3KQ5A

Crystal structure of an uncharacterized protein from coxiella burnetii
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
376
structure length
360
Chain Sequence
b'NQFYKPGMLVPVFSAAGLLKNGRYQFLLQQIETLSLLPTEQYAQLYEALVYRFVEFVQVLPIRLDEPLCSLMNEGLLRGVNSLNHYIQNHPEATPLERYALFSAGLLLEVAHAVVNQKIFITDEEGNFIKQWNPFSGPLIDDVETKHYKIMPLSSYYQRNIPSITPILVRQLLPDEGFLWLTSDMRVFSDWMQALRDDGRFEHVLQLFKHKNIDGLFNTLPALPVNLQDSPATAHADAFLNWLKEALATNQIKVNTSDAGVHVIPEGVFLEKTGIFKQYIDLHVNVPVNLFTVYQQFGNLFGLTKLSGIDYRFEQLFDALKRKSKMGFAGLSPTREGVLIADPNLIFTRGEIPSATYLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical cytosolic protein
publication title Crystal structure of an uncharacterized protein from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Structural genomics, unknown function
total genus 118
structure length 360
sequence length 376
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.40 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 3kq5A01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 3kq5A02
2IPQX 3KQ5A
chains in the Genus database with same CATH superfamily
1COWD 1EPTB 1VKYA 3QX5H 4BZBA 1QRXA 1FI8A 1XM1A 4I8HA 4NSVA 2J4IA 3ATIA 4O3UA 1A5GH 1C2KA 5HKKD 3BTME 3GOVB 2P8OB 2VIQA 2PWXA 1JIRA 4HG6A 1GI2A 5DP3A 3DFJA 1ANDA 1V2WT 4RT1A 2FTLE 3LU9B 5JPMH 1JWTA 1QQ4A 4I32A 5K7RA 2GMTB 2BY7X 4K1EA 1V2NT 4ZKOU 1O3EA 4FUHA 4CREA 2JDID 5EJLA 1EXFA 2FLOA 4WMEA 5KEDA 1J14A 1QNJA 4CRBA 1DUAA 1BMAA 3ZZ9A 1Y3UA 2WZQA 1HGTH 1YLDA 2W3IA 2GJGA 3JZ2B 1C2GA 1NN6A 2BDHA 1MTUA 1SMFE 3UREA 1T31A 4YT7H 1IAUA 5KGOA 2O8LA 1TX7A 2P94A 1GHBF 1GBJA 4IC6A 1ABJH 1VGCC 1TNHA 5EQQA 5E0HA 1W7GH 3FZDA 1WDIA 1IQLA 3PRBA 5IK2D 1DDJA 1O3DA 1TRNA 3ZVFA 5EXMA 3T25A 1ZJDA 2HALA 4XD7D 4QFYA 1HAVB 4TYDA 5E0GA 5KECA 3LOXA 5DKMA 1K1OA 4TO1A 3A88A 1TGNA 2J94A 3HATH 8GCHF 4ZHLU 1GMHF 1V2UT 3KHVA 4E05H 1AWHB 2AMPA 4H4FA 3SJ8A 1H8DH 5JYIA 1TRMA 4WJG2 3TM8A 3F6UH 3LC5A 4ZUHA 2IN2A 1YPGH 2O8TA 3TJOA 2GV7A 1AKSB 2V7QD 3VGCB 3LPRA 2ZO3H 5CMXH 1BTYA 2J97A 7GCHG 5DJ7A 4YOIA 2HGTH 1CGHA 3BG8A 1CT4E 2Y5FA 3OE7D 3M3TA 4L1JB 1O3BA 3NPSA 1C1MA 4YZUA 3LKWA 3PLPA 4K5ZA 3SU4A 5BRRE 5C1XA 4QFXA 1P8VC 2TPIZ 1W8BH 5LGOA 4NIXA 1JRSA 2BD9A 1ZTLA 3IITA 3F9EA 1EOJA 2Z9LA 4DIIH 2P3UB 1HAVA 2UUJB 1VR1H 1U6QA 2OUAA 3PO1B 3U9AH 1TQ0B 1E1RD 1TMUH 5FBEA 4MDZA 1FUJA 2WHXA 2G5NA 2BHGA 4QG4A 1YPLH 3CENA 3Q3XA 2BX3A 1N1LA 2XOKD 4GPGA 3UWIA 3SU0A 3DD2H 3MNBA 3MTYA 5GXPA 4AFSA 1K1MA 1AD8H 4MNVA 2GCHG 1DANH 3WY8A 1MUEB 1AKSA 1P12E 4WWYA 1A46H 1C5ZB 4BXWA 2VU8E 5G4BA 4QQYA 1AE8H 1JRTA 1S0RA 3VB7A 3UTUH 2FOCA 1S81A 1P2NA 3SV8A 4A1TA 2EI6A 1DUEA 5A09A 1HFDA 4L1JA 3SQHE 1FONA 2F91A 1ZPBA 2ZFQH 2VWMA 4XBBA 1DY8A 1BHXB 2PTCE 2ZU4A 2BM2A 2FWWA 3ATKA 4Y7BA 4ABIA 4DIHH 1XKAC 4UFEH 4ZCNA 5C0TA 1ESBA 2D1JA 3T5FH 3OX7U 1GI8B 1C1SA 1NBMD 2AERH 3F2FA 1SFIA 1FX0B 4K69A 2BDGA 2KAIB 3SHAH 4TY6A 2VGCC 2Z3EA 3T2NA 4ZKNU 1L4ZA 1ESTA 1ELBA 1O3FA 4MNYA 3NR1A 3A8CA 1LVBA 3GY2A 3QLPH 1CBWB 1K1IA 5A8YA 1GMHG 1QZ8A 2QXJA 4Q7HA 1SQAA 4ZKRU 4GHTA 7LPRA 3RM0H 4JK5A 2TGAA 4Z0KA 5DN6D 4IS5A 5FCKA 1QL7A 3MH4A 1W0YH 4Y71A 2FOHA 1CE5A 3LGWA 4IW4E 3IG6B 3SUDA 4TT3D 4B71A 4RI0A 5HIZA 1PPGE 3LH1A 1O2UA 3GCNA 1KTSB 4XE4A 1YYY1 1AMHA 1GHAF 2G52A 3E0NB 5DK1A 1ETSH 3LGVA 4ISNA 1H9LB 1G3CA 2ILNA 5GDSH 3GDSA 3MEMA 1A0LA 1O37A 4D7FA 3SGAE 1G30B 1MAXA 2W7UA 2SGFE 2UUYA 5C0UA 4E7NA 1QB1A 2KZ4A 2CHAB 4NIYA 1WTHD 1C9PA 1L2EA 4FUCA 1AFQC 2GTBA 4I8JA 2ODPA 3E1XB 2J34A 4CH2B 3VB4A 2QYIA 3GY3A 1JMOH 2JJ2D 3UOPA 4XFQA 3GYMA 1GBIA 3RXUA 1MCVA 1O3MA 1B0FA 2BQ6B 3UQVA 5DP9A 2M5TA 3MO9A 4OS2A 1PYTD 1AVXA 3OTJE 1EAXA 1YPJH 3A8BA 4XDEA 3RXAA 1LVOA 2FLBH 3W94A 2GX4A 4J2YB 2C93B 4QQWA 2A4OA 1VJAU 2GCTC 2M2AA 3R0FA 1MBMA 2KCAA 3T29A 1P10A 4GUXA 4JZDH 3SU3A 1HAPH 1NPMA 3EA7A 3KQDA 1AI8H 1VCPA 2A1DB 1AVWA 1A4WH 2FX4A 2ANKH 4JK6A 4FOUC 1ZRKA 2P3FH 3TH2H 2ZCHP 3P8OA 1GDNA 1FJSA 4Y10E 1GCTC 1KTTB 1L1GA 1IQKA 4AFUA 1E37B 2ASUB 2ZHWH 1TAWA 8KME2 4WY3A 4B1TA 3I7AA 1XUKA 1FIZA 4B2CA 1IQJA 1DXPA 1DITH 1L1NA 1C5XB 1WOFA 4Q80A 4FUJA 1S82A 1ZSKA 2V35A 3Q77A 1Q3XA 5TK8A 2ZHEH 3GS9A 1S85A 5C3NA 5TCAA 1CT2E 1SGDE 3SI3H 3MOCA 2QIQA 4I31A 1V2ST 1Y59T 2W5EA 2OCVB 1SFQB 5T6DA 