3KQ4A

Structure of intrinsic factor-cobalamin bound to its receptor cubilin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
393
structure length
385
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gastric intrinsic factor
total genus 114
structure length 385
sequence length 393
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3kq4A01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3kq4A02
1W6JA 3PZ1B 3D5SA 1N4QB 3DSUB 4MBGB 4LNVA 1O1RB 3EU5B 4D4AA 1R76A 3PZ2B 2G0DA 1NL4B 1SQCA 3EUVB 4GTTB 4GTQB 1H3CA 1SA5B 3DRAB 3Q79B 2PN5A 1GXNA 2WINB 1H39A 1O1TB 1GXMA 2V3PA 4D4BA 3DSXB 1JCRB 4GTRB 1C3DA 2BBCA 1H35A 3Q75B 1H3BA 3KSLB 4ZH1A 1NI1B 4LNBB 1QQFA 2H6GB 5FO8B 1S64B 1O6HA 3HXFB 5FOBB 5FO7B 3U7ZA 1N4RB 1FPPB 3DSTB 1QBQB 4EHMB 1D8EB 3E34B 4YDOB 4ONTA 3DSWB 4GTOB 2B39A 4D94A 4FXGB 1O79A 3C72B 1H36A 3D5RA 3DSVB 3Q73B 3Q7AB 3RJ3A 1N94B 1TN8B 2BB6A 2H6IB 3OEDA 3KLSA 3KSQB 5FO9B 2ZISB 2BEDB 4KKJA 3HXBB 4ZRQA 4FXKB 1N4SB 1X81B 1TNUB 3OXUA 1W6KA 2WY7A 2ZIRB 4D4DA 4D4CA 3SFYB 4MU9A 1GSZA 1TN7B 4M76A 1KZOB 1N4PB 4GTVB 2V3NA 1FT1B 1HZFA 3PZ4B 4V1SA 1O1SB 4GTPB 1H3AA 1UMPA 2R2LB 3Q78B 2V8JA 1SA4B 4L9PB 3Q7FB 3SQCA 5JPMB 1LD7B 1O6QA 2F0YB 1FT2B 2H6HB 3CU7A 3G6JB 2G02A 2A73B 2PMVA 3E37B 1GHQA 1TN6B 1N95B 3E32B 1LTXB 3HXCB 2WIIB 3K7XA 1TNZB 1N9AB 1JCQB 1KZPB 2GOXA 4GTMB 2V8IA 3HXDB 3E30B 5JPNB 1DCEB 2XQWA 5AGDA 3DPYB 4BOKA 4LNGB 4YDEB 2BB5A 2H6FB 2XWJB 1S63B 1GXOA 1LD8B 2V8KA 3SFXB 1QSJA 1O5MB 4KKIA 2XWBB 4C1SA 1TNOB 3HXEB 1O6RA 3E33B 3DSSB 1H37A 2SQCA 4GTSB 3KQ4A 3PZ3B 2NOJA 1TNYB 1JCSB 1MZCB 4ZRPA 4V1RA 1D8DB 2I07B 2IEJB 4BOJA 1TNBB 2WY8A
chains in the Genus database with same CATH superfamily
3C0RB 5JHBA 3APFA 3TF4A 1P0RA 1OGWA 1KRFA 4GTTB 2W3SA 4XDDA 4JGHB 1WWTA 1IS9A 1WXSA 1WE7A 2WXJA 5IP4D 3U4EG 2A4ZA 1JW9D 3N1YC 1MPEA 1MFWA 2XBBC 1LXDA 4LNIA 5GY3A 1FXTB 1WX7A 3U7ZA 4K81A 3DSTB 3QA8A 3N1XC 2JXTA 2N9EB 4YTNB 5ILDA 1TTNA 2NTTA 4C80A 5D7GA 3QT3A 3WANA 2IY1B 3P4RB 5DCNA 2FBAA 2XK5A 4NNJB 2AX5A 1KTKA 3CSTA 1E10A 2J4XA 2N4FA 1N5WA 3S4CA 3WKHA 3W7WA 2D11A 2G4SA 5FO9B 3W7TA 1J7BA 3A9JB 1X81B 2O6VD 2LWPA 1HZ6A 3AULA 1TS4A 4DHZB 2V3NA 2SAKA 2R61A 1O1SB 3M7LA 2EELA 5CX3A 2C9WB 4M02A 1V7VA 3P2BA 1JALA 1IA7A 2LJ5A 1LD7B 3TJPA 2D8LA 3AE5B 4G50A 4IWPA 2YIKA 1L5PA 4W9HA 3TMPB 1N95B 1EM7A 1L4ZB 4WWOA 3Q69A 1GC7A 3RCZA 2RPQA 2WXOA 4GTMB 3I5JC 1OJNA 5DPWA 2G1EA 3DPYB 4DDID 1V7WA 4FJYA 4YWGG 3TL5A 2GB1A 4OVUA 3AFJA 2GBKA 4HRSA 3M7EA 4MMIA 2PTLA 4C1SA 1H14A 4BVUC 2QC8A 2KNBA 2KVZA 2RGFA 1VZ8A 3P42A 1GC6A 2BRWA 2C7NB 5GZKA 2IEJB 3ML8A 2KMMA 2L32A 3SFEB 1W6JA 3VR9B 2HJ8A 1N24A 1V7XA 1HA5A 1I4QA 4JIOU 2RDBC 2N9PC 2V4IB 2VN4A 5G55A 2VN7A 5J17A 3H7LA 3BK2A 5E6NA 5HKHA 1E90A 4A9AA 4C4VA 3DPDA 3M01A 1O6HA 3M7CA 3W5NA 1LM8B 1LGRA 3TEYA 3P2CA 2MP2A 5AZGA 4FJVB 3ECIA 4M0WA 3AE7B 1KSDA 1DYQA 1FPYA 1PYWD 4M01A 2E6XA 1W3YA 4JPSA 3R3MA 1RAXA 3EZ8A 3RUIB 4YCRA 2Q5WD 2KTRB 2QSDA 3SDTA 1FNUA 3WUXA 3PS6A 4CYEA 1WXQA 4WH4A 1J0NA 2K8CA 2NCNA 2RSUA 2ZISB 1WIAA 5IK0A 2RGKA 4EKUA 2ZVNA 3T33A 1UG9A 2QMTA 1V97A 3RX5A 3EQAA 1E5WA 3AV8A 4GDLB 1EU3A 4AQ7A 2FUQA 3U7DA 2PKOA 2WX0A 3CU7A 1TN6B 3I3TB 3DHGC 1J19A 2RPVA 1UUPA 1QKZA 1SE4A 2HD5B 1JWSD 3NNBA 4D2KA 3HXDB 1WU4A 2KWCA 3O13A 4ZRJA 1HN0A 3N1ZC 3RNEC 2C60A 1P3QU 1L1YA 2M4NA 2G9HD 1HX9A 2OJRA 3AM9A 3L17A 4WVCA 1O5MB 2KJRA 3RNFC 2IO0B 3ZQ4A 4X57B 3ZNHB 1H37A 3DWGC 3D3IA 4MJSA 4ZRPA 2LI5A 4PK1A 3WKFA 3IT4B 1YQ3B 3QARA 2F6DA 3BIID 2J52A 1RWCA 3WA0A 5IKHA 3S4BA 1U4AA 4LNVA 1KLUD 2MBBB 3PZ2B 4XE0A 4AOFA 3FILA 3TEZA 1RYJA 3Q79B 4XUVA 2KK8A 3W7SA 2FNJB 4F1SA 3DHIC 2QHOA 1C77A 4RM8A 3TEXA 1IUEA 1N4RB 3QFYA 2DZIA 2KZRA 1WF9A 2IGHA 3KUDB 3L13A 4LNOA 3C72B 3HUIA 3UI3A 5CHWA 1H36A 2INNE 3WIRA 2JVCA 4DHJB 1YIWA 4XX5A 2V9HA 1WZ3A 3Q3NC 2KN5A 2FE8A 5T8IA 3H7PB 1SE3A 1F9OA 1ZXIA 2OJWA 4HEA1 5D94A 2Y5BB 1I4RA 4IC7B 3SFDB 1GAQB 3R7QA 2KDFB 3C19A 2R2LB 4RH6A 3VVWB 3DWMA 2JT4B 2ASQA 3ZW3A 1KFGA 2A5UA 2IO2B 2LGSA 5I4DA 2BKFA 2E22A 2KDBA 3QX1A 3E37B 4GB9A 4F13A 2RD0A 1IP9A 4WWMA 1MG4A 4W9EA 4DODA 1ZPSA 1F1SA 2CJNA 1T3QA 1KF6B 1NC5A 1ZE3D 4NQKE 1DCEB 2LZ6A 2JQRB 1FIQA 1V1PA 2K8BA 4AYPA 3NOBA 1UWMA 3ZXRA 4OZBA 4BZAA 3RENA 1CK1A 2IYDB 4DBGA 3FILB 3W7UA 4HDQA 3UIOB 4Q2JA 2GMIC 3AEFB 4MT5A 1HTQA 3WIWA 3ZVVA 1JCSB 1N7QA 3MFGA 5D2MB 3DVGY 1SGHA 1XLOA 3ONSA 4BOJA 3RNGC 1TNBB 1AARA 4RCOA 3U52E 4HJGE 1D5XC 4MBGB 4KTPA 2EACA 3EU5B 4L2YA 4E3CA 1N21A 1R76A 1I4HA 2K1FA 4KGSA 3B2FA 2JZ3B 3S9VA 2QEJC 2KDMA 3GE3C 3GZKA 5CZLA 1UD7A 2KWVB 4EFOA 4KZ0A 2PE9A 1N63A 4IM0A 2B76B 2KAJA 2EABA 1TZ1A 3VXWA 4EE2A 2B39A 4FXGB 2N7DA 3ZRCA 2E24A 1XD3B 2YVCA 4IKGA 3DBHI 3PRMB 1RQ5A 2N9LA 3RJ3A 3RRSA 2BS3B 4IG7B 2LVQA 4BAXA 1QZEA 2MJEA 3KLSA 3LDZE 1XEEA 3VH3B 4P16A 3ACSA 3ANKA 4ZRQA 4B95A 1STEA 1ZUD2 1JWBD 1N60A 3L54A 4BKTA 1UF0A 1GA2A 4J5TA 1Z5SB 3L16A 1V1PB 4GTPB 2N9KA 3DBHB 1L4DB 2KTRA 3PZ8A 2ZBLA 2AL6A 4A3OA 2CKHB 1Y8RC 5DGRA 2N7EA 1G6IA 4IWQA 2K22A 2IO3B 2A73B 2L3ZA 4MGKE 2IBIB 4FHKA 3P1MA 2JSVX 1HMUA 3RPFC 4EZKA 1KZPB 2AYOB 3HRDD 1WXVA 4CE7A 4F10A 2J0JA 2K6DB 2NVPA 3SEBA 2EKEC 4WJOA 3BYTB 4XWTA 2LGYA 2QDFA 3SFXB 4HK2A 4TMAB 2W54A 3IVFA 3AE6B 1TNYB 1Q5WB 2CQSA 3PZDA 5ILJA 3Q8EA 3ZNGC 3ZNID 4WURA 1VR9A 2EADA 3ZDMC 2ZPYA 1HXAA 1FBOA 1FRRA 1V9JA 1WZZA 2ZZPB 3VH4B 1VLBA 4CQNA 2DYOA 3N0FA 2NR2A 4B0MA 4EEWA 1GB1A 2IPKD 5EE1A 2N1VA 2LVPA 4HROA 4P7IA 5ILHA 3HXFB 3ZJUA 2I1JA 2JF4A 2EMTA 4LCDE 2Y5PA 3M7BA 2BQQA 1I4XA 4KSKC 3A0OA 1YNTE 3PTFC 1C78A 1CJEA 2INDC 2JU6X 2JRIB 1K53A 4WVAA 5IL3A 3N32A 1L7YA 2O6VA 2PPHA 2WLBA 2KTFA 3RT3B 1V2YA 4H2AA 2X38A 5TR5A 2FCMA 2CHWA 1TNUB 4AYRA 1TJEA 2KWDA 3KH0A 3SFYB 1OTRB 1ZGUB 1WR6E 3V05A 4M00A 2V8JA 1SXTA 2MBQA 2LFIA 3R7RA 3T8MA 1G87A 4KDIC 3M76A 3DBRI 1F9JA 2BTEA 2J7QB 4DDGD 2FV0A 3AEBB 4G3XB 3K11A 3K7XA 2GOXA 3CF6E 1SIJA 3ZO5B 2WDRB 1B1ZA 3E30B 2XQWA 3D32A 4A90A 1C4CA 4IWOA 1JCKB 2DRSA 4AUQC 4AS1A 1UGJA 1WFYA 4ICVA 1D3ZA 4JJJA 1UT9A 3M75A 4US9A 3ON6A 2D3GA 4C00A 3V61A 1HMWA 2KFKB 3Q3MC 2JXXA 1PUTA 4FLHA 3NS1A 5EAUA 1A70A 2I07B 3AN1A 4ANVA 1T0QC 3ML9A 2EAEA 2LVOA 1WGRA 1QLBB 2ZNVB 2H88B 2MBHA 3BVGA 1T5XD 3FAHA 2FCNA 1P7FA 4AJWA 1H39A 3Q14C 3M3JA 3H6NA 2BBCA 1RWAA 3IT6B 4IM2A 5GXGB 4RGOS 1D5ZC 1E8WA 4BKGA 2AWTA 3MC8A 4MACA 5FO8B 3N0GA 5IM1A 1OFFA 3PRPB 3RNCC 2DYMA 5H8YE 1V8CA 4OZWA 3E34B 1NYRA 2MRPA 5IAAC 4YDOB 3T3NA 4TV3A 1FCLA 4LDTD 5ILIA 4WVBA 1O79A 3BK1A 2WXKA 3HVZA 5DPSA 5C23A 1PGXA 2GBJA 2G4DB 2H6IB 3A4RA 4PS8A 4US8A 1CZPA 2I1KA 4BKSA 2BEDB 1RFKA 2W9NA 1C1YB 3APCA 2KWUB 1W6KA 2WY7A 3APDA 2J53A 3AU5A 3Q8AA 1N4PB 5JZEB 2WDVB 4JL9A 1JWMD 4YXDB 4V1SA 1QF6A 3PZ4B 4DHZE 2BW2A 2WDTB 3AI5A 4EUTA 1ZDVA 3WKIA 3DVGX 1WY8A 2HE7A 3NRZA 4XDCA 4L6XA 3K9OB 2GRIA 2XEWA 2PMVA 3HIZA 3S4DA 4ARIA 2P0VA 1H54A 2BYVE 5MEHA 3RYTA 1GB4A 3GOEA 2PVGC 3N9YC 1UWXA 1F52A 2WXIA 4MGZE 3MTNB 1N22A 3QSPA 1E8ZA 1NENB 2XN9C 4DHJD 2H6FB 1I4PA 4MEMA 4W9KA 3OWEB 2V1YA 4W9DA 1WGDA 3A4SC 4MELA 4YTPB 1RM6C 1NEKB 4FNVA 1IBXB 3E33B 2QILA 4HCPB 3R2IA 1YN4A 2ZCCA 5E6OA 5AZFA 1E6EB 3AB5A 1L0VB 1QOGA 3ZTCA 3ZGZA 1A5RA 4GOCA 1KKTA 4CHKA 2CU3A 3A1QB 3W9CB 2GOWA 1LQBA 1IGCA 3QQ8B 3AEGB 2SEBD 1IYFA 2JRHA 3VRBB 1TKYA 3X23A 1XF5L 2CHXA 2O2VA 3AEEB 3PPAA 2WINB 4LJPB 4FA6A 3B9JA 4YSZB 1E8YA 4GTRB 2K8HA 2D07B 1RWFA 1H3BA 4C7YA 1HV6A 1XXGA 3TCAA 4HPMB 1NDDA 1NBFC 1S1QB 1KREA 3OAWA 