3KQ4A

Structure of intrinsic factor-cobalamin bound to its receptor cubilin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
393
structure length
385
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gastric intrinsic factor
total genus 114
structure length 385
sequence length 393
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3kq4A01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3kq4A02
1O6RA 1O5MB 2G02A 3HXBB 2GOXA 3G6JB 2A73B 4LNBB 1D8DB 3E34B 3HXDB 4BOKA 1W6KA 2WIIB 1DCEB 1H36A 1N4PB 2BB5A 2B39A 1JCRB 2XQWA 3KSQB 4FXGB 4LNGB 4GTRB 4ONTA 2BEDB 4GTOB 4V1SA 1NL4B 4MU9A 5JPNB 4GTTB 1O1SB 1N4RB 3DSTB 3C72B 1N95B 1N4SB 1S64B 5FO7B 1H35A 2ZIRB 1LTXB 3SFXB 2NOJA 1D8EB 3Q73B 1SA4B 3HXEB 3DSXB 3PZ3B 1S63B 3Q7AB 3DSVB 2SQCA 3E33B 2WY8A 3U7ZA 5FOBB 3OXUA 4ZRPA 5AGDA 4C1SA 4EHMB 2V8IA 1NI1B 3KSLB 1LD8B 4KKIA 3PZ1B 4V1RA 1KZOB 2V8KA 3DSUB 2V8JA 4YDOB 1C3DA 2PMVA 4ZRQA 1TN6B 2PN5A 3SQCA 4GTMB 2BB6A 2H6IB 3EUVB 4D4AA 1O6HA 1W6JA 3E32B 4D4CA 2G0DA 3SFYB 1O1RB 1TNBB 4GTSB 1H3CA 1H39A 3Q7FB 3DSWB 1X81B 3RJ3A 4LNVA 1TN7B 1FT2B 2V3NA 1GHQA 2XWBB 2I07B 3DSSB 5FO9B 1GXNA 1N9AB 4D4DA 2WY7A 1TNZB 4BOJA 2XWJB 5FO8B 3CU7A 3E30B 3DRAB 1QSJA 2IEJB 2V3PA 5JPMB 1TNYB 3Q79B 1H3BA 1O79A 4GTQB 1JCSB 1QQFA 1MZCB 3HXCB 4MBGB 1FPPB 4GTVB 1R76A 3PZ2B 3D5RA 2WINB 3HXFB 1LD7B 1SQCA 3Q78B 4FXKB 1GXOA 4L9PB 2F0YB 3PZ4B 4D94A 1QBQB 4ZH1A 2H6GB 4KKJA 1JCQB 2H6HB 2R2LB 3K7XA 1H3AA 3EU5B 3DPYB 1TN8B 4M76A 2H6FB 1TNUB 4YDEB 1N94B 3E37B 1SA5B 3KLSA 3KQ4A 1TNOB 1H37A 1O6QA 1KZPB 2ZISB 3D5SA 1HZFA 1UMPA 4GTPB 1GXMA 1GSZA 1O1TB 1FT1B 1N4QB 3Q75B 2BBCA 3OEDA 4D4BA
chains in the Genus database with same CATH superfamily
1XF5L 2KWCA 4RF1A 5E6JA 3EHVA 4IWOA 5JH5C 4HKZE 3B2GA 3M77A 4DODA 3HXDB 2IBIB 3EECA 1WR1A 1RLFA 2UWQA 3ZNHB 1IGCA 2J0KA 1OQRA 1ZPSA 2DHZA 1XCQL 3RULA 2JZPA 2LGYA 1N61A 1GNUA 2G45B 3Q3MC 3P5PA 1E90A 3D32A 4HCNB 5IK0A 4DI5A 3OJ4B 4NPNA 3QG0A 2N9KA 5E6NA 4GU2A 1SE4A 3MFGA 2Y5BB 2LVQA 1KZOB 3WKIA 3V6EB 4AYOA 2L0FA 5HKHA 3E73A 4MDKE 1QOGA 4D4AA 1O6HA 2JRHA 1FNWA 4ZHOA 3RCZA 1LM8B 3ZTCA 3SDUA 2K25A 1TF4A 1T5XD 2WXIA 3T3OA 2KJRA 3AE8B 3K9OB 4OW0A 4ZH5A 1HTOA 2KOXA 2LJ5A 1ZXHA 2QILA 1DOXA 2LHDA 3AEEB 4MSMB 4C7YA 2ZEQA 3WAMA 1QOAA 4P1CC 1E7PB 4G3XB 2KTFA 3OAWA 2BYTA 3PO0A 3PVLA 1V6EA 3IXSA 1XEEA 3QXQA 5ILZA 3UF8A 2FUZA 3P5RA 2WCOA 3L08A 3S4BA 1UZXB 1B9RA 1YJJA 2WXOA 5AZFA 3A3VA 1ENFA 3EFCA 5LXIB 1HZ6A 3ZW3A 3NZUA 1N94B 5HI1A 1O6QA 3CIRB 1XQQA 2NPTA 4XDCA 3I9V1 4II2B 1KREA 3BK2A 1KRFA 3ML9A 4DWFA 2WDAA 2LHEA 1E8ZA 2PJHA 3WIQA 5AUIA 3VRBB 1GJZA 1GB4A 1QOBA 3WA0A 4DHZB 2IYDB 3ZDTA 3A9KA 2D07B 2C9WB 2JXTA 1VD2A 2BKRB 4MJSB 1V5DA 1WJUA 3KSQB 5MPOA 4BKTA 1YMHE 2KQ7A 1GC7A 3UGBB 3VFKA 5HFYA 3AE5B 4GTTB 5KHQA 4RMAA 3V3XA 3SU8X 1N95B 1ZDXA 5FO7B 1HTQA 2ZIRB 2MEKA 3ZYYX 2NOJA 1EF5A 1KSDA 4A20A 1L0YB 2M17A 3DSXB 1T0QC 1E7VA 5CD2A 2H88B 3E33B 3AE2B 3P63A 3PZ7A 2GBRA 4TUUA 4M8NA 3GZNI 3QJZA 5BMGA 1OJPA 4KX6B 5CTRC 1M94A 1FCCC 4A3PA 3NHEB 4YSZB 2A8ZA 2KJ6A 2KX3A 1JS4A 1TNBB 4HJKA 2NCNA 2IO0B 5GXGB 5AEKB 5D7GA 1GHQA 1RWHA 3QPFA 5AZGA 1UG9A 2EELA 4D4DA 3WCQA 1FO4A 1KLUD 2J52A 1E0ZA 1YQ4B 2V3PA 4EZJA 1UWXA 2R2QA 1HMUA 3ZGZA 1TT5B 3C19A 3N32A 4KVGB 1YN3A 2KQ4X 2V9HA 4OK4A 2RR9A 2KZRA 4IM3A 1K52A 3URYA 1VZ8A 2FIDA 4GDLB 1WMHB 3ACSA 3LDZE 2C60A 3JSVA 1YJ1A 1TKGA 2RI9A 3E37B 2AL6A 2R61A 4MGIE 1ZOYB 4ARIA 4HDOA 3ANKA 4J5TA 2ZVOA 4NAMA 3WALA 4HPPA 2AL3A 1N4QB 1QOFA 3QHTA 4P1BC 5EDSA 5ILIA 2BS3B 2O6VA 1X9DA 3HXBB 2ZJDA 4WAAA 2GOXA 1L2NA 2A73B 1UELA 4AOFA 1C9FA 3WKFA 4GGQA 1I4QA 1DCEB 1PUTA 2K1FA 3R3MA 3X0WA 1N4PB 2O6VB 3I57A 4ZG8A 1N7RA 3EZ8A 4GTOB 2FUTA 3QWTA 1TBEA 1N4RB 3M78A 1XT9B 1GUAB 3RNAC 4B0MA 3C72B 2XN9C 4ITKA 2KWVB 3ETRA 1OTRB 2N4FA 4RFBA 4HXDA 3A1QB 3H2WA 2M0AA 4KDIC 1WE6A 2QMTA 4JPSA 4ZRJA 1H54A 1ZE3D 3ZXRA 3M74A 4EHMB 2BT6A 3AEFB 4KDLB 2C7NB 5D3IB 3A33B 4A6QA 3P4QB 1F1SA 4RGTA 2I1JA 2DZIA 2BS2B 4MH0E 2L76A 5E6PA 2JWZA 3B9JA 4F8CB 1DOIA 3Q8CA 3R8BA 2H6IB 3H7LA 1R4MI 2MH7A 3U2SC 1G6IA 4JWSC 4W9DA 5DGQA 3KYCD 3GLYA 4P6VF 4YWGG 2M56B 2L7RA 3NFVA 5IO9A 3NG0A 1D5ZC 2DLBA 1XD3B 3A9JA 2PKOA 5FO8B 1EWYC 2DBYA 3ANJA 4AS1A 1J8CA 3KW5B 3APFA 1TNYB 4C56C 3HXCB 1BXTA 3EA6A 4WWPA 2RPVA 4EL8A 3R66C 2WDTB 3AU4A 4ZH1A 4L9PB 2K9XA 4YTMB 3J9CA 5EATA 3RSYA 2M0XA 1JCQB 3IHPC 2JYTA 3FILA 1TN8B 2X38A 1SXTA 2JWUA 2LUEA 4IWPA 1ET9A 4W9JA 3I5JC 2XK5A 1N63A 3UQBA 3W7XA 2INDC 3BYTB 4CYEA 1WRDB 1V8CA 4E74A 2CS4A 3IT4B 4HVBA 3OEDA 5D6JB 2LVPA 2JU6X 2KDFB 4IW0A 4Z4JA 2FCSA 3DDCB 4CJ1A 1K72A 3HM3A 4MMHA 1AYFA 1JALA 3KUZA 2J53A 3N20C 2C7HA 3H7PB 2MWSB 1IA6A 5DPWA 2MBBB 4JIOU 2B39A 4KSLC 1UNSA 3Q3OC 3S4CA 2FCQA 3AXCA 3IFWB 5ILJA 1SB3C 3DVNU 3G4DA 4MSQB 5IK6A 1I4GA 2YLMA 3JYUA 4D2KA 4B95A 4DBGA 1FIQA 1YX6B 3OXUA 2V8IA 1NI1B 3B2FA 3TEXA 3C0RB 4V1RA 2L00B 2L32A 1SJHD 3W5UB 2BB6A 3E6UA 1U4AA 3ONSA 3NVWA 1LOHA 1V49A 3DBHI 4N59A 1TN7B 5IA7A 4GXBA 3IG3A 1P9DU 2D3CA 4KGRA 1WGYA 2QIEB 3NS8A 3Q8FA 4NQLB 4Q2BA 2XWJB 2W3SA 1V86A 4Q88A 2BWES 3HM6X 1IBXA 2K8CA 5JPMB 3V61A 1Q1OA 2JUOA 1GAHA 2CU3A 1V97A 1R76A 1C4CA 4JL9A 2Z8LA 1RAXA 1LD7B 2JX5A 4YT0B 3M01A 3ACTA 2GZ6A 3UI3A 2LUMA 2E22A 4WH4A 3RFZB 2WXJA 2XNAC 3VQIA 2J0JA 3QDEA 5AZHA 2KDEB 2ZISB 3SR6A 2OEDA 3VUXA 1HXCA 1YNTE 3SFDB 1FT1B 1WGHA 4D4BA 2LASA 1YN4A 4XE0A 3BVMA 3PRPB 4PS8A 2KLCA 4CQNA 2W3RA 3VUWA 1P98A 3M7CA 1UH6A 3BVZA 4FUSA 4M02A 3Q8AA 4AYRA 2DROA 3AE4B 4TQ0A 2E24A 1TKYA 4GN1A 4LNGB 3T3NA 4TF4A 1BMLC 1UUPA 4AJWA 1ACCA 1NL4B 1E6EB 2ONQA 3L13A 4GLSC 4DDID 1L6VA 4WJOA 1N4SB 1WZZA 1E7UA 4KIKB 1DL2A 4TXTA 1X1IA 3B0AA 1NC5A 4XX5A 3W1YA 3LZ9A 1HE8A 2QHOA 3M7LA 2CU1A 2X8XX 4GDLA 3A1QA 3KSLB 4F1SA 4J6IA 1P7FA 1HXYD 5IL8A 4N58A 2CQSA 1C79A 1PDXA 3OJ3A 4L6XA 1MVKA 5IAAC 1DYQA 4W9IA 1Q10A 1YN5A 4BFRA 4FHKA 5FKAC 3DWGC 3QRYA 1LF6A 2D3GA 1WXMA 2MBEA 1GXNA 3PZ8A 3X23A 1TNZB 4GL3A 3BWUD 4GB9A 5DPTA 4NAWA 3CU7A 1EF1A 3E30B 1T0RC 1QSJA 1CMXB 1F9GA 1Q0WB 3R2IA 3W1SA 1FCEA 2EAEA 2IY1B 3DBSA 1QQFA 4KIKA 2AEHA 4FADA 2ZW1A 4ANWA 4HK2A 1SQCA 1JWUD 1DGJA 2NMQA 2RPQA 4IM2A 2IDYA 3V60A 3AH7A 2G9HD 4A9AA 5E6OA 4DXGA 3AULA 2E3TA 1H8CA 1I4HA 3VH3B 1WGDA 3GE8C 3BYYB 2KTRA 3QCAA 1KKTA 2MQJA 4DK5A 2JT4B 3D5SA 2BYEA 1OJNA 1TJEA 4II3B 2M1MA 2ZBLA 3MC8A 3N1YC 3L17A 2MJ3A 1NYRA 3WAPA 1C1YB 1AWDA 3O65B 3PHXB 1UGJA 4DOEA 1V81A 4S0RA 3ECIA 3O13A 3P1MA 1JCRB 1FBWA 1D5XC 1SE9A 4NNJB 4FXGB 2KC1A 1TS3A 4V1SA 1KFYB 5JPNB 3DBHB 4OVZA 3RT3B 2MLBA 1S64B 2CJOA 4YXDB 2OHFA 1TYGB 1D8EB 2D8LA 4YTPB 1AN8A 1QLBB 2SQCA 1NEKB 4WWMA 3CSTA 2REXA 1F2RI 2HD5B 3TEZA 4K3BA 5AGDA 3ZTDA 3CF6E 2FNJB 2PMVA 2MCNB 3UQAA 1WY8A 1XXGA 2WGSA 1S3SG 4KTPA 2N9PC 3P4SB 4ZYNA 2HE7A 2KMAA 2G4DB 1NI2A 2QCZA 1FNVA 3QARA 4FNVA 1JQ4A 4YSYB 1NXCA 3PSEB 2Q5WD 1FEHA 2ICIA 4E71A 4C7ZA 2BPSA 2LRUA 3MJWA 5CA3A 1UBIA 3GS2A 4M0WB 3M00A 1R4MB 4M00A 2BRVX 5CHWA 1FO2A 3SDQA 1WYGA 2WXHA 2ZCBA 1GB1A 3ANIA 1LO5D 4MBGB 3NS1A 1FPPB 4WQOB 1Z2MA 4G0NB 4D94A 2Y5CA 2VN4A 1WYWB 4JJJA 1OQYA 2G3QB 4B0EA 4B6WA 2MP2B 1Y56A 2FV1A 4LNFA 1GPXA 1SGHA 1QZEA 1KZPB 5EE0A 4BBNC 3NVZA 1N7PA 4K81A 1GSZA 2WXFA 4C4VA 1NVID 4XZ4A 4DXAB 1L2AA 2FBWB 1MG8A 1IUEA 3FAHA 2JJBA 2D3AA 3VUYA 1UF0A 4KGSA 4FBJB 4I6NB 2X03A 2J7QB 2O2VB 4BVUC 2QJLA 4HLEA 1F77A 1HN0A 3L10B 2BVCA 1KS8A 2N9XA 2LGIA 1ZUD2 2WDRB 5BYQA 4LDTD 1IPGA 4HEA1 1WXAA 3A4SC 5JZEB 1WGRA 3H8HA 