LD7B 3G6JB 2GOXA 2XWJB 1S63B 4FXGB 4YDOB 1GSZA 1N95B 3D5RA 2V8JA 3Q7FB 2H6GB 2G02A 3DRAB 5FO7B 2BB6A 3HXEB 4D4BA 1W6JA 1FT2B 2V3NA 2H6FB 3K7XA 2WY7A 4D4AA 4M76A 2XQWA 1SQCA 1QQFA 2PMVA 1D8DB 2V8KA 1N4QB 2F0YB 1TNYB 3DPYB
chains in the Genus database with same CATH superfamily
2WXOA 3HVDA 4GB9A 2GMIC 2JY6A 1TNOB 5DGRA 2YIKA 1T0YA 2D8LA 2JG0A 4DHZE 3N9YC 5CHWA 5EATA 2KJRA 4OZVA 4MH8A 2DAFA 3TCAA 4YDEB 1HXGA 4NY0A 3ZJVA 3D5SA 4ONTA 1TT5B 1JWAD 2PLPA 5JMDA 3HHMA 1EUVB 2EAEA 4ZG8A 3KW5B 2KX3A 2INPE 2WXFA 3E80A 3BYYB 3DHGC 3AEDB 4L9PB 4RGMA 1TKEA 2D5GA 1EU4A 1LO5D 4FADA 4WVAA 3IG3A 1U4AA 3CWIA 1NL4B 1ZE3D 1FCEA 3QT3A 4NQKE 2HDEA 2A8ZA 2FUZA 1RW9A 1E8ZA 1WFYA 3NZ3A 2WXPA 4ZRIA 1C77A 2IGHA 1XEEA 2CJOA 3RNEC 5I4DA 3MTNB 3VW5A 1S64B 2X03A 3U7DA 4GDLB 2O6VD 5LXHA 1MVKA 1EGUA 1A5RA 1P1AA 2ONQA 5E6NA 4HXDA 1OGWA 1VD2A 1N21A 4KX6B 4IM2A 4ARCA 4P1BC 3FC4A 5G2NA 1FNUA 2OHFA 4CO7A 2KHWB 1IYFA 1GAIA 1FPYA 1WX7A 3WIRA 1KKTA 1XD3B 2A73B 3C8YA 5DHKA 1T0RC 1XT9B 1RWFA 4ZRJA 2NTSA 2KXJA 3IFWB 1HM3A 3BINA 3Q7FB 2X8XX 2KKCA 4D4BA 4KGSA 2JXXA 1YQ3B 1NBFC 1CLCA 1QOBA 2JPHA 2LMCA 2TSSA 2J52A 3SDVA 5LLIA 1XLOA 1K52A 1I4HA 1KH0A 1N20A 1FO3A 3DPYB 3SFXB 5GMVA 4W9KA 1IPGA 3U4EG 2I07B 4HDQA 1HZ6A 4XGAB 1SA5B 5ILZA 5EAUA 1XO3A 2KANA 2LGIA 5EE3A 2ZJDA 1IP9A 3SFEB 3E6UA 2WDQB 3ML9A 2CKHB 1GC6A 2DWQA 4A9AA 5FK9C 2RR9A 2DX5B 2DYOA 5FO9B 3OWEB 4FXCA 1HZFA 3E34B 3A0OA 4DHZB 1E7VA 3Q3MC 4PS7A 1RAXA 1F9GA 3NY5A 3DSTB 3K9PB 1XW2A 2O6VB 2ZCCA 4HRSA 2IO1B 2XWBB 3A3VA 1CK1A 3WIQA 2YEPF 1GB4A 3EQAA 1KOTA 1E8XA 4KTRA 4XX5A 2MJ3A 4KDLB 3ZDMC 2FUHB 1TNZB 3KVFB 3MC9A 4HLEA 3SR6A 1H12A 3CU7A 3PLVA 4F13A 1JQ4A 1GXMA 1C4PA 4WQOB 2C5LC 4W9IA 2IY0B 3AFJA 1JWMD 2MP2A 1AGMA 1X1HA 2K8CA 3SU8X 3FILA 4OVZA 2L1AA 1TZ1A 3N1XC 3NVWA 3EFCA 2KTFA 3QFZA 5E6JA 3RENA 3AE2B 2BBCA 4HPPA 1D8EB 3EA6A 2M17A 1ET6A 3M01A 2KVRA 4IM0A 5AUKA 3L54A 2JZZA 1WE7A 1CJEA 2W82A 1WRDB 4WURA 1P0RA 3WAPA 3DBLB 2I1JA 2INNE 3Q3FA 4MT5A 1QQFA 3LZ9A 1WMHA 1HMUA 1BMLC 2GOWA 2D07B 1RYJA 3HXFB 3ZVVA 4D4DA 1WXVA 2GRIA 3KYCD 1TY0A 1NI3A 3Q3OC 2NPTA 1KS8A 3S4AA 1ZP0B 2RI8A 2Y5BB 2WDTB 1J7BA 1OJOA 3U8ZA 3QQ8B 5M7IA 3P4QB 1WU6A 1T3QA 1MHHE 5C1ZA 2EACA 2NBUA 3CSTA 4A8XC 2N7EA 1JRPA 4LTUA 3N1YC 3QRYA 3PHXB 5DPWA 1X1MA 1UH6A 1R4MB 3GZKA 1Z5SB 3IXSA 3L08A 3N0GA 2QMTA 3ZO5B 4I6NB 3WAOA 3ACTA 5BYSA 2KWVB 1DCEB 2PVGC 3M76A 4FLHA 1F77A 3DBHI 1RLFA 1HTQA 4GTQB 2L00B 5E2JA 3VVWB 2JF5A 2E3TA 4IW0A 4YTPB 1O79A 3Q78B 2OJRA 3ENEA 1WXSA 3VH3B 5H92C 1YN4A 3DWMA 1TKGA 3ZNZB 1ZGUB 4YT0B 3UF8A 3VXDA 2UWQA 4Q88A 3RN9C 2WXGA 2ZIRB 1W3YA 1SE2A 1MPEA 4PYUA 4HKZE 1JMLA 4WQMA 4S17A 3R66C 4HCNB 2WU5B 4J3OD 1JCSB 2WU2B 1FBOA 5JHBA 1F9OA 1Q0WB 1WXMA 2MP2B 2RGFA 2D3AA 1OJMA 4M00A 3FILB 1GLMA 3WCQA 2L0FA 3RD2A 4EZKA 4E1YA 3QFYA 2JX5A 1WZ0A 3ZJUA 2I2YA 2OEDA 4AOFA 3AU5A 2MJEA 2Z0DB 1SQCA 1OQQA 1QT9A 3BWUD 3CF6E 1N7QA 2F0YB 2K5PA 5AGDA 4HKQA 4FBJB 1CQVA 1FM0D 3V61A 1WZ3A 4E3CA 2L0TA 5ILIA 4US8A 3I63C 1E5WA 1WU5A 2WDAA 1WMHB 4USAA 1O6HA 2KACA 3IVFA 2LRUA 1WF9A 2Q5WD 3ZTDA 4NQLB 1FAEA 2NPTB 3D3IA 2XK5A 1DOYA 1NI2A 4DXGA 3OLMD 4KSLC 4GTSB 4ZHPA 2IO0B 2GZ6A 3LJ3A 4C7ZA 1HQRD 2DRRA 2D3CA 2WS3B 4JE3B 2RSUA 1KZOB 3W7XA 1P7FA 2HE7A 4MMHA 2A4ZA 3SDUA 3W5MA 4N59A 3U30A 3APFA 3VTUA 1IGCA 2J0KA 3HM3A 3GS2A 3VSMA 3RFZB 2BB5A 2BKFA 4W9HA 4DDGD 3BYTB 2K6DB 4C80A 3P42A 1N62A 3EUVB 1RWCA 5ILYA 3RNFC 1XLNA 1HZ5A 2D3GA 3Q3NC 3QK0A 4DHJD 1R4NI 1WRIA 3NG0A 1JCKB 5IO9A 3S9VA 4C4VA 4BOJA 2K22A 2WGSA 1GUAB 1YX5B 3N3KB 3W1SA 2L76A 3P63A 3DBSA 3PZ1B 3NOBA 4LNKA 3T3OA 3HIZA 4TV3A 1EF1A 3Q8FA 3M7LA 3T9LA 3ANIA 2GOXA 1F1HA 2CQTA 1N95B 4I6LB 1I4PA 3NHEB 2V8JA 4DBGA 3NFVA 2G02A 2KQ4X 2C60A 4XDDA 4XYCA 5EE0A 1UZXB 2P0VA 2EABA 4YSYB 5EE9A 3H7SA 2G4SA 4W9JA 2BF8B 3DSVB 1EWYC 1TNYB 3UIOB 5EDSA 5JZEB 1ZW7A 2WX1A 3DSSB 1H14A 2EMSA 2RDHA 2N1VA 1WX9A 1QLBB 3AEGB 3DPDA 2YLMA 4GTTB 3LDZE 3OAWA 3M77A 3GZNB 5TR5A 3V62A 2Z8LA 3GB1A 3MC0B 1HM2A 3RX8A 4RM9A 2MHJA 1TIFA 2V4LA 3N30A 3H6NA 3IT4B 3OG5A 5FR6A 4AP4C 4G50A 4B0EA 2EMTA 3GT5A 3R7QA 1N7NA 2L32A 3Q69A 3Q73B 3TJPA 1FMAD 1NVID 4DXAB 5J2RA 2KYWA 2IGGA 1FXIA 1JALA 3W7TA 4DXFA 3R7RA 2XK5B 2LGSA 3ZYYX 3A33B 2VN4A 3QSPA 3QDEA 1M94A 3TEYA 5CZLA 2LXCA 1Q1OA 2AYOB 2JJBA 2M4NA 3DSUB 1HXYD 1FCLA 4BFRA 2WXIA 2FUQA 4IG7B 1KF6B 4G11A 1QZEA 3WIMA 1LXMA 3RNCC 3TIXA 4JJJA 2IZVB 2ZNVB 1GOZA 5D2MB 1GXNA 2KJHB 5JHAA 2AEHA 4DQOC 1I4XA 3HVZA 3E30B 1E9MA 2V3PA 3ABVB 1JROA 1G87A 4FJZA 5L83A 2MH7A 3Q8BA 3UINB 5GW7A 1ZXIA 3RJ3A 2K9XA 4REZA 3L0WB 4FULA 4TUUA 4BVUC 4K3CA 4ZH1A 2AL6A 2JUOA 3DVNU 4XDCA 5HI1A 5J17A 2LWPA 3G4FA 1KLGD 3JSVA 4K7WA 1TN8B 3KQ4A 3N32A 5GY3A 4B9KA 2BYTA 1LD7B 5IAAC 5H8YE 2XWJB 4YDOB 4HDOA 2NR2A 3N20C 2WXKA 2MJDA 4FJVB 4O1NA 2L3ZA 3NZSA 1FT2B 4RF0A 4MDKE 2B4FA 2WY7A 2V8KA 2DYMA 2DLBA 2JZPA 5CX3A 1N5XA 2NCNA 2OOBB 4W9FA 3MHSD 3EHVA 4M8MA 1N7PA 4LIXA 4P7IA 3MJWA 4HCPB 3BVGA 3B0AA 3DHIC 3PZDA 4L23A 1GHQA 3KH0A 1CB8A 3RUIB 5D3DA 3NVVA 3HXCB 3M95A 4K3BA 3ZNHB 1L4ZB 1TS2A 2JF4A 1MHXA 1V8CA 1RFKA 4OZWA 3SDTA 1N63A 3A9JA 2KWDA 5DPTA 3KSQB 2IY1B 2QDFA 3VUXA 2HD5B 1I35A 4GL3A 4LJPB 4BKGA 3SD5A 5L95C 3S4BA 1I4QA 3X17A 2IDYA 2FUG1 2QILA 1H3BA 3RMKC 4OZAA 3ZKJC 2FBWB 1KREA 1E90A 1XCQL 1V97A 4RGOS 4WVBA 2KN5A 4NZLB 1N60A 1EWCA 5BYRA 1H8CA 5HKHA 4W9DA 1V5TA 2C7MB 1LFDA 1F0ZA 2O2VA 2PIAA 4BOZB 1B9RA 4MACA 2WDRB 1YQBA 5DHIA 4GLSC 2IJ0A 4ANUA 4HJGE 2KQSA 5IM1A 1YJJA 1IGDA 3AEBB 3DVNV 3QJZA 1H37A 1N23A 2EADA 2LI5A 3KWLA 1PDXA 2WWZA 1TS5A 2MLBA 2RD0A 5IOIA 2UYZB 5DGQA 1YJIA 1JCRB 1XLQA 3UI3A 2QEJC 5AZFA 4C7YA 1WZZA 1IBXA 1KRFA 3VSNA 2PPHA 3RZFA 4LNOA 4FXGB 2QCZA 2KVZA 2M0AA 2H6GB 2INDC 1M4VA 1YOVB 1ENFA 1LOHA 2BYFA 4EL8A 3JSVB 1D5MC 2N9PC 3P5PA 1D8DB 3M63B 1N4QB 2QC8A 4EEWA 5EE1A 3VRAB 3ZIMA 4XWTA 1KLUD 4YCRA 2J0JA 2LEKA 2AQ3B 3DVGX 1K51A 1A70A 1OEYJ 1PGBA 3CSFA 3JVZX 4EE2A 1QOFA 3QWZB 3KUDB 1G9GA 2ZW0A 3DCGA 2DHZA 4WAAA 2CJNA 2KN4A 2XNAC 3P1MA 3B2FA 3VQIA 4W9GA 1KRHA 2N9KA 4LLGM 3X23A 1XLPA 2C7HA 2MBEA 3I3TB 4TSSA 4HPMB 1TGZB 2HJ1A 2GH4A 1SF0A 2PJHA 3RYTA 1DOGA 1FEHA 1TS4A 1RWGA 2BPSA 1VD5A 4F7ZA 1X1JA 1ZPSA 2V1YA 4ZOHC 4A3OA 1UELA 4DWFA 1SBBB 1N4RB 2G1EA 4XC2A 1L2NA 1N24A 3A9JB 1QKZA 2L7RA 3I57A 3Q8EA 4AQ7A 3AE7B 3APCA 3P4RB 3ML8A 4W9CA 1T0SC 1C78A 4LNIA 5HG2A 3LYYA 4JGHB 3AMZA 3TEWA 4F8CB 4PT5A 4YSXB 1Q5WB 2BVCA 2WINB 3AEFB 3AN1A 2ACZB 3ZLZA 1X9DA 4RNAA 2AQ2B 2ZISB 1FRRA 2FCSA 2N7DA 1VZ8A 1FO4A 1SJED 4J6IA 4GTRB 3PZ8A 3H7PA 1AWDA 2Y5PA 3L16A 2O2VB 3QIJA 3V60A 2NS5A 1N9AB 1KM7A 2ICIA 4K7SA 4DDID 3PGEA 2K0PA 4ASWC 1QBQB 1KLVA 1V1OA 1I8QA 2LVPA 2VZKB 3W9CB 2Z0EB 2DZKA 4X57B 4RH6A 1VR9A 1LQBA 4OZBA 4NNJB 1VZ7A 4II2B 2CU3A 4N6EB 3B08A 1EF5A 3PV1A 4WH4A 3SAEA 2BB6A 1L4DB 2VH1A 3VFKA 2VH2A 3PRZA 2FAZA 1D4BA 4FJQA 2JRIB 5GZKA 1D3ZA 1IBXB 4HROA 1WM2A 3W5VB 2WYNA 3LB8C 3V3XA 4XE0A 3DBRB 2SQCA 1GNUA 1TZOA 4J5TA 1UBQA 4ICVA 1HTOA 2ONHA 1SIFA 1WYWB 2B39A 1GXOA 4ANWA 4GU2A 1AYFA 2KMAA 1E6EB 3RX5A 3GLYA 1XF5L 1VRAB 3V6CB 1UGJA 1L0VB 1UNSA 3AULA 4NJ7A 4TF4A 1MI0A 4D4CA 2FE8A 3EUB2 1N94B 3P4SB 5IKHA 2OKXA 4AYPA 1FT1B 2ZZPB 4NPNA 1ULVA 2M8SA 3IAM1 3KWVA 4LNNA 3R8BA 3ACSA 2LUEA 1VZ6A 2NVUI 4E71A 1F9DA 3AXCA 