1FZZA 1LTOA 4NWLA 3PV4A 3VFEA 2EY4C 4ASUD 2YOLA 2A4QA 4CRCA 1U6ZA 1HCGA 2JH6D 2LELA 3SW2B 2A5IA 3TGIE 1VCWA 1O2YA 4Q2CA 5IDKA 1A3EH 1GBDA 4MPVA 1IQIA 2BD3A 2ZCKP 3TNSA 2AMDA 4MLFB 1O5BB 1O2ZA 4XSKU 4B6EA 3RXPA 1GDQA 2A5AA 2FP7B 3MNSA 3ZZ5A 2OQ5A 4F4OC 3PMBB 3R3GB 1CHGA 1UVSH 2PUQH 3SU5A 3ZVDA 1GBHA 1O3KA 2ZFFH 2FX6A 1G36A 4ABAA 3GICB 1O3NA 1XUFA 4TO6A 2J5UA 4AB9A 1BDAA 3M36A 3L3TA 4NGAH 5LPRA 4RT0A 4TNPA 1V2PT 2AS9A 1RXPA 1BITA 4P00A 3MU8A 3QZRA 1NU7B 2SNWA 1BBRH 1AGJA 2IPQX 1DWBH 1EP5A 1C5PA 1MMJN 1SGNE 1AUTC 3ELAH 3OEHD 3HPTB 4R0IA 3ZZCA 1H8IH 2KX4A 1TGBA 1O2SA 1QGFA 4BOHA 3MQKC 2XC0A 1KXCA 3A7YA 4BAOB 3BEFB 1K22H 3LJJA 1ELDE 2Q1JA 3Q3YA 2ZTYA 3UNQA 1SHHB 2RDLA 3SN8A 1MD7A 4IMZA 1LQDB 4TWWA 3P6ZB 1SHYA 2ZA5A 3I29A 3SQEE 5A0BA 4QQXA 5JBAS 1LHFH 2CK3D 3BTTE 3SOSA 2H9EH 2SNVA 4X6OA 5T3HA 2FI3E 1YCPK 2GZ8A 1QJ1B 1UK3A 1RIWC 1GJCB 1DICA 1TALA 5TJXA 1BMLA 3MH5A 1IQMA 1GJDB 5EJ1A 1HPGA 2P93A 2ZGBH 4CHAB 4K2YA 1K2I1 2Z9JA 1XUIA 2FLRH 4X1NU 4OGYA 4M7GA 4THNH 1HJAC 3M5MA 2G8TA 1O34A 5EW2H 4X2YA 4I8LA 4ACBA 1HJ8A 1ZHRA 1J9CH 2YMSB 3N7DA 5TCCA 4LZ4B 1DWDH 5C1YA 1BJVA 1SI5H 2AIPA 3GCTF 2JH5D 2ZDAH 2WV4A 1ANEA 1GBCA 1GBTA 2HLCA 1TABE 2TGDA 2BOHB 3HK6B 3PV2A 3QGJA 2KCOA 1A61H 4AB8A 3SNAA 1EKBB 3H09A 1IQNA 1DOJA 1O2HA 2QE7D 5F53A 3M3SA 1BIOA 1QBOA 2ODYB 2FS9A 4YT6H 1H4WA 2XC5A 1O3GA 4N6WA 1AQ7A 2A4GA 2ESTE 1ELAA 2OC8A 5ESBA 8ESTE 1EZXC 1O35A 1KLTA 1YKTA 5F8ZA 2BXUH 2H5DA 1BRUP 3GY4A 3MI4A 5EOKA 4OM9A 4ACAA 1Y5AT 3ATWA 1DWCH 3BTGE 5DPAA 5HGGA 2VH0A 2BY8X 4XDSA 1C9TA 1EFRD 2V3OH 2UUKB 3NK8A 1P9SA 1DT2A 3FFGA 1UTNA 1UCYE 3PYHA 2TRMA 2GDDA 1QTFA 1ZR0A 2C8ZB 2FS8A 3E3TA 1VZQH 1V2KT 2BD4A 3STIA 1CA8B 1C5WB 4VGCB 3RXGA 4X8SH 1TGSZ 3RXFA 2JJ1D 1SC8U 4KTCA 1A7SA 3S69A 1SLWB 1SQRA 2UWOA 4TWYA 5DSFA 5AO4A 3ZZ3A 3EE0B 2ZGCA 4ME4A 4LZ1H 3BEUA 1K9OE 3OTPA 1FN6A 1SGFA 2FOMB 2FI5E 3RDZA 3VB3A 2PHBA 5E8EH 5HMAA 3A8DA 5JBBS 2WPJS 1ELGA 2ZPSA 4R8TB 4B2AA 2PFEA 3PLBA 3TVJB 1F2SE 1C1WH 1V2RT 3MWIU 2TIOA 2CJIA 3RXOA 1GI6A 1SGRE 1NM6A 2P8OC 1CO7E 3CS0A 1H9HE 1TNJA 1VITF 3TJUA 1W14U 3V3MA 3SV2H 4O97A 1MAYA 2WPIS 3PMAB 5GWZA 2AGEX 1YF4A 3GCTG 1EAUA 2OBQA 1C5SA 3VG8A 1T7CA 2B9LA 2OC7A 4MQAA 1C5LH 3QGNB 3VXEH 1EZQA 1XX7A 3WWBA 2R0KA 2BZ6H 4TPYA 1FV9A 1WU1A 4INHA 2HRVA 1Z6EA 1AU8A 1L0ZA 3RXIA 2ALPA 1KY9A 4Z1MD 2XTTB 3UAIC 1TGTA 1CU1A 1GHZA 3U8OH 1H9IE 2Q6DA 1PFXC 1ZJKA 1DLEA 5H4IB 3EA8A 4DY7B 3MHWU 4P02A 3RXBA 4B75A 1C1UH 1MU8B 1O2MA 1QL9A 1AVGH 1YY3A 1ZGVA 4MVNA 4RXSA 3M5NA 4ZWEA 3E91A 4X0WU 5C5OA 5F6MA 1TOMH 1O2IA 3UQOA 1HAYB 1NO9H 3D62A 1TNLA 4PROA 1NZQH 3BTFE 1A0JA 1UJ1A 4F55A 1DSUA 3PWBA 1HNEE 2D26C 5DP8A 1F0RA 3RLYH 5SGAE 4L7WA 4MNWA 1SGEE 1EATA 4JCNA 3TNTA 4ZMAH 1UTMA 4FUEA 1NY22 3F9FA 3QZQA 1G3BA 1YOYA 2EA3A 1NFYA 1T4UH 1QB9A 2GCHF 3QDZB 1EB1H 2GDEH 4B6FA 1KLIH 2BXTH 3NCLA 1Z8RA 4BNRA 3TJNA 2QAAA 1GHWH 1GWAA 1V2TT 2Y80A 2Z94A 3U1JB 2H1UA 4JZFH 2G00A 1KXFA 1MBQA 4JMYA 2ZFPH 1O2TA 2Y82A 1UHBA 2FO9A 1HJ9A 3VPKA 3RXMA 1MTNC 1DXWA 3TGKE 5B6LA 1C5UA 3SORA 1BRAA 5B6OA 1DWEH 1GJBB 4JZ1A 4OS6A 2UUFB 5L2YH 2Y6TA 5EPYA 4MCWA 4NZLA 5T1VA 4AORA 2B5TB 3KIDU 2VIDA 3V12A 3M1TA 1CA0C 1O33A 3PTBA 1BZXE 4E06H 1FY4A 2AHME 5BPEA 3SZEA 4UFDH 2QGRA 3AAVA 2NU1E 1GJ5H 2DUCA 5EIYA 2BMGB 1VITG 2OGIA 3B8JA 1C5MD 4ABEA 5GCHF 1BBRK 4L7EA 3EDXB 3KEEA 1LHEH 2FOAA 1LDTT 1D6RA 3A8AA 1CT0E 3A7VA 2PQ7A 5HXFA 1AO5A 3QK1A 2OC1A 2WPMS 1BTXA 1O2RA 3RC5A 2VIVA 2DE8A 4NA9H 4N71A 1BRBE 3LJXA 1NRRH 5DO4H 2A2XH 1XMNB 4AZ2B 2AGIX 2C8XB 1PQ7A 4ZKSU 3SJKA 5C94A 1IHSH 3UPEA 1MKWK 1YWUA 5A0AE 3SJ9A 2WV5A 2UWLA 2VVVA 3GY7A 4X6NA 1P01A 1P2OA 2FI4E 1IQGA 1MKXK 5EG4A 2ZKSA 3ATLA 1TX8A 4TY7A 3WW7A 4OS1A 3M7TA 1N6YA 1F7ZA 3A86A 4ZXXH 1W0KD 3V0XA 2BLWA 4IGDA 4R8ZA 1BA8B 2FOEA 2VNTA 3AW1A 3M7UA 1IQHA 2P59A 3ZVBA 1NROH 4ZROA 1P57B 1Y3WA 2A0QB 1T8NA 3PRDA 4XBCA 4A6LA 2OBOA 1NS3A 1O2VA 3SU6A 1RGQA 4UONA 2FOFA 1GDUA 3GCOA 1HBTH 2F43B 1BRCE 1XXDA 3ZZDA 1P2KA 1IOEA 3SUGA 2IJD1 4O9VA 3IRHA 1F5RA 1E36B 1OYQA 4TNXA 2CHAC 3RXRA 4BAMB 1C5VA 3BTWE 3RXDA 3CNRA 3SUEA 1O2QA 2ZECA 1VGCB 1ZMLA 2R2WU 3M7QA 2PGSA 1EQ9A 1BTZA 3RP2A 1TQ7B 3QUMP 1KXBA 1V2VT 1IQEA 5A2MH 1ANCA 1ELVA 1O2NA 4DMBA 4TSFD 1FMGA 5CE1A 3GISB 1OWJA 