3M71A 3G4FA 3BWUD 3QC8B 4LTUA 5FO7B 2RR9A 2KYWA 1C9FA 1D5MC 3ZTDA 3IHPC 1C4PA 1K72A 1WE6A 2EKIA 4QT9A 3U30A 3RX7A 1WGGA 4IW0A 2IGGA 3D5RA 3ZLZA 2OKXA 2QIEB 4KX6B 4P1BC 3ALBA 1S3SG 4ZYNA 3KYCD 2MQJA 3RZWC 3UINB 1WMHA 1L6VA 4RF1A 1AYXA 2M17A 1HXGA 4FUSA 1QOFA 1XO3A 2WP9B 3W5UB 4G0NB 4ARCA 1UMPA 3PZ7A 1F77A 1WRIA 3RFZB 3B08A 3CIHA 1CLCA 1R7SA 1SJHD 3EGRA 3M74A 2G02A 1GUAB 2AL3A 1FRDA 3ACTA 4FXCA 1IPGA 2CR5A 2BS4B 1TNZB 5G5GA 1VZ7A 1ZP0B 2L7RA 1WYWB 1YOVB 4TF4A 4XC2A 3IG3A 2BB5A 3NZ3A 2OOBB 1Z2MA 1TY0A 4KSLC 2H89B 2WDQB 1L6UA 3DVNV 2V0GA 2N0SB 1TIFA 2IJ0A 3ZUNA 3PT2B 5HG2A 1JMLA 4V1RA 1WYGA 3QT9A 4NEIA 2GH4A 3C8YA 1N4QB 1LO5D 4ITKA 2IY0B 4AYOA 2K9XA 3RMKC 2C7MB 5M7YA 3KWVA 1F2RI 1H3CA 2DBYA 3AE1B 1ZKHA 1GXNA 4WU0A 4W9IA 5IK9A 3WCQA 4OW0A 3VFKA 3NHEB 4HJKA 3JVZX 1H35A 2Z59B 2LMCA 4HCNB 3NZSA 1Q1OA 2VH1A 3KYDD 3P4QB 2CQTA 3H7PA 4HPLB 4MH8A 2KFJA 3W1SC 1D8EB 4ZHPA 3MHZA 1MJDA 4II2B 1KJTA 1E0ZA 3LXFA 4YTMB 1C3TA 3DSWB 1PGAA 1FO2A 3PHWB 1GAIA 4RNAA 1UNSA 1FXIA 4ZG8A 1GG3A 2ZPNA 3KVFB 5DHKA 1MVKA 2GBNA 2DHZA 1H13A 3B0AA 4J3OD 3OEDA 4B6WA 1B9RA 2AFAA 4Q2BA 4ZH5A 3NUHB 4A8XC 5GW7A 3M78A 5MPOA 1ET9A 2JJBA 3PV1A 5C1ZA 1GAHA 2K0PA 3JYUA 2DWQA 3BYYB 4D4CA 2ZW0A 3QXFA 1TN7B 2C5LC 3VTWA 1FCEA 2FUTA 1ZXHA 4L9PB 2VZKD 4RGMA 3AECB 3M73A 2WYNA 1NYQA 1KH0A 2F0YB 1NI2A 3G6JB 1WR1A 2WCOA 1VD5A 4KVGB 4CO7A 5KKBA 3Q2AC 1JCQB 4WJNA 3GB1A 3A33B 5FR3A 3QCAA 4KIKA 1FO3A 1YQBA 2RI9A 2K6QA 4K7UA 3RNBC 3QRYA 4LNGB 2ZVOA 3LZ9A 1GXOA 2WX1A 1J7CA 2KD0A 2KQ7A 1LXMA 3DHHC 1ZDXA 3AH7A 3OLMD 5JXVA 2ACZB 1HM3A 4Q88A 4ANWA 2FBWB 2M8SA 4E74A 1LF9A 2JZPA 3QHTA 3IFWB 2L52A 3LB8C 1FM0D 1K52A 3MP9A 4OZAA 1KWFA 3AXCA 3VW5A 5IKAA 1H4RA 3AEDB 3DDCB 2JWZA 1NXCA 3RD2A 2FUZA 1Q10A 3NVWA 2KQSA 3DVNU 5IOIA 1TS2A 3SDVA 2PN5A 2KACA 5M7IA 1GXMA 1YJJA 2IO1B 4JX1C 1F9GA 1OJMA 3OJ3A 3HK0A 2Z0DB 1I7HA 1JQ4A 2GLSA 4RGNA 3KUCB 2KDEB 2KOXA 5DGQA 1FBWA 2J0KA 4ASWC 4EOYA 2CU1A 3V62A 3PHXB 1V6EA 2L0FA 3DBSA 2VH2A 2KDIA 2O2VB 1CMXB 4D94A 2NVUI 2LUMA 3NFVA 4FJQA 3Q73B 2Z0EB 4II3B 5LXHA 2QNOA 2XK5B 2KMCA 4HLEA 1PGBA 2KT7A 2ZZRA 5KHQA 3GLYA 3HVDA 1LF6A 3QAQA 2LUEA 3SDRA 1IGDA 3HXBB 3EUB2 1JRUA 3O65B 2WGSA 3SU8X 3AFLA 4WJPA 5L95C 1JWAD 4M76A 1KZOB 1MI0A 3I9V1 4BBNC 1H8CA 1H3AA 1QOBA 5DPTA 2M19A 3RNAC 1P7EA 4ACFA 3Q7FB 2M56B 1G9JA 1DOXA 4TQ1A 4MM3A 2K39A 3VDZA 1EF1A 3WAOA 1FT2B 3EA6A 3VRAB 1GHQA 2JY6A 5ILKA 2MJ3A 1XW2A 3EFUA 4KGTA 1P98A 2INPE 5IO9A 2BT6A 3T3OA 1UELA 4ZYSA 2LRUA 4NAWB 3AMZA 3T9LA 1JRPA 1YJ1A 1DOGA 2R2OA 1NI3A 2NBUA 3DBLB 2V8KA 2BS2B 1WM3A 4GN1A 3E6UA 5E6PA 2TSSA 2E3TA 3PSEB 1N5XA 2PJHA 2SQCA 3AE8B 2WXPA 1WJNA 4BFRA 3W7XA 4REZA 5C2TB 1OEYJ 1FD6A 3D5SA 2LXAA 3QXQA 4AWJA 1SF0A 3EUVB 2CHZA 2KLCA 4GTQB 4FHJA 5D6JB 2AQ3B 1KS8A 4D4BA 1KOTA 3ANJA 1KM7A 1SB3C 2RDGA 4IOIE 3W5MA 2ZEQA 4MMHA 1T0YA 4NJ7A 3PYAA 3Q8FA 4NQLB 3MJWA 1RFAA 3NVYA 1I42A 4EHMB 4WAAA 3K9PB 1CEMA 1P9DU 4GTOB 4P1CC 3Q8CA 3A3VA 3X17A 4W9LA 2LJIA 1BXTA 1EWYC 1OEYA 4RFBA 2BB6A 3GZNB 3KSQB 4LNFA 4AP4C 2BRVX 5J18A 1FMIA 3BZDB 2BVCA 1N4SB 2D5JA 4GLSC 4XGAB 4WQMA 1WGKA 3IBEA 4JWUC 1GSZA 5IL8A 3AE9B 3L0WB 4RF0A 4EZJA 3ZJTA 4DK5A 3UQAA 3MC0B 1C76A 1F9DA 3SQCA 2DAJA 1LFDA 1M94A 5ILZA 1TBEA 4ANXA 3EC8A 1PDXA 5LNK1 4PT5A 3DQVA 5JHAA 2D2QA 2MH7A 3R2TA 3CWIA 2JZZA 1GJZA 1AN8A 1N9AB 3LYYA 1WX9A 3PO0A 4DXGA 5CA3A 3FKYA 4GDKB 3AE2B 4C7ZA 4FADA 2B4FA 3P5RA 1GOZA 4RM9A 2KXJA 2BYEA 4KKIA 1O6RA 3Q3OC 4K7WA 3W2DA 1RWHA 3EU8A 2DZKA 4GU2A 1Q0WB 2D3BA 1KLGD 2WQYB 2L8JA 1TS3A 3KLSX 4L0GA 1D8DB 3PMMA 3RI7C 3V3XA 3AE4B 2XFGA 3ABVB 5EASA 1E9MA 2UWQA 3BVMA 4FJZA 4XZ4A 2NBVB 1YMHE 2DNFA 4A6QA 1SSNA 4XWWA 1CB8A 1DL2A 1NI1B 1JWUD 4Z4LA 5TSSA 2M0XA 4LNBB 3ZIMA 2AQ1B 4FBJB 3PGEA 3E7JA 1OQYA 3N20C 1L2AA 3V6EB 4NY0A 1QBQB 5EE0A 1WJUA 5FR6A 2L83A 2QCZA 4E71A 3RULA 1CQVA 4URKA 1EU4A 5AZHA 2C7HA 2LD9A 1G6JA 1EGUA 3BVZA 3X0WA 4Z4JA 3ENEA 2D5GA 1N7RA 2WXRA 4HDOA 4IUMB 4KKJA 2VZKB 4FXKB 2JPHA 1N20A 3M63B 3Q8BA 3R8BA 5JH5C 1N7NA 3Q6BA 1SA4B 2J0MA 2MCNB 4DI5A 4GDLA 3S2AA 1SEBD 1KLVA 2DENB 1T0RC 4IM3A 2RI8A 1J0MA 3TEWA 2H6HB 1SE9A 2KQ4X 4RNQA 3P4PB 4OZVA 3V6CB 1K51A 5E2JA 4WJQA 3SDLC 2PEAA 2V8IA 2K3UA 2AHGA 3WIMA 1XWQA 2D3AA 3VUYA 3QDEA 3A1QA 1HQRD 2AHFA 4HWIB 4F8CB 5EE9A 5HI1A 3B2GA 4BKSD 1WZ0A 1LD8B 1WRDB 4MM3B 1R4MI 5EDSA 3PLVA 3W1SA 2IDYA 4PYZA 1WU6A 1FEHA 3DSSB 4PYUA 4GTSB 1IBXA 3BINA 4GIVA 4LLGM 1K50A 4L23A 3JSVA 3L10B 2NS5A 4MJSB 2ONHA 5GMVA 3QWTA 3WC3A 1XQQA 4ZRKA 5AEKB 3TUOA 1E7UA 3NG0A 3DSUB 1L2NA 2EMSA 3PVLA 4LIXA 2KJHB 1DOYA 1SQCA 3DRAB 4ICUA 3FC4A 4NPNA 5FKAC 2V3PA 2YLMA 1YN3A 1FFUA 1C3DA 2BYTA 4TKNA 4DXFA 1V5CA 1OQQA 3VAWA 3QIJA 1UH6A 1S64B 2PVOD 4TQ0A 5CD2A 2FUG1 4K3CA 1WMHB 1WGYA 5IK6A 5C3JB 1N61A 4ONTA 4O1NA 2DRQA 1WJ6A 1ENFA 2REXA 1EUVB 2JUOA 3LJ3A 3DSVB 2O6VB 2WU2B 4A20A 3QG0A 5HHDG 3UGBB 3CIRB 3L4PA 3PYBA 2BPSA 4MDKE 2KC2A 4M8MA 2MEKA 3N30A 3BY4B 3SDUA 3VSNA 2KLGA 3H2WA 4GMVA 4RMAA 3Q78B 1Y56A 2LHEA 2G3QB 4MGIE 1UBQA 4NAMA 4NJ6A 2BKRB 1QAZA 5C05A 2AEHA 3E56A 5G2NA 1R4MB 4NJCA 4L1BA 4KV2A 4HVBA 2DROA 3GZNI 3H8HA 2CJOA 4JLCA 4MSMB 1ZW7A 1ZOYB 3TBLD 3A9JA 1FXAA 2L05A 4N58A 1L0XB 1NVID 2A8ZA 2UYZB 2WXMA 3H7SA 4E1YA 2B3AA 3M72A 1FO4A 4YDEB 2UU7A 2X8XX 4LDTB 1S63B 3AU4A 3Q3JA 5IKCM 4P6VF 3NS8A 1FFVA 3VQIA 1YN5A 2WU5B 5L83A 4J6IA 2MA9B 4S0RA 5ILYA 4QAYA 3UQBA 1MZCB 4B9KA 4ZDVA 5BYQA 1AYFA 3P63A 1V81A 3DOWA 1AW7A 4K3BA 3SHQA 4BOSC 3B1LX 2FAZA 2KJ6A 3WAMA 1C79A 4LK0M 1O1RB 5EE3A 2RMMA 1VD2A 4N6EB 4A3PA 3P4SB 3UF8A 4MGYE 4KGRA 1GNUA 4EZLA 1JCRB 2FCSA 2I38A 1N62A 3G4DA 1TKEA 4G11A 1QQFA 2HJ1A 2WYQA 2Q1FA 3PLUA 3ETRA 3VTUA 2ONQA 1WJ4A 5FOBB 4KTRA 2CS4A 4ANUA 2Z8LA 2QJLA 4OZCA 4GXBA 1XCTL 1PQSA 2K25A 3VHTC 1N1ZA 2DRRA 1EF5A 5HFYA 1M4VA 1F2RC 2D10A 3HHMA 1R4NI 2WXLA 1WXAA 4JE3B 5D3IB 3W5VB 2MBOA 3E73A 4C4VB 1FAEA 3RZFA 3DBRB 2MBEA 2WWZA 2KANA 3H1UA 1TS5A 2M0AA 3NVZA 1IA6A 2ZW1A 1BT0A 2LRWA 1E8XA 1ESFA 2HTHA 1V49A 1VJKA 4MU9A 3A9KA 1D6EC 5IA7A 2M1MA 1RW9A 4YSXB 4MH0E 2ZNVC 3ZNZB 1O6QA 1SBBB 2ZJDA 3KWLA 4C56C 3QFZA 5BMGA 3E32B 1E7VA 2X03A 4DOEA 1T0SC 3TIXA 1RRBA 1XLQA 4LNKA 5JPNB 2HTME 3MHSD 5BYSA 2OHFA 5AGDA 4IDIA 4KDLB 3VUXA 2LXCA 1R4NB 2IZVB 4ZRIA 2BGFA 1V80A 1X1JA 2XWBB 3NJTA 1TNOB 2KFKA 3M95A 2BRPA 2V4LA 3KQ4A 2KC1A 5CHFA 4CJ0A 2Z07A 3HM6X 2MWSB 3MJ5A 1SE2A 1X9DA 1P1AA 1ROEA 1TY2A 2ICIA 4I6NB 1AGMA 4D4AA 4OK2A 1RLFA 3N3KB 4A55A 4OHJA 1KSCA 1VDVA 4EL8A 3GS2A 1LXKA 2WXQA 1SJED 3Q75B 4OJZA 4W9CA 4ZH1A 3MC9A 2H6GB 1FNWA 2OEDA 3DCGA 2ONGA 1UZXB 1FPPB 3WIQA 3SDQA 1TGZB 3GT5A 3A9KB 3P5PA 2I2YA 1TF4A 2HDEA 2D3CA 1JROA 1C82A 2JG0A 4LNNA 4WWNA 2W55A 4UDUC 2NTSA 2R2QA 1XWTA 1TN8B 3JW0X 2NMQA 1TYGB 3H9DA 2BWES 4RGTA 2WXFA 2GZ6A 1EWCA 2WXGA 2G45B 4HKQA 2K5PA 2L1AA 2L0TA 3OXUA 4S17A 3SAEA 3WALA 4YT0B 1N7OA 4W9GA 3AEAB 2DLBA 1HZFA 4NAWA 5BMIA 2Y3AA 2LGDA 3V60A 1D4BA 1ISNA 3PREA 4K7SA 5JPMB 4ZHOA 2MSED 3KW5B 1FNVA 2MX2A 4KZCA 4WQOB 4W9JA 3PRZA 5BYRA 2ON8A 3M00A 3QJZA 5G5HA 4HPPA 3WAPA 2JF5A 4GDKA 3EFCA 3ZYYX 1QILA 3TSSA 1QQRA 4XYCA 2XWJB 1ULVA 1J7AA 1V86A 1VRAB 1AWDA 3IAM1 1V5OA 1C4AA 4TSSA 5BMHA 2JX5A 2LGXA 1HXCA 1X1HA 1H12A 2BF8B 1I35A 1MG8A 4N9F4 2GI9A 2WY8A 1EO6A 1XLNA 4R3DA 1I8QA 3U8ZA 2FIDA 3E9SA 2NPTA 4DXAB 3ZKJC 1NL4B 1WM2A 1WH3A 1OJPA 5LXIB 4WWPA 1RWSA 1O1TB 5LLIA 2DZMA 1ET6A 3DSXB 1QT9A 1V5TA 5D3DA 1N7PA 2V3SA 2ZCBA 2J5CA 2PIAA 2MW5A 4BBNF 1E7PB 2KHWB 