3C19A 1HXCA 1N1ZA 4K1RB 4G0NB 4BKSA 3PZ3B 1L0XB 1YNTE 3AE1B 4K81A 4LK0M 2DBYA 4OZCA 4A20A 4EZLA 4FNVA 2MBHA 2WYQA 1E0ZA 1OFFA 3TEXA 5D7GA 2IO2B 1YJ1A 4IDIA 2NBVB 1I42A 1AARA 4JL9A 5KHQA 5FO8B 1JWSD 3QC8B 1K72A 3VTWA 2SEBD 1KSCA 2WXRA 3A9KA 2HTHA 3DQVA 3H7PB 3P4PB 1CEMA 3M7BA 4EKUA 1HN0A 4AJWA 1V5DA 1UT9A 1WXQA 4L2YA 3AECB 4MGYE 3EFUA 3DRAB 3MC8A 1DGJA 2LUMA 2MQJA 4XWWA 3L4PA 1TF4A 2GBJA 4GTOB 3ZXRA 2FUTA 2JYTA 1PUTA 5CA3A 3JYUA 3VAWA 1GPXA 2LZ6A 3SQCA 4KKIA 4KIKA 4PS3A 4ZH5A 4R3DA 3NVZA 2EELA 4P1CC 3EECA 3AFLA 2VRRB 1BT0A 2W9NA 4OK4A 4URKA 3PREA 2ZVNA 3W5NA 1HX9A 2E6XA 1QSJA 2FIFA 2LD9A 2KLGA 3BIID 4YWGG 1VLBA 4NJ6A 2K25A 1FPPB 2KMCA 2NOJA 5DCNA 3C0RB 3WKIA 1H39A 2KT7A 3U7ZA 4FXKB 1SJHD 3O13A 1GJZA 1NEKB 1G9JA 1GAHA 2GBNA 2FCQA 2N9LA 1ISNA 3X0WA 5MPOA 3DDCB 1I4RA 2QNOA 1YN3A 5IN7A 4LNFA 1N4PB 4JIOU 3Q14C 2AFAA 3PS6A 2D3BA 5D94A 3T8MA 4JWSC 1QF6A 4ANXA 5JXVA 1D6EC 3OEDA 2IGDA 1G6IA 3H9DA 4XZ4A 2CR5A 3T3NA 4C56C 4WVCA 1LM8B 1TN6B 5HHDG 3SDRA 1V1PA 1N6ZA 2BGFA 1PGAA 5DPSA 3AV8A 4V1SA 5ILDA 1Q10A 3AE3B 2GBRA 3QX1A 2MA9B 3VUWA 3RSYA 1V7VA 1FNWA 1T6BX 2B3AA 4OW0A 1L6VA 3APDA 4FN2A 1SEBD 1P7EA 2FV0A 4KTPA 3SFYB 4Z4LA 3QG0A 2M19A 1C82A 3P2BA 2N9EB 3G6JB 1VDVA 3D5RA 3SEBA 3A9KB 2ZPYA 5BYQA 2KD0A 3WC3A 2KWCA 1GB1A 1V5CA 1J19A 2JQRB 4DI5A 3NS1A 1WGGA 2WY8A 2DENB 4TQ1A 4YXDB 2CS4A 4IOIE 1LD8B 4B0MA 1O1RB 4P6VF 4BBNC 2MBQA 3DSXB 2MX2A 3QPFA 2PE9A 4B6WA 1GAQB 2MRPA 3BK2A 2MCNB 2G4DB 1V2YA 1H36A 2PN5A 1R7SA 1LF9A 3QCAA 2H6IB 1KFGA 4OJZA 3OJ4B 4B95A 4KDIC 2KJ6A 3IBEA 3PLUA 3M3JA 3G4DA 3M62B 4KIKB 4N58A 1GC7A 2ONGA 3ALBA 3NVYA 3BVZA 3J9CA 3H1UA 1P98A 2GLSA 1G6JA 2NTTA 3P5RA 3ONSA 4JLCA 1RWHA 2PVOD 3Q3JA 4II3B 3WALA 2D5JA 2W55A 2K3UA 1RRBA 3R2TA 2K39A 2H6HB 3QARA 5ILKA 1JRUA 1O1TB 3QAQA 3DWGC 3PTFC 2KWUB 2I38A 3BY4B 3WKFA 1EO6A 1C76A 3AM9A 1MZCB 1WGRA 2PTLA 4HK2A 3NS8A 1ZDVA 4F10A 3WUXA 1FIQA 3GOEA 4K7UA 4KGTA 1E7PB 1GA2A 3DHHC 1WU4A 1K8RB 3AH7A 3M00A 5IL3A 3EZ8A 2KQ7A 2BW2A 5M7YA 1V1PB 4WU0A 2R2OA 5CD2A 3AE4B 3QXQA 4V1RA 1C9FA 3BZDB 2KX0A 3SDQA 4RF1A 5AEKB 1GSZA 4RGNA 3RCZA 2FV1A 2H6FB 2EKEC 2RPQA 5C2TB 1ZKHA 2N9XA 3IT6B 4WJNA 3Q8AA 1WJ4A 4WWPA 5IK9A 1V5OA 4ANVA 2G0DA 2IYDB 4TXTA 3RZWC 1J0GA 1S1QB 3UQBA 2M56B 3WIWA 2XN9C 4C4VB 2KOXA 2D11A 1WM3A 2BS2B 2PE6B 2J0MA 1WJNA 3DBLI 2ZCBA 1T0QC 3U2SC 2LXAA 2MBOA 2WX0A 3E56A 4GTVB 1TN7B 4G3XB 1YN5A 2ZEQA 3JW0X 5IL8A 4PK1A 2BYEA 4L0GA 3W7SA 1C3TA 3V6EB 3DBHB 2DZJA 1QQRA 1WGKA 4FHJA 2RDGA 3RI7C 2BRVX 4HEA1 3W7WA 1F9JA 2LHDA 2J42A 1BUIC 3ZRCA 1J0MA 3QWTA 4PYZA 2R2QA 1AN8A 4Q2BA 2FCNA 1N7OA 3RNGC 4I6PA 1TTNA 4ARIA 4CJ0A 1O5MB 5JPNB 2FNJB 1R4MI 3WKHA 2INCC 2WP9B 2V8IA 4E74A 3QXFA 3DSWB 4W9LA 3EGRA 2B76B 1J8CA 1L5PA 2JVCA 2LGYA 4TMAB 2KK8A 1KJTA 4EZJA 1Y8RC 5IKCM 2DAJA 2IEJB 1X81B 1WIAA 2LJIA 4BZAA 1L7YA 2IPKD 3PZ2B 1ROEA 2ZVOA 5G5GA 2BQQA 4IC7B 3KLSX 3Q7AB 3NZUA 4LNGB 4C00A 3B1LX 1XWTA 1SA4B 1V7WA 3CIHA 1WGYA 3BVMA 2BRWA 1RM6C 1TJEA 4UDUC 5DPRA 1WYGA 3GE3C 5IK0A 3DVGY 4RFBA 1O1SB 1OQYA 1LGRA 3VXWA 4YTMB 1E8YA 3ANJA 1XQQA 1FXTB 3TBLD 5C23A 1MG8A 2KFKA 4FJYA 2O6VA 2SAKA 2MBBB 1SXTA 1W6JA 3NRZA 3W5UB 2KDFB 2V3NA 1BXTA 4DK5A 4EFOA 1E10A 3N0FA 2XQWA 1N1BA 3S2AA 5MEHA 3ZW3A 2AX5A 1UWMA 5BO4B 3MFGA 1H3CA 1YD8U 1IS9A 1WX8A 2GBKA 2KDBA 1KSDA 1V80A 2BWES 3Q79B 4RMAA 3I5JC 3E9SA 1WY8A 1YIWA 3M74A 1CMXB 3RNBC 1NI1B 2IO3B 4BBNF 3HUIA 3W1YA 3K9OB 2BT6A 3ZQ4A 2RGKA 3M75A 3N1ZC 1HE8A 2K1FA 3E32B 1YMHE 5TSSA 4MH0E 1N7RA 3ZNGC 1WH3A 1K50A 2VZKD 2AQ1B 5IKAA 1P9DU 4OK2A 2L52A 3E7JA 1H54A 1JWUD 2V3SA 3WA0A 2KDEB 3PO0A 4MELA 2NVPA 1L2AA 3UGBB 1R4NB 3RT3B 5AZHA 4ZYNA 2CHWA 2WIIB 4L1BA 5IP4D 4N9F4 4D2KA 1AYXA 2LVOA 2K8BA 4NJCA 4GXBA 2D2QA 2PEAA 3HK0A 3EU8A 1NDDA 4MSQB 5D6JB 4GAXA 3ZJTA 2BRPA 1LXDA 3TMPB 3HRDD 3AE5B 3RPFC 1VJKA 1Y56A 4ZRQA 3P2CA 1D5ZC 4MGIE 4ZRPA 1TBEA 3M7EA 2PW9A 3ZGZA 2ASQA 3NUHB 3VH4B 4LDTD 2WXLA 1JCQB 4EUTA 1HXAA 4H2AA 2WDVB 4MM3A 3HXDB 4YTNB 5BMIA 1FFUA 4W9EA 2LVQA 3U52E 3VTVA 1GG3A 1E7UA 3H2WA 4GDKA 4OVUA 1JS4A 1UBIA 1WE6A 4IUMB 4LJOB 2AWTA 2KFKB 1ZDXA 4KGRA 2WXHA 3CIRB 4RGTA 2WXJA 1C3DA 3W2DA 3BK1A 2KC2A 4L6XA 2WCOA 1L6UA 3QHTA 3ECIA 4ZHOA 3M02A 2Y3AA 1X1IA 4IWPA 1EM7A 3ON6A 1C4AA 4GMVA 1XWQA 4AYRA 3UQAA 4M0WA 2N1WA 1TKYA 3CMMB 1IA7A 4GTPB 4F1SA 2D10A 2NMQA 2RI9A 4CE7A 4WAFA 1V86A 1TS3A 3L17A 1VCBA 3URYA 3GZNI 5HFYA 2L8JA 2KZRA 1V6EA 2G3QB 2CHZA 2CHXA 2DROA 4JQWC 3PYAA 2ZBLA 2WXMA 2DYBA 2M1MA 2J4XA 2KAJA 2ON8A 1ZOYB 2REXA 3QT9A 3M72A 2C7NB 4LDTB 5E6OA 4M02A 4ZYSA 1H3AA 1NYRA 4ACFA 3VHTC 3E33B 1SE4A 4WWNA 3V05A 3SHQA 5LXIB 2V4IB 3ZNID 5JPMB 3OJ3A 4GN1A 3AEEB 3EC8A 3M78A 4DOEA 2R61A 4CYEA 1W6KA 2KMMA 3PZ7A 3OXUA 2JWUA 1WGDA 3E37B 2KO3A 1FRDA 4S0RA 3Q2AC 1ZUD2 1I4GA 3PYBA 1QOAA 2JRHA 1ESFA 2C9WB 2W3RA 2GB1A 5AUIA 1UGMA 4A90A 1SB3C 2QHOA 3DOWA 1FP3A 2KDIA 1JW9D 3ZRFA 1S63B 1JWBD 2IBIB 3RULA 1RQ5A 1WXAA 1NENB 3K11A 3D32A 1S3SG 1C79A 4OHJA 4D4AA 1V9JA 3VUYA 1UG9A 3E73A 4MM3B 2PMVA 3WAMA 2A5UA 4WWMA 1IUEA 1F52A 1O6QA 1V81A 3WKGA 2MSED 1OEYA 3S4DA 2LGXA 2LHEA 4JX1C 2BS4B 4HVBA 4WJQA 3A4RA 5JH5C 4HWIB 4FUSA 4GDKB 4GGQA 2JT4B 1SE9A 5FKAC 4ZDVA 5C3JB 1PFDA 2JSVX 1AW7A 1NXCA 2AHGA 4ZRKA 1CZPA 4EHMB 1SGHA 2ZPNA 2W3SA 4BKSD 3ETRA 2J53A 3ZUNA 1C1YB 4IKGA 3KUCB 4MGZE 1IA6A 3A4SC 3RX7A 1V7XA 1PGXA 3PPAA 4CJ1A 4RCOA 1WSPA 2Q1FA 4KKJA 3Q6BA 3VDZA 2LRWA 4M0WB 3TUOA 2AHFA 5G5HA 5ILHA 2X38A 3I9V1 4M8NA 1RWSA 1HV6A 1O6RA 4QAYA 4MBGB 3RNAC 1DYQA 3KSLB 5GXGB 2N4FA 2FCMA 1C4CA 3VR8B 4AYQA 3TSSA 5D3IB 3FAHA 4ITKA 1F2RI 3NNBA 3M7CA 4CHKA 4MEMA 4NAMA 5T8IA 4MGKE 1TNBB 1TNUB 1OQRA 1UD7A 3H3KA 2H89B 2N0SB 2BKRB 2J7QB 2L05A 3MJ5A 3AI5A 1FO2A 1KWFA 1EU3A 2JYEA 1N4SB 4TKNA 4FHKA 4HPLB 2EKIA 1N5WA 3AEAB 1STEA 5LNK1 2JXTA 2CQSA 3RRSA 1Z2MA 4GTMB 2MW5A 3L13A 4GIVA 2WXQA 1D5XC 4RM8A 4NEIA 2YVCA 4Z4JA 4KSKC 4GSWA 1UUPA 4A55A 1J0NA 3VR9B 4BAXA 5FO7B 2Y5CA 3HXEB 4AJYB 1ACCA 4AYOA 2QSDA 1OJNA 1WR1A 4M76A 2WQYB 2OJWA 2ZZRA 1HA5A 1LXKA 4IM3A 4EOYA 3A1QA 4ICUA 5CTRC 1QOGA 4WJPA 2BEDB 1J7AA 2KFJA 4IWQA 4KVGB 4MJSA 1WJ6A 1FMIA 1OTRB 2JU6X 1MJDA 3KLSA 2HJ8A 4BKTA 1KZPB 1ET9A 3MHZA 1I7HA 4BOSC 1MFWA 4DODA 1WI0A 1LF6A 3AB5A 4FA6A 1L1YA 2JWZA 2RDBC 2N7JA 1T5XD 2DRQA 2M0XA 3FKYA 2WXNA 4LNBB 1E8WA 2DZIA 3B2GA 3KUZA 1FD6A 2R2LB 5FOBB 3O65B 2BS3B 3KYDD 1H35A 3PHWB 3SDLC 4A6QA 3PSEB 4JWUC 4GOCA 5J18A 2XBBC 1HEZE 1FFVA 1MG4A 4MMIA 4WJOA 4BOKA 3ZXVA 1QILA 2WNMA 1NC5A 1UWXA 4AUQC 2WLBA 1TYGB 1V49A 2JZ3B 5FR3A 3PRPB 1XXGA 2G9HD 2FBAA 4P16A 5CHVC 2LGDA 3QA8A 2J5CA 1UMPA 1F1SA 3M73A 4LCDE 2DZMA 1LTXB 4AWJA 2KTRA 1R76A 2W54A 2XEWA 2KDMA 3AE8B 2HTME 2PKOA 2QJLA 3PT2B 3TL5A 1HMWA 1SSNA 2G45B 2BWFA 3IHPC 1WR6E 5BMHA 4OVVA 1L0YB 2Z59B 2WHIA 4NAWA 3AU4A 1RWAA 1P3QU 3ZTCA 3L10B 3Q8CA 1TY2A 2GBMA 2K8HA 3K7XA 4KZ0A 1ZXHA 3M71A 3PVLA 1HCUA 1UF0A 1XCTL 4M01A 3R2IA 3WANA 5BMGA 2Z07A 4DHJB 5AZGA 1H4RA 2V0GA 1PYWD 2LFIA 2ZNVC 5IK6A 3S4CA 3Q75B 2MEKA 2MWSB 3AE9B 2BYVE 2K6QA 4WWOA 5KHOA 1H13A 1SE3A 1B1ZA 3A1QB 5JMFA 4IWOA 3ZDTA 5ILJA 5C05A 3UIPB 1WGHA 1RFAA 3DBRI 2RMMA 4RNQA 2BTEA 3NJTA 2L83A 4MJSB 2NBWB 3GP7A 3HM6X 3ANKA 2KC1A 3R3MA 4KV2A 3IAS1 3PRMB 4JPSA 4D94A 4Q2JA 2QIEB 2V9HA 1KTKA 1FXAA 2FIDA 4HJKA 2ZW1A 1QAZA 4PS8A 3W1SC 1DOIA 2GI9A 4MU9A 3HXBB 2RPVA 4A3PA 5KKBA 2LASA 4C1SA 2E24A 2KNBA 1FNVA 4GDLA 1J7CA 4KZCA 5EASA 2LJ5A 1FCCC 1YQ4B 3TF4A 3W7UA 3AE6B 2VN7A 3PZ4B 2YEPB 5CHFA 1FBWA 4MSMB 5G55A 2AL3A 4CQNA 3MP9A 4QT9A 4US9A 4WIPA 2F6DA 2CU1A 4TQ0A 5E6PA 3B9JA 2XFGA 5IA7A 4AS1A 1N61A 3LXFA 1DL2A 4YL8A 3C72B 1NYQA 1WJUA 3TEZA 1OJPA 2E22A 2DRSA 3EU5B 3H7LA 4LNVA 1KFYB 1K53A 2I1KA 1YX6B 3H8HA 1DOXA 2KTRB 4YSZB 1PQSA 2UU7A 1WWTA 3GE8C 1N22A 1F2RC 2DNFA 3T33A 2H88B 1SIJA 3SFDB 3VRBB 2KLCA 3PMMA 4NAWB 4XUVA