1BTPA 5EXLA 1V2LT 1DLKB 2BD5A 2Y5GA 4X1RU 3U1IB 3UFAA 2KFWA 3DCLA 4H6TA 1FY3A 1INCA 1GGDC 5GCHG 2NU2E 2V6NA 1UTOA 1J15A 3STJA 1EX3A 1K1PA 1LHCH 2WPHS 1C5NH 1UTLM 1QL8A 1SGQE 5FPTA 4LOYH 3ODDA 1C2LA 1N6XA 4KP0A 2ZFTA 3ZYDA 1O3JA 4QT8C 2F9BH 1AHTH 1S6FA 3S7HB 1O5AB 2GT8A 1CVWH 7KMEH 5C20A 2A7JA 1UVPA 2BZAA 3P17H 1P02A 1C5OH 1SOTA 1C1VH 2ZC9H 3T62A 4I86A 3SKDA 1TLDA 4AYVB 4FUDA 4MNXA 2BD7A 2F3CE 3RUOA 2JETC 2VVUA 2SGDE 1W12U 1UK2A 4ABJA 2FDAA 3HKJB 2BY5X 1PQ5A 5GJ4B 1O3HA 4Y76A 2OLGA 1GHYH 3M5LA 4B74A 4Q63A 4AX9H 3TPIZ 2FOBA 4MLNA 1ID5H 1C2JA 1YPHE 3EGKH 1BB0B 5JB8S 5AO2A 2FPZA 1PPHE 4K1TA 2A7CA 5EQSA 3FVFB 5F8TA 3D23A 2KCYA 1TNIA 2BLOA 4CBNA 1MH0A 4MPUA 1FLEE 3P3QA 3P70B 3SJOA 3NZIA 4XOJA 1E0FD 1Q31A 4DJZB 5EU8A 1KDQA 1WUNH 1HAOH 3E8LA 3L6PA 4KTSA 5L2ZH 2Z9IA 1L1JA 3TITA 3HI0A 1SLXB 1HAZB 2PTNA 3FAOA 1AB9C 1TRYA 2RG3A 4BTTB 1T8LA 5IYTA 3F68H 4DVAU 2XWBI 3UY9A 4CR9A 1GG6C 1PQAA 2VGCB 1M9UA 1NC6A 2G81E 5T6FA 2J38A 1D4PB 1O2JA 4ZWGA 1QFKH 1S0QA 3S0NA 2PKSB 1QB6A 1YLNA 3S9AA 1P9UA 1C4U2 4TO4A 3VB6A 1C4Y2 1ZRBA 1S6LA 2F4LA 2G5VA 2H6MA 1G3DA 1NBME 2XNDD 2ANYA 2ZU5A 3E90B 1AWFH 2P3TB 1EJNA 1G9IE 1OYTH 1YPEH 2Z3DA 1P06A 4K60A 2V3HH 4BXSA 3RF0A 5DP7A 3SU2A 1XX9A 1GMCF 1SR5C 1HV7A 3MU4A 3QTVH 1FY5A 3F0PA 1FIWA 4RXQA 1DPOA 1FN8A 4WH8A 3TH4H 1GJAB 1OHHD 2IOTA 1OWIA 3UWJH 1LVYA 5ETXA 1O39A 1QBVH 2XXLA 2XRCA 2FEQH 5CDFE 3MU5A 1AFQB 3W1EA 1FNIA 3EA9A 4F49A 1N8OC 5DP6A 3U1NA 1GHXH 1S84A 1C1NA 3A84A 2L74A 1RJXB 1BCUH 1SVPA 2AMQA 3RXQA 5CHBA 1GPZA 4YM9A 3KN2A 3PWCA 3TMBA 4NZQA 4ISLA 5CHAC 2H5CA 1OKXA 3GDVA 4BAKB 3LH3A 1WTGH 1V3XA 3BIUH 3PV5A 1DS2E 1O2GH 4LK4A 1GI9B 3M5OA 1ZTKA 6CHAC 5EGMA 2GCTB 4OS5A 1C2FA 4BAQB 1UO6A 4NSYA 2O8UA 2Y7XA 1OWKA 4J1YA 4FETA 1FY1A 2PSYA 3ZV8A 4RXPA 1BTHH 2H9TH 3RXHA 3TK5A 1OWHA 1TPPA 1MTSA 4BTIB 1GBFA 1KMHB 1NFXA 2GGVB 3HKIB 4LXBH 2XBVA 2ZHDA 1TE0A 1AN1E 3A80A 3GCHC 4ABGA 1GCTB 3P8FA 3A7TA 4MPXA 3A7ZA 1NRSH 1W3CA 2XW9A 1P09A 3LC3A 4AFQA 1QA7A 4QFZA 1UK4A 3IWMA 4CRAA 3RXSA 1B7XB 4A92A 1SKYE 3RXJA 3ZZAA 2BY6X 3VXFH 1D3DB 3OU0A 3EYDA 4I8KA 3KYFA 2GP9B 3MH6A 1G2LA 3OY6U 2BOKA 4CRGA 5LH8A 1EASA 2HPPH 2BLVA 4X2WA 2FM2A 4UFFH 1LVMA 1C1OA 1XUGA 2AYWA 4Y8YA 1OPHB 3KQEA 1CQQA 1LQEA 1XXFA 2TBSA 1C1TA 4JYUH 4FXGH 1LKAA 3SV6A 3A83A 4Y79A 2R3UA 2ZI2H 1UTJA 1TIOA 4NIWA 2GZ7A 1KXAA 1GMCG 3G01A 2BDBA 1VJ7A 3DFLA 4MDSA 1SG8B 1TMBH 4FUGA 1WXRA 3BG4C 2VJ1A 4Y8XA 4X2VA 1FY8E 1GJ6A 1SGYE 5FAHA 4DURA 2CQZA 5L6NH 1DM4B 2VH6A 4Y0ZE 1QIXB 5T6GA 2GV6A 1PPCE 1NRQH 2JH0D 1UVUH 1G2MA 4NIVA 5EW1H 2WPDD 2BDAA 4X1QU 1YPHC 2QF4A 2ZHQH 1C1QA 2ANMH 2FZZA 2H9HA 1G3EA 1FAKH 4FUIA 1HXEH 3KH1A 1VQRA 1KXDA 1X7AC 4MPWA 4F48B 4ZH8A 4X6MA 4U30A 4LRLA 4ISHH 3BTQE 2GVFA 1YP9A 2KM0A 3UR6A 2LP6A 1THSH 3T28A 1DFPA 1C2IA 1ORFA 2G4TA 3RU4D 3C27B 1O5DH 2H2ZA 2D2DA 1W7XH 2GD4B 3PMHB 1OWDA 4OS7A 5AFZH 1O5FH 1AZ8A 2GKVE 5FPYA 1UTPA 2YNAA 5FL7D 1TONA 3BF6H 3ESTA 1D3TB 2W3KA 5J4SA 4JYTA 2Z9GA 2BYAX 3F2HA 2IJOB 1TA2A 3MFJA 3SV9A 1NFWA 1TWXB 2BTCE 1EZSC 1QA0A 1GJ9B 1V6DA 1MABB 1SB1H 1TNGA 1RTFB 2HLDD 1E79D 1HDTH 1RFNA 1TB6H 5FCRA 3SBKA 1J16A 3M61U 1ZMNA 1RIWB 2AH4X 3NQWA 1MQ5A 2VIWA 4MLMA 4K8BA 5ABWA 4NFFA 2QXHA 3A85A 1FQ3A 4RN6A 1O2LA 5FBIA 3U69H 3LDXH 5AF9H 1GJ4H 1J17T 4BZCA 2CN0H 1C2HA 1EUFA 4AG1A 1OP8A 3OY5U 4I33A 1C5TA 2KCPA 1C2EA 2RDEA 3BTKE 3PLKA 2NWNA 3RXLA 3LIWA 1BHXF 1EPTC 4IBLH 1O30A 1V2JT 2TGPZ 2FODA 5TK7A 2PW8H 1K21H 3QTOH 4U32A 3S9CA 1W0ZU 1ZMJA 1H8ED 2A31A 1O3OA 3NUMA 2AFQB 2K0QA 3P92A 3ZVCA 1BMFD 4DW2U 3E6PH 3BV9B 4UDWH 4AYYB 1TBZH 2OD3B 1Q2WA 2PARA 1WBGB 2ZDVH 3DHKH 1T32A 2GMTC 1C1PA 3AAUA 4X8TH 1O3AA 2BVSH 4INKA 3TK9A 1GCDA 3SGBE 4AN7A 1AUJA 2ZFSA 4NG9H 4Q7XA 1SLVB 2DQBA 3O8CA 3P95A 1ZSJA 2AIQA 2BDYA 4H6SB 4WMFA 1HIAB 3RXEA 2SGEE 2RA3A 4HFPB 5C17A 1A0HB 4UE7H 1ARCA 1O3PB 3FP6E 3C1KA 1MTWA 1ELTA 1XUJA 4ZXYH 3PROA 1ZOMA 1SPJA 4DT7B 3U28C 3GY5A 4ISOA 4DOQA 4TO5A 4Q2DA 4ABBA 2OQUA 4FU7A 1TPOA 1UHBB 2L6OA 3K6ZA 3KCGH 4QG1A 1C2MA 3RC6A 1EZUC 1GBLA 3H7TA 2GZ9A 3MO6A 3PB1E 3RXCA 1PYTC 4MG3A 2PLXA 3BEIB 3KF2A 3PTNA 3BG2A 1Z1IA 1UVTH 1NTPA 3ZVAA 1Z8JB 2QF3A 2O08A 1MQ6A 2F9PA 5FXLA 1EB2A 1CGIE 3GDUA 2OTVA 3UR9A 1MZAA 1PPFE 2C8WB 4BTUB 1T4VH 5AFYH 2YMSD 