3RX8A 2PE6B 3ANIA 1BMLC 3EECA 3SD5A 3SR6A 4GL3A 4FN2A 1J0GA 1JS4A 3Q3FA 4I6LB 4B0EA 2LHDA 3Q7AB 2XNAC 1QOAA 1N94B 3VSMA 3ZJVA 3VTVA 3QK0A 1GPXA 1XCQL 2KVRA 3QWZB 4K1RB 3M62B 4GTVB 5JMDA 3QPFA 2KMAA 2PLPA 2MLBA 3M02A 2WDAA 2PW9A 1N1BA 3OJ4B 3IAS1 1PFDA 2LEKA 5BO4B 1VCBA 2WNMA 2WHIA 1YD8U 5IN7A 1XT9B 2LGIA 4TUUA 1HM2A 2FV1A 2WIIB 4GGQA 1LOHA 3NVVA 1X1IA 2L00B 2N7JA 1HE8A 5JMFA 1TKGA 1TT5B 3E80A 1WGHA 2N1WA 2JYEA 2VRRB 4DQOC 2KO3A 2L76A 4M8NA 2WXNA 2MJDA 2BWFA 3I57A 4W9FA 2FUHB 3CMMB 4USAA 1K8RB 4YSYB 2NPTB 5E6JA 2NBWB 5AUIA 1UGMA 2JWUA 4HXDA 4CJ1A 2KN4A 1V1OA 4TXTA 3GE8C 4JQWC 1F1HA 3CSFA 4GSWA 3S4AA 4GAXA 1G9GA 2GBMA 1V5DA 1I4GA 2BYFA 3ZDTA 2Y5CA 3PZ1B 2KKCA 3KUZA 5J2RA 1KRHA 3ZRFA 3DBLI 3NZUA 3IXSA 3RN9C 3OG5A 2G0DA 4BOZB 1XLPA 2DAFA 2FCQA 2KX3A 5H92C 4YL8A 1T6BX 2WXHA 1SA5B 5CTRC 3GP7A 3H3KA 3UIPB 4FULA 1HXYD 1HCUA 2YEPB 3KSLB 2LASA 3VXDA 1L0YB 1YX5B 4MSQB 5KHOA 3VUWA 4OVVA 1WSPA 5EATA 3M77A 1FMAD 3NY5A 1HTOA 2INCC 1WU5A 2N9XA 4I6PA 3HM3A 1GLMA 1FP3A 1HEZE 4DWFA 1DGJA 4PS7A 1WI0A 2DZJA 3RSYA 1SIFA 1ACCA 5CHVC 1F0ZA 5AUKA 3EHVA 1YX6B 2MP2B 5FK9C 2ZIRB 4M0WB 4D4DA 2YEPF 1HZ5A 1YJIA 1J8CA 1FT1B 2MHJA 2DYBA 2W82A 1RWGA 1MHXA 3I63C 2KX0A 4WAFA 2RDHA 3R66C 1N23A 5DHIA 2J42A 3U2SC 4NZLB 4AJYB 4ZOHC 4PS3A 3URYA 1DOIA 3AE3B 3L08A 4AYQA 1VZ6A 3HXCB 1LTXB 4F7ZA 1BUIC 4OK4A 3WKGA 1N6ZA 2FIFA 4N59A 3J9CA 4BOKA 3W1YA 4KIKB 4HKZE 1UBIA 1YQ4B 3VR8B 1OJOA 1FCCC 1OQRA 5DPRA 1QSJA 4OVZA 3ZXVA 1TZOA 1KFYB 1WX8A 1X1MA 1WXMA 3HXEB 1MHHE 4WIPA 2WS3B 2JYTA 4LJOB 2IGDA 4JWSC 3PZ3B 2DX5B 2NOJA 2AQ2B 2GBRA 2W3RA 3JSVB
chains in the Genus database with same CATH topology
2EADA 1NXCA 2FUZA 1C79A 4LK0M 1FBOA 1O1RB 1FRRA 5EE3A 1Q10A 3TF4A 2RMMA 3NVWA 1WZZA 1KRFA 4N6EB 4GTTB 2W3SA 3P4SB 1VLBA 4CQNA 1TS2A 2DYOA 4XDDA 3SDVA 2PN5A 1WWTA 2KACA 1IS9A 5M7IA 1GXMA 1YJJA 2WXJA 4KGRA 4JX1C 1JCRB 2I38A 3U4EG 4B0MA 1N62A 1JW9D 1I7HA 1MPEA 1TKEA 1GB1A 1JQ4A 2IPKD 5EE1A 1QQFA 3ETRA 4RGNA 4HROA 5GY3A 2ONQA 3HXFB 5DGQA 3ZJUA 5FOBB 4KTRA 1FBWA 2JF4A 3U7ZA 3DSTB 2JXTA 2Y5PA 3M7BA 4YTNB 2NTTA 2Z8LA 1I4XA 5D7GA 4C80A 2QJLA 3QT3A 4OZCA 1YNTE 4D94A 1C78A 1CJEA 1XCTL 2JU6X 2LUMA 3P4RB 2FBAA 2DRRA 5HFYA 1M4VA 3Q73B 1KTKA 2AX5A 1K53A 2QNOA 1F2RC 4WVAA 1PGBA 1E10A 2J4XA 2WXLA 4JE3B 2ZZRA 5D3IB 2WLBA 3GLYA 3E73A 3W5VB 1N5WA 1FAEA 3HVDA 3S4CA 1LF6A 3WKHA 3W7WA 3SDRA 5FO9B 3W7TA 1J7BA 4H2AA 2X38A 1IGDA 3HXBB 1TS5A 2M0AA 3EUB2 3NVZA 1IA6A 2ZW1A 1X81B 3Q8CA 1TNUB 4AYRA 1HZ6A 1TJEA 1TS4A 2KWDA 1ESFA 3SFYB 1VJKA 4MU9A 1JWAD 4M76A 1KZOB 1D6EC 1MI0A 3I9V1 2V3NA 2SAKA 3V05A 2R61A 1O1SB 3M7LA 1H3AA 1QOBA 2EELA 2V8JA 1SXTA 2M19A 1V7VA 1P7EA 3Q7FB 1JALA 2M56B 1G9JA 4YSXB 2LFIA 1DOXA 4TQ1A 1IA7A 1G87A 1LD7B 1O6QA 2D8LA 1SBBB 1FT2B 3EA6A 3AE5B 3KWLA 3M76A 2YIKA 3VRAB 2BTEA 1GHQA 2FV0A 1L5PA 3AEBB 4C56C 3QFZA 1N95B 1EM7A 1L4ZB 3E32B 3K11A 2MJ3A 5BMGA 1XW2A 3K7XA 3Q69A 4KGTA 2INPE 4DOEA 2WXOA 2GOXA 4GTMB 1SIJA 1XLQA 2WDRB 1B1ZA 3E30B 5JPNB 2BT6A 2HTME 2XQWA 5BYSA 3T3OA 4A90A 4ZYSA 2OHFA 5AGDA 1C4CA 2G1EA 4IDIA 3DPYB 4NAWB 4AS1A 1JCKB 2DRSA 1V7WA 3AMZA 1UGJA 1JRPA 4YWGG 1DOGA 1NI3A 2GB1A 3AFJA 4JJJA 2V8KA 1UT9A 3M75A 2BS2B 4US9A 3ON6A 4HRSA 3E6UA 3M7EA 2XWBB 2PTLA 2E3TA 2TSSA 4C1SA 1TNOB 1N5XA 1H14A 2SQCA 3KQ4A 2WXPA 3AE8B 1VZ8A 1PUTA 3NS1A 3W7XA 4CJ0A 2Z07A 3P42A 3MJ5A 4REZA 5GZKA 1SE2A 1A70A 1X9DA 2I07B 3AN1A 2IEJB 5C2TB 2EAEA 1ROEA 2KMMA 2L32A 3SFEB 1FD6A 1QLBB 1W6JA 3VR9B 3D5SA 1TY2A 2H88B 2ICIA 1AGMA 3BVGA 1T5XD 4D4AA 3QXQA 1SF0A 3FAHA 3EUVB 1V7XA 1HA5A 4GTQB 1I4QA 1P7FA 4OHJA 4A55A 1KSCA 1VDVA 4EL8A 1H39A 3GS2A 2AQ3B 1KS8A 4D4BA 2V4IB 2VN4A 3ANJA 2WXQA 1SB3C 2VN7A 2BBCA 1SJED 3Q75B 3H7LA 2RDGA 3BK2A 3IT6B 4IOIE 4RGOS 4ZH1A 5GXGB 3W5MA 1D5ZC 4A9AA 2H6GB 4MACA 5FO8B 3PYAA 1FNWA 2OEDA 1O6HA 3M7CA 3W5NA 3Q8FA 1OFFA 2DYMA 1FPPB 3NVYA 3TEYA 4EHMB 3P2CA 3WIQA 5H8YE 1V8CA 1NYRA 3E34B 3SDQA 4M0WA 4YDOB 3GT5A 1CEMA 3T3NA 3P5PA 3AE7B 2I2YA 1KSDA 1FCLA 1DYQA 1PYWD 4GTOB 1TF4A 4WVBA 2E6XA 2HDEA 1O79A 4JPSA 1JROA 3EZ8A 3BK1A 3A3VA 2JG0A 3X17A 2WXKA 4YCRA 2Q5WD 2LJIA 1BXTA 1EWYC 3SDTA 2QSDA 2W55A 3HVZA 2NTSA 4UDUC 1FNUA 3WUXA 1XWTA 1PGXA 1TN8B 4RFBA 2BB6A 2WXHA 2H6IB 2NMQA 1TYGB 1WXQA 4WH4A 4US8A 3KSQB 1CZPA 2ZISB 1FMIA 2BEDB 2WXFA 3BZDB 2GZ6A 2RGKA 1EWCA 1RFKA 2WXGA 4RGTA 1N4SB 2D5JA 4GLSC 2K5PA 4HKQA 3T33A 2L1AA 4WQMA 3OXUA 1W6KA 2WY7A 1UG9A 2J53A 2QMTA 3SAEA 1WGKA 1V97A 3Q8AA 1GSZA 3RX5A 3AE9B 4JWUC 4RF0A 4YT0B 1N4PB 3ZJTA 2WDVB 2DLBA 1JWMD 3AEAB 3EQAA 1HZFA 3PZ4B 4V1SA 3AV8A 4GDLB 4YXDB 2BW2A 3MC0B 5BMIA 2Y3AA 1C76A 1EU3A 1D4BA 1F9DA 3SQCA 1ZDVA 4AQ7A 3WKIA 2PKOA 5JPMB 3NRZA 4XDCA 4ZHOA 4L6XA 2GRIA 1FNVA 1PDXA 3CU7A 5LNK1 2PMVA 4PT5A 5BYRA 1TN6B 2ON8A 3S4DA 2MH7A 3R2TA 2P0VA 3CWIA 4ARIA 1H54A 1AN8A 2RPVA 1UUPA 5MEHA 1N9AB 1QKZA 1SE4A 3LYYA 5G5HA 1JWSD 1GB4A 4D2KA 3HXDB 1WU4A 2PVGC 3N9YC 3O13A 1UWXA 2WXIA 3PO0A 4DXGA 3ZYYX 3QSPA 1QILA 1NENB 2XN9C 3TSSA 5CA3A 1QQRA 4GDKB 3AE2B 2H6FB 1L1YA 2XWJB 1ULVA 1I4PA 4C7ZA 1J7AA 2G9HD 2B4FA 3P5RA 1GOZA 3AM9A 3OWEB 4WVCA 1O5MB 4KKIA 1VRAB 1AWDA 4YTPB 1RM6C 1NEKB 3IAM1 3ZQ4A 1IBXB 1O6RA 3E33B 2QILA 1H37A 1C4AA 3R2IA 3DWGC 4TSSA 2JX5A 3W2DA 3D3IA 1YN4A 5BMHA 3EU8A 1KLGD 1E6EB 2WQYB 4ZRPA 1H12A 1TS3A 3AB5A 1L0VB 1QOGA 3KLSX 4L0GA 1D8DB 3WKFA 3IT4B 3ZGZA 1KKTA 1YQ3B 2F6DA 2CU3A 3BIID 2J52A 2GI9A 3W9CB 2WY8A 3PMMA 1XLNA 3V3XA 4R3DA 1IGCA 3S4BA 3AEGB 4LNVA 3AE4B 2SEBD 2XFGA 1KLUD 3PZ2B 3ABVB 3E9SA 1E9MA 3VRBB 4XE0A 3BVMA 1NL4B 3FILA 1TKYA 3TEZA 1XF5L 3AEEB 1RYJA 3Q79B 1RWSA 2WINB 4XUVA 1O1TB 3B9JA 1ET6A 4YSZB 3DSXB 1YMHE 3W7SA 4GTRB 4A6QA 1QT9A 1SSNA 4XWWA 1DL2A 1H3BA 4C7YA 1XXGA 1NI1B 1C77A 4Z4LA 1JWUD 5TSSA 5D3DA 4LNBB 2AQ1B 3TEXA 1KREA 1IUEA 3M71A 2PIAA 1L2AA 3BWUD 4LTUA 5FO7B 1N4RB 1E7PB 3QFYA 1QBQB 5EE0A 1C9FA 3RX8A 1D5MC 3ANIA 2L83A 1BMLC 1CQVA 3SR6A 2IGHA 1C4PA 1EU4A 1K72A 2EKIA 4GL3A 4QT9A 3RX7A 1JS4A 3C72B 3HUIA 3UI3A 2IGGA 3BVZA 1H36A 3D5RA 4B0EA 2OKXA 2INNE 3WIRA 3Q7AB 2LHDA 2QIEB 2XNAC 1QOAA 4KX6B 1N94B 4Z4JA 2D5GA 3ZJVA 2WXRA 2FE8A 5T8IA 1GPXA 1SE3A 1F9OA 1ZXIA 4KKJA 2VZKB 4FXKB 1L6VA 4RF1A 1AYXA 4HEA1 1I4RA 1XCQL 3SFDB 1GAQB 3Q8BA 4GTVB 3R8BA 3QPFA 4FUSA 1QOFA 1XO3A 2PLPA 2WP9B 3W5UB 4ARCA 1UMPA 2R2LB 4RH6A 3DWMA 1SA4B 3PZ7A 2PW9A 1F77A 1WRIA 1KFGA 1SEBD 3RFZB 3IAS1 2RI8A 5I4DA 1PFDA 2LEKA 3CIHA 3TEWA 2WNMA 1CLCA 2H6HB 1R7SA 1SJHD 3EGRA 2KQ4X 3M74A 2G02A 3P4PB 3E37B 1FRDA 3ACTA 2LGIA 4FXCA 2FV1A 2WIIB 1K51A 5E2JA 1TNZB 4DODA 2BS4B 1VZ7A 1ZPSA 4WWMA 5G5GA 2CJNA 1T3QA 1KF6B 2N7JA 1TKGA 1NC5A 1ZE3D 2V8IA 2JYEA 2K3UA 4DQOC 2AHGA 1DCEB 2JQRB 1ZP0B 1FIQA 1XWQA 1V1PA 2MJDA 3QDEA 4AYPA 2WXNA 4TF4A 1UWMA 1HQRD 2AHFA 3I57A 4OZBA 2BB5A 3RENA 5EE9A 3NZ3A 3B2GA 5HI1A 1CK1A 1LD8B 4MM3B 4USAA 4YSYB 1TY0A 2H89B 2WDQB 5E6JA 3FILB 3W7UA 3W1SA 2IDYA 5AUIA 1WU6A 1FEHA 2JWUA 4Q2JA 1L6UA 4CJ1A 2V0GA 2N0SB 3DSSB 2KN4A 4GTSB 3AEFB 1IBXA 1V1OA 2IJ0A 4MT5A 4TXTA 5HG2A 3WIWA 1JMLA 1JCSB 3MFGA 4LLGM 4V1RA 1WYGA 1K50A 4L23A 3S4AA 3QT9A 1G9GA 1XLOA 1V5DA 1I4GA 2GH4A 3QWTA 4BOJA 3WC3A 1TNBB 2Y5CA 4RCOA 3U52E 4HJGE 3PZ1B 3C8YA 3TUOA 1N4QB 1LO5D 1D5XC 3DSUB 4KTPA 4MBGB 4ITKA 2EACA 1KRHA 4AYOA 2K9XA 3EU5B 3NVVA 4L2YA 4LIXA 1R76A 3IXSA 5M7YA 1I4HA 2G0DA 3KWVA 1SQCA 1XLPA 4KGSA 1DOYA 3B2FA 5H92C 1F2RI 3S9VA 1T6BX 1H3CA 1SA5B 3DRAB 2DBYA 2QEJC 1GXNA 4WU0A 2KDMA 3AE1B 3FC4A 3GP7A 