chains in the Genus database with same CATH topology
1TF4A 4GTOB 2WXOA 3HVDA 3Q8BA 1ZDXA 4KGRA 3DSSB 2JYTA 1PUTA 1H14A 2WXHA 3CIRB 4RGTA 2WXJA 1C3DA 3W2DA 5CA3A 1TNOB 2RDHA 3BK1A 5DGRA 4L6XA 1QLBB 2YIKA 3AEGB 1L6UA 2D8LA 2JG0A 1GPXA 4GTTB 3SQCA 4KKIA 4ZHOA 3M77A 3N9YC 2Y3AA 2Z8LA 3GB1A 4ZH5A 3MC0B 4R3DA 1EM7A 3NVZA 3ON6A 1C4AA 3RX8A 2EELA 4MH8A 3IT4B 1XWQA 4YDEB 4C7ZA 4AYRA 4M0WA 4B0EA 1TKYA 1DOYA 3GT5A 3W5NA 1IA7A 4GTPB 2L32A 2E6XA 3Q73B 3Q69A 3ZJVA 1QSJA 1FMAD 3D5SA 1NVID 2NMQA 2RI9A 3BIID 4CE7A 4WAFA 4YWGG 1TS3A 4ONTA 1FXIA 1VLBA 1JALA 2IGGA 3URYA 1FPPB 1JWAD 5HFYA 2NOJA 3W7TA 2PLPA 4DXFA 2EAEA 4ZG8A 3WKIA 1H39A 2INPE 2DROA 2WXFA 3U7ZA 3BYYB 3PYAA 4FXKB 1SJHD 3AEDB 3O13A 1NEKB 4L9PB 2ZBLA 4RGMA 1G9JA 1TKEA 2WXMA 3ZYYX 1GAHA 2VN4A 2D5GA 3QSPA 2N9LA 2J4XA 5MPOA 2KAJA 1I4RA 2QNOA 1EU4A 1YN3A 2ON8A 1LO5D 3QDEA 3TEYA 1ZOYB 5CZLA 3QT9A 1N4PB 3M72A 4WVAA 2AFAA 4ZYSA 2JJBA 3CWIA 4JWSC 1QF6A 3DSUB 5JXVA 1NL4B 1H3AA 1HXYD 1FCEA 1NYRA 1D6EC 3OEDA 3QT3A 1ZE3D 1FCLA 2IGDA 2HDEA 1G6IA 2A8ZA 2FUZA 2WXIA 1KF6B 3E33B 1SE4A 3NZ3A 3V05A 2V4IB 3T3NA 2WXPA 4JJJA 5JPMB 1C77A 2IGHA 1XEEA 4C56C 2CJOA 4WVCA 1GOZA 3AEEB 1GXNA 3M78A 1TN6B 5I4DA 3VW5A 1S64B 4DOEA 4DQOC 4GDLB 1I4XA 3SDRA 3E30B 1E9MA 2V3PA 1V1PA 1PGAA 2R61A 3ABVB 3AV8A 1MVKA 4V1SA 1JROA 1G87A 1W6KA 1Q10A 2KMMA 3OXUA 2MH7A 2JWUA 2ONQA 3AE3B 5GW7A 3PZ7A 1ZXIA 3E37B 3RJ3A 2K9XA 4REZA 1FRDA 3RSYA 1V7VA 4KX6B 4ZH1A 1FNWA 1ZUD2 1I4GA 3PYBA 1QOAA 1T6BX 4XDCA 4ARCA 1ESFA 4OW0A 1L6VA 2W3RA 3FC4A 1FNUA 2GB1A 1SEBD 5AUIA 5HI1A 2OHFA 1P7EA 1GAIA 2FV0A 4A90A 4KTPA 1SB3C 3SFYB 1KLGD 1TN8B 3WIRA 1KKTA 3KQ4A 2A73B 1FP3A 3QG0A 5GY3A 4Z4LA 1JW9D 2M19A 3C8YA 2BYTA 1LD7B 3G6JB 2NTSA 5H8YE 2XWJB 1S63B 4YDOB 1JWBD 1VDVA 1RQ5A 3D5RA 2MJDA 2WXKA 3SEBA 4O1NA 3Q7FB 1NENB 3K11A 4KGSA 4D4BA 1YQ3B 5BYQA 1FT2B 1CLCA 1QOBA 2TSSA 2LMCA 4RF0A 1C79A 2B4FA 2WY7A 2J52A 4OHJA 4D4AA 3SDVA 1UG9A 3E73A 3WC3A 2PMVA 4MM3B 1XLOA 1GB1A 1V5CA 2V8KA 1K52A 1I4HA 1KH0A 2JQRB 4WWMA 2DYMA 1FO3A 1IUEA 3DPYB 3SFXB 3NS1A 2DLBA 1O6QA 3WKGA 2JZPA 3U4EG 2I07B 2WY8A 3S4DA 1N5XA 2LHEA 2BS4B 4JX1C 4TQ1A 4YXDB 1HZ6A 4IOIE 4LIXA 1LD8B 4FUSA 1SA5B 4GDKB 4B0MA 1O1RB 4P6VF 5FKAC 1XO3A 2LGIA 3BVGA 1PFDA 2JSVX 1AW7A 5EE3A 1NXCA 3DSXB 5C3JB 2AHGA 1CZPA 4EHMB 3QPFA 1GAQB 2W3SA 3E6UA 4L23A 3SFEB 2WDQB 1GHQA 3BK2A 3ETRA 1H36A 2PN5A 2DWQA 3NVVA 3HXCB 2J53A 5D3DA 1R7SA 5FK9C 4A9AA 1LF9A 4IKGA 4JE3B 2H6IB 1IA6A 1L4ZB 1KFGA 3RX7A 2JF4A 5FO9B 1MHXA 1RFKA 1TS2A 1HZFA 3SDTA 3E34B 1N63A 2DYOA 3OWEB 2KWDA 1V7XA 1PGXA 3KSQB 4CJ1A 4RCOA 4GL3A 3DSTB 1XW2A 1WSPA 4N58A 4KKJA 3S4BA 1I4QA 3NVYA 3X17A 2IDYA 4HRSA 3BVZA 3J9CA 2FUG1 2QILA 1H3BA 4OZAA 3TUOA 2AHFA 2XWBB 3A3VA 1CK1A 2FBWB 2NTTA 5G5HA 2X38A 1KREA 3WIQA 1XCQL 3P5RA 1V97A 4WVBA 2YEPF 3I9V1 4RGOS 1GB4A 3EQAA 4NZLB 1N60A 1RWSA 2PVOD 1EWCA 1O6RA 2D5JA 4KTRA 4MBGB 2K3UA 2W55A 5BYRA 3R2TA 1DYQA 3KSLB 2H6HB 1O1TB 2MJ3A 3DWGC 5GXGB 1F0ZA 1C4CA 2I38A 4AYQA 1TNZB 3TSSA 3VR8B 5D3IB 2PIAA 3FAHA 4ITKA 3WKFA 3SR6A 1F2RI 1H12A 1B9RA 3CU7A 4MACA 1C76A 1JQ4A 1GXMA 2WDRB 3M7CA 1C4PA 1MZCB 3AM9A 4NAMA 5T8IA 4GLSC 2IJ0A 2PTLA 4HJGE 1TNBB 1TNUB 1OQRA 3AFJA 3H3KA 1JWMD 1FIQA 3WUXA 1AGMA 1ZDVA 2H89B 2N0SB 4KGTA 1YJJA 1E7PB 1IGDA 3AEBB 3FILA 1GA2A 4OVZA 3MJ5A 2L1AA 1FO2A 1H37A 1WU4A 2EADA 3NVWA 1KWFA 1EU3A 2JYEA 3AH7A 3KWLA 3QFZA 1PDXA 1N4SB 3EZ8A 5E6JA 2EKIA 1N5WA 3RENA 1STEA 1TS5A 2BW2A 3AE2B 2BBCA 3AEAB 5M7YA 2JXTA 5DGQA 2CQSA 4WU0A 3RRSA 1V1PB 4GTMB 1YJIA 1JCRB 1D8EB 3EA6A 1XLQA 3UI3A 1ET6A 5CD2A 1V8CA 2QEJC 1D5XC 2WXQA 3AE4B 5AUKA 4C7YA 3QXQA 1WZZA 4V1RA 4Z4JA 1IBXA 1C9FA 3BZDB 1KRFA 3SDQA 1UUPA 4FXGB 4A55A 4RF1A 3VR9B 1GSZA 4RGNA 2M0AA 1CJEA 2W82A 2FV1A 4WURA 2H6GB 5FO7B 2Y5CA 3HXEB 1M4VA 1ACCA 1ENFA 4AYOA 2QSDA 2H6FB 4EL8A 1D5MC 4M76A 2INNE 2WQYB 4MT5A 5C2TB 1QQFA 3P5PA 1D8DB 2ZZRA 1N4QB 3IT6B 1BMLC 5EE1A 3VRAB 1HA5A 1RYJA 3Q8AA 4XWTA 1KLUD 3HXFB 4YCRA 4D4DA 2GRIA 2LEKA 1QOGA 2G0DA 2AQ3B 4TXTA 1K51A 2BEDB 1A70A 1J7AA 1NI3A 1PGBA 1TY0A 3WIWA 2M56B 2XN9C 4EE2A 1QOFA 1KS8A 1G9GA 2ZW0A 1FMIA 3S4AA 2BS2B 1ZP0B 2JU6X 2CJNA 2KN4A 2RI8A 3KLSA 2XNAC 3U2SC 1J7BA 3B2FA 3P1MA 3VQIA 1KRHA 2N9KA 1KZPB 1ET9A 3MHZA 1I7HA 3E56A 4LLGM 4GTVB 1TN7B 5M7IA 3P4QB 4DODA 1LF6A 3AB5A 1YN5A 1XLPA 4TSSA 1WU6A 1T3QA 4L0GA 3W7SA 1MHHE 1L1YA 2EACA 2GH4A 1SF0A 1DOGA 4A8XC 1FEHA 1TS4A 1JRPA 2N7JA 4LTUA 1T5XD 3HVZA 1VD5A 2DRQA 3QRYA 1QQRA 1WGKA 4LNBB 2WXNA 2RDGA 1ZPSA 4ZOHC 3GZKA 3B2GA 3IXSA 4HEA1 3W7WA 1FD6A 2R2LB 2QMTA 2LHDA 2J42A 1BUIC 1SBBB 1N4RB 2G1EA 5FOBB 3QWTA 2BS3B 1H35A 3ACTA 1AN8A 4Q2BA 1QKZA 3I57A 4A6QA 3Q8EA 4JWUC 3AE7B 5BYSA 4AQ7A 2PVGC 1DCEB 3M76A 1F77A 3P4RB 4ARIA 1HEZE 4CJ0A 1O5MB 4GTQB 5JPNB 1C78A 1FFVA 5HG2A 3LYYA 3AMZA 4BOKA 3TEWA 5E2JA 4PT5A 4YSXB 1QILA 2WNMA 1NC5A 3WKHA 1UWXA 2WINB 3AEFB 3AN1A 2E3TA 2ACZB 2WLBA 1TYGB 1X9DA 4RNAA 2AQ2B 2ZISB 2WP9B 2V8IA 4YTPB 5FR3A 1O79A 3Q78B 3DSWB 3QXFA 1FRRA 1VZ8A 2FBAA 1SJED 1XXGA 2B76B 2G9HD 1L5PA 3EGRA 4P16A 4TMAB 5H92C 1YN4A 3DWMA 1TKGA 4GTRB 4YT0B 1UMPA 2IEJB 1X81B 3VXDA 3PZ8A 3M73A 2LJIA 4Q88A 2WXGA 2ZIRB 1AWDA 2Y5PA 5LNK1 1LTXB 1N9AB 1SE2A 2IPKD 1R76A 1MPEA 4HKZE 2ICIA 2W54A 3PZ2B 1JMLA 1ROEA 2KDMA 4WQMA 3AE8B 5G5GA 2HTME 2PKOA 2K0PA 1QBQB 2WU5B 1V1OA 2QJLA 1JCSB 2WU2B 4J3OD 1FBOA 2VZKB 3KLSX 3Q7AB 4LNGB 3W9CB 1XWTA 1SA4B 1F9OA 1V7WA 3CIHA 1SSNA 3BVMA 1RM6C 1TJEA 4UDUC 4RH6A 1VR9A 1WYGA 4OZBA 5BMHA 1VZ7A 4RFBA 1L0YB 3FILB 1GLMA 1O1SB 3WCQA 4YTMB 2CU3A 3ANJA 4N6EB 3QFYA 2JX5A 3Q8CA 3ZJUA 1TY2A 4WH4A 3SAEA 2BB6A 2I2YA 2OEDA 1L4DB 5HHDG 2SAKA 3W5UB 1SXTA 1W6JA 3NRZA 2V3NA 1BXTA 1D4BA 3K7XA 1E10A 2MJEA 2XQWA 5GZKA 1SQCA 1OQQA 1QT9A 1ZXHA 3BWUD 3M71A 5MEHA 1HCUA 1IBXB 4HROA 2AX5A 3W5VB 1UWMA 2F0YB 2WYNA 1XCTL 2K5PA 3LB8C 3MFGA 3V3XA 3R2IA 4XE0A 1H3CA 5AGDA 4HKQA 1FO4A 1IS9A 1CQVA 1FM0D 2Z07A 5BMGA 2SQCA 1TZOA 4J5TA 4US8A 2V0GA 1PYWD 2LFIA 3S4CA 2MEKA 3Q75B 3AE9B 1WU5A 2B39A 1GXOA 1KSDA 3Q79B 4USAA 1H13A 1O6HA 1AYFA 3E9SA 2KACA 3M74A 1SE3A 1B1ZA 1E6EB 3RX5A 1NI1B 2Q5WD 3GLYA 1XF5L 1VRAB 3HUIA 1UGJA 1L0VB 1FAEA 1UNSA 4FXCA 2RMMA 3D3IA 2BTEA 4TF4A 1MI0A 4D4CA 2BT6A 2FE8A 2L83A 2RGKA 3EUB2 3M75A 3GP7A 1N94B 3ZQ4A 3ANKA 3P4SB 4DXGA 4GTSB 4ZHPA 2OKXA 2GZ6A 1FT1B 4AYPA 3IAS1 3E32B 1YMHE 4JPSA 5TSSA 4D94A 4Q2JA 2QIEB 1ULVA 1HQRD 2DRRA 1KTKA 2WS3B 3IAM1 1FXAA 1K50A 2VZKD 3KWVA 2AQ1B 2ZW1A 2L52A 1H54A 1KZOB 3R8BA 3ACSA 1DOIA 1JWUD 2GI9A 3W7XA 1VZ6A 1P7FA 4MU9A 3PO0A 3HXBB 1F9DA 2RPVA 5KKBA 2NVPA 1L2AA 3SDUA 4C1SA 3W5MA 4N59A 3PZ3B 1L0XB 1YNTE 1FNVA 3AE1B 1J7CA 1IGCA 4LK0M 2DBYA 4OZCA 3GS2A 1FCCC 1YQ4B 3RFZB 3TF4A 2BB5A 3W7UA 