2ZFRH 2EEKA 2P16A 3VGCC 5I25A 2HNTE 3RU4T 4YLUA 1WSSH 2A45B 1HIAA 1T8OA 3Q76A 3B23B 3RMMH 2IPHA 3DT0H 4OS4A 1Y3VA 2JIZD 1RTKA 1O2KA 2ZQ2A 2STBE 5EODA 1GJ7B 4AOQA 1QJ7B 2ZWLH 1SGTA 3HC1A 2SGQE 3LGTA 2PUXB 3FN8A 1E35B 2W7SA 3OSYA 1ELCA 2ZGHA 4D9QA 3T26A 1UVOA 3ZZ8A 3GY8A 3ZZ4A 3SK9A 2ZU1A 1SL3A 1G37A 3PO1C 5E2PA 4X9EA 1BOQA 4B73A 8LPRA 4IN2A 1J8AA 1WAYB 1D3PB 1BJUA 1ETTH 3RXTA 1VCQA 5DG6A 3SYJA 2G55A 4ESTE 4XRNA 1E38B 3ATMA 2Q6GA 1A5HA 1GHVH 2R0LA 2ZGJA 1HB0B 1Z71A 1ZHMA 2OXSA 2EI8A 1KXEA 1O38A 3K65B 2FOGA 2BDCA 2XBYA 2W26A 9ESTA 4SGBE 4ISIH 4AC9A 2OC0A 3K2UA 2VIOA 1Z8GA 1DY9A 2RFKC 2HNTF 2RCEA 5TK6A 1P0SH 2V0BA 1AE5A 2R2MB 1YC0A 1EPTA 4ASHA 1S5SA 1UCYH 4RXOA 2QF0A 1VITH 4CR5A 2VWNA 5K0HA 1ZLRA 5EXNA 1P11E 2WINI 2VWLA 2WYGA 4FUFA 1LO6A 5A0CA 2C8YB 2ZZUH 3NWUA 1F0UA 5LPEA 1F0SA 3VB5A 4INLA 1HUTH 3S7KB 1WYKA 5GNDA 2ZHFH 4CBOA 1C1RA 3EAJA 1P05A 5TKAA 3ZZBA 2ZPQA 4X8VH 1P3CA 3MMGA 3Q3KA 1CBWC 3LGUA 4RKJB 3AVZA 4OGXA 1P03A 3U8TH 1TNKA 3V7TA 1C2DA 2ANWA 3DSPA 1Z8IB 4A1VA 4DG4A 1YCPH 3A87A 1GBAA 4YOGA 3O8RA 4D9RA 3RLWH 1W10U 4BANB 1KYNA 3P8GA 1C4V2 1ELFA 4UFGH 1KSNA 4A1XA 2FYQA 2ZDKA 1DE7H 1QR3E 1GI4A 2R3YA 5PTPA 1SOZA 1VJ9U 1Z7KA 2CMYA 2EQNA 2F9NA 4ABHA 3B9FH 1MTNB 1G32B 2SGAA 4B2BA 4ABFA 3URCA 1DVAH 2F9UA 1NRPH 1NESE 4H42U 1O2OA 3AASA 5F03A 4YXWD 3SZNA 1HYLA 1O2WA 3NXPA 4FVDA 4NFEA 1EAIA 1CA0B 1V2MT 2BQ7B 4RKOB 3TJVA 5E0JA 1NU9A 2DE9A 2HWLB 1W2KH 2PAUA 4WXVA 4Y8ZA 2JKHA 1QURH 1V2QT 2NU3E 2XBXA 1GMDF 4O03A 1YNBA 2EI7A 3DUXH 2SFAA 3V13A 2XCNA 2HVXA 1JIMA 4DCDA 4RXRA 3ZVGA 3WWFA 2ZEBA 1SLUB 1EP6A 2FXRA 1A5IA 3TGJE 1O3CA 4TPIZ 3KQ5A 2J98B 3SJIA 4Q7ZA 2B7DH 3W95A 1FDPA 1ZGIA 1BBRE 4AGKA 3AW0A 2PAQA 1HRTH 4FUBA 1AFEH 2VIPA 1ZZZA 4QG0A 1GHBG 2BD8A 2WUBA 2B0FA 2BB4A 3TH3H 5FPSA 4IC5A 1ZHPA 1ETRH 2Z7FE 3HGPA 2LNCA 4WMDA 5HM9A 2BX4A 1E1QD 2C3SA 3A7WA 3MNXA 3TMDA 2ALVA 3F0OA 1KDQB 3KQCA 3A81A 1UMAH 3E16B 2BLQA 3FZZA 1GI0A 8GCHG 2PKSC 1JXPA 2Q14A 4GLYA 5GIBA 1GBBA 2QA9E 1FAXA 2EC9H 2HNTC 1TBQH 4A7IB 1EJAA 2J98A 3EQ0H 2CF8H 1GL0E 3QO6A 1TGCA 1WQVH 4Q7YA 5JB9S 3ZV9A 4SGAE 1O0DH 2BQWB 5DP5A 2O6IA 4WF8A 4ZHMU 4DT4A 3F9GA 1HAIH 5AHGH 2QY0B 2QC2A 2VINA 1YPMH 2ZGXH 2ZDNA 2F9VA 2ZIQH 2XBWA 4Y6DA 3LONA 3N99A 1ELEE 3BTHE 5F8XA 5HM2A 3H7OA 2KAIA 1QQUA 4M9FA 1BMNH 1QBNA 1Y3YA 3SGQE 3OEED 3NRLA 4TNQA 2O8WA 2PR3A 4ZAEA 3ENSB 1HXFH 4AGJA 3GY6A 1PJPA 1QRWA 4CH8B 1C5RA 1O5EH 2ZCLP 4GHQA 1O36A 2BY9X 1BUIA 5LPFA 2Y7ZA 2F83A 2STAE 4FVBA 3K9XB 3KYGA 3MH7A 4IMQA 4ABDA 5EPNA 1QRZA 2PKAB 2THFB 2V3MA 4HI3A 1LHDH 2J2UA 3MU1A 1K28D 4DGJA 4MZ7A 2OINA 1QHRB 1P04A 2ZDLA 1GMDG 1C5QA 4QQZA 1P2QA 3N7OA 1SQTA 3PMJA 1SGPE 3SNCA 3UUZA 1GGDB 2FESH 1DX5M 5ESTE 2AGGX 2HEKA 1O5GH 3CS7A 1P2IA 1P2JA 1OOKB 3TLOA 4A5TS 1WQSA 1K1NA 2OK5A 2FMJA 3S4LA 1BMMH 1Y8TA 2WUCA 3ZVEA 3MZOA 5GPIB 4X1SU 1BQYA 1GVLA 1JBUH 2CV3A 5A8ZA 1W13U 2BD2A 3DSGA 3NKKA 3A89A 1XVMA 4K8YA 4NA8A 3CCGA 4TNRA 1CHOF 5EQRA 2W6JD 1O2XA 2JETB 3SNDA 1Y3XA 4JZEH 3SO3A 1BTWA 2PKAA 1V2OT 5JDUB 1K1JA 3F2GA 2F9OA 3RXVA 1YBWA 4Y0YE 4MTBA 5AVDA 5FX5A 1GI1A 1IHTH 1Y5BT 2BDIA 2PGBB 2K8IA 3FO8D 4KTUA 4CHAC 1XKBC 2QXIA 3A7XA 3DSOA 1MTVA 2QCYA 1Z6JH 2NU4E 1PPEE 4YO9A 1YM0A 4KELA 1HAGE 1MU6B 2YMSC 5DGJA 1C5YB 1OXGA 1SGFG 3D65E 1BTUA 1D6WA 1OP2A 3SV7A 1D9IA 3I77A 5E2OA 2PV9B 1GHAG 4AFZA 3ITIA 2HPQH 3URDA 4KGAA 1NT1A 1W11U 1KIGH 3TIUA 2CF9H 1LMWB 1E34B 2ZTXA 1WV7H 1HLTH 2WPLS 3M3VA 2I6SA 3FOAA 3ZZ6A 2TGTA 2Z3CA 1ESAA 2P95A 1AB9B 1K1LA 5C5NA 3VEQB 3TMCA 3FP7E 9LPRA 3UIRA 1AIXH 3SU1A 2G51A 1NFUA 2PP6A 3LGYA 4I7YH 1FPCH 2R9PA 1LCYA 6GCHF 1GG6B 4HTCH 1GBMA 2A5KA 1TPSA 1UCYK 2WSSD 4CRDA 2KR7A 3ZYEA 3GYLB 3LGIA 1ZTJA 3E0PB 2GT7A 2QV1A 3SUFA 1LPKB 1H8HD 1QCPA 3UB0A 3SHCH 3F1SB 3P8NA 4XBDA 3F9HA 1TFXA 3DA9B 5FX6A 2K1QA 3JZ1B 1O2PA 3AK5A 1LPZB 2NU0E 3ZZ7A 1GI5A 1O32A 2FTMA 1OWEA 4X8UH 4GSOA 1A2CH 2ZDMA 1MKWH 1DSTA 1THPB 1ARBA 1TBRH 1ZPZA 1UTKA 1GVKB 4VGCC 1UW7A 1XVOA 1GBKA 1MKXH 3KNXA 4YTAA 3MNCA 3SNEA 1BT7A 2AEIH 5AO0A 4GVUA 2CGAA 4UD9H 2WV9A 4FU9A 5JBCS 2CXVA 2D8WA 2WPKS 2XYAA 2A7HA 5AO3A 1N8OB 1JOUB 3N7EA 5EJZA 1CHOG 3RC4A 5L30H 1HAXB 1O3IA 3HGNA 5A8XA 1CGJE 3QN7A 2RA0A 1SGIB 5HYOA 1P3EA 1TOCB 3HK3B 4GCHF 3U8RH 2ZU2A 4HZHA 4ZHAA 