4MGZE 4S17A 1JCKB 4HDQA 3QQ8B 3ZRFA 3X17A 2FBAA 2FAZA 3GZKA 1XO3A 3NY5A 2IO2B 3A9JB 2WXGA 4GDKA 5FR3A 3RZWC 1W3YA 1PGBA 2EMSA 1I42A 3Q2AC 4NY0A 4MGKE 3HK0A 3R7RA 1WU6A 5H8YE 3SFYB 1WX8A 1OJMA 5J17A 1OEYJ 1FBOA 2JG0A 2L3ZA 3Q7FB 2IZVB 1Z5SB 4OZVA 4TMAB 1WGGA 5L83A 2WLBA 2V3NA 1HM3A 5EE9A 4PS3A 2EACA 1XLOA 1P0RA 3N0FA 3AE7B 2PPHA 3QFYA 4WWOA 2WDQB 3DHGC 5DCNA 2G1EA 3DVNV 1WJ4A 1V7WA 1HXGA 5LLIA 1KOTA 1E8WA 3SFEB 2V0GA 2JF4A 4QAYA 1CZPA 4M0WA 3NVVA 2CHWA 2FCMA 4FXKB 3LYYA 3L0WB 2FCNA 3AN1A 1HQRD 3NUHB 2LEKA 3IAS1 2BRPA 4EUTA 3KLSX 3FC4A 1FXIA 3AE6B 1FAEA 1HZFA 4Q2JA 3T8MA 2N1WA 1UMPA 2KDMA 3MC9A 2DRSA 1STEA 3UIPB 5IM1A 3P4PB 2K3UA 2ZZRA 3KYDD 4ICUA 3AFLA 1C4AA 1HEZE 1V1PB 4GDKB 3HVDA 4GSWA 2MSED 1ET6A 3NVYA 4J3OD 1RWSA 3PMMA 2V4IB 1IA7A 1RRBA 1YX5B 1IGDA 4YCRA 2WXQA 4XWWA 1J0MA 2WU2B 1VD5A 1H35A 1UGMA 2CHZA 1SA4B 3PZ3B 1JMLA 1S63B 2KDBA 1CJEA 1LFDA 4WVAA 4WVCA 1BT0A 1P1AA 1P3QU 4C1SA 3N30A 3SHQA 4EE2A 3ZVVA 1NDDA 1KTKA 1G6JA 4KGTA 5IKAA 2KKCA 1WIAA 3CWIA 4G11A 4W9HA 3QIJA 1AGMA 3MJ5A 5C1ZA 1J19A 1WJNA 1H3CA 3M63B 3BZDB 3W5VB 4OZCA 5BMIA 3ML8A 4PK1A 1X1JA 3D3IA 1HXAA 3ZIMA 2XWBB 4P7IA 5JHAA 2VZKB 2GH4A 3DCGA 2BWFA 3VXWA 2GI9A 2AHGA 2KNBA 4ZYSA 3GP7A 2LMCA 3DBLI 3VXDA 2PE6B 2OKXA 3PRZA 4AYQA 1F2RC 1MZCB 5EAUA 2W54A 2D5JA 1HMWA 1TZOA 2MRPA 1D5MC 4MMIA 3WKHA 1TY2A 2WYNA 1OJOA 3ZJUA 1RQ5A 4WWNA 1SIJA 1GXOA 2Y3AA 2BYVE 2LWPA 5J2RA 3AMZA 4KKJA 4F7ZA 3PYAA 2YVCA 2R2LB 3PLUA 1H3AA 4FJYA 1SE2A 2DNFA 4TQ1A 2QSDA 3KLSA 3AEAB 4YSXB 3DBRB 3PS6A 1AYXA 3MC0B 2LGXA 3TMPB 3L4PA 2LZ6A 4NZLB 4FHJA 1O1TB 3AU5A 4A90A 3DQVA 2XK5B 2TSSA 1HM2A 2VZKD 4URKA 1TY0A 3VTUA 4FULA 3ZJVA 3DHHC 4BAXA 2K39A 3RNFC 3H1UA 1JWBD 3U8ZA 1FRRA 2BQQA 1JRPA 1RWGA 4IG7B 3JSVB 3VAWA 5GZKA 5D2MB 2RDBC 2MBQA 3APCA 3TF4A 4OHJA 1PFDA 4ANUA 2I38A 1N24A 3SEBA 1LXMA 3N9YC 1FXTB 2KFKB 1WX7A 2BKFA 2IO3B 2INCC 1JWAD 4HPMB 1UT9A 1KH0A 1W6JA 3ZO5B 5E2JA 1V5TA 3Q14C 4GTSB 2JYEA 2JY6A 3U4EG 1LGRA 3RX5A 2ASQA 1WR6E 4FJQA 1I7HA 2M19A 4GAXA 4LJOB 2QEJC 1CK1A 2CR5A 2DX5B 4K7SA 3A0OA 3TBLD 3RYTA 2N9LA 2JRIB 1LQBA 3NOBA 2O6VD 2L1AA 1XLQA 2JVCA 1ZP0B 1F9OA 3Q79B 4AWJA 1FCLA 4GTQB 1JCSB 5KHOA 2AYOB 1WU4A 2KT7A 4GTVB 2WXMA 3PZ2B 2RMMA 4BOSC 1VR9A 1NI3A 1DOGA 1N7OA 4N9F4 1JRUA 1AW7A 1J7BA 3U7DA 2RDHA 4MJSA 2YIKA 2N0SB 3VTWA 3E9SA 2DRQA 3ZNID 1EWCA 4PS7A 1FP3A 2P0VA 2LXCA 2EKIA 1JROA 2VH2A 1WGKA 4ANXA 2PW9A 2KX0A 4BOKA 4OK2A 2MW5A 4C80A 2FE8A 3E56A 2J0MA 1QILA 2BB5A 3BY4B 4W9LA 2RGFA 4GTRB 3R7QA 3EUB2 3Q69A 2AFAA 2PLPA 5D3DA 3WKGA 4WAFA 4GMVA 3U52E 3IVFA 1N20A 3PHWB 3AV8A 1PQSA 1N6ZA 4RCOA 2KANA 2KDIA 5G2NA 4AP4C 3ZQ4A 2WXRA 1AARA 1N1ZA 3M71A 4W9EA 1ZGUB 3Q3NC 2KHWB 2K8BA 2D11A 3BVGA 3PZ1B 3DSUB 2AX5A 2BYFA 2FIFA 1TS4A 2E6XA 4WIPA 1CQVA 1XLNA 1ZW7A 3EUVB 1HZ5A 3PTFC 4RM8A 2CKHB 1KLGD 1TS5A 1UWMA 2XFGA 2WQYB 3AEBB 5FR6A 4K1RB 4JQWC 3DSWB 3T33A 5EASA 2GMIC 1OEYA 2K0PA 2DZMA 2HJ8A 3K9PB 1PYWD 3S2AA 1L0VB 4CE7A 1C78A 1WXSA 3MP9A 5BYSA 4L1BA 1L5PA 4BKSD 2V3SA 3NNBA 3ZNZB 1ROEA 1H3BA 5GMVA 2XEWA 4JLCA 3M75A 1TZ1A 3M76A 2UU7A 2CJNA 1ISNA 3HRDD 3QX1A 4M8MA 1C4PA 3K11A 1MJDA 4ZRIA 5EE3A 4GOCA 4R3DA 2NTTA 2RGKA 4MH8A 3AB5A 1V7VA 1G9JA 2DYBA 1IYFA 2DRRA 4F13A 3VR8B 5AUKA 1GXMA 4LNNA 1XLPA 4XDDA 3TUOA 4WJQA 3DOWA 3W7WA 1O6RA 4ZHPA 4RGNA 1UBQA 1WXQA 5TR5A 4B9KA 2MBHA 2FUQA 1WF9A 3E34B 2FV0A 2WIIB 1FFVA 1V7XA 4NEIA 4KV2A 2XQWA 2MA9B 4DQOC 2AQ2B 4MU9A 2KAJA 1K51A 2MHJA 1L0XB 1V1OA 2GLSA 2KYWA 1SIFA 1SBBB 4LIXA 4XYCA 2RDGA 1VCBA 1S1QB 1IP9A 3PGEA 1E10A 5M7IA 3WANA 4FA6A 2V4LA 4KKIA 3SAEA 4FLHA 3VRAB 5D94A 2BRWA 4EZKA 2N7JA 2DAJA 4AJYB 4A3OA 4IDIA 5BO4B 1V80A 4CHKA 3DVGX 5HHDG 2LI5A 5MEHA 3PZDA 3WUXA 3R2TA 4F10A 2JSVX 2PE9A 4LLGM 3N3KB 4L0GA 1JWSD 5JMFA 2KMMA 3RRSA 1OQQA 1LXKA 3ZNGC 2LRWA 3DBLB 3MTNB 1DOYA 1OGWA 3DHIC 3A4RA 5I4DA 1IS9A 3V6CB 2ZPYA 2N7EA 3H6NA 3JVZX 3AEDB 1O79A 1A70A 3L16A 1TTNA 2H89B 1N23A 3WIRA 2WDVB 4DXFA 4TV3A 2H6GB 4OJZA 5IK9A 1XWQA 1LXDA 3AECB 2H6HB 1N5XA 3PPAA 3RX8A 1C82A 2KFKA 2NVPA 1N60A 4M76A 3DBRI 4JX1C 4OZAA 3KQ4A 3EC8A 3HHMA 4HRSA 3SDRA 1WE7A 5J18A 2RI8A 5H92C 4MM3A 4O1NA 1L6UA 4GTPB 2G4SA 2FUG1 3CSFA 3DPDA 1O5MB 2G02A 4W9CA 1XCTL 2SAKA 3OG5A 1D8DB 3OWEB 4I6PA 3AI5A 2J42A 3PREA 2NR2A 1Q5WB 2NTSA 5EE1A 3E7JA 3RENA 2L05A 1VDVA 2AQ3B 1X1HA 3SDLC 4EKUA 5CZLA 2K8HA 2KXJA 5G5HA 3DWMA 3Q3FA 2GBKA 4WQMA 3I63C 2DWQA 3HXEB 3W7UA 2ZPNA 1PGAA 3MHZA 3U7ZA 5DHKA 4KZCA 2M8SA 1FMIA 3P2CA 3AEGB 2QDFA 3ZRCA 2I2YA 1D6EC 4RGMA 5HG2A 4LDTB 3M73A 4ZRQA 2BS4B 4EFOA 4PYZA 5C05A 5C23A 1GLMA 2KVZA 4WJNA 1JWMD 1RFAA 2K22A 3RJ3A 5GY3A 3BK1A 2N9EB 2XBBC 3W5MA 4A55A 1IBXB 1XW2A 4E1YA 4UDUC 3DSSB 5FO9B 3TCAA 1HX9A 5ILHA 4FXCA 3B1LX 3NJTA 4ASWC 2WHIA 4WJPA 1P7EA 3DRAB 2IEJB 2DZJA 4M01A 1N7NA 3MHSD 4C00A 1N1BA 3S4DA 4LNKA 4HROA 1N62A 3D5RA 2EKEC 3W2DA 2WINB 2LXAA 1FXAA 1F9DA 2WX1A 2F0YB 3CIHA 1MPEA 2ONGA 4ZRKA 2LGDA 3V05A 3ALBA 3GE3C 2RD0A 1CB8A 1N21A 2W55A 2KACA 4L2YA 3QAQA 1WSPA 1G9GA 3H3KA 2LVOA 3RUIB 5CX3A 4H2AA 2KK8A 3M02A 2ZW0A 4N6EB 4OVUA 2EMTA 4RNQA 1V9JA 3QSPA 2WXLA 4NJCA 4OZBA 2JXXA 3N1XC 2O2VA 1N22A 3IT6B 4LK0M 3CMMB 5T8IA 1W6KA 1YD8U 1E9MA 5CHVC 1QQRA 2ZNVB 2YEPB 1MHHE 2NS5A 1YOVB 1J7AA 2WXPA 2KJHB 3KH0A 1T0SC 1O1SB 4KTRA 2DAFA 4XUVA 1J7CA 2K5PA 3DSTB 3ZJTA 3HUIA 2L0TA 3RX7A 1VJKA 3P2BA 3Q73B 1MI0A 2Z0EB 3P4RB 3Q6BA 2J5CA 3Q7AB 3TSSA 5IOIA 1FMAD 4WURA 3Q8EA 4MT5A 4US8A 4JGHB 2WX0A 1RYJA 5GW7A 4REZA 3N1ZC 1FD6A 2IGHA 3KVFB 4RNAA 2V8JA 2KWDA 2PN5A 4LJPB 4GTMB 3RNCC 5G55A 2ZCCA 2BGFA 3E32B 4D4CA 2CQTA 2G0DA 1O1RB 2ON8A 1RWAA 3RNEC 1H39A 5IL3A 5ILKA 4RM9A 3ZLZA 4HCPB 1X81B 4Z4LA 3RNGC 4JWUC 2KWUB 4W9FA 2RSUA 3KUDB 1V5OA 1N9AB 4MACA 2WU5B 4BOJA 3H7PA 1K50A 2BW2A 3VVWB 3AFJA 5ILDA 4IOIE 2M4NA 3QT3A 4E3CA 1NBFC 4OVVA 2HTME 5IP4D 2EADA 1J0NA 3Q3JA 4DHJD 1SJED 3VSMA 2UYZB 1N5WA 4XC2A 3RI7C 4AUQC 2KN5A 1HA5A 3PZ4B 3ZDMC 2JQRB 2KTRB 3RD2A 1G87A 4W9KA 4ANVA 3K7XA 2WNMA 3WC3A 1RFKA 2GBMA 1E8XA 1EGUA 1GG3A 1Y8RC 3QT9A 3N0GA 3ZKJC 4YDEB 4YL8A 3V62A 2JF5A 1L7YA 2C7MB 4MELA 3SD5A 2MX2A 3BINA 2QC8A 3W7SA 1WU5A 1WWTA 2WXKA 2BF8B 3Q75B 2BBCA 3ZXVA 4AQ7A 3AE1B 4ICVA 3QFZA 1KWFA 2WYQA 1SSNA 2GB1A 4MM3B 4LNBB 3IBEA 2VRRB 4BKSA 1RWCA 3H9DA 3NZ3A 1GAQB 2KLGA 2MJDA 3KWLA 2BTEA 1F0ZA 1I4RA 1UD7A 2A5UA 4AYPA 2KO3A 1VRAB 1I4XA 3WIWA 1WFYA 2D10A 2Z59B 2HDEA 4ONTA 4XGAB 2LGSA 1TS2A 2L52A 3W1SC 1LTXB 1FO3A 1OFFA 3AE9B 3M7EA 5G5GA 1F9JA 1SF0A 3GB1A 2WY8A 5C3JB 1E5WA 1ZXIA 2A4ZA 1WI0A 5ILYA 2PVGC 3TIXA 1NYQA 1TKEA 2WWZA 5FK9C 2MP2A 2PIAA 4YDOB 3LJ3A 3U30A 2Z0DB 4EZLA 3TL5A 3ABVB 2D3BA 5IKHA 3ENEA 1E8YA 2K6QA 1GC6A 3UINB 4US9A 1R4NB 3RPFC 1EO6A 2ACZB 3M3JA 3DVGY 3C8YA 3S9VA 1T0YA 3S4AA 2B76B 1ESFA 4TSSA 2VH1A 5JHBA 4NAWB 1HV6A 3SDVA 1FT2B 2GRIA 1F52A 3QA8A 1WH3A 3QXFA 4RF0A 1H13A 3W7TA 2EABA 4RH6A 2IGDA 1I8QA 2WY7A 2K6DB 1GAIA 4BKGA 1JW9D 4DDGD 2ZNVC 3JW0X 3PV1A 4LNIA 4YTNB 1NENB 4TKNA 3HXFB 1EU3A 4CJ0A 1KFGA 1QBQB 2NBVB 2D2QA 3TEWA 1KRHA 2WS3B 2ZVNA 4WU0A 3EU5B 3DPYB 2DZKA 3UIOB 5DPRA 3TEYA 2H6FB 1TNUB 1WX9A 4L23A 1TIFA 3TJPA 1SA5B 1I4PA 3BIID 1H37A 1FNUA 4NJ6A 1WMHA 4PYUA 2KVRA 3FILB 3QWZB 3ZUNA 1D3ZA 2F6DA 4K7WA 1QAZA 2OJRA 3M72A 2LJIA 4DHZE 1YQ3B 4ACFA 3WAOA 2AWTA 3PRMB 1VZ7A 4EOYA 4BBNF 1HCUA 2OOBB 4DHJB 1WJ6A 4OZWA 3G6JB 2DYOA 5TSSA 1WZ3A 2KMCA 4IM0A 1H36A 1PGXA 4GIVA 2V1YA 4LCDE 4BZAA 3HVZA 2WXNA 3A9KB 2J4XA 2BEDB 2NBWB 