3AE6B 2VN7A 1E0ZA 2WIIB 1OFFA 4L1BA 3PZ4B 3BYTB 3TEXA 2YEPB 4D2KA 1FBWA 5D7GA 4C80A 3P42A 1AYXA 1N62A 4CQNA 3MP9A 3EUVB 3DSVB 4QT9A 1EWYC 4IDIA 4NJCA 4US9A 1XLNA 4WIPA 1HZ5A 2F6DA 3EU8A 4TQ0A 1WRIA 3B9JA 1JCKB 2XFGA 3S9VA 3ZJTA 4AS1A 4BOJA 1N61A 3AE5B 2K22A 3HRDD 5FO8B 3LXFA 1JWSD 3RPFC 1DL2A 1VJKA 1K72A 3C72B 4ZRQA 1NYQA 3P2CA 1Y56A 3W1SA 1D5ZC 4ZRPA 3P63A 2SEBD 3M7EA 2PW9A 1KSCA 3TEZA 3PZ1B 2WXRA 3ZGZA 2DRSA 3NUHB 3EU5B 3H7LA 3T3OA 4LNVA 1KFYB 1K53A 3P4PB 2WXLA 1JCQB 1CEMA 3M7BA 4H2AA 3Q8FA 3M7LA 2WDVB 3H8HA 1DOXA 1V5DA 1UT9A 3HXDB 4YSZB 1WXQA 4L2YA 4YTNB 3ANIA 2GOXA 1WWTA 2CQTA 3AECB 5BMIA 1N95B 1FFUA 1I4PA 1F2RC 2V8JA 3T33A 2G02A 3DRAB 3U52E 2H88B 2KQ4X 4XDDA 5EE0A 3H2WA 1SIJA 1DGJA 2LUMA 3SFDB 2P0VA 1JS4A 2EABA 3VRBB 3PMMA 4YSYB 5EE9A 4NAWB 4XUVA 4XWWA 3L4PA 1TNYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFX B;  1O6Q A;  4GTO B;  1H3C A;  3HXF B;  2I07 B;  2WY8 A;  5AGD A;  4D4D A;  3DSS B;  2G0D A;  1C3D A;  2SQC A;  2BED B;  1TNO B;  1LD8 B;  1SA5 B;  1O1R B;  3Q75 B;  3DSX B;  2B39 A;  1GXO A;  3Q79 B;  4GTT B;  3SQC A;  4KKI A;  4EHM B;  1O6H A;  3KLS A;  1GHQ A;  1NI1 B;  1H36 A;  1KZP B;  2PN5 A;  3HXC B;  4GTV B;  1TN7 B;  4YDE B;  2H6I B;  4D4C A;  5FO9 B;  1HZF A;  3E34 B;  1N94 B;  4GTP B;  3Q73 B;  1QSJ A;  3D5S A;  3KSQ B;  4GTS B;  1FT1 B;  3E32 B;  3DST B;  4ONT A;  4D94 A;  4LNB B;  1FPP B;  2NOJ A;  4KKJ A;  2R2L B;  1H39 A;  3U7Z A;  4FXK B;  1N4R B;  1KZO B;  5FOB B;  1H3B A;  4L9P B;  2XWB B;  1H35 A;  4MU9 A;  3HXB B;  1DCE B;  4C1S A;  1O6R A;  1N4P B;  4MBG B;  3PZ3 B;  1O5M B;  4GTQ B;  5JPN B;  3KSL B;  2H6H B;  4BOK A;  1O1T B;  3DSU B;  1NL4 B;  1H3A A;  2WIN B;  3OED A;  1TNZ B;  2BB5 A;  2WII B;  2ZIS B;  3E33 B;  2V8I A;  3PZ4 B;  1O79 A;  3Q78 B;  3DSW B;  3CU7 A;  5JPM B;  1GXM A;  3EUV B;  1MZC B;  3DSV B;  1GXN A;  1TN6 B;  4GTR B;  1S64 B;  1UMP A;  2IEJ B;  1X81 B;  1TNB B;  3E30 B;  1TNU B;  2V3P A;  4V1S A;  2ZIR B;  1W6K A;  3OXU A;  1LTX B;  1N9A B;  4BOJ A;  5FO8 B;  1R76 A;  3E37 B;  3RJ3 A;  3PZ2 B;  1H37 A;  3C72 B;  4ZRQ A;  1QBQ B;  4ZH1 A;  1N4S B;  1JCS B;  4ZRP A;  3Q7A B;  3PZ1 B;  4LNG B;  2BBC A;  1SA4 B;  3EU5 B;  4GTM B;  4LNV A;  1JCR B;  1D8E B;  1JCQ B;  3SFY B;  1TN8 B;  3KQ4 A;  2A73 B;  4V1R A;  1O1S B;  3HXD B;  1LD7 B;  3G6J B;  2GOX A;  2XWJ B;  1S63 B;  4FXG B;  4YDO B;  1GSZ A;  1N95 B;  3D5R A;  2V8J A;  3Q7F B;  2H6G B;  2G02 A;  3DRA B;  5FO7 B;  2BB6 A;  3HXE B;  4D4B A;  1W6J A;  1FT2 B;  2V3N A;  2H6F B;  3K7X A;  2WY7 A;  4D4A A;  4M76 A;  2XQW A;  1SQC A;  1QQF A;  2PMV A;  1D8D B;  2V8K A;  1N4Q B;  2F0Y B;  1TNY B;  3DPY B; 
#chains in the Genus database with same CATH topology
 2WXO A;  3HVD A;  4GB9 A;  2GMI C;  2JY6 A;  1TNO B;  5DGR A;  2YIK A;  1T0Y A;  2D8L A;  2JG0 A;  4DHZ E;  3N9Y C;  5CHW A;  5EAT A;  2KJR A;  4OZV A;  4MH8 A;  2DAF A;  3TCA A;  4YDE B;  1HXG A;  4NY0 A;  3ZJV A;  3D5S A;  4ONT A;  1TT5 B;  1JWA D;  2PLP A;  5JMD A;  3HHM A;  1EUV B;  2EAE A;  4ZG8 A;  3KW5 B;  2KX3 A;  2INP E;  2WXF A;  3E80 A;  3BYY B;  3DHG C;  3AED B;  4L9P B;  4RGM A;  1TKE A;  2D5G A;  1EU4 A;  1LO5 D;  4FAD A;  4WVA A;  3IG3 A;  1U4A A;  3CWI A;  1NL4 B;  1ZE3 D;  1FCE A;  3QT3 A;  4NQK E;  2HDE A;  2A8Z A;  2FUZ A;  1RW9 A;  1E8Z A;  1WFY A;  3NZ3 A;  2WXP A;  4ZRI A;  1C77 A;  2IGH A;  1XEE A;  2CJO A;  3RNE C;  5I4D A;  3MTN B;  3VW5 A;  1S64 B;  2X03 A;  3U7D A;  4GDL B;  2O6V D;  5LXH A;  1MVK A;  1EGU A;  1A5R A;  1P1A A;  2ONQ A;  5E6N A;  4HXD A;  1OGW A;  1VD2 A;  1N21 A;  4KX6 B;  4IM2 A;  4ARC A;  4P1B C;  3FC4 A;  5G2N A;  1FNU A;  2OHF A;  4CO7 A;  2KHW B;  1IYF A;  1GAI A;  1FPY A;  1WX7 A;  3WIR A;  1KKT A;  1XD3 B;  2A73 B;  3C8Y A;  5DHK A;  1T0R C;  1XT9 B;  1RWF A;  4ZRJ A;  2NTS A;  2KXJ A;  3IFW B;  1HM3 A;  3BIN A;  3Q7F B;  2X8X X;  2KKC A;  4D4B A;  4KGS A;  2JXX A;  1YQ3 B;  1NBF C;  1CLC A;  1QOB A;  2JPH A;  2LMC A;  2TSS A;  2J52 A;  3SDV A;  5LLI A;  1XLO A;  1K52 A;  1I4H A;  1KH0 A;  1N20 A;  1FO3 A;  3DPY B;  3SFX B;  5GMV A;  4W9K A;  1IPG A;  3U4E G;  2I07 B;  4HDQ A;  1HZ6 A;  4XGA B;  1SA5 B;  5ILZ A;  5EAU A;  1XO3 A;  2KAN A;  2LGI A;  5EE3 A;  2ZJD A;  1IP9 A;  3SFE B;  3E6U A;  2WDQ B;  3ML9 A;  2CKH B;  1GC6 A;  2DWQ A;  4A9A A;  5FK9 C;  2RR9 A;  2DX5 B;  2DYO A;  5FO9 B;  3OWE B;  4FXC A;  1HZF A;  3E34 B;  3A0O A;  4DHZ B;  1E7V A;  3Q3M C;  4PS7 A;  1RAX A;  1F9G A;  3NY5 A;  3DST B;  3K9P B;  1XW2 A;  2O6V B;  2ZCC A;  4HRS A;  2IO1 B;  2XWB B;  3A3V A;  1CK1 A;  3WIQ A;  2YEP F;  1GB4 A;  3EQA A;  1KOT A;  1E8X A;  4KTR A;  4XX5 A;  2MJ3 A;  4KDL B;  3ZDM C;  2FUH B;  1TNZ B;  3KVF B;  3MC9 A;  4HLE A;  3SR6 A;  1H12 A;  3CU7 A;  3PLV A;  4F13 A;  1JQ4 A;  1GXM A;  1C4P A;  4WQO B;  2C5L C;  4W9I A;  2IY0 B;  3AFJ A;  1JWM D;  2MP2 A;  1AGM A;  1X1H A;  2K8C A;  3SU8 X;  3FIL A;  4OVZ A;  2L1A A;  1TZ1 A;  3N1X C;  3NVW A;  3EFC A;  2KTF A;  3QFZ A;  5E6J A;  3REN A;  3AE2 B;  2BBC A;  4HPP A;  1D8E B;  3EA6 A;  2M17 A;  1ET6 A;  3M01 A;  2KVR A;  4IM0 A;  5AUK A;  3L54 A;  2JZZ A;  1WE7 A;  1CJE A;  2W82 A;  1WRD B;  4WUR A;  1P0R A;  3WAP A;  3DBL B;  2I1J A;  2INN E;  3Q3F A;  4MT5 A;  1QQF A;  3LZ9 A;  1WMH A;  1HMU A;  1BML C;  2GOW A;  2D07 B;  1RYJ A;  3HXF B;  3ZVV A;  4D4D A;  1WXV A;  2GRI A;  3KYC D;  1TY0 A;  1NI3 A;  3Q3O C;  2NPT A;  1KS8 A;  3S4A A;  1ZP0 B;  2RI8 A;  2Y5B B;  2WDT B;  1J7B A;  1OJO A;  3U8Z A;  3QQ8 B;  5M7I A;  3P4Q B;  1WU6 A;  1T3Q A;  1MHH E;  5C1Z A;  2EAC A;  2NBU A;  3CST A;  4A8X C;  2N7E A;  1JRP A;  4LTU A;  3N1Y C;  3QRY A;  3PHX B;  5DPW A;  1X1M A;  1UH6 A;  1R4M B;  3GZK A;  1Z5S B;  3IXS A;  3L08 A;  3N0G A;  2QMT A;  3ZO5 B;  4I6N B;  3WAO A;  3ACT A;  5BYS A;  2KWV B;  1DCE B;  2PVG C;  3M76 A;  4FLH A;  1F77 A;  3DBH I;  1RLF A;  1HTQ A;  4GTQ B;  2L00 B;  5E2J A;  3VVW B;  2JF5 A;  2E3T A;  4IW0 A;  4YTP B;  1O79 A;  3Q78 B;  2OJR A;  3ENE A;  1WXS A;  3VH3 B;  5H92 C;  1YN4 A;  3DWM A;  1TKG A;  3ZNZ B;  1ZGU B;  4YT0 B;  3UF8 A;  3VXD A;  2UWQ A;  4Q88 A;  3RN9 C;  2WXG A;  2ZIR B;  1W3Y A;  1SE2 A;  1MPE A;  4PYU A;  4HKZ E;  1JML A;  4WQM A;  4S17 A;  3R66 C;  4HCN B;  2WU5 B;  4J3O D;  1JCS B;  2WU2 B;  1FBO A;  5JHB A;  1F9O A;  1Q0W B;  1WXM A;  2MP2 B;  2RGF A;  2D3A A;  1OJM A;  4M00 A;  3FIL B;  1GLM A;  3WCQ A;  2L0F A;  3RD2 A;  4EZK A;  4E1Y A;  3QFY A;  2JX5 A;  1WZ0 A;  3ZJU A;  2I2Y A;  2OED A;  4AOF A;  3AU5 A;  2MJE A;  2Z0D B;  1SQC A;  1OQQ A;  1QT9 A;  3BWU D;  3CF6 E;  1N7Q A;  2F0Y B;  2K5P A;  5AGD A;  4HKQ A;  4FBJ B;  1CQV A;  1FM0 D;  3V61 A;  1WZ3 A;  4E3C A;  2L0T A;  5ILI A;  4US8 A;  3I63 C;  1E5W A;  1WU5 A;  2WDA A;  1WMH B;  4USA A;  1O6H A;  2KAC A;  3IVF A;  2LRU A;  1WF9 A;  2Q5W D;  3ZTD A;  4NQL B;  1FAE A;  2NPT B;  3D3I A;  2XK5 A;  1DOY A;  1NI2 A;  4DXG A;  3OLM D;  4KSL C;  4GTS B;  4ZHP A;  2IO0 B;  2GZ6 A;  3LJ3 A;  4C7Z A;  1HQR D;  2DRR A;  2D3C A;  2WS3 B;  4JE3 B;  2RSU A;  1KZO B;  3W7X A;  1P7F A;  2HE7 A;  4MMH