3RMLH 3FP8E 3BTDE 5CHAB 3U98H 1LKBA 2Z6BD 1H1BA 3RMNH 4NWKA 1Z1JA 1K0HA 1SGCA 1TA6A 2Y5HA 4QG2A 4WH6A 6CHAB 1F0TA 3SI4H 7ESTE 1KLJH 4YESB 3KGPA 6ESTA 3T27A 1PQ8A 4WVPE 3TU7H 4RSPA 4Y7AA 2QN5T 3FKSD 1L4DA 1O5CB 2XNIA 4K1SA 2ZP0H 4U01A 1GVZA 5HIYA 1ABIH 1ZSLA 4UEHH 2OP9A 2ULLA 1LHGH 1THRH 2YNBA 3A82A 3GCHB 4JYVH 3PM3A 3RXKA 4NCYA 2A4RA 1AZZA 2FYRA 3ODFA 2Q6FA 4E7RG 4TO0A 1S83A 4TO2A 4Y11E 1ANBA 1YLCA 2A32A 4WXIA 3S9BA 2C4FH 1RRKA 3RM2H 1GI7B 1YPKH 3BSQA 1RD3B 1GJ8B 4JZIA 3BTEE 4TNZA 6GCHG 4IN1A 1A1RA 1MZDA 1S6HA 3OAAD 3O8DA 1OP0A 5TK9A 1CSOE 4TNYA 2I6QA 4YLQH 3Q00A 5DP4A 1YGCH 2ZTZA 1O31A 1OSSA 3OYPA 1HAHH 1TX6A 2ZQ1A 3UNRA 4CRFA 4B76A 2O8MA 1HJAB 1NRNH 3BN9A 3D49H 1QJ6B 2VVCA 1EAWA 5FHTA 1P2MA 3TK6A 2VWOA 1TYNA 3UNSA 3I78A 4Q2KA 2XWAA 2ODQA 3RMOH 4K3JA 3M37A 1T8MA 3ZIAD 3BG4B 1F5KU 4Z6AH 4FU8A 1EOLA 2G4UA 3LT3A 4NA7A 4X1PU 1PPZA 1YCPM 2ZPRA 1PPBH 2LPRA 4D7GA 2QF5A 4X6PA 3UOUA 2VB0A 1O3LA 2ZF0H 3BIVH 2FIRH 4Q4LA 4BAHB 6LPRA 1GI3A 3GW7A 2ZNKH 3OFND 1TPAE 1B0EA 1A3BH 2QXGA 4D8NA 1FPHH 2PGQB 3F3BA 3K6YA 3MO3A 2J9NA 5C67A 1D3QB 4GCHG 1QY6A 5AO1A 2B8OH 1ZYOA 1SQOA 4D76A 1Y5UT 2O9QA 5I46H 3QWCH 3H5CB 4KKDA 1XUHA 1SBWA 2HOBA 1SSXA 3CP7A 2BVRH 4HGCA 1F5LA 5J4QA 4X2XA 2WYJA 1GBEA 3MYWA 1UTQA 2A2QH 1RS0A 2GZ4A 2VBCA 2W6ID 1IQFA 5C2ZA 3L33A 4YOJA 1B5GH 3MU0A 3KQBA 2Z9KA 1LPGB 1GL1A 1MD8A 2C90B 7GCHF 1OS8A 4U2WA 4O3TA 2J95A 1AY6H 2HVYB 3EE7A 4I8GA 3RU4E 2XCFA 1FXYA 3FANA 4GAWA 3KL6A 1WCZA 2J92A 5JBTA 3LJOA 1ZPCA 2BVXH 3O8BA 2ZG0H 3SNBA 1ACBE 2UWPA 2Y81A 2SGPE 1EJMA 1MCTA 2XC4A 4AG2A 1W0JD 1TMTH 2ZU3A 1F92A 1RTLA 1OX1A 5C1UA 3M35A 2PSXA 4TO3A
chains in the Genus database with same CATH topology
4QG4A 3KQ5A 4RXQA 4BZBA 4TO6A 1VJ7A 2HEKA 4RXSA 4TNPA 4ZWEA 2DQBA 2CQZA 5TK6A 3SKDA 2PAQA 4XDSA 2IPQX 3S4LA 3U1NA 4QG0A 3MZOA 4QQWA 4L7WA 4QQYA 2FLOA 4RXOA 4R8ZA 5AO0A 3TMBA 3KH1A 3CCGA 1VQRA 4TNRA 3TMDA 4MLNA 4L1JA 4TO5A 2PARA 4Q2DA 4LRLA 5AO3A 1YOYA 4QG1A 5AO2A 4QQZA 3GW7A 2Q14A 3BG2A 4RXPA 5AO4A 5TKAA 5AO1A 4QQXA 4ME4A 3P3QA 3I7AA 2O08A 4QG2A 3IRHA 4QFYA 5TK8A 4TNXA 3HI0A 2O6IA 4TO1A 2PGSA 3NR1A 4QFZA 4MCWA 3TM8A 4Q7HA 3M1TA 2GZ4A 1U6ZA 3NQWA 4MLMA 4DMBA 3HC1A 4Q2CA 4ZWGA 4TNQA 3TMCA 4BZCA 2OGIA 4TO0A 4TO2A 3SK9A 4L7EA 4X9EA 4TO4A 4L1JB 1XX7A 5TK7A 2PAUA 2PQ7A 4QFXA 3MEMA 4TNZA 1YNBA 4MZ7A 3RF0A 4N71A 3LJXA 5TK9A 4N6WA 4RXRA 4TNYA 4MDZA 4TO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPQ X;  3KQ5 A; 
#chains in the Genus database with same CATH topology
 1COW D;  1EPT B;  1VKY A;  3QX5 H;  4BZB A;  1QRX A;  1FI8 A;  1XM1 A;  4I8H A;  4NSV A;  2J4I A;  3ATI A;  4O3U A;  1A5G H;  1C2K A;  5HKK D;  3BTM E;  3GOV B;  2P8O B;  2VIQ A;  2PWX A;  1JIR A;  4HG6 A;  1GI2 A;  5DP3 A;  3DFJ A;  1AND A;  1V2W T;  4RT1 A;  2FTL E;  3LU9 B;  5JPM H;  1JWT A;  1QQ4 A;  4I32 A;  5K7R A;  2GMT B;  2BY7 X;  4K1E A;  1V2N T;  4ZKO U;  1O3E A;  4FUH A;  4CRE A;  2JDI D;  5EJL A;  1EXF A;  2FLO A;  4WME A;  5KED A;  1J14 A;  1QNJ A;  4CRB A;  1DUA A;  1BMA A;  3ZZ9 A;  1Y3U A;  2WZQ A;  1HGT H;  1YLD A;  2W3I A;  2GJG A;  3JZ2 B;  1C2G A;  1NN6 A;  2BDH A;  1MTU A;  1SMF E;  3URE A;  1T31 A;  4YT7 H;  1IAU A;  5KGO A;  2O8L A;  1TX7 A;  2P94 A;  1GHB F;  1GBJ A;  4IC6 A;  1ABJ H;  1VGC C;  1TNH A;  5EQQ A;  5E0H A;  1W7G H;  3FZD A;  1WDI A;  1IQL A;  3PRB A;  5IK2 D;  1DDJ A;  1O3D A;  1TRN A;  3ZVF A;  5EXM A;  3T25 A;  1ZJD A;  2HAL A;  4XD7 D;  4QFY A;  1HAV B;  4TYD A;  5E0G A;  5KEC A;  3LOX A;  5DKM A;  1K1O A;  4TO1 A;  3A88 A;  1TGN A;  2J94 A;  3HAT H;  8GCH F;  4ZHL U;  1GMH F;  1V2U T;  3KHV A;  4E05 H;  1AWH B;  2AMP A;  4H4F A;  3SJ8 A;  1H8D H;  5JYI A;  1TRM A;  4WJG 2;  3TM8 A;  3F6U H;  3LC5 A;  4ZUH A;  2IN2 A;  1YPG H;  2O8T A;  3TJO A;  2GV7 A;  1AKS B;  2V7Q D;  3VGC B;  3LPR A;  2ZO3 H;  5CMX H;  1BTY A;  2J97 A;  7GCH G;  5DJ7 A;  4YOI A;  2HGT H;  1CGH A;  3BG8 A;  1CT4 E;  2Y5F A;  3OE7 D;  3M3T A;  4L1J B;  1O3B A;  3NPS A;  1C1M A;  4YZU A;  3LKW A;  3PLP A;  4K5Z A;  3SU4 A;  5BRR E;  5C1X A;  4QFX A;  1P8V C;  2TPI Z;  1W8B H;  5LGO A;  4NIX A;  1JRS A;  2BD9 A;  1ZTL A;  3IIT A;  3F9E A;  1EOJ A;  2Z9L A;  4DII H;  2P3U