2W9NA 4MEMA 2IGGA 5DHIA 3WIMA 1RM6C 3SFXB 2L8JA 5DPSA 4KSKC 4BOZB 1LF9A 3EFUA 2IPKD 2DENB 3G4FA 4HWIB 5CHFA 4FJVB 1WXVA 2V8KA 5JXVA 1TN6B 2ZZPB 3PLVA 2HJ1A 4MGYE 4K3CA 2C5LC 5BMHA 2DYMA 3T9LA 2I1KA 4JE3B 1KM7A 2IO1B 5L95C 5KKBA 5C2TB 4X57B 4IUMB 1KSCA 1MFWA 2VN7A 2KN4A 2PEAA 3EQAA 2R2OA 2I07B 1KF6B 3SDTA 5IKCM 1EU4A 1FPYA 2AQ1B 3M62B 4ZDVA 1CLCA 3RZFA 1MG4A 2L83A 1R7SA 1K53A 1ULVA 2INNE 3RN9C 4G50A 3VDZA 2KD0A 1V2YA 3AM9A 3Q8BA 2WP9B 4NQKE 2ONHA 3VHTC 3Q78B 1GOZA 1EM7A 4HKQA 1WM2A 1J0GA 1V5CA 2NPTB 1H12A 1F1HA 3W9CB 3LB8C 1RW9A 1RWFA 1TNOB 2B4FA 4XWTA 1FFUA 5IN7A 3GOEA 1FRDA 3HIZA 2INPE 1SEBD 4I6LB 1YQBA 3APDA 1TGZB 4ARCA 1MHXA 3NRZA 2GOWA 2PTLA 2W82A 4FJZA 2IJ0A 4NJ7A 2D5GA 1A5RA 2N7DA 1GA2A 4P16A 4FN2A 1YJIA 1QF6A 3PT2B 1R4NI 1L4ZB 3VW5A 3NZSA 3H7SA 2IY0B 4RGOS 4HPLB 3E80A 1VLBA 3LXFA 1QT9A 2NVUI 3RMKC 1X1MA 3AE3B 1ZKHA 2GBNA 5M7YA 2NBUA 3EU8A 3KUCB 4CO7A 1N7QA 3IAM1 4ZOHC 3DSVB 1YIWA 3VH4B 4A8XC 3ON6A 1CEMA 5FOBB 3QC8B 4ZRPA 1T3QA 5DGRA 4IKGA 1I35A 2QNOA 3M7BA 1D4BA 1LD8B 1C76A 3B08A 1C3DA 3SQCA 4USAA 1K8RB 2FUHB 2JPHA 2MBOA 3RNBC 4W9GA 2CHXA 5LXHA 4WVBA 3FKYA 1H14A 3EGRA 2AHFA 4QT9A 4LNVA 1BUIC 1C77A 2GBJA 2KC2A 1KLVA 5LNK1 2LD9A 3PYBA 2YEPF 1V1PA 1VZ6A 2KQSA 5JMDA 3QK0A 4IC7B 2PVOD 2SEBD 2JZZA 2B3AA 1WM3A 1M4VA 4LTUA 3OLMD 3GZNB 2Y5PA 2Q1FA 3W5NA 3I3TB 4PT5A 4C4VB 1WRIA 3VSNA 3L54A 2MJEA 2LFIA 1QKZA 1XWTA 3P42A 4IWQA 4LNOA 3VR9B 3VTVA 2JZ3B 1T6BX 3M95A 1C3TA 1WZ0A 2HTHA 3KWVA 1KJTA 4KZ0A 4HJGE 1B1ZA 4EEWA 1ZDVA 4K7UA 1L4DB 1EUVB 2KFJA 2OJWA 2N1VA 5BYRA 1H4RA 2Z07A 1FM0D 3GT5A 1L1YA 1SE3A
chains in the Genus database with same CATH topology
1YN4A 4XE0A 3BVMA 1XF5L 4CQNA 2TSSA 2VZKD 3QSPA 2W3RA 2WXLA 4NJCA 4OZBA 4RF1A 5E6JA 1TY0A 3M7CA 3B2GA 4HKZE 3IT6B 4LK0M 3M77A 3BVZA 3ZJVA 4FUSA 4DODA 3Q8AA 3HXDB 1JWBD 5T8IA 1W6KA 4AYRA 2DROA 1E9MA 1FRRA 1JRPA 1QQRA 3AE4B 2YEPB 4TQ0A 1IGCA 1MHHE 1OQRA 1TKYA 1ZPSA 1J7AA 5GZKA 2WXPA 4LNGB 1XCQL 3T3NA 4TF4A 2JZPA 1BMLC 1UUPA 1ACCA 1NL4B 1E6EB 2ONQA 4GLSC 1O1SB 4KTRA 2K5PA 4XUVA 1J7CA 1L6VA 1N61A 3DSTB 1N4SB 1WZZA 3HUIA 3ZJTA 3TF4A 3RX7A 3P5PA 1VJKA 4OHJA 1DL2A 3Q73B 4TXTA 1MI0A 3P4RB 1PFDA 1NC5A 3Q7AB 3TSSA 1FMAD 3M7LA 3QG0A 2N9KA 4WURA 3Q8EA 2I38A 4MT5A 4US8A 1SE4A 1RYJA 5GW7A 3KSLB 3MFGA 3N9YC 4REZA 3SEBA 1FD6A 2IGHA 1P7FA 4RNAA 1KZOB 3WKIA 1HXYD 2V8JA 4N58A 2KWDA 4AYOA 2PN5A 4GTMB 2CQSA 3E73A 1C79A 1JWAD 1QOGA 1PDXA 1UT9A 4D4AA 1O6HA 1W6JA 3E32B 4D4CA 4L6XA 2CQTA 1FNWA 1KH0A 2G0DA 5E2JA 1MVKA 4ZHOA 1O1RB 2ON8A 4GTSB 2JYEA 3U4EG 1H39A 3SDUA 1DYQA 1TF4A 1T5XD 2WXIA 3RX5A 3T3OA 1X81B 3AE8B 1Q10A 4OW0A 1YN5A 4Z4LA 4ZH5A 1I7HA 2M19A 2QEJC 1CK1A 4JWUC 5FKAC 3DWGC 3QRYA 1LF6A 1ZXHA 2QILA 1DOXA 3PZ8A 1GXNA 1N9AB 4MACA 1TNZB 4GL3A 2LHDA 2N9LA 4BOJA 2WU5B 3AEEB 3BWUD 4C7YA 1K50A 2BW2A 3CU7A 2L1AA 3AFJA 1XLQA 3E30B 3R2IA 1QSJA 1ZP0B 4IOIE 3W1SA 1QOAA 1FCEA 2EAEA 3QT3A 1F9OA 3Q79B 1E7PB 1FCLA 4GTQB 1JCSB 1QQFA 2HTME 2EADA 1WU4A 2BYTA 1SJED 4GTVB 2WXMA 3PO0A 1N5WA 3PZ2B 2ZW1A 3IXSA 1XEEA 3QXQA 2RMMA 2FUZA 1SQCA 1JWUD 1DGJA 2NMQA 3P5RA 1HA5A 3PZ4B 1VR9A 3S4BA 2JQRB 2IDYA 1NI3A 1G87A 3AH7A 1DOGA 2G9HD 1YJJA 2WXOA 4A9AA 1B9RA 3K7XA 2WNMA 3WC3A 1AW7A 1RFKA 1J7BA 4DXGA 2RDHA 3A3VA 1ENFA 2YIKA 3QT9A 1HZ6A 2E3TA 2N0SB 1I4HA 3E9SA 2DRQA 4YDEB 1N94B 5HI1A 3BYYB 1O6QA 3CIRB 1KKTA 1EWCA 4XDCA 3D5SA 3I9V1 1KREA 3BK2A 1KRFA 1FP3A 2P0VA 3W7SA 1WU5A 1WWTA 1JROA 2EKIA 2LHEA 2WXKA 1TJEA 3Q75B 2BBCA 4AQ7A 3AE1B 1WGKA 2ZBLA 2PW9A 3WIQA 3QFZA 5AUIA 3VRBB 1KWFA 2MJ3A 1GB4A 1NYRA 1QOBA 1SSNA 2GB1A 4MM3B 1AWDA 4LNBB 3NZ3A 4BOKA 1GAQB 1UGJA 2JXTA 4DOEA 2MJDA 3KWLA 4C80A 2BTEA 2FE8A 3E56A 1F0ZA 3O13A 1I4RA 3P1MA 1QILA 2BB5A 1V5DA 1JCRB 1FBWA 3KSQB 1D5XC 4AYPA 1VRAB 5MPOA 1I4XA 3WIWA 4FXGB 4GTRB 1TS3A 2HDEA 4ONTA 2AFAA 3EUB2 4V1SA 1KFYB 1YMHE 2PLPA 3WKGA 3Q69A 4WAFA 5D3DA 5HFYA 5JPNB 3AE5B 4GTTB 4OVZA 3U52E 3V3XA 1TS2A 1N95B 1ZDXA 1S64B 2L52A 5FO7B 2CJOA 3AV8A 2ZIRB 1LTXB 2MEKA 2NOJA 4RCOA 1KSDA 2OHFA 1FO3A 1OFFA 1TYGB 1D8EB 2D8LA 3AE9B 3M7EA 1L0YB 4YTPB 5G5GA 3DSXB 1SF0A 1AN8A 3ZQ4A 3GB1A 5CD2A 1QLBB 2SQCA 1NEKB 2H88B 2WXRA 3E33B 2WY8A 3AE2B 3P63A 3PZ7A 4WWMA 5C3JB 1F2RI 1ZXIA 3M71A 3TEZA 5AGDA 2PVGC 5BMGA 4KX6B 1NYQA 1TKEA 5FK9C 1FCCC 2PIAA 3PZ1B 3BVGA 3DSUB 4YDOB 2AX5A 2PMVA 4YSZB 1TS4A 2A8ZA 2E6XA 4WIPA 3ABVB 1CQVA 1XLNA 1XXGA 3EUVB 1HZ5A 4KTPA 3P4SB 1KLGD 1TS5A 4US9A 3RPFC 1UWMA 1JS4A 1TNBB 2XFGA 2ACZB 2WQYB 3AEBB 3C8YA 3S9VA 3S4AA 2B76B 3DSWB 1ESFA 4TSSA 1FNVA 3T33A 2MJEA 1JQ4A 5GXGB 4YSYB 2K0PA 1NXCA 2Q5WD 1FEHA 3SDVA 1PYWD 1FT2B 2GRIA 2ICIA 4NAWB 1L0VB 5D7GA 1GHQA 3QPFA 4CE7A 4C7ZA 1C78A 3MP9A 5BYSA 4L1BA 3QXFA 1L5PA 4RF0A 1H13A 1UG9A 3W7TA 2EABA 5CA3A 2IGDA 4RH6A 2EELA 4D4DA 3WCQA 2WY7A 3GS2A 1FO4A 1GAIA 1KLUD 1JW9D 2J52A 1E0ZA 1YQ4B 2V3PA 1ROEA 1H3BA 1UWXA 3ZGZA 1FO2A 3SDQA 1WYGA 2WXHA 1GB1A 3M75A 3ANIA 3M76A 1LO5D 1YN3A 4MBGB 2KQ4X 1FPPB 3NS1A 4YTNB 2CJNA 1NENB 1K52A 3HRDD 3URYA 3HXFB 4D94A 2Y5CA 2VN4A 1EU3A 4CJ0A 1KFGA 1C4PA 1QBQB 3K11A 4JJJA 1VZ8A 4GDLB 3TEWA 3ACSA 1KRHA 2WS3B 4B0EA 4WU0A 3EU5B 3DPYB 5EE3A 1Y56A 4R3DA 1TKGA 3TEYA 2H6FB 1TNUB 2RI9A 3E37B 2NTTA 2FV1A 1SA5B 2RGKA 2R61A 4MH8A 4L23A 1GPXA 1I4PA 1ZOYB 3AB5A 1V7VA 1G9JA 1H37A 1FNUA 1KZPB 3BIID 5EE0A 4ARIA 3FILB 3ANKA 4J5TA 2DRRA 2F6DA 4NAMA 3NVZA 3VR8B 3M72A 2LJIA 5AUKA 1YQ3B 1GXMA 1GSZA 1XLPA 2WXFA 1NVID 1N4QB 1QOFA 4XDDA 3TUOA 1L2AA 2FBWB 2BS3B 3W7WA 1O6RA 1VZ7A 1IUEA 3FAHA 1HCUA 4ZHPA 1X9DA 2JJBA 3HXBB 1WXQA 4RGNA 2GOXA 3G6JB 2A73B 3E34B 2FV0A 2DYOA 1C9FA 3WKFA 5TSSA 2WIIB 1DCEB 1FFVA 1I4QA 1PUTA 1H36A 4KGSA 1N4PB 1V7XA 1PGXA 3I57A 2XQWA 4ZG8A 2QJLA 1F77A 4DQOC 2AQ2B 3HVZA 3EZ8A 1KS8A 2WXNA 2J4XA 2BEDB 4GTOB 2LGIA 3QWTA 4MU9A 2IGGA 1ZUD2 1K51A 1N4RB 3M78A 2KAJA 2WDRB 5BYQA 4B0MA 3C72B 1RM6C 2XN9C 4ITKA 1L0XB 1V1OA 4HEA1 3SFXB 3ETRA 4RFBA 3H8HA 3H2WA 4LIXA 1SBBB 2M0AA 2QMTA 1LF9A 2RDGA 1JCKB 4JPSA 1H54A 3X17A 2FBAA 1ZE3D 3GZKA 1XO3A 1E10A 3M74A 4EHMB 2BT6A 2IPKD 2WXGA 3AEFB 5M7IA 3VR9B 5FR3A 5D3IB 4A6QA 3P4QB 1PGBA 4RGTA 4KKIA 3SAEA 3VRAB 2BS2B 2V8KA 5JXVA 3B9JA 1TN6B 1DOIA 3Q8CA 3R8BA 2H6IB 2N7JA 3H7LA 1WU6A 2MH7A 5H8YE 3U2SC 1G6IA 4JWSC 3SFYB 5BMHA 2DYMA 4IDIA 5HHDG 1FBOA 2JG0A 5DGQA 3Q7FB 5MEHA 3GLYA 3WUXA 4JE3B 3R2TA 4TMAB 2JSVX 4P6VF 4YWGG 5KKBA 2WLBA 2M56B 2V3NA 4LLGM 5C2TB 1KSCA 4L0GA 2VN7A 1JWSD 5EE9A 2KMMA 2KN4A 3RRSA 3EQAA 1OQQA 1D5ZC 2EACA 2I07B 3SDTA 1KF6B 1XLOA 1EU4A 2DLBA 2AQ1B 3AE7B 3QFYA 1DOYA 2WDQB 1CLCA 2PKOA 5I4DA 5FO8B 1EWYC 1IS9A 2L83A 1R7SA 2DBYA 3ANJA 1K53A 2G1EA 1ULVA 2INNE 4AS1A 1V7WA 1TNYB 3AEDB 1O79A 1A70A 3AM9A 3Q8BA 4C56C 2WP9B 3HXCB 1BXTA 2H89B 3EA6A 3SFEB 2RPVA 2V0GA 2JF4A 4EL8A 3WIRA 1CZPA 4M0WA 3NVVA 2WDVB 4DXFA 3Q78B 4ZH1A 4L9PB 4FXKB 1EM7A 1GOZA 2K9XA 3J9CA 3LYYA 4YTMB 4HKQA 2H6GB 3AECB 1XWQA 3AN1A 1V5CA 3RSYA 1HQRD 1JCQB 1H12A 2H6HB 1N5XA 3RX8A 2JYTA 2LEKA 3FILA 3NUHB 1TN8B 2X38A 3IAS1 2NVPA 1N60A 4M76A 3W9CB 3KLSX 1SXTA 3LB8C 4JX1C 2JWUA 4OZAA 3KQ4A 1TNOB 2B4FA 1ET9A 3SDRA 1FXIA 3AE6B 3FC4A 4HRSA 4XWTA 1FFUA 1N63A 1FAEA 1HZFA 3W7XA 2RI8A 4Q2JA 5H92C 4O1NA 1UMPA 1FRDA 4GTPB 1L6UA 2INPE 3BYTB 2KDMA 1V8CA 2DRSA 2FUG1 1STEA 3IT4B 1SEBD 3P4PB 2K3UA 3OEDA 2ZZRA 4ARCA 1C4AA 1HEZE 1MHXA 1O5MB 2G02A 2JU6X 3NRZA 2PTLA 2W82A 1V1PB 4Z4JA 2IJ0A 1XCTL 3HVDA 4GDKB 2SAKA 4CJ1A 1K72A 1D8DB 3OWEB 1AYFA 1JALA 1ET6A 