A;  2A4Z A;  3SDU A;  3W5M A;  4N59 A;  3U30 A;  3APF A;  3VTU A;  1IGC A;  2J0K A;  3HM3 A;  3GS2 A;  3VSM A;  3RFZ B;  2BB5 A;  2BKF A;  4W9H A;  4DDG D;  3BYT B;  2K6D B;  4C80 A;  3P42 A;  1N62 A;  3EUV B;  1RWC A;  5ILY A;  3RNF C;  1XLN A;  1HZ5 A;  2D3G A;  3Q3N C;  3QK0 A;  4DHJ D;  1R4N I;  1WRI A;  3NG0 A;  1JCK B;  5IO9 A;  3S9V A;  4C4V A;  4BOJ A;  2K22 A;  2WGS A;  1GUA B;  1YX5 B;  3N3K B;  3W1S A;  2L76 A;  3P63 A;  3DBS A;  3PZ1 B;  3NOB A;  4LNK A;  3T3O A;  3HIZ A;  4TV3 A;  1EF1 A;  3Q8F A;  3M7L A;  3T9L A;  3ANI A;  2GOX A;  1F1H A;  2CQT A;  1N95 B;  4I6L B;  1I4P A;  3NHE B;  2V8J A;  4DBG A;  3NFV A;  2G02 A;  2KQ4 X;  2C60 A;  4XDD A;  4XYC A;  5EE0 A;  1UZX B;  2P0V A;  2EAB A;  4YSY B;  5EE9 A;  3H7S A;  2G4S A;  4W9J A;  2BF8 B;  3DSV B;  1EWY C;  1TNY B;  3UIO B;  5EDS A;  5JZE B;  1ZW7 A;  2WX1 A;  3DSS B;  1H14 A;  2EMS A;  2RDH A;  2N1V A;  1WX9 A;  1QLB B;  3AEG B;  3DPD A;  2YLM A;  4GTT B;  3LDZ E;  3OAW A;  3M77 A;  3GZN B;  5TR5 A;  3V62 A;  2Z8L A;  3GB1 A;  3MC0 B;  1HM2 A;  3RX8 A;  4RM9 A;  2MHJ A;  1TIF A;  2V4L A;  3N30 A;  3H6N A;  3IT4 B;  3OG5 A;  5FR6 A;  4AP4 C;  4G50 A;  4B0E A;  2EMT A;  3GT5 A;  3R7Q A;  1N7N A;  2L32 A;  3Q69 A;  3Q73 B;  3TJP A;  1FMA D;  1NVI D;  4DXA B;  5J2R A;  2KYW A;  2IGG A;  1FXI A;  1JAL A;  3W7T A;  4DXF A;  3R7R A;  2XK5 B;  2LGS A;  3ZYY X;  3A33 B;  2VN4 A;  3QSP A;  3QDE A;  1M94 A;  3TEY A;  5CZL A;  2LXC A;  1Q1O A;  2AYO B;  2JJB A;  2M4N A;  3DSU B;  1HXY D;  1FCL A;  4BFR A;  2WXI A;  2FUQ A;  4IG7 B;  1KF6 B;  4G11 A;  1QZE A;  3WIM A;  1LXM A;  3RNC C;  3TIX A;  4JJJ A;  2IZV B;  2ZNV B;  1GOZ A;  5D2M B;  1GXN A;  2KJH B;  5JHA A;  2AEH A;  4DQO C;  1I4X A;  3HVZ A;  3E30 B;  1E9M A;  2V3P A;  3ABV B;  1JRO A;  1G87 A;  4FJZ A;  5L83 A;  2MH7 A;  3Q8B A;  3UIN B;  5GW7 A;  1ZXI A;  3RJ3 A;  2K9X A;  4REZ A;  3L0W B;  4FUL A;  4TUU A;  4BVU C;  4K3C A;  4ZH1 A;  2AL6 A;  2JUO A;  3DVN U;  4XDC A;  5HI1 A;  5J17 A;  2LWP A;  3G4F A;  1KLG D;  3JSV A;  4K7W A;  1TN8 B;  3KQ4 A;  3N32 A;  5GY3 A;  4B9K A;  2BYT A;  1LD7 B;  5IAA C;  5H8Y E;  2XWJ B;  4YDO B;  4HDO A;  2NR2 A;  3N20 C;  2WXK A;  2MJD A;  4FJV B;  4O1N A;  2L3Z A;  3NZS A;  1FT2 B;  4RF0 A;  4MDK E;  2B4F A;  2WY7 A;  2V8K A;  2DYM A;  2DLB A;  2JZP A;  5CX3 A;  1N5X A;  2NCN A;  2OOB B;  4W9F A;  3MHS D;  3EHV A;  4M8M A;  1N7P A;  4LIX A;  4P7I A;  3MJW A;  4HCP B;  3BVG A;  3B0A A;  3DHI C;  3PZD A;  4L23 A;  1GHQ A;  3KH0 A;  1CB8 A;  3RUI B;  5D3D A;  3NVV A;  3HXC B;  3M95 A;  4K3B A;  3ZNH B;  1L4Z B;  1TS2 A;  2JF4 A;  1MHX A;  1V8C A;  1RFK A;  4OZW A;  3SDT A;  1N63 A;  3A9J A;  2KWD A;  5DPT A;  3KSQ B;  2IY1 B;  2QDF A;  3VUX A;  2HD5 B;  1I35 A;  4GL3 A;  4LJP B;  4BKG A;  3SD5 A;  5L95 C;  3S4B A;  1I4Q A;  3X17 A;  2IDY A;  2FUG 1;  2QIL A;  1H3B A;  3RMK C;  4OZA A;  3ZKJ C;  2FBW B;  1KRE A;  1E90 A;  1XCQ L;  1V97 A;  4RGO S;  4WVB A;  2KN5 A;  4NZL B;  1N60 A;  1EWC A;  5BYR A;  1H8C A;  5HKH A;  4W9D A;  1V5T A;  2C7M B;  1LFD A;  1F0Z A;  2O2V A;  2PIA A;  4BOZ B;  1B9R A;  4MAC A;  2WDR B;  1YQB A;  5DHI A;  4GLS C;  2IJ0 A;  4ANU A;  4HJG E;  2KQS A;  5IM1 A;  1YJJ A;  1IGD A;  3AEB B;  3DVN V;  3QJZ A;  1H37 A;  1N23 A;  2EAD A;  2LI5 A;  3KWL A;  1PDX A;  2WWZ A;  1TS5 A;  2MLB A;  2RD0 A;  5IOI A;  2UYZ B;  5DGQ A;  1YJI A;  1JCR B;  1XLQ A;  3UI3 A;  2QEJ C;  5AZF A;  4C7Y A;  1WZZ A;  1IBX A;  1KRF A;  3VSN A;  2PPH A;  3RZF A;  4LNO A;  4FXG B;  2QCZ A;  2KVZ A;  2M0A A;  2H6G B;  2IND C;  1M4V A;  1YOV B;  1ENF A;  1LOH A;  2BYF A;  4EL8 A;  3JSV B;  1D5M C;  2N9P C;  3P5P A;  1D8D B;  3M63 B;  1N4Q B;  2QC8 A;  4EEW A;  5EE1 A;  3VRA B;  3ZIM A;  4XWT A;  1KLU D;  4YCR A;  2J0J A;  2LEK A;  2AQ3 B;  3DVG X;  1K51 A;  1A70 A;  1OEY J;  1PGB A;  3CSF A;  3JVZ X;  4EE2 A;  1QOF A;  3QWZ B;  3KUD B;  1G9G A;  2ZW0 A;  3DCG A;  2DHZ A;  4WAA A;  2CJN A;  2KN4 A;  2XNA C;  3P1M A;  3B2F A;  3VQI A;  4W9G A;  1KRH A;  2N9K A;  4LLG M;  3X23 A;  1XLP A;  2C7H A;  2MBE A;  3I3T B;  4TSS A;  4HPM B;  1TGZ B;  2HJ1 A;  2GH4 A;  1SF0 A;  2PJH A;  3RYT A;  1DOG A;  1FEH A;  1TS4 A;  1RWG A;  2BPS A;  1VD5 A;  4F7Z A;  1X1J A;  1ZPS A;  2V1Y A;  4ZOH C;  4A3O A;  1UEL A;  4DWF A;  1SBB B;  1N4R B;  2G1E A;  4XC2 A;  1L2N A;  1N24 A;  3A9J B;  1QKZ A;  2L7R A;  3I57 A;  3Q8E A;  4AQ7 A;  3AE7 B;  3APC A;  3P4R B;  3ML8 A;  4W9C A;  1T0S C;  1C78 A;  4LNI A;  5HG2 A;  3LYY A;  4JGH B;  3AMZ A;  3TEW A;  4F8C B;  4PT5 A;  4YSX B;  1Q5W B;  2BVC A;  2WIN B;  3AEF B;  3AN1 A;  2ACZ B;  3ZLZ A;  1X9D A;  4RNA A;  2AQ2 B;  2ZIS B;  1FRR A;  2FCS A;  2N7D A;  1VZ8 A;  1FO4 A;  1SJE D;  4J6I A;  4GTR B;  3PZ8 A;  3H7P A;  1AWD A;  2Y5P A;  3L16 A;  2O2V B;  3QIJ A;  3V60 A;  2NS5 A;  1N9A B;  1KM7 A;  2ICI A;  4K7S A;  4DDI D;  3PGE A;  2K0P A;  4ASW C;  1QBQ B;  1KLV A;  1V1O A;  1I8Q A;  2LVP A;  2VZK B;  3W9C B;  2Z0E B;  2DZK A;  4X57 B;  4RH6 A;  1VR9 A;  1LQB A;  4OZB A;  4NNJ B;  1VZ7 A;  4II2 B;  2CU3 A;  4N6E B;  3B08 A;  1EF5 A;  3PV1 A;  4WH4 A;  3SAE A;  2BB6 A;  1L4D B;  2VH1 A;  3VFK A;  2VH2 A;  3PRZ A;  2FAZ A;  1D4B A;  4FJQ A;  2JRI B;  5GZK A;  1D3Z A;  1IBX B;  4HRO A;  1WM2 A;  3W5V B;  2WYN A;  3LB8 C;  3V3X A;  4XE0 A;  3DBR B;  2SQC A;  1GNU A;  1TZO A;  4J5T A;  1UBQ A;  4ICV A;  1HTO A;  2ONH A;  1SIF A;  1WYW B;  2B39 A;  1GXO A;  4ANW A;  4GU2 A;  1AYF A;  2KMA A;  1E6E B;  3RX5 A;  3GLY A;  1XF5 L;  1VRA B;  3V6C B;  1UGJ A;  1L0V B;  1UNS A;  3AUL A;  4NJ7 A;  4TF4 A;  1MI0 A;  4D4C A;  2FE8 A;  3EUB 2;  1N94 B;  3P4S B;  5IKH A;  2OKX A;  4AYP A;  1FT1 B;  2ZZP B;  4NPN A;  1ULV A;  2M8S A;  3IAM 1;  3KWV A;  4LNN A;  3R8B A;  3ACS A;  2LUE A;  1VZ6 A;  2NVU I;  4E71 A;  1F9D A;  3AXC A;  3C19 A;  1HXC A;  1N1Z A;  4K1R B;  4G0N B;  4BKS A;  3PZ3 B;  1L0X B;  1YNT E;  3AE1 B;  4K81 A;  4LK0 M;  2DBY A;  4OZC A;  4A20 A;  4EZL A;  4FNV A;  2MBH A;  2WYQ A;  1E0Z A;  1OFF A;  3TEX A;  5D7G A;  2IO2 B;  1YJ1 A;  4IDI A;  2NBV B;  1I42 A;  1AAR A;  4JL9 A;  5KHQ A;  5FO8 B;  1JWS D;  3QC8 B;  1K72 A;  3VTW A;  2SEB D;  1KSC A;  2WXR A;  3A9K A;  2HTH A;  3DQV A;  3H7P B;  3P4P B;  1CEM A;  3M7B A;  4EKU A;  1HN0 A;  4AJW A;  1V5D A;  1UT9 A;  1WXQ A;  4L2Y A;  3AEC B;  4MGY E;  3EFU A;  3DRA B;  3MC8 A;  1DGJ A;  2LUM A;  2MQJ A;  4XWW A;  3L4P A;  1TF4 A;  2GBJ A;  4GTO B;  3ZXR A;  2FUT A;  2JYT A;  1PUT A;  5CA3 A;  3JYU A;  3VAW A;  1GPX A;  2LZ6 A;  3SQC A;  4KKI A;  4KIK A;  4PS3 A;  4ZH5 A;  4R3D A;  3NVZ A;  2EEL A;  4P1C C;  3EEC A;  3AFL A;  2VRR B;  1BT0 A;  2W9N A;  4OK4 A;  4URK A;  3PRE A;  2ZVN A;  3W5N A;  1HX9 A;  2E6X A;  1QSJ A;  2FIF A;  2LD9 A;  2KLG A;  3BII D;  4YWG G;  1VLB A;  4NJ6 A;  2K25 A;  1FPP B;  2KMC A;  2NOJ A;  5DCN A;  3C0R B;  3WKI A;  1H39 A;  2KT7 A;  3U7Z A;  4FXK B;  1SJH D;  3O13 A;  1GJZ A;  1NEK B;  1G9J A;  1GAH A;  2GBN A;  2FCQ A;  2N9L A;  1ISN A;  3X0W A;  5MPO A;  3DDC B;  1I4R A;  2QNO A;  1YN3 A;  5IN7 A;  