B;  1HAV A;  2UUJ B;  1VR1 H;  1U6Q A;  2OUA A;  3PO1 B;  3U9A H;  1TQ0 B;  1E1R D;  1TMU H;  5FBE A;  4MDZ A;  1FUJ A;  2WHX A;  2G5N A;  2BHG A;  4QG4 A;  1YPL H;  3CEN A;  3Q3X A;  2BX3 A;  1N1L A;  2XOK D;  4GPG A;  3UWI A;  3SU0 A;  3DD2 H;  3MNB A;  3MTY A;  5GXP A;  4AFS A;  1K1M A;  1AD8 H;  4MNV A;  2GCH G;  1DAN H;  3WY8 A;  1MUE B;  1AKS A;  1P12 E;  4WWY A;  1A46 H;  1C5Z B;  4BXW A;  2VU8 E;  5G4B A;  4QQY A;  1AE8 H;  1JRT A;  1S0R A;  3VB7 A;  3UTU H;  2FOC A;  1S81 A;  1P2N A;  3SV8 A;  4A1T A;  2EI6 A;  1DUE A;  5A09 A;  1HFD A;  4L1J A;  3SQH E;  1FON A;  2F91 A;  1ZPB A;  2ZFQ H;  2VWM A;  4XBB A;  1DY8 A;  1BHX B;  2PTC E;  2ZU4 A;  2BM2 A;  2FWW A;  3ATK A;  4Y7B A;  4ABI A;  4DIH H;  1XKA C;  4UFE H;  4ZCN A;  5C0T A;  1ESB A;  2D1J A;  3T5F H;  3OX7 U;  1GI8 B;  1C1S A;  1NBM D;  2AER H;  3F2F A;  1SFI A;  1FX0 B;  4K69 A;  2BDG A;  2KAI B;  3SHA H;  4TY6 A;  2VGC C;  2Z3E A;  3T2N A;  4ZKN U;  1L4Z A;  1EST A;  1ELB A;  1O3F A;  4MNY A;  3NR1 A;  3A8C A;  1LVB A;  3GY2 A;  3QLP H;  1CBW B;  1K1I A;  5A8Y A;  1GMH G;  1QZ8 A;  2QXJ A;  4Q7H A;  1SQA A;  4ZKR U;  4GHT A;  7LPR A;  3RM0 H;  4JK5 A;  2TGA A;  4Z0K A;  5DN6 D;  4IS5 A;  5FCK A;  1QL7 A;  3MH4 A;  1W0Y H;  4Y71 A;  2FOH A;  1CE5 A;  3LGW A;  4IW4 E;  3IG6 B;  3SUD A;  4TT3 D;  4B71 A;  4RI0 A;  5HIZ A;  1PPG E;  3LH1 A;  1O2U A;  3GCN A;  1KTS B;  4XE4 A;  1YYY 1;  1AMH A;  1GHA F;  2G52 A;  3E0N B;  5DK1 A;  1ETS H;  3LGV A;  4ISN A;  1H9L B;  1G3C A;  2ILN A;  5GDS H;  3GDS A;  3MEM A;  1A0L A;  1O37 A;  4D7F A;  3SGA E;  1G30 B;  1MAX A;  2W7U A;  2SGF E;  2UUY A;  5C0U A;  4E7N A;  1QB1 A;  2KZ4 A;  2CHA B;  4NIY A;  1WTH D;  1C9P A;  1L2E A;  4FUC A;  1AFQ C;  2GTB A;  4I8J A;  2ODP A;  3E1X B;  2J34 A;  4CH2 B;  3VB4 A;  2QYI A;  3GY3 A;  1JMO H;  2JJ2 D;  3UOP A;  4XFQ A;  3GYM A;  1GBI A;  3RXU A;  1MCV A;  1O3M A;  1B0F A;  2BQ6 B;  3UQV A;  5DP9 A;  2M5T A;  3MO9 A;  4OS2 A;  1PYT D;  1AVX A;  3OTJ E;  1EAX A;  1YPJ H;  3A8B A;  4XDE A;  3RXA A;  1LVO A;  2FLB H;  3W94 A;  2GX4 A;  4J2Y B;  2C93 B;  4QQW A;  2A4O A;  1VJA U;  2GCT C;  2M2A A;  3R0F A;  1MBM A;  2KCA A;  3T29 A;  1P10 A;  4GUX A;  4JZD H;  3SU3 A;  1HAP H;  1NPM A;  3EA7 A;  3KQD A;  1AI8 H;  1VCP A;  2A1D B;  1AVW A;  1A4W H;  2FX4 A;  2ANK H;  4JK6 A;  4FOU C;  1ZRK A;  2P3F H;  3TH2 H;  2ZCH P;  3P8O A;  1GDN A;  1FJS A;  4Y10 E;  1GCT C;  1KTT B;  1L1G A;  1IQK A;  4AFU A;  1E37 B;  2ASU B;  2ZHW H;  1TAW A;  8KME 2;  4WY3 A;  4B1T A;  3I7A A;  1XUK A;  1FIZ A;  4B2C A;  1IQJ A;  1DXP A;  1DIT H;  1L1N A;  1C5X B;  1WOF A;  4Q80 A;  4FUJ A;  1S82 A;  1ZSK A;  2V35 A;  3Q77 A;  1Q3X A;  5TK8 A;  2ZHE H;  3GS9 A;  1S85 A;  5C3N A;  5TCA A;  1CT2 E;  1SGD E;  3SI3 H;  3MOC A;  2QIQ A;  4I31 A;  1V2S T;  1Y59 T;  2W5E A;  2OCV B;  1SFQ B;  5T6D A;  1FZZ A;  1LTO A;  4NWL A;  3PV4 A;  3VFE A;  2EY4 C;  4ASU D;  2YOL A;  2A4Q A;  4CRC A;  1U6Z A;  1HCG A;  2JH6 D;  2LEL A;  3SW2 B;  2A5I A;  3TGI E;  1VCW A;  1O2Y A;  4Q2C A;  5IDK A;  1A3E H;  1GBD A;  4MPV A;  1IQI A;  2BD3 A;  2ZCK P;  3TNS A;  2AMD A;  4MLF B;  1O5B B;  1O2Z A;  4XSK U;  4B6E A;  3RXP A;  1GDQ A;  2A5A A;  2FP7 B;  3MNS A;  3ZZ5 A;  2OQ5 A;  4F4O C;  3PMB B;  3R3G B;  1CHG A;  1UVS H;  2PUQ H;  3SU5 A;  3ZVD A;  1GBH A;  1O3K A;  2ZFF H;  2FX6 A;  1G36 A;  4ABA A;  3GIC B;  1O3N A;  1XUF A;  4TO6 A;  2J5U A;  4AB9 A;  1BDA A;  3M36 A;  3L3T A;  4NGA H;  5LPR A;  4RT0 A;  4TNP A;  1V2P T;  2AS9 A;  1RXP A;  1BIT A;  4P00 A;  3MU8 A;  3QZR A;  1NU7 B;  2SNW A;  1BBR H;  1AGJ A;  2IPQ X;  1DWB H;  1EP5 A;  1C5P A;  1MMJ N;  1SGN E;  1AUT C;  3ELA H;  3OEH D;  3HPT B;  4R0I A;  3ZZC A;  1H8I H;  2KX4 A;  1TGB A;  1O2S A;  1QGF A;  4BOH A;  3MQK C;  2XC0 A;  1KXC A;  3A7Y A;  4BAO B;  3BEF B;  1K22 H;  3LJJ A;  1ELD E;  2Q1J A;  3Q3Y A;  2ZTY A;  3UNQ A;  1SHH B;  2RDL A;  3SN8 A;  1MD7 A;  4IMZ A;  1LQD B;  4TWW A;  3P6Z B;  1SHY A;  2ZA5 A;  3I29 A;  3SQE E;  5A0B A;  4QQX A;  5JBA S;  1LHF H;  2CK3 D;  3BTT E;  3SOS A;  2H9E H;  2SNV A;  4X6O A;  5T3H A;  2FI3 E;  1YCP K;  2GZ8 A;  