3WCQA 5FKAC 2V3PA 1YN3A 4OW0A 3H3KA 1FFUA 1C3DA 2BYTA 3GZKA 5CZLA 1H35A 1HCUA 1HXYD 2LMCA 2YEPB 3KSLB 3VXDA 1L0YB 4DXFA 1V5CA 1OQQA 3P4QB 1WSPA 2CQTA 3M77A 1S64B 2PVOD 4MH8A 4TQ0A 5CD2A 2FUG1 1FMAD 1N63A 1D8EB 2B76B 2KAJA 4ZHPA 3MHZA 5C3JB 1N61A 4ONTA 4O1NA 1E0ZA 2DRQA 2EABA 1WU5A 3LXFA 4EE2A 4YTMB 3DSWB 1PGAA 1FO2A 2B39A 4FXGB 1ENFA 1GAIA 4RNAA 1UNSA 1FXIA 4IKGA 1GLMA 1FP3A 4ZG8A 1HEZE 1RQ5A 3DSVB 3RJ3A 3RRSA 2N9LA 1DGJA 2WU2B 3QG0A 1MVKA 2BS3B 1H13A 5HHDG 4J3OD 3CIRB 3OEDA 3RSYA 3KLSA 2MJEA 3PYBA 3L4PA 1B9RA 2AFAA 4Q2BA 4ZH5A 1ACCA 1XEEA 3NUHB 5GW7A 5AUKA 4A8XC 1F0ZA 3M78A 4P16A 3ACSA 3ANKA 5MPOA 4ZRQA 1ET9A 2JJBA 2MEKA 1STEA 1GAHA 1JWBD 1N60A 1ZUD2 2K0PA 2DWQA 3BYYB 2ZIRB 5FK9C 4D4DA 4D4CA 1GA2A 1HZ5A 3SDUA 2YEPF 2ZW0A 3QXFA 1TN7B 1FCEA 1YJIA 4J5TA 1FT1B 3H2WA 1V1PB 4GTPB 3Q78B 1Y56A 2LHEA 2N9KA 2W82A 1L4DB 1ZXHA 4L9PB 1MHXA 2VZKD 2ZBLA 3PZ8A 4NAMA 4WAFA 4RGMA 3E56A 3AECB 2RDHA 3M73A 4L1BA 2WYNA 5DGRA 4NJCA 2DROA 1NYQA 2J42A 1KH0A 4NZLB 4ZOHC 2F0YB 3U2SC 3URYA 1G6IA 2K22A 3H8HA 2CJOA 3G6JB 1DOIA 1ZOYB 2A73B 3AE3B 1FXAA 3P1MA 2JSVX 4AYQA 1VZ6A 1LTXB 1VD5A 3HXCB 1L0XB 4N58A 1NVID 3RPFC 5KKBA 1JCQB 1KZPB 1BUIC 2A8ZA 3WKGA 3GB1A 3HRDD 2WXMA 4N59A 5FR3A 3J9CA 1FO3A 4CE7A 2RI9A 3M72A 4BOKA 2NVPA 3QRYA 1FO4A 3SEBA 4LNGB 4YDEB 4HKZE 3BYTB 1YQ4B 4XWTA 3VR8B 1FCCC 1OQRA 1S63B 1GXOA 4P6VF 3SFXB 1J7CA 1FFVA 1QSJA 4OVZA 3VQIA 1QF6A 4TMAB 1YN5A 2WU5B 1ZDXA 1TZOA 1KFYB 3AH7A 2ACZB 5JXVA 3HXEB 1MHHE 2W54A 4WIPA 2WS3B 4Q88A 2JYTA 2FBWB 1LF9A 2JZPA 2IGDA 4JWSC 2L52A 3PZ3B 3LB8C 2NOJA 1FM0D 1TNYB 1K52A 3AE6B 3MP9A 1MZCB 2AQ2B 4OZAA 2CQSA 1KWFA 5BYQA 3VW5A 3Q8EA 1AYFA 3P63A 2W3RA 3AEDB 1AW7A 4WURA 1VR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6J A;  3PZ1 B;  3D5S A;  1N4Q B;  3DSU B;  4MBG B;  4LNV A;  1O1R B;  3EU5 B;  4D4A A;  1R76 A;  3PZ2 B;  2G0D A;  1NL4 B;  1SQC A;  3EUV B;  4GTT B;  4GTQ B;  1H3C A;  1SA5 B;  3DRA B;  3Q79 B;  2PN5 A;  1GXN A;  2WIN B;  1H39 A;  1O1T B;  1GXM A;  2V3P A;  4D4B A;  3DSX B;  1JCR B;  4GTR B;  1C3D A;  2BBC A;  1H35 A;  3Q75 B;  1H3B A;  3KSL B;  4ZH1 A;  1NI1 B;  4LNB B;  1QQF A;  2H6G B;  5FO8 B;  1S64 B;  1O6H A;  3HXF B;  5FOB B;  5FO7 B;  3U7Z A;  1N4R B;  1FPP B;  3DST B;  1QBQ B;  4EHM B;  1D8E B;  3E34 B;  4YDO B;  4ONT A;  3DSW B;  4GTO B;  2B39 A;  4D94 A;  4FXG B;  1O79 A;  3C72 B;  1H36 A;  3D5R A;  3DSV B;  3Q73 B;  3Q7A B;  3RJ3 A;  1N94 B;  1TN8 B;  2BB6 A;  2H6I B;  3OED A;  3KLS A;  3KSQ B;  5FO9 B;  2ZIS B;  2BED B;  4KKJ A;  3HXB B;  4ZRQ A;  4FXK B;  1N4S B;  1X81 B;  1TNU B;  3OXU A;  1W6K A;  2WY7 A;  2ZIR B;  4D4D A;  4D4C A;  3SFY B;  4MU9 A;  1GSZ A;  1TN7 B;  4M76 A;  1KZO B;  1N4P B;  4GTV B;  2V3N A;  1FT1 B;  1HZF A;  3PZ4 B;  4V1S A;  1O1S B;  4GTP B;  1H3A A;  1UMP A;  2R2L B;  3Q78 B;  2V8J A;  1SA4 B;  4L9P B;  3Q7F B;  3SQC A;  5JPM B;  1LD7 B;  1O6Q A;  2F0Y B;  1FT2 B;  2H6H B;  3CU7 A;  3G6J B;  2G02 A;  2A73 B;  2PMV A;  3E37 B;  1GHQ A;  1TN6 B;  1N95 B;  3E32 B;  1LTX B;  3HXC B;  2WII B;  3K7X A;  1TNZ B;  1N9A B;  1JCQ B;  1KZP B;  2GOX A;  4GTM B;  2V8I A;  3HXD B;  3E30 B;  5JPN B;  1DCE B;  2XQW A;  5AGD A;  3DPY B;  4BOK A;  4LNG B;  4YDE B;  2BB5 A;  2H6F B;  2XWJ B;  1S63 B;  1GXO A;  1LD8 B;  2V8K A;  3SFX B;  1QSJ A;  1O5M B;  4KKI A;  2XWB B;  4C1S A;  1TNO B;  3HXE B;  1O6R A;  3E33 B;  3DSS B;  1H37 A;  2SQC A;  4GTS B;  3KQ4 A;  3PZ3 B;  2NOJ A;  1TNY B;  1JCS B;  1MZC B;  4ZRP A;  4V1R A;  1D8D B;  2I07 B;  2IEJ B;  4BOJ A;  1TNB B;  2WY8 A; 
#chains in the Genus database with same CATH topology
 3C0R B;  5JHB A;  3APF A;  3TF4 A;  1P0R A;  1OGW A;  1KRF A;  4GTT B;  2W3S A;  4XDD A;  4JGH B;  1WWT A;  1IS9 A;  1WXS A;  1WE7 A;  2WXJ A;  5IP4 D;  3U4E G;  2A4Z A;  1JW9 D;  3N1Y C;  1MPE A;  1MFW A;  2XBB C;  1LXD A;  4LNI A;  5GY3 A;  1FXT B;  1WX7 A;  3U7Z A;  4K81 A;  3DST B;  3QA8 A;  3N1X C;  2JXT A;  2N9E B;  4YTN B;  5ILD A;  1TTN A;  2NTT A;  4C80 A;  5D7G A;  3QT3 A;  3WAN A;  2IY1 B;  3P4R B;  5DCN A;  2FBA A;  2XK5 A;  4NNJ B;  2AX5 A;  1KTK A;  3CST A;  1E10 A;  2J4X A;  2N4F A;  1N5W A;  3S4C A;  3WKH A;  3W7W A;  2D11 A;  2G4S A;  5FO9 B;  3W7T A;  1J7B A;  3A9J B;  1X81 B;  2O6V D;  2LWP A;  1HZ6 A;  3AUL A;  1TS4 A;  4DHZ B;  2V3N A;  2SAK A;  2R61 A;  1O1S B;  3M7L A;  2EEL A;  5CX3 A;  2C9W B;  4M02 A;  1V7V A;  3P2B A;  1JAL A;  1IA7 A;  2LJ5 A;  1LD7 B;  3TJP A;  2D8L A;  3AE5 B;  4G50 A;  4IWP A;  2YIK A;  1L5P A;  4W9H A;  3TMP B;  1N95 B;  1EM7 A;  1L4Z B;  4WWO A;  3Q69 A;  1GC7 A;  3RCZ A;  2RPQ A;  2WXO A;  4GTM B;  3I5J C;  1OJN A;  5DPW A;  2G1E A;  3DPY B;  4DDI D;  1V7W A;  4FJY A;  4YWG G;  3TL5 A;  2GB1 A;  4OVU A;  3AFJ A;  2GBK A;  4HRS A;  3M7E A;  4MMI A;  2PTL A;  4C1S A;  1H14 A;  4BVU C;  2QC8 A;  2KNB A;  2KVZ A;  2RGF A;  1VZ8 A;  3P42 A;  1GC6 A;  2BRW A;  2C7N B;  5GZK A;  2IEJ B;  3ML8 A;  2KMM A;  2L32 A;  3SFE B;  1W6J A;  3VR9 B;  2HJ8 A;  1N24 A;  1V7X A;  1HA5 A;  1I4Q A;  4JIO U;  2RDB C;  2N9P C;  2V4I B;  2VN4 A;  5G55 A;  2VN7 A;  5J17 A;  3H7L A;  3BK2 A;  5E6N A;  5HKH A;  1E90 A;  4A9A A;  4C4V A;  3DPD A;  3M01 A;  1O6H A;  3M7C A;  3W5N A;  1LM8 B;  1LGR A;  3TEY A;  3P2C A;  2MP2 A;  5AZG A;  4FJV B;  3ECI A;  4M0W A;  3AE7 B;  1KSD A;  1DYQ A;  1FPY A;  1PYW D;  4M01 A;  2E6X A;  1W3Y A;  4JPS A;  3R3M A;  1RAX A;  3EZ8 A;  3RUI B;  4YCR A;  2Q5W D;  2KTR B;  2QSD A;  3SDT A;  1FNU A;  3WUX A;  3PS6 A;  4CYE A;  1WXQ A;  4WH4 A;  1J0N A;  2K8C A;  2NCN A;  2RSU A;  2ZIS B;  1WIA A;  5IK0 A;  2RGK A;  4EKU A;  2ZVN A;  3T33 A;  1UG9 A;  2QMT A;  1V97 A;  3RX5 A;  3EQA A;  1E5W A;  3AV8 A;  4GDL B;  1EU3 A;  4AQ7 A;  2FUQ A;  3U7D A;  2PKO A;  2WX0 A;  3CU7 A;  1TN6 B;  3I3T B;  3DHG C;  1J19 A;  2RPV A;  1UUP A;  1QKZ A;  1SE4 A;  2HD5 B;  1JWS D;  3NNB A;  4D2K A;  3HXD B;  1WU4 A;  2KWC A;  3O13 A;  4ZRJ A;  1HN0 A;  3N1Z C;  3RNE C;  2C60 A;  1P3Q U;  1L1Y A;  2M4N A;  2G9H D;  1HX9 A;  2OJR A;  3AM9 A;  3L17 A;  4WVC A;  1O5M B;  2KJR A;  3RNF C;  2IO0 B;  3ZQ4 A;  4X57 B;  3ZNH B;  1H37 A;  3DWG C;  3D3I A;  4MJS A;  4ZRP A;  2LI5 A;  4PK1 A;  3WKF A;  3IT4 B;  1YQ3 B;  3QAR A;  2F6D A;  3BII D;  2J52 A;  1RWC A;  3WA0 A;  5IKH A;  3S4B A;  1U4A A;  4LNV A;  1KLU D;  2MBB B;  3PZ2 B;  4XE0 A;  4AOF A;  3FIL A;  3TEZ A;  1RYJ A;  3Q79 B;  4XUV A;  2KK8 A;  3W7S A;  2FNJ B;  4F1S A;  3DHI C;  2QHO A;  1C77 A;  4RM8 A;  3TEX A;  1IUE A;  1N4R B;  3QFY A;  2DZI A;  2KZR A;  1WF9 A;  2IGH A;  3KUD B;  3L13 A;  4LNO A;  3C72 B;  3HUI A;  3UI3 A;  5CHW A;  1H36 A;  2INN E;  3WIR A;  2JVC A;  4DHJ B;  1YIW A;  4XX5 A;  2V9H A;  1WZ3 A;  3Q3N C;  2KN5 A;  2FE8 A;  5T8I A;  3H7P B;  1SE3 A;  1F9O A;  1ZXI A;  2OJW A;  4HEA 1;  5D94 A;  2Y5B B;  1I4R A;  4IC7 B;  3SFD B;  1GAQ B;  3R7Q A;  2KDF B;  3C19 A;  2R2L B;  4RH6 A;  3VVW B;  3DWM A;  2JT4 B;  2ASQ A;  3ZW3 A;  1KFG A;  2A5U A;  2IO2 B;  2LGS A;  5I4D A;  2BKF A;  2E22 A;  2KDB A;  3QX1 A;  3E37 B;  4GB9 A;  4F13 A;  2RD0 A;  1IP9 A;  4WWM A;  1MG4 A;  4W9E A;  4DOD A;  1ZPS A;  1F1S A;  2CJN A;  1T3Q A;  1KF6 B;  1NC5 A;  1ZE3 D;  4NQK E;  1DCE B;  2LZ6 A;  2JQR B;  1FIQ A;  1V1P A;  2K8B A;  4AYP A;  3NOB A;  