4LNF A;  1N4P B;  4JIO U;  3Q14 C;  2AFA A;  3PS6 A;  2D3B A;  5D94 A;  3T8M A;  4JWS C;  1QF6 A;  4ANX A;  5JXV A;  1D6E C;  3OED A;  2IGD A;  1G6I A;  3H9D A;  4XZ4 A;  2CR5 A;  3T3N A;  4C56 C;  4WVC A;  1LM8 B;  1TN6 B;  5HHD G;  3SDR A;  1V1P A;  1N6Z A;  2BGF A;  1PGA A;  5DPS A;  3AV8 A;  4V1S A;  5ILD A;  1Q10 A;  3AE3 B;  2GBR A;  3QX1 A;  2MA9 B;  3VUW A;  3RSY A;  1V7V A;  1FNW A;  1T6B X;  2B3A A;  4OW0 A;  1L6V A;  3APD A;  4FN2 A;  1SEB D;  1P7E A;  2FV0 A;  4KTP A;  3SFY B;  4Z4L A;  3QG0 A;  2M19 A;  1C82 A;  3P2B A;  2N9E B;  3G6J B;  1VDV A;  3D5R A;  3SEB A;  3A9K B;  2ZPY A;  5BYQ A;  2KD0 A;  3WC3 A;  2KWC A;  1GB1 A;  1V5C A;  1J19 A;  2JQR B;  4DI5 A;  3NS1 A;  1WGG A;  2WY8 A;  2DEN B;  4TQ1 A;  4YXD B;  2CS4 A;  4IOI E;  1LD8 B;  4B0M A;  1O1R B;  4P6V F;  4BBN C;  2MBQ A;  3DSX B;  2MX2 A;  3QPF A;  2PE9 A;  4B6W A;  1GAQ B;  2MRP A;  3BK2 A;  2MCN B;  2G4D B;  1V2Y A;  1H36 A;  2PN5 A;  1R7S A;  1LF9 A;  3QCA A;  2H6I B;  1KFG A;  4OJZ A;  3OJ4 B;  4B95 A;  4KDI C;  2KJ6 A;  3IBE A;  3PLU A;  3M3J A;  3G4D A;  3M62 B;  4KIK B;  4N58 A;  1GC7 A;  2ONG A;  3ALB A;  3NVY A;  3BVZ A;  3J9C A;  3H1U A;  1P98 A;  2GLS A;  1G6J A;  2NTT A;  3P5R A;  3ONS A;  4JLC A;  1RWH A;  2PVO D;  3Q3J A;  4II3 B;  3WAL A;  2D5J A;  2W55 A;  2K3U A;  1RRB A;  3R2T A;  2K39 A;  2H6H B;  3QAR A;  5ILK A;  1JRU A;  1O1T B;  3QAQ A;  3DWG C;  3PTF C;  2KWU B;  2I38 A;  3BY4 B;  3WKF A;  1EO6 A;  1C76 A;  3AM9 A;  1MZC B;  1WGR A;  2PTL A;  4HK2 A;  3NS8 A;  1ZDV A;  4F10 A;  3WUX A;  1FIQ A;  3GOE A;  4K7U A;  4KGT A;  1E7P B;  1GA2 A;  3DHH C;  1WU4 A;  1K8R B;  3AH7 A;  3M00 A;  5IL3 A;  3EZ8 A;  2KQ7 A;  2BW2 A;  5M7Y A;  1V1P B;  4WU0 A;  2R2O A;  5CD2 A;  3AE4 B;  3QXQ A;  4V1R A;  1C9F A;  3BZD B;  2KX0 A;  3SDQ A;  4RF1 A;  5AEK B;  1GSZ A;  4RGN A;  3RCZ A;  2FV1 A;  2H6F B;  2EKE C;  2RPQ A;  5C2T B;  1ZKH A;  2N9X A;  3IT6 B;  4WJN A;  3Q8A A;  1WJ4 A;  4WWP A;  5IK9 A;  1V5O A;  4ANV A;  2G0D A;  2IYD B;  4TXT A;  3RZW C;  1J0G A;  1S1Q B;  3UQB A;  2M56 B;  3WIW A;  2XN9 C;  4C4V B;  2KOX A;  2D11 A;  1WM3 A;  2BS2 B;  2PE6 B;  2J0M A;  1WJN A;  3DBL I;  2ZCB A;  1T0Q C;  3U2S C;  2LXA A;  2MBO A;  2WX0 A;  3E56 A;  4GTV B;  1TN7 B;  4G3X B;  1YN5 A;  2ZEQ A;  3JW0 X;  5IL8 A;  4PK1 A;  2BYE A;  4L0G A;  3W7S A;  1C3T A;  3V6E B;  3DBH B;  2DZJ A;  1QQR A;  1WGK A;  4FHJ A;  2RDG A;  3RI7 C;  2BRV X;  4HEA 1;  3W7W A;  1F9J A;  2LHD A;  2J42 A;  1BUI C;  3ZRC A;  1J0M A;  3QWT A;  4PYZ A;  2R2Q A;  1AN8 A;  4Q2B A;  2FCN A;  1N7O A;  3RNG C;  4I6P A;  1TTN A;  4ARI A;  4CJ0 A;  1O5M B;  5JPN B;  2FNJ B;  1R4M I;  3WKH A;  2INC C;  2WP9 B;  2V8I A;  4E74 A;  3QXF A;  3DSW B;  4W9L A;  3EGR A;  2B76 B;  1J8C A;  1L5P A;  2JVC A;  2LGY A;  4TMA B;  2KK8 A;  1KJT A;  4EZJ A;  1Y8R C;  5IKC M;  2DAJ A;  2IEJ B;  1X81 B;  1WIA A;  2LJI A;  4BZA A;  1L7Y A;  2IPK D;  3PZ2 B;  1ROE A;  2ZVO A;  5G5G A;  2BQQ A;  4IC7 B;  3KLS X;  3Q7A B;  3NZU A;  4LNG B;  4C00 A;  3B1L X;  1XWT A;  1SA4 B;  1V7W A;  3CIH A;  1WGY A;  3BVM A;  2BRW A;  1RM6 C;  1TJE A;  4UDU C;  5DPR A;  1WYG A;  3GE3 C;  5IK0 A;  3DVG Y;  4RFB A;  1O1S B;  1OQY A;  1LGR A;  3VXW A;  4YTM B;  1E8Y A;  3ANJ A;  1XQQ A;  1FXT B;  3TBL D;  5C23 A;  1MG8 A;  2KFK A;  4FJY A;  2O6V A;  2SAK A;  2MBB B;  1SXT A;  1W6J A;  3NRZ A;  3W5U B;  2KDF B;  2V3N A;  1BXT A;  4DK5 A;  4EFO A;  1E10 A;  3N0F A;  2XQW A;  1N1B A;  3S2A A;  5MEH A;  3ZW3 A;  2AX5 A;  1UWM A;  5BO4 B;  3MFG A;  1H3C A;  1YD8 U;  1IS9 A;  1WX8 A;  2GBK A;  2KDB A;  1KSD A;  1V80 A;  2BWE S;  3Q79 B;  4RMA A;  3I5J C;  3E9S A;  1WY8 A;  1YIW A;  3M74 A;  1CMX B;  3RNB C;  1NI1 B;  2IO3 B;  4BBN F;  3HUI A;  3W1Y A;  3K9O B;  2BT6 A;  3ZQ4 A;  2RGK A;  3M75 A;  3N1Z C;  1HE8 A;  2K1F A;  3E32 B;  1YMH E;  5TSS A;  4MH0 E;  1N7R A;  3ZNG C;  1WH3 A;  1K50 A;  2VZK D;  2AQ1 B;  5IKA A;  1P9D U;  4OK2 A;  2L52 A;  3E7J A;  1H54 A;  1JWU D;  2V3S A;  3WA0 A;  2KDE B;  3PO0 A;  4MEL A;  2NVP A;  1L2A A;  3UGB B;  1R4N B;  3RT3 B;  5AZH A;  4ZYN A;  2CHW A;  2WII B;  4L1B A;  5IP4 D;  4N9F 4;  4D2K A;  1AYX A;  2LVO A;  2K8B A;  4NJC A;  4GXB A;  2D2Q A;  2PEA A;  3HK0 A;  3EU8 A;  1NDD A;  4MSQ B;  5D6J B;  4GAX A;  3ZJT A;  2BRP A;  1LXD A;  3TMP B;  3HRD D;  3AE5 B;  3RPF C;  1VJK A;  1Y56 A;  4ZRQ A;  3P2C A;  1D5Z C;  4MGI E;  4ZRP A;  1TBE A;  3M7E A;  2PW9 A;  3ZGZ A;  2ASQ A;  3NUH B;  3VH4 B;  4LDT D;  2WXL A;  1JCQ B;  4EUT A;  1HXA A;  4H2A A;  2WDV B;  4MM3 A;  3HXD B;  4YTN B;  5BMI A;  1FFU A;  4W9E A;  2LVQ A;  3U52 E;  3VTV A;  1GG3 A;  1E7U A;  3H2W A;  4GDK A;  4OVU A;  1JS4 A;  1UBI A;  1WE6 A;  4IUM B;  4LJO B;  2AWT A;  2KFK B;  1ZDX A;  4KGR A;  2WXH A;  3CIR B;  4RGT A;  2WXJ A;  1C3D A;  3W2D A;  3BK1 A;  2KC2 A;  4L6X A;  2WCO A;  1L6U A;  3QHT A;  3ECI A;  4ZHO A;  3M02 A;  2Y3A A;  1X1I A;  4IWP A;  1EM7 A;  3ON6 A;  1C4A A;  4GMV A;  1XWQ A;  4AYR A;  3UQA A;  4M0W A;  2N1W A;  1TKY A;  3CMM B;  1IA7 A;  4GTP B;  4F1S A;  2D10 A;  2NMQ A;  2RI9 A;  4CE7 A;  4WAF A;  1V86 A;  1TS3 A;  3L17 A;  1VCB A;  3URY A;  3GZN I;  5HFY A;  2L8J A;  2KZR A;  1V6E A;  2G3Q B;  2CHZ A;  2CHX A;  2DRO A;  4JQW C;  3PYA A;  2ZBL A;  2WXM A;  2DYB A;  2M1M A;  2J4X A;  2KAJ A;  2ON8 A;  1ZOY B;  2REX A;  3QT9 A;  3M72 A;  2C7N B;  4LDT B;  5E6O A;  4M02 A;  4ZYS A;  1H3A A;  1NYR A;  4ACF A;  3VHT C;  3E33 B;  1SE4 A;  4WWN A;  3V05 A;  3SHQ A;  5LXI B;  2V4I B;  3ZNI D;  5JPM B;  3OJ3 A;  4GN1 A;  3AEE B;  3EC8 A;  3M78 A;  4DOE A;  2R61 A;  4CYE A;  1W6K A;  2KMM A;  3PZ7 A;  3OXU A;  2JWU A;  1WGD A;  3E37 B;  2KO3 A;  1FRD A;  4S0R A;  3Q2A C;  1ZUD 2;  1I4G A;  3PYB A;  1QOA A;  2JRH A;  1ESF A;  2C9W B;  2W3R A;  2GB1 A;  5AUI A;  1UGM A;  4A90 A;  1SB3 C;  2QHO A;  3DOW A;  1FP3 A;  2KDI A;  1JW9 D;  3ZRF A;  1S63 B;  1JWB D;  2IBI B;  3RUL A;  1RQ5 A;  1WXA A;  1NEN B;  3K11 A;  3D32 A;  1S3S G;  1C79 A;  4OHJ A;  4D4A A;  1V9J A;  3VUY A;  1UG9 A;  3E73 A;  4MM3 B;  2PMV A;  3WAM A;  2A5U A;  4WWM A;  1IUE A;  1F52 A;  1O6Q A;  1V81 A;  3WKG A;  2MSE D;  1OEY A;  3S4D A;  2LGX A;  2LHE A;  4JX1 C;  2BS4 B;  4HVB A;  4WJQ A;  3A4R A;  5JH5 C;  4HWI B;  4FUS A;  4GDK B;  4GGQ A;  2JT4 B;  1SE9 A;  5FKA C;  4ZDV A;  5C3J B;  1PFD A;  2JSV X;  1AW7 A;  1NXC A;  2AHG A;  4ZRK A;  1CZP A;  4EHM B;  1SGH A;  2ZPN A;  2W3S A;  4BKS D;  3ETR A;  2J53 A;  3ZUN A;  1C1Y B;  4IKG A;  3KUC B;  4MGZ E;  1IA6 A;  3A4S C;  3RX7 A;  1V7X A;  1PGX A;  3PPA A;  4CJ1 A;  4RCO A;  1WSP A;  2Q1F A;  4KKJ A;  3Q6B A;  3VDZ A;  2LRW A;  4M0W B;  3TUO A;  2AHF A;  5G5H A;  5ILH A;  2X38 A;  3I9V 1;  4M8N A;  1RWS A;  1HV6 A;  1O6R A;  4QAY A;  4MBG B;  3RNA C;  1DYQ A;  3KSL B;  5GXG B;  2N4F A;  2FCM A;  1C4C A;  3VR8 B;  4AYQ A;  3TSS A;  5D3I B;  3FAH A;  4ITK A;  1F2R I;  3NNB A;  3M7C A;  4CHK A;  4MEM A;  4NAM A;  5T8I A;  4MGK E;  1TNB B;  1TNU B;  1OQR A;  1UD7 A;  3H3K A;  2H89 B;  2N0S B;  2BKR B;  2J7Q B;  2L05 