1QJ1 B;  1UK3 A;  1RIW C;  1GJC B;  1DIC A;  1TAL A;  5TJX A;  1BML A;  3MH5 A;  1IQM A;  1GJD B;  5EJ1 A;  1HPG A;  2P93 A;  2ZGB H;  4CHA B;  4K2Y A;  1K2I 1;  2Z9J A;  1XUI A;  2FLR H;  4X1N U;  4OGY A;  4M7G A;  4THN H;  1HJA C;  3M5M A;  2G8T A;  1O34 A;  5EW2 H;  4X2Y A;  4I8L A;  4ACB A;  1HJ8 A;  1ZHR A;  1J9C H;  2YMS B;  3N7D A;  5TCC A;  4LZ4 B;  1DWD H;  5C1Y A;  1BJV A;  1SI5 H;  2AIP A;  3GCT F;  2JH5 D;  2ZDA H;  2WV4 A;  1ANE A;  1GBC A;  1GBT A;  2HLC A;  1TAB E;  2TGD A;  2BOH B;  3HK6 B;  3PV2 A;  3QGJ A;  2KCO A;  1A61 H;  4AB8 A;  3SNA A;  1EKB B;  3H09 A;  1IQN A;  1DOJ A;  1O2H A;  2QE7 D;  5F53 A;  3M3S A;  1BIO A;  1QBO A;  2ODY B;  2FS9 A;  4YT6 H;  1H4W A;  2XC5 A;  1O3G A;  4N6W A;  1AQ7 A;  2A4G A;  2EST E;  1ELA A;  2OC8 A;  5ESB A;  8EST E;  1EZX C;  1O35 A;  1KLT A;  1YKT A;  5F8Z A;  2BXU H;  2H5D A;  1BRU P;  3GY4 A;  3MI4 A;  5EOK A;  4OM9 A;  4ACA A;  1Y5A T;  3ATW A;  1DWC H;  3BTG E;  5DPA A;  5HGG A;  2VH0 A;  2BY8 X;  4XDS A;  1C9T A;  1EFR D;  2V3O H;  2UUK B;  3NK8 A;  1P9S A;  1DT2 A;  3FFG A;  1UTN A;  1UCY E;  3PYH A;  2TRM A;  2GDD A;  1QTF A;  1ZR0 A;  2C8Z B;  2FS8 A;  3E3T A;  1VZQ H;  1V2K T;  2BD4 A;  3STI A;  1CA8 B;  1C5W B;  4VGC B;  3RXG A;  4X8S H;  1TGS Z;  3RXF A;  2JJ1 D;  1SC8 U;  4KTC A;  1A7S A;  3S69 A;  1SLW B;  1SQR A;  2UWO A;  4TWY A;  5DSF A;  5AO4 A;  3ZZ3 A;  3EE0 B;  2ZGC A;  4ME4 A;  4LZ1 H;  3BEU A;  1K9O E;  3OTP A;  1FN6 A;  1SGF A;  2FOM B;  2FI5 E;  3RDZ A;  3VB3 A;  2PHB A;  5E8E H;  5HMA A;  3A8D A;  5JBB S;  2WPJ S;  1ELG A;  2ZPS A;  4R8T B;  4B2A A;  2PFE A;  3PLB A;  3TVJ B;  1F2S E;  1C1W H;  1V2R T;  3MWI U;  2TIO A;  2CJI A;  3RXO A;  1GI6 A;  1SGR E;  1NM6 A;  2P8O C;  1CO7 E;  3CS0 A;  1H9H E;  1TNJ A;  1VIT F;  3TJU A;  1W14 U;  3V3M A;  3SV2 H;  4O97 A;  1MAY A;  2WPI S;  3PMA B;  5GWZ A;  2AGE X;  1YF4 A;  3GCT G;  1EAU A;  2OBQ A;  1C5S A;  3VG8 A;  1T7C A;  2B9L A;  2OC7 A;  4MQA A;  1C5L H;  3QGN B;  3VXE H;  1EZQ A;  1XX7 A;  3WWB A;  2R0K A;  2BZ6 H;  4TPY A;  1FV9 A;  1WU1 A;  4INH A;  2HRV A;  1Z6E A;  1AU8 A;  1L0Z A;  3RXI A;  2ALP A;  1KY9 A;  4Z1M D;  2XTT B;  3UAI C;  1TGT A;  1CU1 A;  1GHZ A;  3U8O H;  1H9I E;  2Q6D A;  1PFX C;  1ZJK A;  1DLE A;  5H4I B;  3EA8 A;  4DY7 B;  3MHW U;  4P02 A;  3RXB A;  4B75 A;  1C1U H;  1MU8 B;  1O2M A;  1QL9 A;  1AVG H;  1YY3 A;  1ZGV A;  4MVN A;  4RXS A;  3M5N A;  4ZWE A;  3E91 A;  4X0W U;  5C5O A;  5F6M A;  1TOM H;  1O2I A;  3UQO A;  1HAY B;  1NO9 H;  3D62 A;  1TNL A;  4PRO A;  1NZQ H;  3BTF E;  1A0J A;  1UJ1 A;  4F55 A;  1DSU A;  3PWB A;  1HNE E;  2D26 C;  5DP8 A;  1F0R A;  3RLY H;  5SGA E;  4L7W A;  4MNW A;  1SGE E;  1EAT A;  4JCN A;  3TNT A;  4ZMA H;  1UTM A;  4FUE A;  1NY2 2;  3F9F A;  3QZQ A;  1G3B A;  1YOY A;  2EA3 A;  1NFY A;  1T4U H;  1QB9 A;  2GCH F;  3QDZ B;  1EB1 H;  2GDE H;  4B6F A;  1KLI H;  2BXT H;  3NCL A;  1Z8R A;  4BNR A;  3TJN A;  2QAA A;  1GHW H;  1GWA A;  1V2T T;  2Y80 A;  2Z94 A;  3U1J B;  2H1U A;  4JZF H;  2G00 A;  1KXF A;  1MBQ A;  4JMY A;  2ZFP H;  1O2T A;  2Y82 A;  1UHB A;  2FO9 A;  1HJ9 A;  3VPK A;  3RXM A;  1MTN C;  1DXW A;  3TGK E;  5B6L A;  1C5U A;  3SOR A;  1BRA A;  5B6O A;  1DWE H;  1GJB B;  4JZ1 A;  4OS6 A;  2UUF B;  5L2Y H;  2Y6T A;  5EPY A;  4MCW A;  4NZL A;  5T1V A;  4AOR A;  2B5T B;  3KID U;  2VID A;  3V12 A;  3M1T A;  1CA0 C;  1O33 A;  3PTB A;  1BZX E;  4E06 H;  1FY4 A;  2AHM E;  5BPE A;  3SZE A;  4UFD H;  2QGR A;  3AAV A;  2NU1 E;  1GJ5 H;  2DUC A;  5EIY A;  2BMG B;  1VIT G;  2OGI A;  3B8J A;  1C5M D;  4ABE A;  5GCH F;  1BBR K;  4L7E A;  3EDX B;  3KEE A;  1LHE H;  2FOA A;  1LDT T;  1D6R A;  3A8A A;  1CT0 E;  3A7V A;  2PQ7 A;  5HXF A;  1AO5 A;  3QK1 A;  2OC1 A;  2WPM S;  1BTX A;  1O2R A;  3RC5 A;  2VIV A;  2DE8 A;  4NA9 H;  4N71 A;  1BRB E;  3LJX A;  1NRR H;  5DO4 H;  2A2X H;  1XMN B;  4AZ2 B;  2AGI X;  2C8X B;  1PQ7 A;  4ZKS U;  3SJK A;  5C94 A;  1IHS H;  3UPE A;  1MKW K;  1YWU A;  5A0A E;  3SJ9 A;  2WV5 A;  2UWL A;  2VVV A;  3GY7 A;  4X6N A;  1P01 A;  1P2O A;  2FI4 E;  1IQG A;  1MKX K;  5EG4 A;  2ZKS A;  3ATL A;  1TX8 A;  4TY7 A;  3WW7 A;  