2D5GA 2J53A 3NVYA 1GA2A 2J42A 4P16A 4J3OD 1IA6A 1YJIA 1RWSA 2NTSA 5EE1A 3PMMA 1QF6A 2V4IB 3RENA 1L4ZB 2B39A 3VW5A 1VDVA 1IA7A 1UNSA 4RGOS 1IGDA 2AQ3B 5CZLA 3S4CA 1VLBA 3LXFA 4YCRA 1QT9A 2WXQA 3ZYYX 3AE3B 1SB3C 4XWWA 5G5HA 3DWMA 2WU2B 5M7YA 1VD5A 1H35A 4WQMA 1I4GA 4D2KA 3EU8A 2DWQA 1SA4B 3HXEB 3PZ3B 1JMLA 3W7UA 1S63B 1CJEA 1FIQA 3DSVB 4WVAA 3IAM1 4WVCA 4ZOHC 1PGAA 3MHZA 3U7ZA 4A8XC 1FMIA 1CEMA 3ON6A 3P2CA 3OXUA 4ZRPA 5FOBB 4C1SA 1D6EC 5DGRA 1T3QA 3AEGB 4RGMA 2I2YA 4IKGA 2V8IA 1NI1B 2QNOA 3M7BA 3B2FA 1LD8B 5HG2A 3TEXA 4EE2A 1D4BA 4V1RA 1C76A 1KTKA 3M73A 4KGTA 1C3DA 2L32A 4ZRQA 1SJHD 3SQCA 2BS4B 4USAA 3W5UB 2BB6A 3CWIA 1AGMA 3MJ5A 1GLMA 3E6UA 1H3CA 4WVBA 3NVWA 3BZDB 1JWMD 1H14A 2K22A 3RJ3A 3EGRA 3W5VB 2AHFA 4OZCA 5BMIA 4QT9A 4LNVA 1BUIC 1C77A 1TN7B 5GY3A 4N59A 5LNK1 3PYBA 2YEPF 3BK1A 4A55A 3D3IA 3W5MA 1V1PA 2XWBB 1VZ6A 1IBXB 1XW2A 4KGRA 2VZKB 4UDUC 2GH4A 2QIEB 3DSSB 5FO9B 2GI9A 2AHGA 2PVOD 3Q8FA 2SEBD 4FXCA 4Q2BA 2XWJB 4ZYSA 3GP7A 2W3SA 4Q88A 1P7EA 3DRAB 2IEJB 1M4VA 2LMCA 4LTUA 3VXDA 1IBXA 2Y5PA 5JPMB 2OKXA 3W5NA 4PT5A 1WRIA 1GAHA 4AYQA 1F2RC 2LFIA 1MZCB 1TZOA 2D5JA 3S4DA 1QKZA 1XWTA 2CU3A 1V97A 1D5MC 2W54A 3WKHA 1R76A 1TY2A 1C4CA 4HROA 1N62A 3P42A 3D5RA 2WYNA 3W2DA 3ZJUA 2WINB 1RQ5A 1LD7B 2Z8LA 1SIJA 1FXAA 1GXOA 2JX5A 1F9DA 2F0YB 2Y3AA 3CIHA 4YT0B 3ACTA 2GZ6A 3AMZA 4KKJA 1MPEA 3UI3A 3PYAA 2LUMA 2R2LB 3V05A 1H3AA 1T6BX 4WH4A 1SE2A 3RFZB 4TQ1A 2WXJA 2XNAC 2W55A 3VQIA 2KACA 4L2YA 2QSDA 3KLSA 3AEAB 3KWVA 3QDEA 1WSPA 1G9GA 3H3KA 4YSXB 4HJGE 1B1ZA 1AYXA 3MC0B 2ZISB 3SR6A 2OEDA 1ZDVA 1L4DB 4H2AA 3L4PA 1YNTE 4NZLB 5BYRA 3SFDB 1O1TB 2ZW0A 1FT1B 2Z07A 1FM0D 4N6EB 3GT5A 1L1YA 4A90A 4YXDB 4D4BA 1SE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6R A;  1O5M B;  2G02 A;  3HXB B;  2GOX A;  3G6J B;  2A73 B;  4LNB B;  1D8D B;  3E34 B;  3HXD B;  4BOK A;  1W6K A;  2WII B;  1DCE B;  1H36 A;  1N4P B;  2BB5 A;  2B39 A;  1JCR B;  2XQW A;  3KSQ B;  4FXG B;  4LNG B;  4GTR B;  4ONT A;  2BED B;  4GTO B;  4V1S A;  1NL4 B;  4MU9 A;  5JPN B;  4GTT B;  1O1S B;  1N4R B;  3DST B;  3C72 B;  1N95 B;  1N4S B;  1S64 B;  5FO7 B;  1H35 A;  2ZIR B;  1LTX B;  3SFX B;  2NOJ A;  1D8E B;  3Q73 B;  1SA4 B;  3HXE B;  3DSX B;  3PZ3 B;  1S63 B;  3Q7A B;  3DSV B;  2SQC A;  3E33 B;  2WY8 A;  3U7Z A;  5FOB B;  3OXU A;  4ZRP A;  5AGD A;  4C1S A;  4EHM B;  2V8I A;  1NI1 B;  3KSL B;  1LD8 B;  4KKI A;  3PZ1 B;  4V1R A;  1KZO B;  2V8K A;  3DSU B;  2V8J A;  4YDO B;  1C3D A;  2PMV A;  4ZRQ A;  1TN6 B;  2PN5 A;  3SQC A;  4GTM B;  2BB6 A;  2H6I B;  3EUV B;  4D4A A;  1O6H A;  1W6J A;  3E32 B;  4D4C A;  2G0D A;  3SFY B;  1O1R B;  1TNB B;  4GTS B;  1H3C A;  1H39 A;  3Q7F B;  3DSW B;  1X81 B;  3RJ3 A;  4LNV A;  1TN7 B;  1FT2 B;  2V3N A;  1GHQ A;  2XWB B;  2I07 B;  3DSS B;  5FO9 B;  1GXN A;  1N9A B;  4D4D A;  2WY7 A;  1TNZ B;  4BOJ A;  2XWJ B;  5FO8 B;  3CU7 A;  3E30 B;  3DRA B;  1QSJ A;  2IEJ B;  2V3P A;  5JPM B;  1TNY B;  3Q79 B;  1H3B A;  1O79 A;  4GTQ B;  1JCS B;  1QQF A;  1MZC B;  3HXC B;  4MBG B;  1FPP B;  4GTV B;  1R76 A;  3PZ2 B;  3D5R A;  2WIN B;  3HXF B;  1LD7 B;  1SQC A;  3Q78 B;  4FXK B;  1GXO A;  4L9P B;  2F0Y B;  3PZ4 B;  4D94 A;  1QBQ B;  4ZH1 A;  2H6G B;  4KKJ A;  1JCQ B;  2H6H B;  2R2L B;  3K7X A;  1H3A A;  3EU5 B;  3DPY B;  1TN8 B;  4M76 A;  2H6F B;  1TNU B;  4YDE B;  1N94 B;  3E37 B;  1SA5 B;  3KLS A;  3KQ4 A;  1TNO B;  1H37 A;  1O6Q A;  1KZP B;  2ZIS B;  3D5S A;  1HZF A;  1UMP A;  4GTP B;  1GXM A;  1GSZ A;  1O1T B;  1FT1 B;  1N4Q B;  3Q75 B;  2BBC A;  3OED A;  4D4B A; 
#chains in the Genus database with same CATH topology
 1XF5 L;  2KWC A;  4RF1 A;  5E6J A;  3EHV A;  4IWO A;  5JH5 C;  4HKZ E;  3B2G A;  3M77 A;  4DOD A;  3HXD B;  2IBI B;  3EEC A;  1WR1 A;  1RLF A;  2UWQ A;  3ZNH B;  1IGC A;  2J0K A;  1OQR A;  1ZPS A;  2DHZ A;  1XCQ L;  3RUL A;  2JZP A;  2LGY A;  1N61 A;  1GNU A;  2G45 B;  3Q3M C;  3P5P A;  1E90 A;  3D32 A;  4HCN B;  5IK0 A;  4DI5 A;  3OJ4 B;  4NPN A;  3QG0 A;  2N9K A;  5E6N A;  4GU2 A;  1SE4 A;  3MFG A;  2Y5B B;  2LVQ A;  1KZO B;  3WKI A;  3V6E B;  4AYO A;  2L0F A;  5HKH A;  3E73 A;  4MDK E;  1QOG A;  4D4A A;  1O6H A;  2JRH A;  1FNW A;  4ZHO A;  3RCZ A;  1LM8 B;  3ZTC A;  3SDU A;  2K25 A;  1TF4 A;  1T5X D;  2WXI A;  3T3O A;  2KJR A;  3AE8 B;  3K9O B;  4OW0 A;  4ZH5 A;  1HTO A;  2KOX A;  2LJ5 A;  1ZXH A;  2QIL A;  1DOX A;  2LHD A;  3AEE B;  4MSM B;  4C7Y A;  2ZEQ A;  3WAM A;  1QOA A;  4P1C C;  1E7P B;  4G3X B;  2KTF A;  3OAW A;  2BYT A;  3PO0 A;  3PVL A;  1V6E A;  3IXS A;  1XEE A;  3QXQ A;  5ILZ A;  3UF8 A;  2FUZ A;  3P5R A;  2WCO A;  3L08 A;  3S4B A;  1UZX B;  1B9R A;  1YJJ A;  2WXO A;  5AZF A;  3A3V A;  1ENF A;  3EFC A;  5LXI B;  1HZ6 A;  3ZW3 A;  3NZU A;  1N94 B;  5HI1 A;  1O6Q A;  3CIR B;  1XQQ A;  2NPT A;  4XDC A;  3I9V 1;  4II2 B;  1KRE A;  3BK2 A;  1KRF A;  3ML9 A;  4DWF A;  2WDA A;  2LHE A;  1E8Z A;  2PJH A;  3WIQ A;  5AUI A;  3VRB B;  1GJZ A;  1GB4 A;  1QOB A;  3WA0 A;  4DHZ B;  2IYD B;  3ZDT A;  3A9K A;  2D07 B;  2C9W B;  2JXT A;  1VD2 A;  2BKR B;  4MJS B;  1V5D A;  1WJU A;  3KSQ B;  5MPO A;  4BKT A;  1YMH E;  2KQ7 A;  1GC7 A;  3UGB B;  3VFK A;  5HFY A;  3AE5 B;  4GTT B;  5KHQ A;  4RMA A;  3V3X A;  3SU8 X;  1N95 B;  1ZDX A;  5FO7 B;  1HTQ A;  2ZIR B;  2MEK A;  3ZYY X;  2NOJ A;  1EF5 A;  1KSD A;  4A20 A;  1L0Y B;  2M17 A;  3DSX B;  1T0Q C;  1E7V A;  5CD2 A;  2H88 B;  3E33 B;  3AE2 B;  3P63 A;  3PZ7 A;  2GBR A;  4TUU A;  4M8N A;  3GZN I;  3QJZ A;  5BMG A;  1OJP A;  4KX6 B;  5CTR C;  1M94 A;  1FCC C;  4A3P A;  3NHE B;  4YSZ B;  2A8Z A;  2KJ6 A;  2KX3 A;  1JS4 A;  1TNB B;  4HJK A;  2NCN A;  2IO0 B;  5GXG B;  5AEK B;  5D7G A;  1GHQ A;  1RWH A;  3QPF A;  5AZG A;  1UG9 A;  2EEL A;  4D4D A;  3WCQ A;  1FO4 A;  1KLU D;  2J52 A;  1E0Z A;  1YQ4 B;  2V3P A;  4EZJ A;  1UWX A;  2R2Q A;  1HMU A;  3ZGZ A;  1TT5 B;  3C19 A;  3N32 A;  4KVG B;  1YN3 A;  2KQ4 X;  2V9H A;  4OK4 A;  2RR9 A;  2KZR A;  4IM3 A;  1K52 A;  3URY A;  1VZ8 A;  2FID A;  4GDL B;  1WMH B;  3ACS A;  3LDZ E;  2C60 A;  3JSV A;  1YJ1 A;  1TKG A;  2RI9 A;  3E37 B;  2AL6 A;  2R61 A;  4MGI E;  1ZOY B;  4ARI A;  4HDO A;  3ANK A;  4J5T A;  2ZVO A;  4NAM A;  3WAL A;  4HPP A;  2AL3 A;  1N4Q B;  1QOF A;  3QHT A;  4P1B C;  5EDS A;  5ILI A;  2BS3 B;  2O6V A;  1X9D A;  3HXB B;  2ZJD A;  4WAA A;  2GOX A;  1L2N A;  2A73 B;  1UEL A;  4AOF A;  1C9F A;  3WKF A;  4GGQ A;  1I4Q A;  1DCE B;  1PUT A;  2K1F A;  3R3M A;  3X0W A;  1N4P B;  2O6V B;  3I57 A;  4ZG8 A;  1N7R A;  3EZ8 A;  4GTO B;  2FUT A;  3QWT A;  1TBE A;  1N4R B;  3M78 A;  1XT9 B;  1GUA B;  3RNA C;  4B0M A;  3C72 B;  2XN9 C;  4ITK A;  2KWV B;  3ETR A;  1OTR B;  2N4F A;  4RFB A;  4HXD A;  3A1Q B;  3H2W A;  2M0A A;  4KDI C;  1WE6 A;  2QMT A;  4JPS A;  4ZRJ A;  1H54 A;  1ZE3 D;  3ZXR A;  3M74 A;  4EHM B;  2BT6 A;  3AEF B;  4KDL B;  2C7N B;  5D3I B;  3A33 B;  4A6Q A;  3P4Q B;  1F1S A;  4RGT A;  2I1J A;  2DZI A;  2BS2 B;  4MH0 E;  2L76 A;  5E6P A;  2JWZ A;  3B9J A;  4F8C B;  1DOI A;  3Q8C A;  3R8B A;  2H6I B;  3H7L A;  1R4M I;  2MH7 A;  3U2S C;  1G6I A;  4JWS C;  4W9D A;  5DGQ A;  3KYC D;  3GLY A;  4P6V F;  4YWG G;  2M56 B;  2L7R A;  3NFV A;  5IO9 A;  3NG0 A;  1D5Z C;  2DLB A;  1XD3 B;  3A9J A;  2PKO A;  5FO8 B;  1EWY C;  2DBY A;  3ANJ A;  