A;  3MJ5 A;  3AI5 A;  1FO2 A;  1KWF A;  1EU3 A;  2JYE A;  1N4S B;  4TKN A;  4FHK A;  4HPL B;  2EKI A;  1N5W A;  3AEA B;  1STE A;  5LNK 1;  2JXT A;  2CQS A;  3RRS A;  1Z2M A;  4GTM B;  2MW5 A;  3L13 A;  4GIV A;  2WXQ A;  1D5X C;  4RM8 A;  4NEI A;  2YVC A;  4Z4J A;  4KSK C;  4GSW A;  1UUP A;  4A55 A;  1J0N A;  3VR9 B;  4BAX A;  5FO7 B;  2Y5C A;  3HXE B;  4AJY B;  1ACC A;  4AYO A;  2QSD A;  1OJN A;  1WR1 A;  4M76 A;  2WQY B;  2OJW A;  2ZZR A;  1HA5 A;  1LXK A;  4IM3 A;  4EOY A;  3A1Q A;  4ICU A;  5CTR C;  1QOG A;  4WJP A;  2BED B;  1J7A A;  2KFJ A;  4IWQ A;  4KVG B;  4MJS A;  1WJ6 A;  1FMI A;  1OTR B;  2JU6 X;  1MJD A;  3KLS A;  2HJ8 A;  4BKT A;  1KZP B;  1ET9 A;  3MHZ A;  1I7H A;  4BOS C;  1MFW A;  4DOD A;  1WI0 A;  1LF6 A;  3AB5 A;  4FA6 A;  1L1Y A;  2JWZ A;  2RDB C;  2N7J A;  1T5X D;  2DRQ A;  2M0X A;  3FKY A;  2WXN A;  4LNB B;  1E8W A;  2DZI A;  3B2G A;  3KUZ A;  1FD6 A;  2R2L B;  5FOB B;  3O65 B;  2BS3 B;  3KYD D;  1H35 A;  3PHW B;  3SDL C;  4A6Q A;  3PSE B;  4JWU C;  4GOC A;  5J18 A;  2XBB C;  1HEZ E;  1FFV A;  1MG4 A;  4MMI A;  4WJO A;  4BOK A;  3ZXV A;  1QIL A;  2WNM A;  1NC5 A;  1UWX A;  4AUQ C;  2WLB A;  1TYG B;  1V49 A;  2JZ3 B;  5FR3 A;  3PRP B;  1XXG A;  2G9H D;  2FBA A;  4P16 A;  5CHV C;  2LGD A;  3QA8 A;  2J5C A;  1UMP A;  1F1S A;  3M73 A;  4LCD E;  2DZM A;  1LTX B;  4AWJ A;  2KTR A;  1R76 A;  2W54 A;  2XEW A;  2KDM A;  3AE8 B;  2HTM E;  2PKO A;  2QJL A;  3PT2 B;  3TL5 A;  1HMW A;  1SSN A;  2G45 B;  2BWF A;  3IHP C;  1WR6 E;  5BMH A;  4OVV A;  1L0Y B;  2Z59 B;  2WHI A;  4NAW A;  3AU4 A;  1RWA A;  1P3Q U;  3ZTC A;  3L10 B;  3Q8C A;  1TY2 A;  2GBM A;  2K8H A;  3K7X A;  4KZ0 A;  1ZXH A;  3M71 A;  3PVL A;  1HCU A;  1UF0 A;  1XCT L;  4M01 A;  3R2I A;  3WAN A;  5BMG A;  2Z07 A;  4DHJ B;  5AZG A;  1H4R A;  2V0G A;  1PYW D;  2LFI A;  2ZNV C;  5IK6 A;  3S4C A;  3Q75 B;  2MEK A;  2MWS B;  3AE9 B;  2BYV E;  2K6Q A;  4WWO A;  5KHO A;  1H13 A;  1SE3 A;  1B1Z A;  3A1Q B;  5JMF A;  4IWO A;  3ZDT A;  5ILJ A;  5C05 A;  3UIP B;  1WGH A;  1RFA A;  3DBR I;  2RMM A;  4RNQ A;  2BTE A;  3NJT A;  2L83 A;  4MJS B;  2NBW B;  3GP7 A;  3HM6 X;  3ANK A;  2KC1 A;  3R3M A;  4KV2 A;  3IAS 1;  3PRM B;  4JPS A;  4D94 A;  4Q2J A;  2QIE B;  2V9H A;  1KTK A;  1FXA A;  2FID A;  4HJK A;  2ZW1 A;  1QAZ A;  4PS8 A;  3W1S C;  1DOI A;  2GI9 A;  4MU9 A;  3HXB B;  2RPV A;  4A3P A;  5KKB A;  2LAS A;  4C1S A;  2E24 A;  2KNB A;  1FNV A;  4GDL A;  1J7C A;  4KZC A;  5EAS A;  2LJ5 A;  1FCC C;  1YQ4 B;  3TF4 A;  3W7U A;  3AE6 B;  2VN7 A;  3PZ4 B;  2YEP B;  5CHF A;  1FBW A;  4MSM B;  5G55 A;  2AL3 A;  4CQN A;  3MP9 A;  4QT9 A;  4US9 A;  4WIP A;  2F6D A;  2CU1 A;  4TQ0 A;  5E6P A;  3B9J A;  2XFG A;  5IA7 A;  4AS1 A;  1N61 A;  3LXF A;  1DL2 A;  4YL8 A;  3C72 B;  1NYQ A;  1WJU A;  3TEZ A;  1OJP A;  2E22 A;  2DRS A;  3EU5 B;  3H7L A;  4LNV A;  1KFY B;  1K53 A;  2I1K A;  1YX6 B;  3H8H A;  1DOX A;  2KTR B;  4YSZ B;  1PQS A;  2UU7 A;  1WWT A;  3GE8 C;  1N22 A;  1F2R C;  2DNF A;  3T33 A;  2H88 B;  1SIJ A;  3SFD B;  3VRB B;  2KLC A;  3PMM A;  4NAW B;  4XUV A; 
#chains in the Genus database with same CATH homology
 1TF4 A;  4GTO B;  2WXO A;  3HVD A;  3Q8B A;  1ZDX A;  4KGR A;  3DSS B;  2JYT A;  1PUT A;  1H14 A;  2WXH A;  3CIR B;  4RGT A;  2WXJ A;  1C3D A;  3W2D A;  5CA3 A;  1TNO B;  2RDH A;  3BK1 A;  5DGR A;  4L6X A;  1QLB B;  2YIK A;  3AEG B;  1L6U A;  2D8L A;  2JG0 A;  1GPX A;  4GTT B;  3SQC A;  4KKI A;  4ZHO A;  3M77 A;  3N9Y C;  2Y3A A;  2Z8L A;  3GB1 A;  4ZH5 A;  3MC0 B;  4R3D A;  1EM7 A;  3NVZ A;  3ON6 A;  1C4A A;  3RX8 A;  2EEL A;  4MH8 A;  3IT4 B;  1XWQ A;  4YDE B;  4C7Z A;  4AYR A;  4M0W A;  4B0E A;  1TKY A;  1DOY A;  3GT5 A;  3W5N A;  1IA7 A;  4GTP B;  2L32 A;  2E6X A;  3Q73 B;  3Q69 A;  3ZJV A;  1QSJ A;  1FMA D;  3D5S A;  1NVI D;  2NMQ A;  2RI9 A;  3BII D;  4CE7 A;  4WAF A;  4YWG G;  1TS3 A;  4ONT A;  1FXI A;  1VLB A;  1JAL A;  2IGG A;  3URY A;  1FPP B;  1JWA D;  5HFY A;  2NOJ A;  3W7T A;  2PLP A;  4DXF A;  2EAE A;  4ZG8 A;  3WKI A;  1H39 A;  2INP E;  2DRO A;  2WXF A;  3U7Z A;  3BYY B;  3PYA A;  4FXK B;  1SJH D;  3AED B;  3O13 A;  1NEK B;  4L9P B;  2ZBL A;  4RGM A;  1G9J A;  1TKE A;  2WXM A;  3ZYY X;  1GAH A;  2VN4 A;  2D5G A;  3QSP A;  2N9L A;  2J4X A;  5MPO A;  2KAJ A;  1I4R A;  2QNO A;  1EU4 A;  1YN3 A;  2ON8 A;  1LO5 D;  3QDE A;  3TEY A;  1ZOY B;  5CZL A;  3QT9 A;  1N4P B;  3M72 A;  4WVA A;  2AFA A;  4ZYS A;  2JJB A;  3CWI A;  4JWS C;  1QF6 A;  3DSU B;  5JXV A;  1NL4 B;  1H3A A;  1HXY D;  1FCE A;  1NYR A;  1D6E C;  3OED A;  3QT3 A;  1ZE3 D;  1FCL A;  2IGD A;  2HDE A;  1G6I A;  2A8Z A;  2FUZ A;  2WXI A;  1KF6 B;  3E33 B;  1SE4 A;  3NZ3 A;  3V05 A;  2V4I B;  3T3N A;  2WXP A;  4JJJ A;  5JPM B;  1C77 A;  2IGH A;  1XEE A;  4C56 C;  2CJO A;  4WVC A;  1GOZ A;  3AEE B;  1GXN A;  3M78 A;  1TN6 B;  5I4D A;  3VW5 A;  1S64 B;  4DOE A;  4DQO C;  4GDL B;  1I4X A;  3SDR A;  3E30 B;  1E9M A;  2V3P A;  1V1P A;  1PGA A;  2R61 A;  3ABV B;  3AV8 A;  1MVK A;  4V1S A;  1JRO A;  1G87 A;  1W6K A;  1Q10 A;  2KMM A;  3OXU A;  2MH7 A;  2JWU A;  2ONQ A;  3AE3 B;  5GW7 A;  3PZ7 A;  1ZXI A;  3E37 B;  3RJ3 A;  2K9X A;  4REZ A;  1FRD A;  3RSY A;  1V7V A;  4KX6 B;  4ZH1 A;  1FNW A;  1ZUD 2;  1I4G A;  3PYB A;  1QOA A;  1T6B X;  4XDC A;  4ARC A;  1ESF A;  4OW0 A;  1L6V A;  2W3R A;  3FC4 A;  1FNU A;  2GB1 A;  1SEB D;  5AUI A;  5HI1 A;  2OHF A;  1P7E A;  1GAI A;  2FV0 A;  4A90 A;  4KTP A;  1SB3 C;  3SFY B;  1KLG D;  1TN8 B;  3WIR A;  1KKT A;  3KQ4 A;  2A73 B;  1FP3 A;  3QG0 A;  5GY3 A;  4Z4L A;  1JW9 D;  2M19 A;  3C8Y A;  2BYT A;  1LD7 B;  3G6J B;  2NTS A;  5H8Y E;  2XWJ B;  1S63 B;  4YDO B;  1JWB D;  1VDV A;  1RQ5 A;  3D5R A;  2MJD A;  2WXK A;  3SEB A;  4O1N A;  3Q7F B;  1NEN B;  3K11 A;  4KGS A;  4D4B A;  1YQ3 B;  5BYQ A;  1FT2 B;  1CLC A;  1QOB A;  2TSS A;  2LMC A;  4RF0 A;  1C79 A;  2B4F A;  2WY7 A;  2J52 A;  4OHJ A;  4D4A A;  3SDV A;  1UG9 A;  3E73 A;  3WC3 A;  2PMV A;  4MM3 B;  1XLO A;  1GB1 A;  1V5C A;  2V8K A;  1K52 A;  1I4H A;  1KH0 A;  2JQR B;  4WWM A;  2DYM A;  1FO3 A;  1IUE A;  3DPY B;  3SFX B;  3NS1 A;  2DLB A;  1O6Q A;  3WKG A;  2JZP A;  3U4E G;  2I07 B;  2WY8 A;  3S4D A;  1N5X A;  2LHE A;  2BS4 B;  4JX1 C;  4TQ1 A;  4YXD B;  1HZ6 A;  4IOI E;  4LIX A;  1LD8 B;  4FUS A;  1SA5 B;  4GDK B;  4B0M A;  1O1R B;  4P6V F;  5FKA C;  1XO3 A;  2LGI A;  3BVG A;  1PFD A;  2JSV X;  1AW7 A;  5EE3 A;  1NXC A;  3DSX B;  5C3J B;  2AHG A;  1CZP A;  4EHM B;  3QPF A;  1GAQ B;  2W3S A;  3E6U A;  4L23 A;  3SFE B;  2WDQ B;  1GHQ A;  3BK2 A;  3ETR A;  1H36 A;  2PN5 A;  2DWQ A;  3NVV A;  3HXC B;  2J53 A;  5D3D A;  1R7S A;  5FK9 C;  4A9A A;  1LF9 A;  4IKG A;  4JE3 B;  2H6I B;  1IA6 A;  1L4Z B;  1KFG A;  3RX7 A;  2JF4 A;  5FO9 B;  1MHX A;  1RFK A;  1TS2 A;  1HZF A;  3SDT A;  3E34 B;  1N63 A;  2DYO A;  3OWE B;  2KWD A;  1V7X A;  1PGX A;  3KSQ B;  4CJ1 A;  4RCO A;  4GL3 A;  3DST B;  1XW2 A;  1WSP A;  4N58 A;  4KKJ A;  3S4B A;  1I4Q A;  3NVY A;  3X17 A;  2IDY A;  4HRS A;  3BVZ A;  3J9C A;  2FUG 1;  2QIL A;  1H3B A;  4OZA A;  3TUO A;  