1UWM A;  3ZXR A;  4OZB A;  4BZA A;  3REN A;  1CK1 A;  2IYD B;  4DBG A;  3FIL B;  3W7U A;  4HDQ A;  3UIO B;  4Q2J A;  2GMI C;  3AEF B;  4MT5 A;  1HTQ A;  3WIW A;  3ZVV A;  1JCS B;  1N7Q A;  3MFG A;  5D2M B;  3DVG Y;  1SGH A;  1XLO A;  3ONS A;  4BOJ A;  3RNG C;  1TNB B;  1AAR A;  4RCO A;  3U52 E;  4HJG E;  1D5X C;  4MBG B;  4KTP A;  2EAC A;  3EU5 B;  4L2Y A;  4E3C A;  1N21 A;  1R76 A;  1I4H A;  2K1F A;  4KGS A;  3B2F A;  2JZ3 B;  3S9V A;  2QEJ C;  2KDM A;  3GE3 C;  3GZK A;  5CZL A;  1UD7 A;  2KWV B;  4EFO A;  4KZ0 A;  2PE9 A;  1N63 A;  4IM0 A;  2B76 B;  2KAJ A;  2EAB A;  1TZ1 A;  3VXW A;  4EE2 A;  2B39 A;  4FXG B;  2N7D A;  3ZRC A;  2E24 A;  1XD3 B;  2YVC A;  4IKG A;  3DBH I;  3PRM B;  1RQ5 A;  2N9L A;  3RJ3 A;  3RRS A;  2BS3 B;  4IG7 B;  2LVQ A;  4BAX A;  1QZE A;  2MJE A;  3KLS A;  3LDZ E;  1XEE A;  3VH3 B;  4P16 A;  3ACS A;  3ANK A;  4ZRQ A;  4B95 A;  1STE A;  1ZUD 2;  1JWB D;  1N60 A;  3L54 A;  4BKT A;  1UF0 A;  1GA2 A;  4J5T A;  1Z5S B;  3L16 A;  1V1P B;  4GTP B;  2N9K A;  3DBH B;  1L4D B;  2KTR A;  3PZ8 A;  2ZBL A;  2AL6 A;  4A3O A;  2CKH B;  1Y8R C;  5DGR A;  2N7E A;  1G6I A;  4IWQ A;  2K22 A;  2IO3 B;  2A73 B;  2L3Z A;  4MGK E;  2IBI B;  4FHK A;  3P1M A;  2JSV X;  1HMU A;  3RPF C;  4EZK A;  1KZP B;  2AYO B;  3HRD D;  1WXV A;  4CE7 A;  4F10 A;  2J0J A;  2K6D B;  2NVP A;  3SEB A;  2EKE C;  4WJO A;  3BYT B;  4XWT A;  2LGY A;  2QDF A;  3SFX B;  4HK2 A;  4TMA B;  2W54 A;  3IVF A;  3AE6 B;  1TNY B;  1Q5W B;  2CQS A;  3PZD A;  5ILJ A;  3Q8E A;  3ZNG C;  3ZNI D;  4WUR A;  1VR9 A;  2EAD A;  3ZDM C;  2ZPY A;  1HXA A;  1FBO A;  1FRR A;  1V9J A;  1WZZ A;  2ZZP B;  3VH4 B;  1VLB A;  4CQN A;  2DYO A;  3N0F A;  2NR2 A;  4B0M A;  4EEW A;  1GB1 A;  2IPK D;  5EE1 A;  2N1V A;  2LVP A;  4HRO A;  4P7I A;  5ILH A;  3HXF B;  3ZJU A;  2I1J A;  2JF4 A;  2EMT A;  4LCD E;  2Y5P A;  3M7B A;  2BQQ A;  1I4X A;  4KSK C;  3A0O A;  1YNT E;  3PTF C;  1C78 A;  1CJE A;  2IND C;  2JU6 X;  2JRI B;  1K53 A;  4WVA A;  5IL3 A;  3N32 A;  1L7Y A;  2O6V A;  2PPH A;  2WLB A;  2KTF A;  3RT3 B;  1V2Y A;  4H2A A;  2X38 A;  5TR5 A;  2FCM A;  2CHW A;  1TNU B;  4AYR A;  1TJE A;  2KWD A;  3KH0 A;  3SFY B;  1OTR B;  1ZGU B;  1WR6 E;  3V05 A;  4M00 A;  2V8J A;  1SXT A;  2MBQ A;  2LFI A;  3R7R A;  3T8M A;  1G87 A;  4KDI C;  3M76 A;  3DBR I;  1F9J A;  2BTE A;  2J7Q B;  4DDG D;  2FV0 A;  3AEB B;  4G3X B;  3K11 A;  3K7X A;  2GOX A;  3CF6 E;  1SIJ A;  3ZO5 B;  2WDR B;  1B1Z A;  3E30 B;  2XQW A;  3D32 A;  4A90 A;  1C4C A;  4IWO A;  1JCK B;  2DRS A;  4AUQ C;  4AS1 A;  1UGJ A;  1WFY A;  4ICV A;  1D3Z A;  4JJJ A;  1UT9 A;  3M75 A;  4US9 A;  3ON6 A;  2D3G A;  4C00 A;  3V61 A;  1HMW A;  2KFK B;  3Q3M C;  2JXX A;  1PUT A;  4FLH A;  3NS1 A;  5EAU A;  1A70 A;  2I07 B;  3AN1 A;  4ANV A;  1T0Q C;  3ML9 A;  2EAE A;  2LVO A;  1WGR A;  1QLB B;  2ZNV B;  2H88 B;  2MBH A;  3BVG A;  1T5X D;  3FAH A;  2FCN A;  1P7F A;  4AJW A;  1H39 A;  3Q14 C;  3M3J A;  3H6N A;  2BBC A;  1RWA A;  3IT6 B;  4IM2 A;  5GXG B;  4RGO S;  1D5Z C;  1E8W A;  4BKG A;  2AWT A;  3MC8 A;  4MAC A;  5FO8 B;  3N0G A;  5IM1 A;  1OFF A;  3PRP B;  3RNC C;  2DYM A;  5H8Y E;  1V8C A;  4OZW A;  3E34 B;  1NYR A;  2MRP A;  5IAA C;  4YDO B;  3T3N A;  4TV3 A;  1FCL A;  4LDT D;  5ILI A;  4WVB A;  1O79 A;  3BK1 A;  2WXK A;  3HVZ A;  5DPS A;  5C23 A;  1PGX A;  2GBJ A;  2G4D B;  2H6I B;  3A4R A;  4PS8 A;  4US8 A;  1CZP A;  2I1K A;  4BKS A;  2BED B;  1RFK A;  2W9N A;  1C1Y B;  3APC A;  2KWU B;  1W6K A;  2WY7 A;  3APD A;  2J53 A;  3AU5 A;  3Q8A A;  1N4P B;  5JZE B;  2WDV B;  4JL9 A;  1JWM D;  4YXD B;  4V1S A;  1QF6 A;  3PZ4 B;  4DHZ E;  2BW2 A;  2WDT B;  3AI5 A;  4EUT A;  1ZDV A;  3WKI A;  3DVG X;  1WY8 A;  2HE7 A;  3NRZ A;  4XDC A;  4L6X A;  3K9O B;  2GRI A;  2XEW A;  2PMV A;  3HIZ A;  3S4D A;  4ARI A;  2P0V A;  1H54 A;  2BYV E;  5MEH A;  3RYT A;  1GB4 A;  3GOE A;  2PVG C;  3N9Y C;  1UWX A;  1F52 A;  2WXI A;  4MGZ E;  3MTN B;  1N22 A;  3QSP A;  1E8Z A;  1NEN B;  2XN9 C;  4DHJ D;  2H6F B;  1I4P A;  4MEM A;  4W9K A;  3OWE B;  2V1Y A;  4W9D A;  1WGD A;  3A4S C;  4MEL A;  4YTP B;  1RM6 C;  1NEK B;  4FNV A;  1IBX B;  3E33 B;  2QIL A;  4HCP B;  3R2I A;  1YN4 A;  2ZCC A;  5E6O A;  5AZF A;  1E6E B;  3AB5 A;  1L0V B;  1QOG A;  3ZTC A;  3ZGZ A;  1A5R A;  4GOC A;  1KKT A;  4CHK A;  2CU3 A;  3A1Q B;  3W9C B;  2GOW A;  1LQB A;  1IGC A;  3QQ8 B;  3AEG B;  2SEB D;  1IYF A;  2JRH A;  3VRB B;  1TKY A;  3X23 A;  1XF5 L;  2CHX A;  2O2V A;  3AEE B;  3PPA A;  2WIN B;  4LJP B;  4FA6 A;  3B9J A;  4YSZ B;  1E8Y A;  4GTR B;  2K8H A;  2D07 B;  1RWF A;  1H3B A;  4C7Y A;  1HV6 A;  1XXG A;  3TCA A;  4HPM B;  1NDD A;  1NBF C;  1S1Q B;  1KRE A;  3OAW A;  3M71 A;  3G4F A;  3BWU D;  3QC8 B;  4LTU A;  5FO7 B;  2RR9 A;  2KYW A;  1C9F A;  1D5M C;  3ZTD A;  3IHP C;  1C4P A;  1K72 A;  1WE6 A;  2EKI A;  4QT9 A;  3U30 A;  3RX7 A;  1WGG A;  4IW0 A;  2IGG A;  3D5R A;  3ZLZ A;  2OKX A;  2QIE B;  4KX6 B;  4P1B C;  3ALB A;  1S3S G;  4ZYN A;  3KYC D;  2MQJ A;  3RZW C;  3UIN B;  1WMH A;  1L6V A;  4RF1 A;  1AYX A;  2M17 A;  1HXG A;  4FUS A;  1QOF A;  1XO3 A;  2WP9 B;  3W5U B;  4G0N B;  4ARC A;  1UMP A;  3PZ7 A;  1F77 A;  1WRI A;  3RFZ B;  3B08 A;  3CIH A;  1CLC A;  1R7S A;  1SJH D;  3EGR A;  3M74 A;  2G02 A;  1GUA B;  2AL3 A;  1FRD A;  3ACT A;  4FXC A;  1IPG A;  2CR5 A;  2BS4 B;  1TNZ B;  5G5G A;  1VZ7 A;  1ZP0 B;  2L7R A;  1WYW B;  1YOV B;  4TF4 A;  4XC2 A;  3IG3 A;  2BB5 A;  3NZ3 A;  2OOB B;  1Z2M A;  1TY0 A;  4KSL C;  2H89 B;  2WDQ B;  1L6U A;  3DVN V;  2V0G A;  2N0S B;  1TIF A;  2IJ0 A;  3ZUN A;  3PT2 B;  5HG2 A;  1JML A;  4V1R A;  1WYG A;  3QT9 A;  4NEI A;  2GH4 A;  3C8Y A;  1N4Q B;  1LO5 D;  4ITK A;  2IY0 B;  4AYO A;  2K9X A;  3RMK C;  2C7M B;  5M7Y A;  3KWV A;  1F2R I;  1H3C A;  2DBY A;  3AE1 B;  1ZKH A;  1GXN A;  4WU0 A;  4W9I A;  5IK9 A;  3WCQ A;  4OW0 A;  3VFK A;  3NHE B;  4HJK A;  3JVZ X;  1H35 A;  2Z59 B;  2LMC A;  4HCN B;  3NZS A;  1Q1O A;  2VH1 A;  3KYD D;  3P4Q B;  2CQT A;  3H7P A;  4HPL B;  4MH8 A;  2KFJ A;  3W1S C;  1D8E B;  4ZHP A;  3MHZ A;  1MJD A;  4II2 B;  1KJT A;  1E0Z A;  3LXF A;  4YTM B;  1C3T A;  3DSW B;  1PGA A;  1FO2 A;  3PHW B;  1GAI A;  4RNA A;  1UNS A;  1FXI A;  4ZG8 A;  1GG3 A;  2ZPN A;  3KVF B;  5DHK A;  1MVK A;  2GBN A;  2DHZ A;  1H13 A;  3B0A A;  4J3O D;  3OED A;  4B6W A;  1B9R A;  2AFA A;  4Q2B A;  4ZH5 A;  3NUH B;  4A8X C;  5GW7 A;  3M78 A;  5MPO A;  1ET9 A;  2JJB A;  3PV1 A;  5C1Z A;  1GAH A;  2K0P A;  3JYU A;  2DWQ A;  3BYY B;  4D4C A;  2ZW0 A;  3QXF A;  1TN7 B;  2C5L C;  3VTW A;  1FCE A;  2FUT A;  1ZXH A;  4L9P B;  2VZK D;  4RGM A;  3AEC B;  3M73 A;  2WYN A;  1NYQ A;  1KH0 A;  2F0Y B;  1NI2 A;  3G6J B;  1WR1 A;  2WCO A;  1VD5 A;  4KVG B;  4CO7 A;  5KKB A;  3Q2A C;  1JCQ B;  4WJN A;  3GB1 A;  3A33 B;  5FR3 A;  3QCA A;  4KIK A;  1FO3 A;  1YQB A;  2RI9 A;  2K6Q A;  4K7U A;  3RNB C;  3QRY A;  4LNG B;  2ZVO A;  3LZ9 A;  1GXO A;  2WX1 A;  1J7C A;  2KD0 A;  2KQ7 A;  1LXM A;  3DHH C;  1ZDX A;  3AH7 A;  3OLM D;  5JXV A;  2ACZ B;  1HM3 A;  4Q88 A;  4ANW A;  2FBW B;  2M8S A;  4E74 A;  1LF9 A;  2JZP A;  3QHT A;  3IFW B;  2L52 A;  3LB8 C;  1FM0 D;  1K52 A;  3MP9 A;  4OZA A;  1KWF A;  3AXC A;  3VW5 A;  5IKA A;  1H4R A;  3AED B;  3DDC B;  2JWZ A;  