4AS1 A;  1J8C A;  3KW5 B;  3APF A;  1TNY B;  4C56 C;  3HXC B;  1BXT A;  3EA6 A;  4WWP A;  2RPV A;  4EL8 A;  3R66 C;  2WDT B;  3AU4 A;  4ZH1 A;  4L9P B;  2K9X A;  4YTM B;  3J9C A;  5EAT A;  3RSY A;  2M0X A;  1JCQ B;  3IHP C;  2JYT A;  3FIL A;  1TN8 B;  2X38 A;  1SXT A;  2JWU A;  2LUE A;  4IWP A;  1ET9 A;  4W9J A;  3I5J C;  2XK5 A;  1N63 A;  3UQB A;  3W7X A;  2IND C;  3BYT B;  4CYE A;  1WRD B;  1V8C A;  4E74 A;  2CS4 A;  3IT4 B;  4HVB A;  3OED A;  5D6J B;  2LVP A;  2JU6 X;  2KDF B;  4IW0 A;  4Z4J A;  2FCS A;  3DDC B;  4CJ1 A;  1K72 A;  3HM3 A;  4MMH A;  1AYF A;  1JAL A;  3KUZ A;  2J53 A;  3N20 C;  2C7H A;  3H7P B;  2MWS B;  1IA6 A;  5DPW A;  2MBB B;  4JIO U;  2B39 A;  4KSL C;  1UNS A;  3Q3O C;  3S4C A;  2FCQ A;  3AXC A;  3IFW B;  5ILJ A;  1SB3 C;  3DVN U;  3G4D A;  4MSQ B;  5IK6 A;  1I4G A;  2YLM A;  3JYU A;  4D2K A;  4B95 A;  4DBG A;  1FIQ A;  1YX6 B;  3OXU A;  2V8I A;  1NI1 B;  3B2F A;  3TEX A;  3C0R B;  4V1R A;  2L00 B;  2L32 A;  1SJH D;  3W5U B;  2BB6 A;  3E6U A;  1U4A A;  3ONS A;  3NVW A;  1LOH A;  1V49 A;  3DBH I;  4N59 A;  1TN7 B;  5IA7 A;  4GXB A;  3IG3 A;  1P9D U;  2D3C A;  4KGR A;  1WGY A;  2QIE B;  3NS8 A;  3Q8F A;  4NQL B;  4Q2B A;  2XWJ B;  2W3S A;  1V86 A;  4Q88 A;  2BWE S;  3HM6 X;  1IBX A;  2K8C A;  5JPM B;  3V61 A;  1Q1O A;  2JUO A;  1GAH A;  2CU3 A;  1V97 A;  1R76 A;  1C4C A;  4JL9 A;  2Z8L A;  1RAX A;  1LD7 B;  2JX5 A;  4YT0 B;  3M01 A;  3ACT A;  2GZ6 A;  3UI3 A;  2LUM A;  2E22 A;  4WH4 A;  3RFZ B;  2WXJ A;  2XNA C;  3VQI A;  2J0J A;  3QDE A;  5AZH A;  2KDE B;  2ZIS B;  3SR6 A;  2OED A;  3VUX A;  1HXC A;  1YNT E;  3SFD B;  1FT1 B;  1WGH A;  4D4B A;  2LAS A;  1YN4 A;  4XE0 A;  3BVM A;  3PRP B;  4PS8 A;  2KLC A;  4CQN A;  2W3R A;  3VUW A;  1P98 A;  3M7C A;  1UH6 A;  3BVZ A;  4FUS A;  4M02 A;  3Q8A A;  4AYR A;  2DRO A;  3AE4 B;  4TQ0 A;  2E24 A;  1TKY A;  4GN1 A;  4LNG B;  3T3N A;  4TF4 A;  1BML C;  1UUP A;  4AJW A;  1ACC A;  1NL4 B;  1E6E B;  2ONQ A;  3L13 A;  4GLS C;  4DDI D;  1L6V A;  4WJO A;  1N4S B;  1WZZ A;  1E7U A;  4KIK B;  1DL2 A;  4TXT A;  1X1I A;  3B0A A;  1NC5 A;  4XX5 A;  3W1Y A;  3LZ9 A;  1HE8 A;  2QHO A;  3M7L A;  2CU1 A;  2X8X X;  4GDL A;  3A1Q A;  3KSL B;  4F1S A;  4J6I A;  1P7F A;  1HXY D;  5IL8 A;  4N58 A;  2CQS A;  1C79 A;  1PDX A;  3OJ3 A;  4L6X A;  1MVK A;  5IAA C;  1DYQ A;  4W9I A;  1Q10 A;  1YN5 A;  4BFR A;  4FHK A;  5FKA C;  3DWG C;  3QRY A;  1LF6 A;  2D3G A;  1WXM A;  2MBE A;  1GXN A;  3PZ8 A;  3X23 A;  1TNZ B;  4GL3 A;  3BWU D;  4GB9 A;  5DPT A;  4NAW A;  3CU7 A;  1EF1 A;  3E30 B;  1T0R C;  1QSJ A;  1CMX B;  1F9G A;  1Q0W B;  3R2I A;  3W1S A;  1FCE A;  2EAE A;  2IY1 B;  3DBS A;  1QQF A;  4KIK A;  2AEH A;  4FAD A;  2ZW1 A;  4ANW A;  4HK2 A;  1SQC A;  1JWU D;  1DGJ A;  2NMQ A;  2RPQ A;  4IM2 A;  2IDY A;  3V60 A;  3AH7 A;  2G9H D;  4A9A A;  5E6O A;  4DXG A;  3AUL A;  2E3T A;  1H8C A;  1I4H A;  3VH3 B;  1WGD A;  3GE8 C;  3BYY B;  2KTR A;  3QCA A;  1KKT A;  2MQJ A;  4DK5 A;  2JT4 B;  3D5S A;  2BYE A;  1OJN A;  1TJE A;  4II3 B;  2M1M A;  2ZBL A;  3MC8 A;  3N1Y C;  3L17 A;  2MJ3 A;  1NYR A;  3WAP A;  1C1Y B;  1AWD A;  3O65 B;  3PHX B;  1UGJ A;  4DOE A;  1V81 A;  4S0R A;  3ECI A;  3O13 A;  3P1M A;  1JCR B;  1FBW A;  1D5X C;  1SE9 A;  4NNJ B;  4FXG B;  2KC1 A;  1TS3 A;  4V1S A;  1KFY B;  5JPN B;  3DBH B;  4OVZ A;  3RT3 B;  2MLB A;  1S64 B;  2CJO A;  4YXD B;  2OHF A;  1TYG B;  1D8E B;  2D8L A;  4YTP B;  1AN8 A;  1QLB B;  2SQC A;  1NEK B;  4WWM A;  3CST A;  2REX A;  1F2R I;  2HD5 B;  3TEZ A;  4K3B A;  5AGD A;  3ZTD A;  3CF6 E;  2FNJ B;  2PMV A;  2MCN B;  3UQA A;  1WY8 A;  1XXG A;  2WGS A;  1S3S G;  4KTP A;  2N9P C;  3P4S B;  4ZYN A;  2HE7 A;  2KMA A;  2G4D B;  1NI2 A;  2QCZ A;  1FNV A;  3QAR A;  4FNV A;  1JQ4 A;  4YSY B;  1NXC A;  3PSE B;  2Q5W D;  1FEH A;  2ICI A;  4E71 A;  4C7Z A;  2BPS A;  2LRU A;  3MJW A;  5CA3 A;  1UBI A;  3GS2 A;  4M0W B;  3M00 A;  1R4M B;  4M00 A;  2BRV X;  5CHW A;  1FO2 A;  3SDQ A;  1WYG A;  2WXH A;  2ZCB A;  1GB1 A;  3ANI A;  1LO5 D;  4MBG B;  3NS1 A;  1FPP B;  4WQO B;  1Z2M A;  4G0N B;  4D94 A;  2Y5C A;  2VN4 A;  1WYW B;  4JJJ A;  1OQY A;  2G3Q B;  4B0E A;  4B6W A;  2MP2 B;  1Y56 A;  2FV1 A;  4LNF A;  1GPX A;  1SGH A;  1QZE A;  1KZP B;  5EE0 A;  4BBN C;  3NVZ A;  1N7P A;  4K81 A;  1GSZ A;  2WXF A;  4C4V A;  1NVI D;  4XZ4 A;  4DXA B;  1L2A A;  2FBW B;  1MG8 A;  1IUE A;  3FAH A;  2JJB A;  2D3A A;  3VUY A;  1UF0 A;  4KGS A;  4FBJ B;  4I6N B;  2X03 A;  2J7Q B;  2O2V B;  4BVU C;  2QJL A;  4HLE A;  1F77 A;  1HN0 A;  3L10 B;  2BVC A;  1KS8 A;  2N9X A;  2LGI A;  1ZUD 2;  2WDR B;  5BYQ A;  4LDT D;  1IPG A;  4HEA 1;  1WXA A;  3A4S C;  5JZE B;  1WGR A;  3H8H A;  4MGZ E;  4S17 A;  1JCK B;  4HDQ A;  3QQ8 B;  3ZRF A;  3X17 A;  2FBA A;  2FAZ A;  3GZK A;  1XO3 A;  3NY5 A;  2IO2 B;  3A9J B;  2WXG A;  4GDK A;  5FR3 A;  3RZW C;  1W3Y A;  1PGB A;  2EMS A;  1I42 A;  3Q2A C;  4NY0 A;  4MGK E;  3HK0 A;  3R7R A;  1WU6 A;  5H8Y E;  3SFY B;  1WX8 A;  1OJM A;  5J17 A;  1OEY J;  1FBO A;  2JG0 A;  2L3Z A;  3Q7F B;  2IZV B;  1Z5S B;  4OZV A;  4TMA B;  1WGG A;  5L83 A;  2WLB A;  2V3N A;  1HM3 A;  5EE9 A;  4PS3 A;  2EAC A;  1XLO A;  1P0R A;  3N0F A;  3AE7 B;  2PPH A;  3QFY A;  4WWO A;  2WDQ B;  3DHG C;  5DCN A;  2G1E A;  3DVN V;  1WJ4 A;  1V7W A;  1HXG A;  5LLI A;  1KOT A;  1E8W A;  3SFE B;  2V0G A;  2JF4 A;  4QAY A;  1CZP A;  4M0W A;  3NVV A;  2CHW A;  2FCM A;  4FXK B;  3LYY A;  3L0W B;  2FCN A;  3AN1 A;  1HQR D;  3NUH B;  2LEK A;  3IAS 1;  2BRP A;  4EUT A;  3KLS X;  3FC4 A;  1FXI A;  3AE6 B;  1FAE A;  1HZF A;  4Q2J A;  3T8M A;  2N1W A;  1UMP A;  2KDM A;  3MC9 A;  2DRS A;  1STE A;  3UIP B;  5IM1 A;  3P4P B;  2K3U A;  2ZZR A;  3KYD D;  4ICU A;  3AFL A;  1C4A A;  1HEZ E;  1V1P B;  4GDK B;  3HVD A;  4GSW A;  2MSE D;  1ET6 A;  3NVY A;  4J3O D;  1RWS A;  3PMM A;  2V4I B;  1IA7 A;  1RRB A;  1YX5 B;  1IGD A;  4YCR A;  2WXQ A;  4XWW A;  1J0M A;  2WU2 B;  1VD5 A;  1H35 A;  1UGM A;  2CHZ A;  1SA4 B;  3PZ3 B;  1JML A;  1S63 B;  2KDB A;  1CJE A;  1LFD A;  4WVA A;  4WVC A;  1BT0 A;  1P1A A;  1P3Q U;  4C1S A;  3N30 A;  3SHQ A;  4EE2 A;  3ZVV A;  1NDD A;  1KTK A;  1G6J A;  4KGT A;  5IKA A;  2KKC A;  1WIA A;  3CWI A;  4G11 A;  4W9H A;  3QIJ A;  1AGM A;  3MJ5 A;  5C1Z A;  1J19 A;  1WJN A;  1H3C A;  3M63 B;  3BZD B;  3W5V B;  4OZC A;  5BMI A;  3ML8 A;  4PK1 A;  1X1J A;  3D3I A;  1HXA A;  3ZIM A;  2XWB B;  4P7I A;  5JHA A;  2VZK B;  2GH4 A;  3DCG A;  2BWF A;  3VXW A;  2GI9 A;  2AHG A;  2KNB A;  4ZYS A;  3GP7 A;  2LMC A;  3DBL I;  3VXD A;  2PE6 B;  2OKX A;  3PRZ A;  4AYQ A;  1F2R C;  1MZC B;  5EAU A;  2W54 A;  2D5J A;  1HMW A;  1TZO A;  2MRP A;  1D5M C;  4MMI A;  3WKH A;  1TY2 A;  2WYN A;  1OJO A;  3ZJU A;  1RQ5 A;  4WWN A;  1SIJ A;  1GXO A;  2Y3A A;  2BYV E;  2LWP A;  5J2R A;  3AMZ A;  4KKJ A;  4F7Z A;  3PYA A;  2YVC A;  2R2L B;  3PLU A;  1H3A A;  4FJY A;  1SE2 A;  2DNF A;  4TQ1 A;  2QSD A;  3KLS A;  3AEA B;  4YSX B;  3DBR B;  3PS6 A;  1AYX A;  3MC0 B;  2LGX A;  3TMP B;  3L4P A;  2LZ6 A;  4NZL B;  4FHJ A;  1O1T B;  3AU5 A;  4A90 A;  3DQV A;  2XK5 B;  2TSS A;  1HM2 A;  2VZK D;  4URK A;  1TY0 A;  3VTU A;  4FUL A;  3ZJV A;  3DHH C;  4BAX A;  2K39 A;  3RNF C;  3H1U A;  1JWB D;  3U8Z A;  1FRR A;  2BQQ A;  1JRP A;  1RWG A;  4IG7 B;  3JSV B;  3VAW A;  5GZK A;  5D2M B;  2RDB C;  2MBQ A;  3APC A;  3TF4 A;  4OHJ A;  1PFD A;  4ANU A;  2I38 A;  1N24 A;  3SEB A;  1LXM A;  3N9Y C;  1FXT B;  2KFK B;  1WX7 A;  2BKF A;  2IO3 B;  2INC C;  1JWA D;  4HPM B;  1UT9 A;  1KH0 A;  1W6J A;  3ZO5 B;  5E2J A;  1V5T A;  3Q14 C;  4GTS B;  2JYE A;  2JY6 A;  3U4E G;  1LGR A;  3RX5 A;  2ASQ A;  1WR6 E;  4FJQ A;  1I7H A;  2M19 A;  4GAX A;  4LJO B;  2QEJ C;  1CK1 A;  2CR5 A;  2DX5 B;  4K7S A;  3A0O A;  3TBL D;  3RYT A;  2N9L A;  2JRI B;  1LQB A;  3NOB A;  2O6V D;  2L1A A;  1XLQ A;  2JVC A;  1ZP0 B;  1F9O A;  3Q79 B;  4AWJ A;  1FCL A;  4GTQ B;  1JCS B;  5KHO A;  2AYO B;  1WU4 A;  2KT7 A;  4GTV B;  2WXM A;  3PZ2 B;  2RMM A;  4BOS C;  1VR9 A;  1NI3 A;  1DOG A;  1N7O A;  4N9F 4;  1JRU A;  1AW7 A;  1J7B A;  3U7D A;  2RDH A;  4MJS A;  2YIK A;  2N0S B;  3VTW A;  3E9S A;  2DRQ A;  3ZNI D;  1EWC A;  4PS7 A;  1FP3 A;  2P0V A;  2LXC A;  2EKI A;  1JRO A;  2VH2 A;  1WGK A;  4ANX A;  2PW9 A;  2KX0 A;  4BOK A;  4OK2 A;  2MW5 A;  4C80 A;  2FE8 A;  3E56 A;  2J0M A;  1QIL A;  2BB5 A;  3BY4 B;  4W9L A;  2RGF A;  4GTR B;  3R7Q A;  3EUB 2;  3Q69 A;  2AFA A;  2PLP A;  5D3D A;  3WKG A;  4WAF A;  4GMV A;  3U52 E;  3IVF A;  1N20 A;  3PHW B;  3AV8 A;  1PQS A;  1N6Z A;  4RCO A;  2KAN A;  2KDI A;  5G2N A;  4AP4 C;  3ZQ4 A;  2WXR A;  1AAR A;  1N1Z A;  3M71 A;  4W9E A;  1ZGU B;  3Q3N C;  2KHW B;  2K8B A;  2D11 A;  3BVG A;  3PZ1 B;  3DSU B;  2AX5 A;  2BYF A;  2FIF A;  1TS4 A;  2E6X A;  4WIP A;  1CQV A;  1XLN A;  1ZW7 A;  3EUV B;  1HZ5 A;  3PTF C;  4RM8 A;  2CKH B;  1KLG D;  1TS5 A;  1UWM A;  2XFG A;  2WQY B;  3AEB B;  5FR6 A;  4K1R B;  4JQW C;  3DSW B;  3T33 A;  5EAS A;  2GMI C;  1OEY A;  2K0P A;  2DZM A;  2HJ8 A;  3K9P B;  1PYW D;  3S2A A;  1L0V B;  4CE7 A;  1C78 A;  1WXS A;  3MP9 A;  5BYS A;  4L1B A;  1L5P A;  4BKS D;  2V3S A;  3NNB A;  3ZNZ B;  1ROE A;  1H3B A;  5GMV A;  2XEW A;  4JLC A;  3M75 A;  1TZ1 A;  3M76 A;  2UU7 A;  2CJN A;  1ISN A;  3HRD D;  3QX1 A;  4M8M A;  1C4P A;  3K11 A;  1MJD A;  4ZRI A;  5EE3 A;  4GOC A;  4R3D A;  2NTT A;  2RGK A;  4MH8 A;  3AB5 A;  1V7V A;  1G9J A;  2DYB A;  1IYF A;  2DRR A;  4F13 A;  3VR8 B;  5AUK A;  1GXM A;  4LNN A;  1XLP A;  4XDD A;  3TUO A;  4WJQ A;  3DOW A;  3W7W A;  1O6R A;  4ZHP A;  4RGN A;  1UBQ A;  1WXQ A;  5TR5 A;  4B9K A;  2MBH A;  2FUQ A;  1WF9 A;  3E34 B;  2FV0 A;  2WII B;  1FFV A;  1V7X A;  4NEI A;  4KV2 A;  2XQW A;  2MA9 B;  4DQO C;  2AQ2 B;  4MU9 A;  2KAJ A;  1K51 A;  2MHJ A;  1L0X B;  1V1O A;  2GLS A;  2KYW A;  1SIF A;  1SBB B;  4LIX A;  4XYC A;  2RDG A;  1VCB A;  1S1Q B;  1IP9 A;  3PGE A;  1E10 A;  5M7I A;  3WAN A;  4FA6 A;  2V4L A;  4KKI A;  3SAE A;  4FLH A;  3VRA B;  5D94 A;  2BRW A;  4EZK A;  2N7J A;  2DAJ A;  4AJY B;  4A3O A;  4IDI A;  5BO4 B;  1V80 A;  4CHK A;  3DVG X;  5HHD G;  2LI5 A;  5MEH A;  3PZD A;  3WUX A;  3R2T A;  4F10 A;  2JSV X;  2PE9 A;  4LLG M;  3N3K B;  4L0G A;  1JWS D;  5JMF A;  2KMM A;  3RRS A;  1OQQ A;  1LXK A;  3ZNG C;  2LRW A;  3DBL B;  3MTN B;  1DOY A;  1OGW A;  3DHI C;  3A4R A;  5I4D A;  1IS9 A;  3V6C B;  2ZPY A;  2N7E A;  3H6N A;  3JVZ X;  3AED B;  1O79 A;  1A70 A;  3L16 A;  1TTN A;  2H89 B;  1N23 A;  3WIR A;  2WDV B;  4DXF A;  4TV3 A;  2H6G B;  4OJZ A;  5IK9 A;  1XWQ A;  1LXD A;  3AEC B;  2H6H B;  1N5X A;  3PPA A;  3RX8 A;  1C82 A;  2KFK A;  2NVP A;  1N60 A;  4M76 A;  3DBR I;  4JX1 C;  4OZA A;  3KQ4 A;  3EC8 A;  3HHM A;  4HRS A;  3SDR A;  1WE7 A;  5J18 A;  2RI8 A;  5H92 C;  4MM3 A;  4O1N A;  1L6U A;  4GTP B;  2G4S A;  2FUG 1;  3CSF A;  3DPD A;  1O5M B;  2G02 A;  4W9C A;  1XCT L;  2SAK A;  3OG5 A;  1D8D B;  3OWE B;  4I6P A;  3AI5 A;  2J42 A;  3PRE A;  2NR2 A;  1Q5W B;  2NTS A;  5EE1 A;  3E7J A;  3REN A;  2L05 A;  1VDV A;  2AQ3 B;  1X1H A;  3SDL C;  4EKU A;  5CZL A;  2K8H A;  2KXJ A;  5G5H A;  3DWM A;  3Q3F A;  2GBK A;  4WQM A;  3I63 C;  2DWQ A;  3HXE B;  3W7U A;  2ZPN A;  1PGA A;  3MHZ A;  3U7Z A;  5DHK A;  4KZC A;  2M8S A;  1FMI A;  3P2C A;  3AEG B;  2QDF A;  3ZRC A;  2I2Y A;  1D6E C;  4RGM A;  5HG2 A;  4LDT B;  3M73 A;  4ZRQ A;  2BS4 B;  4EFO A;  4PYZ A;  5C05 A;  5C23 A;  1GLM A;  2KVZ A;  4WJN A;  1JWM D;  1RFA A;  2K22 A;  3RJ3 A;  5GY3 A;  3BK1 A;  2N9E B;  2XBB C;  3W5M A;  4A55 A;  1IBX B;  1XW2 A;  4E1Y A;  4UDU C;  3DSS B;  5FO9 B;  3TCA A;  1HX9 A;  5ILH A;  4FXC A;  3B1L X;  3NJT A;  4ASW C;  2WHI A;  4WJP A;  1P7E A;  3DRA B;  2IEJ B;  2DZJ A;  4M01 A;  1N7N A;  3MHS D;  4C00 A;  1N1B A;  3S4D A;  4LNK A;  4HRO A;  1N62 A;  3D5R A;  2EKE C;  3W2D A;  2WIN B;  2LXA A;  1FXA A;  1F9D A;  2WX1 A;  2F0Y B;  3CIH A;  1MPE A;  2ONG A;  4ZRK A;  2LGD A;  3V05 A;  3ALB A;  3GE3 C;  2RD0 A;  1CB8 A;  1N21 A;  2W55 A;  2KAC A;  4L2Y A;  3QAQ A;  1WSP A;  1G9G A;  3H3K A;  2LVO A;  3RUI B;  5CX3 A;  4H2A A;  2KK8 A;  3M02 A;  2ZW0 A;  4N6E B;  4OVU A;  2EMT A;  4RNQ A;  1V9J A;  3QSP A;  2WXL A;  4NJC A;  4OZB A;  2JXX A;  3N1X C;  2O2V A;  1N22 A;  3IT6 B;  4LK0 M;  3CMM B;  5T8I A;  1W6K A;  1YD8 U;  1E9M A;  5CHV C;  1QQR A;  2ZNV B;  2YEP B;  1MHH E;  2NS5 A;  1YOV B;  1J7A A;  2WXP A;  2KJH B;  3KH0 A;  1T0S C;  1O1S B;  4KTR A;  2DAF A;  4XUV A;  1J7C A;  2K5P A;  3DST B;  3ZJT A;  3HUI A;  2L0T A;  3RX7 A;  1VJK A;  3P2B A;  3Q73 B;  1MI0 A;  2Z0E B;  3P4R B;  3Q6B A;  2J5C A;  3Q7A B;  3TSS A;  5IOI A;  1FMA D;  4WUR A;  3Q8E A;  4MT5 A;  4US8 A;  4JGH B;  2WX0 A;  1RYJ A;  5GW7 A;  4REZ A;  3N1Z C;  1FD6 A;  2IGH A;  3KVF B;  4RNA A;  2V8J A;  2KWD A;  2PN5 A;  4LJP B;  4GTM B;  3RNC C;  5G55 A;  2ZCC A;  2BGF A;  3E32 B;  4D4C A;  2CQT A;  2G0D A;  1O1R B;  2ON8 A;  1RWA A;  3RNE C;  1H39 A;  5IL3 A;  5ILK A;  4RM9 A;  3ZLZ A;  4HCP B;  1X81 B;  4Z4L A;  3RNG C;  4JWU C;  2KWU B;  4W9F A;  2RSU A;  3KUD B;  1V5O A;  1N9A B;  4MAC A;  2WU5 B;  4BOJ A;  3H7P A;  1K50 A;  2BW2 A;  3VVW B;  3AFJ A;  5ILD A;  4IOI E;  2M4N A;  3QT3 A;  4E3C A;  1NBF C;  4OVV A;  2HTM E;  5IP4 D;  2EAD A;  1J0N A;  3Q3J A;  4DHJ D;  1SJE D;  3VSM A;  2UYZ B;  1N5W A;  4XC2 A;  3RI7 C;  4AUQ C;  2KN5 A;  1HA5 A;  3PZ4 B;  3ZDM C;  2JQR B;  2KTR B;  3RD2 A;  1G87 A;  4W9K A;  4ANV A;  3K7X A;  2WNM A;  3WC3 A;  1RFK A;  2GBM A;  1E8X A;  1EGU A;  1GG3 A;  1Y8R C;  3QT9 A;  3N0G A;  3ZKJ C;  4YDE B;  4YL8 A;  3V62 A;  2JF5 A;  1L7Y A;  2C7M B;  4MEL A;  3SD5 A;  2MX2 A;  3BIN A;  2QC8 A;  3W7S A;  1WU5 A;  1WWT A;  2WXK A;  2BF8 B;  3Q75 B;  2BBC A;  3ZXV A;  4AQ7 A;  3AE1 B;  4ICV A;  3QFZ A;  1KWF A;  2WYQ A;  1SSN A;  2GB1 A;  4MM3 B;  4LNB B;  3IBE A;  2VRR B;  4BKS A;  1RWC A;  3H9D A;  3NZ3 A;  1GAQ B;  2KLG A;  2MJD A;  3KWL A;  2BTE A;  1F0Z A;  1I4R A;  1UD7 A;  2A5U A;  4AYP A;  2KO3 A;  1VRA B;  1I4X A;  3WIW A;  1WFY A;  2D10 A;  2Z59 B;  2HDE A;  4ONT A;  4XGA B;  2LGS A;  1TS2 A;  2L52 A;  3W1S C;  1LTX B;  1FO3 A;  1OFF A;  3AE9 B;  3M7E A;  5G5G A;  1F9J A;  1SF0 A;  3GB1 A;  2WY8 A;  5C3J B;  1E5W A;  1ZXI A;  2A4Z A;  1WI0 A;  5ILY A;  2PVG C;  3TIX A;  1NYQ A;  1TKE A;  2WWZ A;  5FK9 C;  2MP2 A;  2PIA A;  4YDO B;  3LJ3 A;  3U30 A;  2Z0D B;  4EZL A;  3TL5 A;  3ABV B;  2D3B A;  5IKH A;  3ENE A;  1E8Y A;  2K6Q A;  1GC6 A;  3UIN B;  4US9 A;  1R4N B;  3RPF C;  1EO6 A;  2ACZ B;  3M3J A;  3DVG Y;  3C8Y A;  3S9V A;  1T0Y A;  3S4A A;  2B76 B;  1ESF A;  4TSS A;  2VH1 A;  5JHB A;  4NAW B;  1HV6 A;  3SDV A;  1FT2 B;  2GRI A;  1F52 A;  3QA8 A;  1WH3 A;  3QXF A;  4RF0 A;  1H13 A;  3W7T A;  2EAB A;  4RH6 A;  2IGD A;  1I8Q A;  2WY7 A;  2K6D B;  1GAI A;  4BKG A;  1JW9 D;  4DDG D;  2ZNV C;  3JW0 X;  3PV1 A;  4LNI A;  4YTN B;  1NEN B;  4TKN A;  3HXF B;  1EU3 A;  4CJ0 A;  1KFG A;  1QBQ B;  2NBV B;  2D2Q A;  3TEW A;  1KRH A;  2WS3 B;  2ZVN A;  4WU0 A;  3EU5 B;  3DPY B;  2DZK A;  3UIO B;  5DPR A;  3TEY A;  2H6F B;  1TNU B;  1WX9 A;  4L23 A;  1TIF A;  3TJP A;  1SA5 B;  1I4P A;  3BII D;  1H37 A;  1FNU A;  4NJ6 A;  1WMH A;  4PYU A;  2KVR A;  3FIL B;  3QWZ B;  3ZUN A;  1D3Z A;  2F6D A;  4K7W A;  1QAZ A;  2OJR A;  3M72 A;  2LJI A;  4DHZ E;  1YQ3 B;  4ACF A;  3WAO A;  2AWT A;  3PRM B;  1VZ7 A;  4EOY A;  4BBN F;  1HCU A;  2OOB B;  4DHJ B;  1WJ6 A;  4OZW A;  3G6J B;  2DYO A;  5TSS A;  1WZ3 A;  2KMC A;  4IM0 A;  1H36 A;  1PGX A;  4GIV A;  2V1Y A;  4LCD E;  4BZA A;  3HVZ A;  2WXN A;  3A9K B;  2J4X A;  2BED B;  2NBW B;  2W9N A;  4MEM A;  2IGG A;  5DHI A;  3WIM A;  1RM6 C;  3SFX B;  2L8J A;  5DPS A;  4KSK C;  4BOZ B;  1LF9 A;  3EFU A;  2IPK D;  2DEN B;  3G4F A;  4HWI B;  5CHF A;  4FJV B;  1WXV A;  2V8K A;  5JXV A;  1TN6 B;  2ZZP B;  3PLV A;  2HJ1 A;  4MGY E;  4K3C A;  2C5L C;  5BMH A;  2DYM A;  3T9L A;  2I1K A;  4JE3 B;  1KM7 A;  2IO1 B;  5L95 C;  5KKB A;  5C2T B;  4X57 B;  4IUM B;  1KSC A;  1MFW A;  2VN7 A;  2KN4 A;  2PEA A;  3EQA A;  2R2O A;  2I07 B;  1KF6 B;  3SDT A;  5IKC M;  1EU4 A;  1FPY A;  2AQ1 B;  3M62 B;  4ZDV A;  1CLC A;  3RZF A;  1MG4 A;  2L83 A;  1R7S A;  1K53 A;  1ULV A;  2INN E;  3RN9 C;  4G50 A;  3VDZ A;  2KD0 A;  1V2Y A;  3AM9 A;  3Q8B A;  2WP9 B;  4NQK E;  2ONH A;  3VHT C;  3Q78 B;  1GOZ A;  1EM7 A;  4HKQ A;  1WM2 A;  1J0G A;  1V5C A;  2NPT B;  1H12 A;  1F1H A;  3W9C B;  3LB8 C;  1RW9 A;  1RWF A;  1TNO B;  2B4F A;  4XWT A;  1FFU A;  5IN7 A;  3GOE A;  1FRD A;  3HIZ A;  2INP E;  1SEB D;  4I6L B;  1YQB A;  3APD A;  1TGZ B;  4ARC A;  1MHX A;  3NRZ A;  2GOW A;  2PTL A;  2W82 A;  4FJZ A;  2IJ0 A;  4NJ7 A;  2D5G A;  1A5R A;  2N7D A;  1GA2 A;  4P16 A;  4FN2 A;  1YJI A;  1QF6 A;  3PT2 B;  1R4N I;  1L4Z B;  3VW5 A;  3NZS A;  3H7S A;  2IY0 B;  4RGO S;  4HPL B;  3E80 A;  1VLB A;  3LXF A;  1QT9 A;  2NVU I;  3RMK C;  1X1M A;  3AE3 B;  1ZKH A;  2GBN A;  5M7Y A;  2NBU A;  3EU8 A;  3KUC B;  4CO7 A;  1N7Q A;  3IAM 1;  4ZOH C;  3DSV B;  1YIW A;  3VH4 B;  4A8X C;  3ON6 A;  1CEM A;  5FOB B;  3QC8 B;  4ZRP A;  1T3Q A;  5DGR A;  4IKG A;  1I35 A;  2QNO A;  3M7B A;  1D4B A;  1LD8 B;  1C76 A;  3B08 A;  1C3D A;  3SQC A;  4USA A;  1K8R B;  2FUH B;  2JPH A;  2MBO A;  3RNB C;  4W9G A;  2CHX A;  5LXH A;  4WVB A;  3FKY A;  1H14 A;  3EGR A;  2AHF A;  4QT9 A;  4LNV A;  1BUI C;  1C77 A;  2GBJ A;  2KC2 A;  1KLV A;  5LNK 1;  2LD9 A;  3PYB A;  2YEP F;  1V1P A;  1VZ6 A;  2KQS A;  5JMD A;  3QK0 A;  4IC7 B;  2PVO D;  2SEB D;  2JZZ A;  2B3A A;  1WM3 A;  1M4V A;  4LTU A;  3OLM D;  3GZN B;  2Y5P A;  2Q1F A;  3W5N A;  3I3T B;  4PT5 A;  4C4V B;  1WRI A;  3VSN A;  3L54 A;  2MJE A;  2LFI A;  1QKZ A;  1XWT A;  3P42 A;  4IWQ A;  4LNO A;  3VR9 B;  3VTV A;  2JZ3 B;  1T6B X;  3M95 A;  1C3T A;  1WZ0 A;  2HTH A;  3KWV A;  1KJT A;  4KZ0 A;  4HJG E;  1B1Z A;  4EEW A;  1ZDV A;  4K7U A;  1L4D B;  1EUV B;  2KFJ A;  2OJW A;  2N1V A;  5BYR A;  1H4R A;  2Z07 A;  1FM0 D;  3GT5 A;  1L1Y A;  1SE3 A; 
#chains in the Genus database with same CATH homology
 1YN4 A;  4XE0 A;  3BVM A;  1XF5 L;  4CQN A;  2TSS A;  2VZK D;  3QSP A;  2W3R A;  2WXL A;  4NJC A;  4OZB A;  4RF1 A;  5E6J A;  1TY0 A;  3M7C A;  3B2G A;  4HKZ E;  3IT6 B;  4LK0 M;  3M77 A;  3BVZ A;  3ZJV A;  4FUS A;  4DOD A;  3Q8A A;  3HXD B;  1JWB D;  5T8I A;  1W6K A;  4AYR A;  2DRO A;  1E9M A;  1FRR A;  1JRP A;  1QQR A;  3AE4 B;  2YEP B;  4TQ0 A;  1IGC A;  1MHH E;  1OQR A;  1TKY A;  1ZPS A;  1J7A A;  5GZK A;  2WXP A;  4LNG B;  1XCQ L;  3T3N A;  4TF4 A;  2JZP A;  1BML C;  1UUP A;  1ACC A;  1NL4 B;  1E6E B;  2ONQ A;  4GLS C;  1O1S B;  4KTR A;  2K5P A;  4XUV A;  1J7C A;  1L6V A;  1N61 A;  3DST B;  1N4S B;  1WZZ A;  3HUI A;  3ZJT A;  3TF4 A;  3RX7 A;  3P5P A;  1VJK A;  4OHJ A;  1DL2 A;  3Q73 B;  4TXT A;  1MI0 A;  3P4R B;  1PFD A;  1NC5 A;  3Q7A B;  3TSS A;  1FMA D;  3M7L A;  3QG0 A;  2N9K A;  4WUR A;  3Q8E A;  2I38 A;  4MT5 A;  4US8 A;  1SE4 A;  1RYJ A;  5GW7 A;  3KSL B;  3MFG A;  3N9Y C;  4REZ A;  3SEB A;  1FD6 A;  2IGH A;  1P7F A;  4RNA A;  1KZO B;  3WKI A;  1HXY D;  2V8J A;  4N58 A;  2KWD A;  4AYO A;  2PN5 A;  4GTM B;  2CQS A;  3E73 A;  1C79 A;  1JWA D;  1QOG A;  1PDX A;  1UT9 A;  4D4A A;  1O6H A;  1W6J A;  3E32 B;  4D4C A;  4L6X A;  2CQT A;  1FNW A;  1KH0 A;  2G0D A;  5E2J A;  1MVK A;  4ZHO A;  1O1R B;  2ON8 A;  4GTS B;  2JYE A;  3U4E G;  1H39 A;  3SDU A;  1DYQ A;  1TF4 A;  1T5X D;  2WXI A;  3RX5 A;  3T3O A;  1X81 B;  3AE8 B;  1Q10 A;  4OW0 A;  1YN5 A;  4Z4L A;  4ZH5 A;  1I7H A;  2M19 A;  2QEJ C;  1CK1 A;  4JWU C;  5FKA C;  3DWG C;  3QRY A;  1LF6 A;  1ZXH A;  2QIL A;  1DOX A;  3PZ8 A;  1GXN A;  1N9A B;  4MAC A;  1TNZ B;  4GL3 A;  2LHD A;  2N9L A;  4BOJ A;  2WU5 B;  3AEE B;  3BWU D;  4C7Y A;  1K50 A;  2BW2 A;  3CU7 A;  2L1A A;  3AFJ A;  1XLQ A;  3E30 B;  3R2I A;  1QSJ A;  1ZP0 B;  4IOI E;  3W1S A;  1QOA A;  1FCE A;  2EAE A;  3QT3 A;  1F9O A;  3Q79 B;  1E7P B;  1FCL A;  4GTQ B;  1JCS B;  1QQF A;  2HTM E;  2EAD A;  1WU4 A;  2BYT A;  1SJE D;  4GTV B;  2WXM A;  3PO0 A;  1N5W A;  3PZ2 B;  2ZW1 A;  3IXS A;  1XEE A;  3QXQ A;  2RMM A;  2FUZ A;  1SQC A;  1JWU D;  1DGJ A;  2NMQ A;  3P5R A;  1HA5 A;  3PZ4 B;  1VR9 A;  3S4B A;  2JQR B;  2IDY A;  1NI3 A;  1G87 A;  3AH7 A;  1DOG A;  2G9H D;  1YJJ A;  2WXO A;  4A9A A;  1B9R A;  3K7X A;  2WNM A;  3WC3 A;  1AW7 A;  1RFK A;  1J7B A;  4DXG A;  2RDH A;  3A3V A;  1ENF A;  2YIK A;  3QT9 A;  1HZ6 A;  2E3T A;  2N0S B;  1I4H A;  3E9S A;  2DRQ A;  4YDE B;  1N94 B;  5HI1 A;  3BYY B;  1O6Q A;  3CIR B;  1KKT A;  1EWC A;  4XDC A;  3D5S A;  3I9V 1;  1KRE A;  3BK2 A;  1KRF A;  1FP3 A;  2P0V A;  3W7S A;  1WU5 A;  1WWT A;  1JRO A;  2EKI A;  2LHE A;  2WXK A;  1TJE A;  3Q75 B;  2BBC A;  4AQ7 A;  3AE1 B;  1WGK A;  2ZBL A;  2PW9 A;  3WIQ A;  3QFZ A;  5AUI A;  3VRB B;  1KWF A;  2MJ3 A;  1GB4 A;  1NYR A;  1QOB A;  1SSN A;  2GB1 A;  4MM3 B;  1AWD A;  4LNB B;  3NZ3 A;  4BOK A;  1GAQ B;  1UGJ A;  2JXT A;  4DOE A;  2MJD A;  3KWL A;  4C80 A;  2BTE A;  2FE8 A;  3E56 A;  1F0Z A;  3O13 A;  1I4R A;  3P1M A;  1QIL A;  2BB5 A;  1V5D A;  1JCR B;  1FBW A;  3KSQ B;  1D5X C;  4AYP A;  1VRA B;  5MPO A;  1I4X A;  3WIW A;  4FXG B;  4GTR B;  1TS3 A;  2HDE A;  4ONT A;  2AFA A;  3EUB 2;  4V1S A;  1KFY B;  1YMH E;  2PLP A;  3WKG A;  3Q69 A;  4WAF A;  5D3D A;  5HFY A;  5JPN B;  3AE5 B;  4GTT B;  4OVZ A;  3U52 E;  3V3X A;  1TS2 A;  1N95 B;  1ZDX A;  1S64 B;  2L52 A;  5FO7 B;  2CJO A;  3AV8 A;  2ZIR B;  1LTX B;  2MEK A;  2NOJ A;  4RCO A;  1KSD A;  2OHF A;  1FO3 A;  1OFF A;  1TYG B;  1D8E B;  2D8L A;  3AE9 B;  3M7E A;  1L0Y B;  4YTP B;  5G5G A;  3DSX B;  1SF0 A;  1AN8 A;  3ZQ4 A;  3GB1 A;  5CD2 A;  1QLB B;  2SQC A;  1NEK B;  2H88 B;  2WXR A;  3E33 B;  2WY8 A;  3AE2 B;  3P63 A;  3PZ7 A;  4WWM A;  5C3J B;  1F2R I;  1ZXI A;  3M71 A;  3TEZ A;  5AGD A;  2PVG C;  5BMG A;  4KX6 B;  1NYQ A;  1TKE A;  5FK9 C;  1FCC C;  2PIA A;  3PZ1 B;  3BVG A;  3DSU B;  4YDO B;  2AX5 A;  2PMV A;  4YSZ B;  1TS4 A;  2A8Z A;  2E6X A;  4WIP A;  3ABV B;  1CQV A;  1XLN A;  1XXG A;  3EUV B;  1HZ5 A;  4KTP A;  3P4S B;  1KLG D;  1TS5 A;  4US9 A;  3RPF C;  1UWM A;  1JS4 A;  1TNB B;  2XFG A;  2ACZ B;  2WQY B;  3AEB B;  3C8Y A;  3S9V A;  3S4A A;  2B76 B;  3DSW B;  1ESF A;  4TSS A;  1FNV A;  3T33 A;  2MJE A;  1JQ4 A;  5GXG B;  4YSY B;  2K0P A;  1NXC A;  2Q5W D;  1FEH A;  3SDV A;  1PYW D;  1FT2 B;  2GRI A;  2ICI A;  4NAW B;  1L0V B;  5D7G A;  1GHQ A;  3QPF A;  4CE7 A;  4C7Z A;  1C78 A;  3MP9 A;  5BYS A;  4L1B A;  3QXF A;  1L5P A;  4RF0 A;  1H13 A;  1UG9 A;  3W7T A;  2EAB A;  5CA3 A;  2IGD A;  4RH6 A;  2EEL A;  4D4D A;  3WCQ A;  2WY7 A;  3GS2 A;  1FO4 A;  1GAI A;  1KLU D;  1JW9 D;  2J52 A;  1E0Z A;  1YQ4 B;  2V3P A;  1ROE A;  1H3B A;  1UWX A;  3ZGZ A;  1FO2 A;  3SDQ A;  1WYG A;  2WXH A;  1GB1 A;  3M75 A;  3ANI A;  3M76 A;  1LO5 D;  1YN3 A;  4MBG B;  2KQ4 X;  1FPP B;  3NS1 A;  4YTN B;  2CJN A;  1NEN B;  1K52 A;  3HRD D;  3URY A;  3HXF B;  4D94 A;  2Y5C A;  2VN4 A;  1EU3 A;  4CJ0 A;  1KFG A;  1C4P A;  1QBQ B;  3K11 A;  4JJJ A;  1VZ8 A;  4GDL B;  3TEW A;  3ACS A;  1KRH A;  2WS3 B;  4B0E A;  4WU0 A;  3EU5 B;  3DPY B;  5EE3 A;  1Y56 A;  4R3D A;  1TKG A;  3TEY A;  2H6F B;  1TNU B;  2RI9 A;  3E37 B;  2NTT A;  2FV1 A;  1SA5 B;  2RGK A;  2R61 A;  4MH8 A;  4L23 A;  1GPX A;  1I4P A;  1ZOY B;  3AB5 A;  1V7V A;  1G9J A;  1H37 A;  1FNU A;  1KZP B;  3BII D;  5EE0 A;  4ARI A;  3FIL B;  3ANK A;  4J5T A;  2DRR A;  2F6D A;  4NAM A;  3NVZ A;  3VR8 B;  3M72 A;  2LJI A;  5AUK A;  1YQ3 B;  1GXM A;  1GSZ A;  1XLP A;  2WXF A;  1NVI D;  1N4Q B;  1QOF A;  4XDD A;  3TUO A;  1L2A A;  2FBW B;  2BS3 B;  3W7W A;  1O6R A;  1VZ7 A;  1IUE A;  3FAH A;  1HCU A;  4ZHP A;  1X9D A;  2JJB A;  3HXB B;  1WXQ A;  4RGN A;  2GOX A;  3G6J B;  2A73 B;  3E34 B;  2FV0 A;  2DYO A;  1C9F A;  3WKF A;  5TSS A;  2WII B;  1DCE B;  1FFV A;  1I4Q A;  1PUT A;  1H36 A;  4KGS A;  1N4P B;  1V7X A;  1PGX A;  3I57 A;  2XQW A;  4ZG8 A;  2QJL A;  1F77 A;  4DQO C;  2AQ2 B;  3HVZ A;  3EZ8 A;  1KS8 A;  2WXN A;  2J4X A;  2BED B;  4GTO B;  2LGI A;  3QWT A;  4MU9 A;  2IGG A;  1ZUD 2;  1K51 A;  1N4R B;  3M78 A;  2KAJ A;  2WDR B;  5BYQ A;  4B0M A;  3C72 B;  1RM6 C;  2XN9 C;  4ITK A;  1L0X B;  1V1O A;  4HEA 1;  3SFX B;  3ETR A;  4RFB A;  3H8H A;  3H2W A;  4LIX A;  1SBB B;  2M0A A;  2QMT A;  1LF9 A;  2RDG A;  1JCK B;  4JPS A;  1H54 A;  3X17 A;  2FBA A;  1ZE3 D;  3GZK A;  1XO3 A;  1E10 A;  3M74 A;  4EHM B;  2BT6 A;  2IPK D;  2WXG A;  3AEF B;  5M7I A;  3VR9 B;  5FR3 A;  5D3I B;  4A6Q A;  3P4Q B;  1PGB A;  4RGT A;  4KKI A;  3SAE A;  3VRA B;  2BS2 B;  2V8K A;  5JXV A;  3B9J A;  1TN6 B;  1DOI A;  3Q8C A;  3R8B A;  2H6I B;  2N7J A;  3H7L A;  1WU6 A;  2MH7 A;  5H8Y E;  3U2S C;  1G6I A;  4JWS C;  3SFY B;  5BMH A;  2DYM A;  4IDI A;  5HHD G;  1FBO A;  2JG0 A;  5DGQ A;  3Q7F B;  5MEH A;  3GLY A;  3WUX A;  4JE3 B;  3R2T A;  4TMA B;  2JSV X;  4P6V F;  4YWG G;  5KKB A;  2WLB A;  2M56 B;  2V3N A;  4LLG M;  5C2T B;  1KSC A;  4L0G A;  2VN7 A;  1JWS D;  5EE9 A;  2KMM A;  2KN4 A;  3RRS A;  3EQA A;  1OQQ A;  1D5Z C;  2EAC A;  2I07 B;  3SDT A;  1KF6 B;  1XLO A;  1EU4 A;  2DLB A;  2AQ1 B;  3AE7 B;  3QFY A;  1DOY A;  2WDQ B;  1CLC A;  2PKO A;  5I4D A;  5FO8 B;  1EWY C;  1IS9 A;  2L83 A;  1R7S A;  2DBY A;  3ANJ A;  1K53 A;  2G1E A;  1ULV A;  2INN E;  4AS1 A;  1V7W A;  1TNY B;  3AED B;  1O79 A;  1A70 A;  3AM9 A;  3Q8B A;  4C56 C;  2WP9 B;  3HXC B;  1BXT A;  2H89 B;  3EA6 A;  3SFE B;  2RPV A;  2V0G A;  2JF4 A;  4EL8 A;  3WIR A;  1CZP A;  4M0W A;  3NVV A;  2WDV B;  4DXF A;  3Q78 B;  4ZH1 A;  4L9P B;  4FXK B;  1EM7 A;  1GOZ A;  2K9X A;  3J9C A;  3LYY A;  4YTM B;  4HKQ A;  2H6G B;  3AEC B;  1XWQ A;  3AN1 A;  1V5C A;  3RSY A;  1HQR D;  1JCQ B;  1H12 A;  2H6H B;  1N5X A;  3RX8 A;  2JYT A;  2LEK A;  3FIL A;  3NUH B;  1TN8 B;  2X38 A;  3IAS 1;  2NVP A;  1N60 A;  4M76 A;  3W9C B;  3KLS X;  1SXT A;  3LB8 C;  4JX1 C;  2JWU A;  4OZA A;  3KQ4 A;  1TNO B;  2B4F A;  1ET9 A;  3SDR A;  1FXI A;  3AE6 B;  3FC4 A;  4HRS A;  4XWT A;  1FFU A;  1N63 A;  1FAE A;  1HZF A;  3W7X A;  2RI8 A;  4Q2J A;  5H92 C;  4O1N A;  1UMP A;  1FRD A;  4GTP B;  1L6U A;  2INP E;  3BYT B;  2KDM A;  1V8C A;  2DRS A;  2FUG 1;  1STE A;  3IT4 B;  1SEB D;  3P4P B;  2K3U A;  3OED A;  2ZZR A;  4ARC A;  1C4A A;  1HEZ E;  1MHX A;  1O5M B;  2G02 A;  2JU6 X;  3NRZ A;  2PTL A;  2W82 A;  1V1P B;  4Z4J A;  2IJ0 A;  1XCT L;  3HVD A;  4GDK B;  2SAK A;  4CJ1 A;  1K72 A;  1D8D B;  3OWE B;  1AYF A;  1JAL A;  1ET6 A;  2D5G A;  2J53 A;  3NVY A;  1GA2 A;  2J42 A;  4P16 A;  4J3O D;  1IA6 A;  1YJI A;  1RWS A;  2NTS A;  5EE1 A;  3PMM A;  1QF6 A;  2V4I B;  3REN A;  1L4Z B;  2B39 A;  3VW5 A;  1VDV A;  1IA7 A;  1UNS A;  4RGO S;  1IGD A;  2AQ3 B;  5CZL A;  3S4C A;  1VLB A;  3LXF A;  4YCR A;  1QT9 A;  2WXQ A;  3ZYY X;  3AE3 B;  1SB3 C;  4XWW A;  5G5H A;  3DWM A;  2WU2 B;  5M7Y A;  1VD5 A;  1H35 A;  4WQM A;  1I4G A;  4D2K A;  3EU8 A;  2DWQ A;  1SA4 B;  3HXE B;  3PZ3 B;  1JML A;  3W7U A;  1S63 B;  1CJE A;  1FIQ A;  3DSV B;  4WVA A;  3IAM 1;  4WVC A;  4ZOH C;  1PGA A;  3MHZ A;  3U7Z A;  4A8X C;  1FMI A;  1CEM A;  3ON6 A;  3P2C A;  3OXU A;  4ZRP A;  5FOB B;  4C1S A;  1D6E C;  5DGR A;  1T3Q A;  3AEG B;  4RGM A;  2I2Y A;  4IKG A;  2V8I A;  1NI1 B;  2QNO A;  3M7B A;  3B2F A;  1LD8 B;  5HG2 A;  3TEX A;  4EE2 A;  1D4B A;  4V1R A;  1C76 A;  1KTK A;  3M73 A;  4KGT A;  1C3D A;  2L32 A;  4ZRQ A;  1SJH D;  3SQC A;  2BS4 B;  4USA A;  3W5U B;  2BB6 A;  3CWI A;  1AGM A;  3MJ5 A;  1GLM A;  3E6U A;  1H3C A;  4WVB A;  3NVW A;  3BZD B;  1JWM D;  1H14 A;  2K22 A;  3RJ3 A;  3EGR A;  3W5V B;  2AHF A;  4OZC A;  5BMI A;  4QT9 A;  4LNV A;  1BUI C;  1C77 A;  1TN7 B;  5GY3 A;  4N59 A;  5LNK 1;  3PYB A;  2YEP F;  3BK1 A;  4A55 A;  3D3I A;  3W5M A;  1V1P A;  2XWB B;  1VZ6 A;  1IBX B;  1XW2 A;  4KGR A;  2VZK B;  4UDU C;  2GH4 A;  2QIE B;  3DSS B;  5FO9 B;  2GI9 A;  2AHG A;  2PVO D;  3Q8F A;  2SEB D;  4FXC A;  4Q2B A;  2XWJ B;  4ZYS A;  3GP7 A;  2W3S A;  4Q88 A;  1P7E A;  3DRA B;  2IEJ B;  1M4V A;  2LMC A;  4LTU A;  3VXD A;  1IBX A;  2Y5P A;  5JPM B;  2OKX A;  3W5N A;  4PT5 A;  1WRI A;  1GAH A;  4AYQ A;  1F2R C;  2LFI A;  1MZC B;  1TZO A;  2D5J A;  3S4D A;  1QKZ A;  1XWT A;  2CU3 A;  1V97 A;  1D5M C;  2W54 A;  3WKH A;  1R76 A;  1TY2 A;  1C4C A;  4HRO A;  1N62 A;  3P42 A;  3D5R A;  2WYN A;  3W2D A;  3ZJU A;  2WIN B;  1RQ5 A;  1LD7 B;  2Z8L A;  1SIJ A;  1FXA A;  1GXO A;  2JX5 A;  1F9D A;  2F0Y B;  2Y3A A;  3CIH A;  4YT0 B;  3ACT A;  2GZ6 A;  3AMZ A;  4KKJ A;  1MPE A;  3UI3 A;  3PYA A;  2LUM A;  2R2L B;  3V05 A;  1H3A A;  1T6B X;  4WH4 A;  1SE2 A;  3RFZ B;  4TQ1 A;  2WXJ A;  2XNA C;  2W55 A;  3VQI A;  2KAC A;  4L2Y A;  2QSD A;  3KLS A;  3AEA B;  3KWV A;  3QDE A;  1WSP A;  1G9G A;  3H3K A;  4YSX B;  4HJG E;  1B1Z A;  1AYX A;  3MC0 B;  2ZIS B;  3SR6 A;  2OED A;  1ZDV A;  1L4D B;  4H2A A;  3L4P A;  1YNT E;  4NZL B;  5BYR A;  3SFD B;  1O1T B;  2ZW0 A;  1FT1 B;  2Z07 A;  1FM0 D;  4N6E B;  3GT5 A;  1L1Y A;  4A90 A;  4YXD B;  4D4B A;  1SE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...