2AHF A;  2XWB B;  3A3V A;  1CK1 A;  2FBW B;  2NTT A;  5G5H A;  2X38 A;  1KRE A;  3WIQ A;  1XCQ L;  3P5R A;  1V97 A;  4WVB A;  2YEP F;  3I9V 1;  4RGO S;  1GB4 A;  3EQA A;  4NZL B;  1N60 A;  1RWS A;  2PVO D;  1EWC A;  1O6R A;  2D5J A;  4KTR A;  4MBG B;  2K3U A;  2W55 A;  5BYR A;  3R2T A;  1DYQ A;  3KSL B;  2H6H B;  1O1T B;  2MJ3 A;  3DWG C;  5GXG B;  1F0Z A;  1C4C A;  2I38 A;  4AYQ A;  1TNZ B;  3TSS A;  3VR8 B;  5D3I B;  2PIA A;  3FAH A;  4ITK A;  3WKF A;  3SR6 A;  1F2R I;  1H12 A;  1B9R A;  3CU7 A;  4MAC A;  1C76 A;  1JQ4 A;  1GXM A;  2WDR B;  3M7C A;  1C4P A;  1MZC B;  3AM9 A;  4NAM A;  5T8I A;  4GLS C;  2IJ0 A;  2PTL A;  4HJG E;  1TNB B;  1TNU B;  1OQR A;  3AFJ A;  3H3K A;  1JWM D;  1FIQ A;  3WUX A;  1AGM A;  1ZDV A;  2H89 B;  2N0S B;  4KGT A;  1YJJ A;  1E7P B;  1IGD A;  3AEB B;  3FIL A;  1GA2 A;  4OVZ A;  3MJ5 A;  2L1A A;  1FO2 A;  1H37 A;  1WU4 A;  2EAD A;  3NVW A;  1KWF A;  1EU3 A;  2JYE A;  3AH7 A;  3KWL A;  3QFZ A;  1PDX A;  1N4S B;  3EZ8 A;  5E6J A;  2EKI A;  1N5W A;  3REN A;  1STE A;  1TS5 A;  2BW2 A;  3AE2 B;  2BBC A;  3AEA B;  5M7Y A;  2JXT A;  5DGQ A;  2CQS A;  4WU0 A;  3RRS A;  1V1P B;  4GTM B;  1YJI A;  1JCR B;  1D8E B;  3EA6 A;  1XLQ A;  3UI3 A;  1ET6 A;  5CD2 A;  1V8C A;  2QEJ C;  1D5X C;  2WXQ A;  3AE4 B;  5AUK A;  4C7Y A;  3QXQ A;  1WZZ A;  4V1R A;  4Z4J A;  1IBX A;  1C9F A;  3BZD B;  1KRF A;  3SDQ A;  1UUP A;  4FXG B;  4A55 A;  4RF1 A;  3VR9 B;  1GSZ A;  4RGN A;  2M0A A;  1CJE A;  2W82 A;  2FV1 A;  4WUR A;  2H6G B;  5FO7 B;  2Y5C A;  3HXE B;  1M4V A;  1ACC A;  1ENF A;  4AYO A;  2QSD A;  2H6F B;  4EL8 A;  1D5M C;  4M76 A;  2INN E;  2WQY B;  4MT5 A;  5C2T B;  1QQF A;  3P5P A;  1D8D B;  2ZZR A;  1N4Q B;  3IT6 B;  1BML C;  5EE1 A;  3VRA B;  1HA5 A;  1RYJ A;  3Q8A A;  4XWT A;  1KLU D;  3HXF B;  4YCR A;  4D4D A;  2GRI A;  2LEK A;  1QOG A;  2G0D A;  2AQ3 B;  4TXT A;  1K51 A;  2BED B;  1A70 A;  1J7A A;  1NI3 A;  1PGB A;  1TY0 A;  3WIW A;  2M56 B;  2XN9 C;  4EE2 A;  1QOF A;  1KS8 A;  1G9G A;  2ZW0 A;  1FMI A;  3S4A A;  2BS2 B;  1ZP0 B;  2JU6 X;  2CJN A;  2KN4 A;  2RI8 A;  3KLS A;  2XNA C;  3U2S C;  1J7B A;  3B2F A;  3P1M A;  3VQI A;  1KRH A;  2N9K A;  1KZP B;  1ET9 A;  3MHZ A;  1I7H A;  3E56 A;  4LLG M;  4GTV B;  1TN7 B;  5M7I A;  3P4Q B;  4DOD A;  1LF6 A;  3AB5 A;  1YN5 A;  1XLP A;  4TSS A;  1WU6 A;  1T3Q A;  4L0G A;  3W7S A;  1MHH E;  1L1Y A;  2EAC A;  2GH4 A;  1SF0 A;  1DOG A;  4A8X C;  1FEH A;  1TS4 A;  1JRP A;  2N7J A;  4LTU A;  1T5X D;  3HVZ A;  1VD5 A;  2DRQ A;  3QRY A;  1QQR A;  1WGK A;  4LNB B;  2WXN A;  2RDG A;  1ZPS A;  4ZOH C;  3GZK A;  3B2G A;  3IXS A;  4HEA 1;  3W7W A;  1FD6 A;  2R2L B;  2QMT A;  2LHD A;  2J42 A;  1BUI C;  1SBB B;  1N4R B;  2G1E A;  5FOB B;  3QWT A;  2BS3 B;  1H35 A;  3ACT A;  1AN8 A;  4Q2B A;  1QKZ A;  3I57 A;  4A6Q A;  3Q8E A;  4JWU C;  3AE7 B;  5BYS A;  4AQ7 A;  2PVG C;  1DCE B;  3M76 A;  1F77 A;  3P4R B;  4ARI A;  1HEZ E;  4CJ0 A;  1O5M B;  4GTQ B;  5JPN B;  1C78 A;  1FFV A;  5HG2 A;  3LYY A;  3AMZ A;  4BOK A;  3TEW A;  5E2J A;  4PT5 A;  4YSX B;  1QIL A;  2WNM A;  1NC5 A;  3WKH A;  1UWX A;  2WIN B;  3AEF B;  3AN1 A;  2E3T A;  2ACZ B;  2WLB A;  1TYG B;  1X9D A;  4RNA A;  2AQ2 B;  2ZIS B;  2WP9 B;  2V8I A;  4YTP B;  5FR3 A;  1O79 A;  3Q78 B;  3DSW B;  3QXF A;  1FRR A;  1VZ8 A;  2FBA A;  1SJE D;  1XXG A;  2B76 B;  2G9H D;  1L5P A;  3EGR A;  4P16 A;  4TMA B;  5H92 C;  1YN4 A;  3DWM A;  1TKG A;  4GTR B;  4YT0 B;  1UMP A;  2IEJ B;  1X81 B;  3VXD A;  3PZ8 A;  3M73 A;  2LJI A;  4Q88 A;  2WXG A;  2ZIR B;  1AWD A;  2Y5P A;  5LNK 1;  1LTX B;  1N9A B;  1SE2 A;  2IPK D;  1R76 A;  1MPE A;  4HKZ E;  2ICI A;  2W54 A;  3PZ2 B;  1JML A;  1ROE A;  2KDM A;  4WQM A;  3AE8 B;  5G5G A;  2HTM E;  2PKO A;  2K0P A;  1QBQ B;  2WU5 B;  1V1O A;  2QJL A;  1JCS B;  2WU2 B;  4J3O D;  1FBO A;  2VZK B;  3KLS X;  3Q7A B;  4LNG B;  3W9C B;  1XWT A;  1SA4 B;  1F9O A;  1V7W A;  3CIH A;  1SSN A;  3BVM A;  1RM6 C;  1TJE A;  4UDU C;  4RH6 A;  1VR9 A;  1WYG A;  4OZB A;  5BMH A;  1VZ7 A;  4RFB A;  1L0Y B;  3FIL B;  1GLM A;  1O1S B;  3WCQ A;  4YTM B;  2CU3 A;  3ANJ A;  4N6E B;  3QFY A;  2JX5 A;  3Q8C A;  3ZJU A;  1TY2 A;  4WH4 A;  3SAE A;  2BB6 A;  2I2Y A;  2OED A;  1L4D B;  5HHD G;  2SAK A;  3W5U B;  1SXT A;  1W6J A;  3NRZ A;  2V3N A;  1BXT A;  1D4B A;  3K7X A;  1E10 A;  2MJE A;  2XQW A;  5GZK A;  1SQC A;  1OQQ A;  1QT9 A;  1ZXH A;  3BWU D;  3M71 A;  5MEH A;  1HCU A;  1IBX B;  4HRO A;  2AX5 A;  3W5V B;  1UWM A;  2F0Y B;  2WYN A;  1XCT L;  2K5P A;  3LB8 C;  3MFG A;  3V3X A;  3R2I A;  4XE0 A;  1H3C A;  5AGD A;  4HKQ A;  1FO4 A;  1IS9 A;  1CQV A;  1FM0 D;  2Z07 A;  5BMG A;  2SQC A;  1TZO A;  4J5T A;  4US8 A;  2V0G A;  1PYW D;  2LFI A;  3S4C A;  2MEK A;  3Q75 B;  3AE9 B;  1WU5 A;  2B39 A;  1GXO A;  1KSD A;  3Q79 B;  4USA A;  1H13 A;  1O6H A;  1AYF A;  3E9S A;  2KAC A;  3M74 A;  1SE3 A;  1B1Z A;  1E6E B;  3RX5 A;  1NI1 B;  2Q5W D;  3GLY A;  1XF5 L;  1VRA B;  3HUI A;  1UGJ A;  1L0V B;  1FAE A;  1UNS A;  4FXC A;  2RMM A;  3D3I A;  2BTE A;  4TF4 A;  1MI0 A;  4D4C A;  2BT6 A;  2FE8 A;  2L83 A;  2RGK A;  3EUB 2;  3M75 A;  3GP7 A;  1N94 B;  3ZQ4 A;  3ANK A;  3P4S B;  4DXG A;  4GTS B;  4ZHP A;  2OKX A;  2GZ6 A;  1FT1 B;  4AYP A;  3IAS 1;  3E32 B;  1YMH E;  4JPS A;  5TSS A;  4D94 A;  4Q2J A;  2QIE B;  1ULV A;  1HQR D;  2DRR A;  1KTK A;  2WS3 B;  3IAM 1;  1FXA A;  1K50 A;  2VZK D;  3KWV A;  2AQ1 B;  2ZW1 A;  2L52 A;  1H54 A;  1KZO B;  3R8B A;  3ACS A;  1DOI A;  1JWU D;  2GI9 A;  3W7X A;  1VZ6 A;  1P7F A;  4MU9 A;  3PO0 A;  3HXB B;  1F9D A;  2RPV A;  5KKB A;  2NVP A;  1L2A A;  3SDU A;  4C1S A;  3W5M A;  4N59 A;  3PZ3 B;  1L0X B;  1YNT E;  1FNV A;  3AE1 B;  1J7C A;  1IGC A;  4LK0 M;  2DBY A;  4OZC A;  3GS2 A;  1FCC C;  1YQ4 B;  3RFZ B;  3TF4 A;  2BB5 A;  3W7U A;  3AE6 B;  2VN7 A;  1E0Z A;  2WII B;  1OFF A;  4L1B A;  3PZ4 B;  3BYT B;  3TEX A;  2YEP B;  4D2K A;  1FBW A;  5D7G A;  4C80 A;  3P42 A;  1AYX A;  1N62 A;  4CQN A;  3MP9 A;  3EUV B;  3DSV B;  4QT9 A;  1EWY C;  4IDI A;  4NJC A;  4US9 A;  1XLN A;  4WIP A;  1HZ5 A;  2F6D A;  3EU8 A;  4TQ0 A;  1WRI A;  3B9J A;  1JCK B;  2XFG A;  3S9V A;  3ZJT A;  4AS1 A;  4BOJ A;  1N61 A;  3AE5 B;  2K22 A;  3HRD D;  5FO8 B;  3LXF A;  1JWS D;  3RPF C;  1DL2 A;  1VJK A;  1K72 A;  3C72 B;  4ZRQ A;  1NYQ A;  3P2C A;  1Y56 A;  3W1S A;  1D5Z C;  4ZRP A;  3P63 A;  2SEB D;  3M7E A;  2PW9 A;  1KSC A;  3TEZ A;  3PZ1 B;  2WXR A;  3ZGZ A;  2DRS A;  3NUH B;  3EU5 B;  3H7L A;  3T3O A;  4LNV A;  1KFY B;  1K53 A;  3P4P B;  2WXL A;  1JCQ B;  1CEM A;  3M7B A;  4H2A A;  3Q8F A;  3M7L A;  2WDV B;  3H8H A;  1DOX A;  1V5D A;  1UT9 A;  3HXD B;  4YSZ B;  1WXQ A;  4L2Y A;  4YTN B;  3ANI A;  2GOX A;  1WWT A;  2CQT A;  3AEC B;  5BMI A;  1N95 B;  1FFU A;  1I4P A;  1F2R C;  2V8J A;  3T33 A;  2G02 A;  3DRA B;  3U52 E;  2H88 B;  2KQ4 X;  4XDD A;  5EE0 A;  3H2W A;  1SIJ A;  1DGJ A;  2LUM A;  3SFD B;  2P0V A;  1JS4 A;  2EAB A;  3VRB B;  3PMM A;  4YSY B;  5EE9 A;  4NAW B;  4XUV A;  4XWW A;  3L4P A;  1TNY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...