1NXC A;  3RD2 A;  2FUZ A;  1Q10 A;  3NVW A;  2KQS A;  3DVN U;  5IOI A;  1TS2 A;  3SDV A;  2PN5 A;  2KAC A;  5M7I A;  1GXM A;  1YJJ A;  2IO1 B;  4JX1 C;  1F9G A;  1OJM A;  3OJ3 A;  3HK0 A;  2Z0D B;  1I7H A;  1JQ4 A;  2GLS A;  4RGN A;  3KUC B;  2KDE B;  2KOX A;  5DGQ A;  1FBW A;  2J0K A;  4ASW C;  4EOY A;  2CU1 A;  3V62 A;  3PHX B;  1V6E A;  2L0F A;  3DBS A;  2VH2 A;  2KDI A;  2O2V B;  1CMX B;  4D94 A;  2NVU I;  2LUM A;  3NFV A;  4FJQ A;  3Q73 B;  2Z0E B;  4II3 B;  5LXH A;  2QNO A;  2XK5 B;  2KMC A;  4HLE A;  1PGB A;  2KT7 A;  2ZZR A;  5KHQ A;  3GLY A;  3HVD A;  1LF6 A;  3QAQ A;  2LUE A;  3SDR A;  1IGD A;  3HXB B;  3EUB 2;  1JRU A;  3O65 B;  2WGS A;  3SU8 X;  3AFL A;  4WJP A;  5L95 C;  1JWA D;  4M76 A;  1KZO B;  1MI0 A;  3I9V 1;  4BBN C;  1H8C A;  1H3A A;  1QOB A;  5DPT A;  2M19 A;  3RNA C;  1P7E A;  4ACF A;  3Q7F B;  2M56 B;  1G9J A;  1DOX A;  4TQ1 A;  4MM3 A;  2K39 A;  3VDZ A;  1EF1 A;  3WAO A;  1FT2 B;  3EA6 A;  3VRA B;  1GHQ A;  2JY6 A;  5ILK A;  2MJ3 A;  1XW2 A;  3EFU A;  4KGT A;  1P98 A;  2INP E;  5IO9 A;  2BT6 A;  3T3O A;  1UEL A;  4ZYS A;  2LRU A;  4NAW B;  3AMZ A;  3T9L A;  1JRP A;  1YJ1 A;  1DOG A;  2R2O A;  1NI3 A;  2NBU A;  3DBL B;  2V8K A;  2BS2 B;  1WM3 A;  4GN1 A;  3E6U A;  5E6P A;  2TSS A;  2E3T A;  3PSE B;  1N5X A;  2PJH A;  2SQC A;  3AE8 B;  2WXP A;  1WJN A;  4BFR A;  3W7X A;  4REZ A;  5C2T B;  1OEY J;  1FD6 A;  3D5S A;  2LXA A;  3QXQ A;  4AWJ A;  1SF0 A;  3EUV B;  2CHZ A;  2KLC A;  4GTQ B;  4FHJ A;  5D6J B;  2AQ3 B;  1KS8 A;  4D4B A;  1KOT A;  3ANJ A;  1KM7 A;  1SB3 C;  2RDG A;  4IOI E;  3W5M A;  2ZEQ A;  4MMH A;  1T0Y A;  4NJ7 A;  3PYA A;  3Q8F A;  4NQL B;  3MJW A;  1RFA A;  3NVY A;  1I42 A;  4EHM B;  4WAA A;  3K9P B;  1CEM A;  1P9D U;  4GTO B;  4P1C C;  3Q8C A;  3A3V A;  3X17 A;  4W9L A;  2LJI A;  1BXT A;  1EWY C;  1OEY A;  4RFB A;  2BB6 A;  3GZN B;  3KSQ B;  4LNF A;  4AP4 C;  2BRV X;  5J18 A;  1FMI A;  3BZD B;  2BVC A;  1N4S B;  2D5J A;  4GLS C;  4XGA B;  4WQM A;  1WGK A;  3IBE A;  4JWU C;  1GSZ A;  5IL8 A;  3AE9 B;  3L0W B;  4RF0 A;  4EZJ A;  3ZJT A;  4DK5 A;  3UQA A;  3MC0 B;  1C76 A;  1F9D A;  3SQC A;  2DAJ A;  1LFD A;  1M94 A;  5ILZ A;  1TBE A;  4ANX A;  3EC8 A;  1PDX A;  5LNK 1;  4PT5 A;  3DQV A;  5JHA A;  2D2Q A;  2MH7 A;  3R2T A;  3CWI A;  2JZZ A;  1GJZ A;  1AN8 A;  1N9A B;  3LYY A;  1WX9 A;  3PO0 A;  4DXG A;  5CA3 A;  3FKY A;  4GDK B;  3AE2 B;  4C7Z A;  4FAD A;  2B4F A;  3P5R A;  1GOZ A;  4RM9 A;  2KXJ A;  2BYE A;  4KKI A;  1O6R A;  3Q3O C;  4K7W A;  3W2D A;  1RWH A;  3EU8 A;  2DZK A;  4GU2 A;  1Q0W B;  2D3B A;  1KLG D;  2WQY B;  2L8J A;  1TS3 A;  3KLS X;  4L0G A;  1D8D B;  3PMM A;  3RI7 C;  3V3X A;  3AE4 B;  2XFG A;  3ABV B;  5EAS A;  1E9M A;  2UWQ A;  3BVM A;  4FJZ A;  4XZ4 A;  2NBV B;  1YMH E;  2DNF A;  4A6Q A;  1SSN A;  4XWW A;  1CB8 A;  1DL2 A;  1NI1 B;  1JWU D;  4Z4L A;  5TSS A;  2M0X A;  4LNB B;  3ZIM A;  2AQ1 B;  4FBJ B;  3PGE A;  3E7J A;  1OQY A;  3N20 C;  1L2A A;  3V6E B;  4NY0 A;  1QBQ B;  5EE0 A;  1WJU A;  5FR6 A;  2L83 A;  2QCZ A;  4E71 A;  3RUL A;  1CQV A;  4URK A;  1EU4 A;  5AZH A;  2C7H A;  2LD9 A;  1G6J A;  1EGU A;  3BVZ A;  3X0W A;  4Z4J A;  3ENE A;  2D5G A;  1N7R A;  2WXR A;  4HDO A;  4IUM B;  4KKJ A;  2VZK B;  4FXK B;  2JPH A;  1N20 A;  3M63 B;  3Q8B A;  3R8B A;  5JH5 C;  1N7N A;  3Q6B A;  1SA4 B;  2J0M A;  2MCN B;  4DI5 A;  4GDL A;  3S2A A;  1SEB D;  1KLV A;  2DEN B;  1T0R C;  4IM3 A;  2RI8 A;  1J0M A;  3TEW A;  2H6H B;  1SE9 A;  2KQ4 X;  4RNQ A;  3P4P B;  4OZV A;  3V6C B;  1K51 A;  5E2J A;  4WJQ A;  3SDL C;  2PEA A;  2V8I A;  2K3U A;  2AHG A;  3WIM A;  1XWQ A;  2D3A A;  3VUY A;  3QDE A;  3A1Q A;  1HQR D;  2AHF A;  4HWI B;  4F8C B;  5EE9 A;  5HI1 A;  3B2G A;  4BKS D;  1WZ0 A;  1LD8 B;  1WRD B;  4MM3 B;  1R4M I;  5EDS A;  3PLV A;  3W1S A;  2IDY A;  4PYZ A;  1WU6 A;  1FEH A;  3DSS B;  4PYU A;  4GTS B;  1IBX A;  3BIN A;  4GIV A;  4LLG M;  1K50 A;  4L23 A;  3JSV A;  3L10 B;  2NS5 A;  4MJS B;  2ONH A;  5GMV A;  3QWT A;  3WC3 A;  1XQQ A;  4ZRK A;  5AEK B;  3TUO A;  1E7U A;  3NG0 A;  3DSU B;  1L2N A;  2EMS A;  3PVL A;  4LIX A;  2KJH B;  1DOY A;  1SQC A;  3DRA B;  4ICU A;  3FC4 A;  4NPN A;  5FKA C;  2V3P A;  2YLM A;  1YN3 A;  1FFU A;  1C3D A;  2BYT A;  4TKN A;  4DXF A;  1V5C A;  1OQQ A;  3VAW A;  3QIJ A;  1UH6 A;  1S64 B;  2PVO D;  4TQ0 A;  5CD2 A;  2FUG 1;  4K3C A;  1WMH B;  1WGY A;  5IK6 A;  5C3J B;  1N61 A;  4ONT A;  4O1N A;  2DRQ A;  1WJ6 A;  1ENF A;  2REX A;  1EUV B;  2JUO A;  3LJ3 A;  3DSV B;  2O6V B;  2WU2 B;  4A20 A;  3QG0 A;  5HHD G;  3UGB B;  3CIR B;  3L4P A;  3PYB A;  2BPS A;  4MDK E;  2KC2 A;  4M8M A;  2MEK A;  3N30 A;  3BY4 B;  3SDU A;  3VSN A;  2KLG A;  3H2W A;  4GMV A;  4RMA A;  3Q78 B;  1Y56 A;  2LHE A;  2G3Q B;  4MGI E;  1UBQ A;  4NAM A;  4NJ6 A;  2BKR B;  1QAZ A;  5C05 A;  2AEH A;  3E56 A;  5G2N A;  1R4M B;  4NJC A;  4L1B A;  4KV2 A;  4HVB A;  2DRO A;  3GZN I;  3H8H A;  2CJO A;  4JLC A;  4MSM B;  1ZW7 A;  1ZOY B;  3TBL D;  3A9J A;  1FXA A;  2L05 A;  4N58 A;  1L0X B;  1NVI D;  2A8Z A;  2UYZ B;  2WXM A;  3H7S A;  4E1Y A;  2B3A A;  3M72 A;  1FO4 A;  4YDE B;  2UU7 A;  2X8X X;  4LDT B;  1S63 B;  3AU4 A;  3Q3J A;  5IKC M;  4P6V F;  3NS8 A;  1FFV A;  3VQI A;  1YN5 A;  2WU5 B;  5L83 A;  4J6I A;  2MA9 B;  4S0R A;  5ILY A;  4QAY A;  3UQB A;  1MZC B;  4B9K A;  4ZDV A;  5BYQ A;  1AYF A;  3P63 A;  1V81 A;  3DOW A;  1AW7 A;  4K3B A;  3SHQ A;  4BOS C;  3B1L X;  2FAZ A;  2KJ6 A;  3WAM A;  1C79 A;  4LK0 M;  1O1R B;  5EE3 A;  2RMM A;  1VD2 A;  4N6E B;  4A3P A;  3P4S B;  3UF8 A;  4MGY E;  4KGR A;  1GNU A;  4EZL A;  1JCR B;  2FCS A;  2I38 A;  1N62 A;  3G4D A;  1TKE A;  4G11 A;  1QQF A;  2HJ1 A;  2WYQ A;  2Q1F A;  3PLU A;  3ETR A;  3VTU A;  2ONQ A;  1WJ4 A;  5FOB B;  4KTR A;  2CS4 A;  4ANU A;  2Z8L A;  2QJL A;  4OZC A;  4GXB A;  1XCT L;  1PQS A;  2K25 A;  3VHT C;  1N1Z A;  2DRR A;  1EF5 A;  5HFY A;  1M4V A;  1F2R C;  2D10 A;  3HHM A;  1R4N I;  2WXL A;  1WXA A;  4JE3 B;  5D3I B;  3W5V B;  2MBO A;  3E73 A;  4C4V B;  1FAE A;  3RZF A;  3DBR B;  2MBE A;  2WWZ A;  2KAN A;  3H1U A;  1TS5 A;  2M0A A;  3NVZ A;  1IA6 A;  2ZW1 A;  1BT0 A;  2LRW A;  1E8X A;  1ESF A;  2HTH A;  1V49 A;  1VJK A;  4MU9 A;  3A9K A;  1D6E C;  5IA7 A;  2M1M A;  1RW9 A;  4YSX B;  4MH0 E;  2ZNV C;  3ZNZ B;  1O6Q A;  1SBB B;  2ZJD A;  3KWL A;  4C56 C;  3QFZ A;  5BMG A;  3E32 B;  1E7V A;  2X03 A;  4DOE A;  1T0S C;  3TIX A;  1RRB A;  1XLQ A;  4LNK A;  5JPN B;  2HTM E;  3MHS D;  5BYS A;  2OHF A;  5AGD A;  4IDI A;  4KDL B;  3VUX A;  2LXC A;  1R4N B;  2IZV B;  4ZRI A;  2BGF A;  1V80 A;  1X1J A;  2XWB B;  3NJT A;  1TNO B;  2KFK A;  3M95 A;  2BRP A;  2V4L A;  3KQ4 A;  2KC1 A;  5CHF A;  4CJ0 A;  2Z07 A;  3HM6 X;  2MWS B;  3MJ5 A;  1SE2 A;  1X9D A;  1P1A A;  1ROE A;  1TY2 A;  2ICI A;  4I6N B;  1AGM A;  4D4A A;  4OK2 A;  1RLF A;  3N3K B;  4A55 A;  4OHJ A;  1KSC A;  1VDV A;  4EL8 A;  3GS2 A;  1LXK A;  2WXQ A;  1SJE D;  3Q75 B;  4OJZ A;  4W9C A;  4ZH1 A;  3MC9 A;  2H6G B;  1FNW A;  2OED A;  3DCG A;  2ONG A;  1UZX B;  1FPP B;  3WIQ A;  3SDQ A;  1TGZ B;  3GT5 A;  3A9K B;  3P5P A;  2I2Y A;  1TF4 A;  2HDE A;  2D3C A;  1JRO A;  1C82 A;  2JG0 A;  4LNN A;  4WWN A;  2W55 A;  4UDU C;  2NTS A;  2R2Q A;  1XWT A;  1TN8 B;  3JW0 X;  2NMQ A;  1TYG B;  3H9D A;  2BWE S;  4RGT A;  2WXF A;  2GZ6 A;  1EWC A;  2WXG A;  2G45 B;  4HKQ A;  2K5P A;  2L1A A;  2L0T A;  3OXU A;  4S17 A;  3SAE A;  3WAL A;  4YT0 B;  1N7O A;  4W9G A;  3AEA B;  2DLB A;  1HZF A;  4NAW A;  5BMI A;  2Y3A A;  2LGD A;  3V60 A;  1D4B A;  1ISN A;  3PRE A;  4K7S A;  5JPM B;  4ZHO A;  2MSE D;  3KW5 B;  1FNV A;  2MX2 A;  4KZC A;  4WQO B;  4W9J A;  3PRZ A;  5BYR A;  2ON8 A;  3M00 A;  3QJZ A;  5G5H A;  4HPP A;  3WAP A;  2JF5 A;  4GDK A;  3EFC A;  3ZYY X;  1QIL A;  3TSS A;  1QQR A;  4XYC A;  2XWJ B;  1ULV A;  1J7A A;  1V86 A;  1VRA B;  1AWD A;  3IAM 1;  1V5O A;  1C4A A;  4TSS A;  5BMH A;  2JX5 A;  2LGX A;  1HXC A;  1X1H A;  1H12 A;  2BF8 B;  1I35 A;  1MG8 A;  4N9F 4;  2GI9 A;  2WY8 A;  1EO6 A;  1XLN A;  4R3D A;  1I8Q A;  3U8Z A;  2FID A;  3E9S A;  2NPT A;  4DXA B;  3ZKJ C;  1NL4 B;  1WM2 A;  1WH3 A;  1OJP A;  5LXI B;  4WWP A;  1RWS A;  1O1T B;  5LLI A;  2DZM A;  1ET6 A;  3DSX B;  1QT9 A;  1V5T A;  5D3D A;  1N7P A;  2V3S A;  2ZCB A;  2J5C A;  2PIA A;  2MW5 A;  4BBN F;  1E7P B;  2KHW B;  3RX8 A;  2PE6 B;  3ANI A;  1BML C;  3EEC A;  3SD5 A;  3SR6 A;  4GL3 A;  4FN2 A;  1J0G A;  1JS4 A;  3Q3F A;  4I6L B;  4B0E A;  2LHD A;  3Q7A B;  2XNA C;  1QOA A;  1N94 B;  3VSM A;  3ZJV A;  3VTV A;  3QK0 A;  1GPX A;  1XCQ L;  2KVR A;  3QWZ B;  4K1R B;  3M62 B;  4GTV B;  5JMD A;  3QPF A;  2KMA A;  2PLP A;  2MLB A;  3M02 A;  2WDA A;  2PW9 A;  1N1B A;  3OJ4 B;  3IAS 1;  1PFD A;  2LEK A;  5BO4 B;  1VCB A;  2WNM A;  2WHI A;  1YD8 U;  5IN7 A;  1XT9 B;  2LGI A;  4TUU A;  1HM2 A;  2FV1 A;  2WII B;  4GGQ A;  1LOH A;  3NVV A;  1X1I A;  2L00 B;  2N7J A;  1HE8 A;  5JMF A;  1TKG A;  1TT5 B;  3E80 A;  1WGH A;  2N1W A;  2JYE A;  2VRR B;  4DQO C;  2KO3 A;  2L76 A;  4M8N A;  2WXN A;  2MJD A;  2BWF A;  3I57 A;  4W9F A;  2FUH B;  3CMM B;  4USA A;  1K8R B;  4YSY B;  2NPT B;  5E6J A;  2NBW B;  5AUI A;  1UGM A;  2JWU A;  4HXD A;  4CJ1 A;  2KN4 A;  1V1O A;  4TXT A;  3GE8 C;  4JQW C;  1F1H A;  3CSF A;  4GSW A;  3S4A A;  4GAX A;  1G9G A;  2GBM A;  1V5D A;  1I4G A;  2BYF A;  3ZDT A;  2Y5C A;  3PZ1 B;  2KKC A;  3KUZ A;  5J2R A;  1KRH A;  3ZRF A;  3DBL I;  3NZU A;  3IXS A;  3RN9 C;  3OG5 A;  2G0D A;  4BOZ B;  1XLP A;  2DAF A;  2FCQ A;  2KX3 A;  5H92 C;  4YL8 A;  1T6B X;  2WXH A;  1SA5 B;  5CTR C;  3GP7 A;  3H3K A;  3UIP B;  4FUL A;  1HXY D;  1HCU A;  2YEP B;  3KSL B;  2LAS A;  3VXD A;  1L0Y B;  1YX5 B;  4MSQ B;  5KHO A;  3VUW A;  4OVV A;  1WSP A;  5EAT A;  3M77 A;  1FMA D;  3NY5 A;  1HTO A;  2INC C;  1WU5 A;  2N9X A;  4I6P A;  3HM3 A;  1GLM A;  1FP3 A;  1HEZ E;  4DWF A;  1DGJ A;  4PS7 A;  1WI0 A;  2DZJ A;  3RSY A;  1SIF A;  1ACC A;  5CHV C;  1F0Z A;  5AUK A;  3EHV A;  1YX6 B;  2MP2 B;  5FK9 C;  2ZIR B;  4M0W B;  4D4D A;  2YEP F;  1HZ5 A;  1YJI A;  1J8C A;  1FT1 B;  2MHJ A;  2DYB A;  2W82 A;  1RWG A;  1MHX A;  3I63 C;  2KX0 A;  4WAF A;  2RDH A;  3R66 C;  1N23 A;  5DHI A;  2J42 A;  3U2S C;  4NZL B;  4AJY B;  4ZOH C;  4PS3 A;  3URY A;  1DOI A;  3AE3 B;  3L08 A;  4AYQ A;  1VZ6 A;  3HXC B;  1LTX B;  4F7Z A;  1BUI C;  4OK4 A;  3WKG A;  1N6Z A;  2FIF A;  4N59 A;  3J9C A;  4BOK A;  3W1Y A;  4KIK B;  4HKZ E;  1UBI A;  1YQ4 B;  3VR8 B;  1OJO A;  1FCC C;  1OQR A;  5DPR A;  1QSJ A;  4OVZ A;  3ZXV A;  1TZO A;  1KFY B;  1WX8 A;  1X1M A;  1WXM A;  3HXE B;  1MHH E;  4WIP A;  2WS3 B;  2JYT A;  4LJO B;  2IGD A;  4JWS C;  3PZ3 B;  2DX5 B;  2NOJ A;  2AQ2 B;  2GBR A;  2W3R A;  3JSV B; 
#chains in the Genus database with same CATH homology
 2EAD A;  1NXC A;  2FUZ A;  1C79 A;  4LK0 M;  1FBO A;  1O1R B;  1FRR A;  5EE3 A;  1Q10 A;  3TF4 A;  2RMM A;  3NVW A;  1WZZ A;  1KRF A;  4N6E B;  4GTT B;  2W3S A;  3P4S B;  1VLB A;  4CQN A;  1TS2 A;  2DYO A;  4XDD A;  3SDV A;  2PN5 A;  1WWT A;  2KAC A;  1IS9 A;  5M7I A;  1GXM A;  1YJJ A;  2WXJ A;  4KGR A;  4JX1 C;  1JCR B;  2I38 A;  3U4E G;  4B0M A;  1N62 A;  1JW9 D;  1I7H A;  1MPE A;  1TKE A;  1GB1 A;  1JQ4 A;  2IPK D;  5EE1 A;  1QQF A;  3ETR A;  4RGN A;  4HRO A;  5GY3 A;  2ONQ A;  3HXF B;  5DGQ A;  3ZJU A;  5FOB B;  4KTR A;  1FBW A;  2JF4 A;  3U7Z A;  3DST B;  2JXT A;  2Y5P A;  3M7B A;  4YTN B;  2NTT A;  2Z8L A;  1I4X A;  5D7G A;  4C80 A;  2QJL A;  3QT3 A;  4OZC A;  1YNT E;  4D94 A;  1C78 A;  1CJE A;  1XCT L;  2JU6 X;  2LUM A;  3P4R B;  2FBA A;  2DRR A;  5HFY A;  1M4V A;  3Q73 B;  1KTK A;  2AX5 A;  1K53 A;  2QNO A;  1F2R C;  4WVA A;  1PGB A;  1E10 A;  2J4X A;  2WXL A;  4JE3 B;  2ZZR A;  5D3I B;  2WLB A;  3GLY A;  3E73 A;  3W5V B;  1N5W A;  1FAE A;  3HVD A;  3S4C A;  1LF6 A;  3WKH A;  3W7W A;  3SDR A;  5FO9 B;  3W7T A;  1J7B A;  4H2A A;  2X38 A;  1IGD A;  3HXB B;  1TS5 A;  2M0A A;  3EUB 2;  3NVZ A;  1IA6 A;  2ZW1 A;  1X81 B;  3Q8C A;  1TNU B;  4AYR A;  1HZ6 A;  1TJE A;  1TS4 A;  2KWD A;  1ESF A;  3SFY B;  1VJK A;  4MU9 A;  1JWA D;  4M76 A;  1KZO B;  1D6E C;  1MI0 A;  3I9V 1;  2V3N A;  2SAK A;  3V05 A;  2R61 A;  1O1S B;  3M7L A;  1H3A A;  1QOB A;  2EEL A;  2V8J A;  1SXT A;  2M19 A;  1V7V A;  1P7E A;  3Q7F B;  1JAL A;  2M56 B;  1G9J A;  4YSX B;  2LFI A;  1DOX A;  4TQ1 A;  1IA7 A;  1G87 A;  1LD7 B;  1O6Q A;  2D8L A;  1SBB B;  1FT2 B;  3EA6 A;  3AE5 B;  3KWL A;  3M76 A;  2YIK A;  3VRA B;  2BTE A;  1GHQ A;  2FV0 A;  1L5P A;  3AEB B;  4C56 C;  3QFZ A;  1N95 B;  1EM7 A;  1L4Z B;  3E32 B;  3K11 A;  2MJ3 A;  5BMG A;  1XW2 A;  3K7X A;  3Q69 A;  4KGT A;  2INP E;  4DOE A;  2WXO A;  2GOX A;  4GTM B;  1SIJ A;  1XLQ A;  2WDR B;  1B1Z A;  3E30 B;  5JPN B;  2BT6 A;  2HTM E;  2XQW A;  5BYS A;  3T3O A;  4A90 A;  4ZYS A;  2OHF A;  5AGD A;  1C4C A;  2G1E A;  4IDI A;  3DPY B;  4NAW B;  4AS1 A;  1JCK B;  2DRS A;  1V7W A;  3AMZ A;  1UGJ A;  1JRP A;  4YWG G;  1DOG A;  1NI3 A;  2GB1 A;  3AFJ A;  4JJJ A;  2V8K A;  1UT9 A;  3M75 A;  2BS2 B;  4US9 A;  3ON6 A;  4HRS A;  3E6U A;  3M7E A;  2XWB B;  2PTL A;  2E3T A;  2TSS A;  4C1S A;  1TNO B;  1N5X A;  1H14 A;  2SQC A;  3KQ4 A;  2WXP A;  3AE8 B;  1VZ8 A;  1PUT A;  3NS1 A;  3W7X A;  4CJ0 A;  2Z07 A;  3P42 A;  3MJ5 A;  4REZ A;  5GZK A;  1SE2 A;  1A70 A;  1X9D A;  2I07 B;  3AN1 A;  2IEJ B;  5C2T B;  2EAE A;  1ROE A;  2KMM A;  2L32 A;  3SFE B;  1FD6 A;  1QLB B;  1W6J A;  3VR9 B;  3D5S A;  1TY2 A;  2H88 B;  2ICI A;  1AGM A;  3BVG A;  1T5X D;  4D4A A;  3QXQ A;  1SF0 A;  3FAH A;  3EUV B;  1V7X A;  1HA5 A;  4GTQ B;  1I4Q A;  1P7F A;  4OHJ A;  4A55 A;  1KSC A;  1VDV A;  4EL8 A;  1H39 A;  3GS2 A;  2AQ3 B;  1KS8 A;  4D4B A;  2V4I B;  2VN4 A;  3ANJ A;  2WXQ A;  1SB3 C;  2VN7 A;  2BBC A;  1SJE D;  3Q75 B;  3H7L A;  2RDG A;  3BK2 A;  3IT6 B;  4IOI E;  4RGO S;  4ZH1 A;  5GXG B;  3W5M A;  1D5Z C;  4A9A A;  2H6G B;  4MAC A;  5FO8 B;  3PYA A;  1FNW A;  2OED A;  1O6H A;  3M7C A;  3W5N A;  3Q8F A;  1OFF A;  2DYM A;  1FPP B;  3NVY A;  3TEY A;  4EHM B;  3P2C A;  3WIQ A;  5H8Y E;  1V8C A;  1NYR A;  3E34 B;  3SDQ A;  4M0W A;  4YDO B;  3GT5 A;  1CEM A;  3T3N A;  3P5P A;  3AE7 B;  2I2Y A;  1KSD A;  1FCL A;  1DYQ A;  1PYW D;  4GTO B;  1TF4 A;  4WVB A;  2E6X A;  2HDE A;  1O79 A;  4JPS A;  1JRO A;  3EZ8 A;  3BK1 A;  3A3V A;  2JG0 A;  3X17 A;  2WXK A;  4YCR A;  2Q5W D;  2LJI A;  1BXT A;  1EWY C;  3SDT A;  2QSD A;  2W55 A;  3HVZ A;  2NTS A;  4UDU C;  1FNU A;  3WUX A;  1XWT A;  1PGX A;  1TN8 B;  4RFB A;  2BB6 A;  2WXH A;  2H6I B;  2NMQ A;  1TYG B;  1WXQ A;  4WH4 A;  4US8 A;  3KSQ B;  1CZP A;  2ZIS B;  1FMI A;  2BED B;  2WXF A;  3BZD B;  2GZ6 A;  2RGK A;  1EWC A;  1RFK A;  2WXG A;  4RGT A;  1N4S B;  2D5J A;  4GLS C;  2K5P A;  4HKQ A;  3T33 A;  2L1A A;  4WQM A;  3OXU A;  1W6K A;  2WY7 A;  1UG9 A;  2J53 A;  2QMT A;  3SAE A;  1WGK A;  1V97 A;  3Q8A A;  1GSZ A;  3RX5 A;  3AE9 B;  4JWU C;  4RF0 A;  4YT0 B;  1N4P B;  3ZJT A;  2WDV B;  2DLB A;  1JWM D;  3AEA B;  3EQA A;  1HZF A;  3PZ4 B;  4V1S A;  3AV8 A;  4GDL B;  4YXD B;  2BW2 A;  3MC0 B;  5BMI A;  2Y3A A;  1C76 A;  1EU3 A;  1D4B A;  1F9D A;  3SQC A;  1ZDV A;  4AQ7 A;  3WKI A;  2PKO A;  5JPM B;  3NRZ A;  4XDC A;  4ZHO A;  4L6X A;  2GRI A;  1FNV A;  1PDX A;  3CU7 A;  5LNK 1;  2PMV A;  4PT5 A;  5BYR A;  1TN6 B;  2ON8 A;  3S4D A;  2MH7 A;  3R2T A;  2P0V A;  3CWI A;  4ARI A;  1H54 A;  1AN8 A;  2RPV A;  1UUP A;  5MEH A;  1N9A B;  1QKZ A;  1SE4 A;  3LYY A;  5G5H A;  1JWS D;  1GB4 A;  4D2K A;  3HXD B;  1WU4 A;  2PVG C;  3N9Y C;  3O13 A;  1UWX A;  2WXI A;  3PO0 A;  4DXG A;  3ZYY X;  3QSP A;  1QIL A;  1NEN B;  2XN9 C;  3TSS A;  5CA3 A;  1QQR A;  4GDK B;  3AE2 B;  2H6F B;  1L1Y A;  2XWJ B;  1ULV A;  1I4P A;  4C7Z A;  1J7A A;  2G9H D;  2B4F A;  3P5R A;  1GOZ A;  3AM9 A;  3OWE B;  4WVC A;  1O5M B;  4KKI A;  1VRA B;  1AWD A;  4YTP B;  1RM6 C;  1NEK B;  3IAM 1;  3ZQ4 A;  1IBX B;  1O6R A;  3E33 B;  2QIL A;  1H37 A;  1C4A A;  3R2I A;  3DWG C;  4TSS A;  2JX5 A;  3W2D A;  3D3I A;  1YN4 A;  5BMH A;  3EU8 A;  1KLG D;  1E6E B;  2WQY B;  4ZRP A;  1H12 A;  1TS3 A;  3AB5 A;  1L0V B;  1QOG A;  3KLS X;  4L0G A;  1D8D B;  3WKF A;  3IT4 B;  3ZGZ A;  1KKT A;  1YQ3 B;  2F6D A;  2CU3 A;  3BII D;  2J52 A;  2GI9 A;  3W9C B;  2WY8 A;  3PMM A;  1XLN A;  3V3X A;  4R3D A;  1IGC A;  3S4B A;  3AEG B;  4LNV A;  3AE4 B;  2SEB D;  2XFG A;  1KLU D;  3PZ2 B;  3ABV B;  3E9S A;  1E9M A;  3VRB B;  4XE0 A;  3BVM A;  1NL4 B;  3FIL A;  1TKY A;  3TEZ A;  1XF5 L;  3AEE B;  1RYJ A;  3Q79 B;  1RWS A;  2WIN B;  4XUV A;  1O1T B;  3B9J A;  1ET6 A;  4YSZ B;  3DSX B;  1YMH E;  3W7S A;  4GTR B;  4A6Q A;  1QT9 A;  1SSN A;  4XWW A;  1DL2 A;  1H3B A;  4C7Y A;  1XXG A;  1NI1 B;  1C77 A;  4Z4L A;  1JWU D;  5TSS A;  5D3D A;  4LNB B;  2AQ1 B;  3TEX A;  1KRE A;  1IUE A;  3M71 A;  2PIA A;  1L2A A;  3BWU D;  4LTU A;  5FO7 B;  1N4R B;  1E7P B;  3QFY A;  1QBQ B;  5EE0 A;  1C9F A;  3RX8 A;  1D5M C;  3ANI A;  2L83 A;  1BML C;  1CQV A;  3SR6 A;  2IGH A;  1C4P A;  1EU4 A;  1K72 A;  2EKI A;  4GL3 A;  4QT9 A;  3RX7 A;  1JS4 A;  3C72 B;  3HUI A;  3UI3 A;  2IGG A;  3BVZ A;  1H36 A;  3D5R A;  4B0E A;  2OKX A;  2INN E;  3WIR A;  3Q7A B;  2LHD A;  2QIE B;  2XNA C;  1QOA A;  4KX6 B;  1N94 B;  4Z4J A;  2D5G A;  3ZJV A;  2WXR A;  2FE8 A;  5T8I A;  1GPX A;  1SE3 A;  1F9O A;  1ZXI A;  4KKJ A;  2VZK B;  4FXK B;  1L6V A;  4RF1 A;  1AYX A;  4HEA 1;  1I4R A;  1XCQ L;  3SFD B;  1GAQ B;  3Q8B A;  4GTV B;  3R8B A;  3QPF A;  4FUS A;  1QOF A;  1XO3 A;  2PLP A;  2WP9 B;  3W5U B;  4ARC A;  1UMP A;  2R2L B;  4RH6 A;  3DWM A;  1SA4 B;  3PZ7 A;  2PW9 A;  1F77 A;  1WRI A;  1KFG A;  1SEB D;  3RFZ B;  3IAS 1;  2RI8 A;  5I4D A;  1PFD A;  2LEK A;  3CIH A;  3TEW A;  2WNM A;  1CLC A;  2H6H B;  1R7S A;  1SJH D;  3EGR A;  2KQ4 X;  3M74 A;  2G02 A;  3P4P B;  3E37 B;  1FRD A;  3ACT A;  2LGI A;  4FXC A;  2FV1 A;  2WII B;  1K51 A;  5E2J A;  1TNZ B;  4DOD A;  2BS4 B;  1VZ7 A;  1ZPS A;  4WWM A;  5G5G A;  2CJN A;  1T3Q A;  1KF6 B;  2N7J A;  1TKG A;  1NC5 A;  1ZE3 D;  2V8I A;  2JYE A;  2K3U A;  4DQO C;  2AHG A;  1DCE B;  2JQR B;  1ZP0 B;  1FIQ A;  1XWQ A;  1V1P A;  2MJD A;  3QDE A;  4AYP A;  2WXN A;  4TF4 A;  1UWM A;  1HQR D;  2AHF A;  3I57 A;  4OZB A;  2BB5 A;  3REN A;  5EE9 A;  3NZ3 A;  3B2G A;  5HI1 A;  1CK1 A;  1LD8 B;  4MM3 B;  4USA A;  4YSY B;  1TY0 A;  2H89 B;  2WDQ B;  5E6J A;  3FIL B;  3W7U A;  3W1S A;  2IDY A;  5AUI A;  1WU6 A;  1FEH A;  2JWU A;  4Q2J A;  1L6U A;  4CJ1 A;  2V0G A;  2N0S B;  3DSS B;  2KN4 A;  4GTS B;  3AEF B;  1IBX A;  1V1O A;  2IJ0 A;  4MT5 A;  4TXT A;  5HG2 A;  3WIW A;  1JML A;  1JCS B;  3MFG A;  4LLG M;  4V1R A;  1WYG A;  1K50 A;  4L23 A;  3S4A A;  3QT9 A;  1G9G A;  1XLO A;  1V5D A;  1I4G A;  2GH4 A;  3QWT A;  4BOJ A;  3WC3 A;  1TNB B;  2Y5C A;  4RCO A;  3U52 E;  4HJG E;  3PZ1 B;  3C8Y A;  3TUO A;  1N4Q B;  1LO5 D;  1D5X C;  3DSU B;  4KTP A;  4MBG B;  4ITK A;  2EAC A;  1KRH A;  4AYO A;  2K9X A;  3EU5 B;  3NVV A;  4L2Y A;  4LIX A;  1R76 A;  3IXS A;  5M7Y A;  1I4H A;  2G0D A;  3KWV A;  1SQC A;  1XLP A;  4KGS A;  1DOY A;  3B2F A;  5H92 C;  1F2R I;  3S9V A;  1T6B X;  1H3C A;  1SA5 B;  3DRA B;  2DBY A;  2QEJ C;  1GXN A;  4WU0 A;  2KDM A;  3AE1 B;  3FC4 A;  3GP7 A;  3WCQ A;  5FKA C;  2V3P A;  1YN3 A;  4OW0 A;  3H3K A;  1FFU A;  1C3D A;  2BYT A;  3GZK A;  5CZL A;  1H35 A;  1HCU A;  1HXY D;  2LMC A;  2YEP B;  3KSL B;  3VXD A;  1L0Y B;  4DXF A;  1V5C A;  1OQQ A;  3P4Q B;  1WSP A;  2CQT A;  3M77 A;  1S64 B;  2PVO D;  4MH8 A;  4TQ0 A;  5CD2 A;  2FUG 1;  1FMA D;  1N63 A;  1D8E B;  2B76 B;  2KAJ A;  4ZHP A;  3MHZ A;  5C3J B;  1N61 A;  4ONT A;  4O1N A;  1E0Z A;  2DRQ A;  2EAB A;  1WU5 A;  3LXF A;  4EE2 A;  4YTM B;  3DSW B;  1PGA A;  1FO2 A;  2B39 A;  4FXG B;  1ENF A;  1GAI A;  4RNA A;  1UNS A;  1FXI A;  4IKG A;  1GLM A;  1FP3 A;  4ZG8 A;  1HEZ E;  1RQ5 A;  3DSV B;  3RJ3 A;  3RRS A;  2N9L A;  1DGJ A;  2WU2 B;  3QG0 A;  1MVK A;  2BS3 B;  1H13 A;  5HHD G;  4J3O D;  3CIR B;  3OED A;  3RSY A;  3KLS A;  2MJE A;  3PYB A;  3L4P A;  1B9R A;  2AFA A;  4Q2B A;  4ZH5 A;  1ACC A;  1XEE A;  3NUH B;  5GW7 A;  5AUK A;  4A8X C;  1F0Z A;  3M78 A;  4P16 A;  3ACS A;  3ANK A;  5MPO A;  4ZRQ A;  1ET9 A;  2JJB A;  2MEK A;  1STE A;  1GAH A;  1JWB D;  1N60 A;  1ZUD 2;  2K0P A;  2DWQ A;  3BYY B;  2ZIR B;  5FK9 C;  4D4D A;  4D4C A;  1GA2 A;  1HZ5 A;  3SDU A;  2YEP F;  2ZW0 A;  3QXF A;  1TN7 B;  1FCE A;  1YJI A;  4J5T A;  1FT1 B;  3H2W A;  1V1P B;  4GTP B;  3Q78 B;  1Y56 A;  2LHE A;  2N9K A;  2W82 A;  1L4D B;  1ZXH A;  4L9P B;  1MHX A;  2VZK D;  2ZBL A;  3PZ8 A;  4NAM A;  4WAF A;  4RGM A;  3E56 A;  3AEC B;  2RDH A;  3M73 A;  4L1B A;  2WYN A;  5DGR A;  4NJC A;  2DRO A;  1NYQ A;  2J42 A;  1KH0 A;  4NZL B;  4ZOH C;  2F0Y B;  3U2S C;  3URY A;  1G6I A;  2K22 A;  3H8H A;  2CJO A;  3G6J B;  1DOI A;  1ZOY B;  2A73 B;  3AE3 B;  1FXA A;  3P1M A;  2JSV X;  4AYQ A;  1VZ6 A;  1LTX B;  1VD5 A;  3HXC B;  1L0X B;  4N58 A;  1NVI D;  3RPF C;  5KKB A;  1JCQ B;  1KZP B;  1BUI C;  2A8Z A;  3WKG A;  3GB1 A;  3HRD D;  2WXM A;  4N59 A;  5FR3 A;  3J9C A;  1FO3 A;  4CE7 A;  2RI9 A;  3M72 A;  4BOK A;  2NVP A;  3QRY A;  1FO4 A;  3SEB A;  4LNG B;  4YDE B;  4HKZ E;  3BYT B;  1YQ4 B;  4XWT A;  3VR8 B;  1FCC C;  1OQR A;  1S63 B;  1GXO A;  4P6V F;  3SFX B;  1J7C A;  1FFV A;  1QSJ A;  4OVZ A;  3VQI A;  1QF6 A;  4TMA B;  1YN5 A;  2WU5 B;  1ZDX A;  1TZO A;  1KFY B;  3AH7 A;  2ACZ B;  5JXV A;  3HXE B;  1MHH E;  2W54 A;  4WIP A;  2WS3 B;  4Q88 A;  2JYT A;  2FBW B;  1LF9 A;  2JZP A;  2IGD A;  4JWS C;  2L52 A;  3PZ3 B;  3LB8 C;  2NOJ A;  1FM0 D;  1TNY B;  1K52 A;  3AE6 B;  3MP9 A;  1MZC B;  2AQ2 B;  4OZA A;  2CQS A;  1KWF A;  5BYQ A;  3VW5 A;  3Q8E A;  1AYF A;  3P63 A;  2W3R A;  3AED B;  1AW7 A;  4WUR A;  1VR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...