4OS1 A;  3M7T A;  1N6Y A;  1F7Z A;  3A86 A;  4ZXX H;  1W0K D;  3V0X A;  2BLW A;  4IGD A;  4R8Z A;  1BA8 B;  2FOE A;  2VNT A;  3AW1 A;  3M7U A;  1IQH A;  2P59 A;  3ZVB A;  1NRO H;  4ZRO A;  1P57 B;  1Y3W A;  2A0Q B;  1T8N A;  3PRD A;  4XBC A;  4A6L A;  2OBO A;  1NS3 A;  1O2V A;  3SU6 A;  1RGQ A;  4UON A;  2FOF A;  1GDU A;  3GCO A;  1HBT H;  2F43 B;  1BRC E;  1XXD A;  3ZZD A;  1P2K A;  1IOE A;  3SUG A;  2IJD 1;  4O9V A;  3IRH A;  1F5R A;  1E36 B;  1OYQ A;  4TNX A;  2CHA C;  3RXR A;  4BAM B;  1C5V A;  3BTW E;  3RXD A;  3CNR A;  3SUE A;  1O2Q A;  2ZEC A;  1VGC B;  1ZML A;  2R2W U;  3M7Q A;  2PGS A;  1EQ9 A;  1BTZ A;  3RP2 A;  1TQ7 B;  3QUM P;  1KXB A;  1V2V T;  1IQE A;  5A2M H;  1ANC A;  1ELV A;  1O2N A;  4DMB A;  4TSF D;  1FMG A;  5CE1 A;  3GIS B;  1OWJ A;  1BTP A;  5EXL A;  1V2L T;  1DLK B;  2BD5 A;  2Y5G A;  4X1R U;  3U1I B;  3UFA A;  2KFW A;  3DCL A;  4H6T A;  1FY3 A;  1INC A;  1GGD C;  5GCH G;  2NU2 E;  2V6N A;  1UTO A;  1J15 A;  3STJ A;  1EX3 A;  1K1P A;  1LHC H;  2WPH S;  1C5N H;  1UTL M;  1QL8 A;  1SGQ E;  5FPT A;  4LOY H;  3ODD A;  1C2L A;  1N6X A;  4KP0 A;  2ZFT A;  3ZYD A;  1O3J A;  4QT8 C;  2F9B H;  1AHT H;  1S6F A;  3S7H B;  1O5A B;  2GT8 A;  1CVW H;  7KME H;  5C20 A;  2A7J A;  1UVP A;  2BZA A;  3P17 H;  1P02 A;  1C5O H;  1SOT A;  1C1V H;  2ZC9 H;  3T62 A;  4I86 A;  3SKD A;  1TLD A;  4AYV B;  4FUD A;  4MNX A;  2BD7 A;  2F3C E;  3RUO A;  2JET C;  2VVU A;  2SGD E;  1W12 U;  1UK2 A;  4ABJ A;  2FDA A;  3HKJ B;  2BY5 X;  1PQ5 A;  5GJ4 B;  1O3H A;  4Y76 A;  2OLG A;  1GHY H;  3M5L A;  4B74 A;  4Q63 A;  4AX9 H;  3TPI Z;  2FOB A;  4MLN A;  1ID5 H;  1C2J A;  1YPH E;  3EGK H;  1BB0 B;  5JB8 S;  5AO2 A;  2FPZ A;  1PPH E;  4K1T A;  2A7C A;  5EQS A;  3FVF B;  5F8T A;  3D23 A;  2KCY A;  1TNI A;  2BLO A;  4CBN A;  1MH0 A;  4MPU A;  1FLE E;  3P3Q A;  3P70 B;  3SJO A;  3NZI A;  4XOJ A;  1E0F D;  1Q31 A;  4DJZ B;  5EU8 A;  1KDQ A;  1WUN H;  1HAO H;  3E8L A;  3L6P A;  4KTS A;  5L2Z H;  2Z9I A;  1L1J A;  3TIT A;  3HI0 A;  1SLX B;  1HAZ B;  2PTN A;  3FAO A;  1AB9 C;  1TRY A;  2RG3 A;  4BTT B;  1T8L A;  5IYT A;  3F68 H;  4DVA U;  2XWB I;  3UY9 A;  4CR9 A;  1GG6 C;  1PQA A;  2VGC B;  1M9U A;  1NC6 A;  2G81 E;  5T6F A;  2J38 A;  1D4P B;  1O2J A;  4ZWG A;  1QFK H;  1S0Q A;  3S0N A;  2PKS B;  1QB6 A;  1YLN A;  3S9A A;  1P9U A;  1C4U 2;  4TO4 A;  3VB6 A;  1C4Y 2;  1ZRB A;  1S6L A;  2F4L A;  2G5V A;  2H6M A;  1G3D A;  1NBM E;  2XND D;  2ANY A;  2ZU5 A;  3E90 B;  1AWF H;  2P3T B;  1EJN A;  1G9I E;  1OYT H;  1YPE H;  2Z3D A;  1P06 A;  4K60 A;  2V3H H;  4BXS A;  3RF0 A;  5DP7 A;  3SU2 A;  1XX9 A;  1GMC F;  1SR5 C;  1HV7 A;  3MU4 A;  3QTV H;  1FY5 A;  3F0P A;  1FIW A;  4RXQ A;  1DPO A;  1FN8 A;  4WH8 A;  3TH4 H;  1GJA B;  1OHH D;  2IOT A;  1OWI A;  3UWJ H;  1LVY A;  5ETX A;  1O39 A;  1QBV H;  2XXL A;  2XRC A;  2FEQ H;  5CDF E;  3MU5 A;  1AFQ B;  3W1E A;  1FNI A;  3EA9 A;  4F49 A;  1N8O C;  5DP6 A;  3U1N A;  1GHX H;  1S84 A;  1C1N A;  3A84 A;  2L74 A;  1RJX B;  1BCU H;  1SVP A;  2AMQ A;  3RXQ A;  5CHB A;  1GPZ A;  4YM9 A;  3KN2 A;  3PWC A;  3TMB A;  4NZQ A;  4ISL A;  5CHA C;  2H5C A;  1OKX A;  3GDV A;  4BAK B;  3LH3 A;  1WTG H;  1V3X A;  3BIU H;  3PV5 A;  1DS2 E;  1O2G H;  4LK4 A;  1GI9 B;  3M5O A;  1ZTK A;  6CHA C;  5EGM A;  2GCT B;  4OS5 A;  1C2F A;  4BAQ B;  1UO6 A;  4NSY A;  2O8U A;  2Y7X A;  1OWK A;  4J1Y A;  4FET A;  1FY1 A;  2PSY A;  3ZV8 A;  4RXP A;  1BTH H;  2H9T H;  3RXH A;  3TK5 A;  1OWH A;  1TPP A;  1MTS A;  4BTI B;  1GBF A;  1KMH B;  1NFX A;  2GGV B;  3HKI B;  4LXB H;  2XBV A;  2ZHD A;  1TE0 A;  1AN1 E;  3A80 A;  3GCH C;  4ABG A;  1GCT B;  3P8F A;  3A7T A;  4MPX A;  3A7Z A;  1NRS H;  1W3C A;  2XW9 A;  1P09 A;  3LC3 A;  4AFQ A;  1QA7 A;  4QFZ A;  1UK4 A;  3IWM A;  4CRA A;  3RXS A;  1B7X B;  4A92 A;  1SKY E;  3RXJ A;  3ZZA A;  2BY6 X;  3VXF H;  1D3D B;  3OU0 A;  3EYD A;  4I8K A;  3KYF A;  2GP9 B;  3MH6 A;  1G2L A;  3OY6 U;  2BOK A;  4CRG A;  5LH8 A;  1EAS A;  2HPP H;  2BLV A;  4X2W A;  2FM2 A;  4UFF H;  1LVM A;  1C1O A;  1XUG A;  2AYW A;  4Y8Y A;  1OPH B;  3KQE A;  1CQQ A;  1LQE A;  1XXF A;  2TBS A;  1C1T A;  4JYU H;  4FXG H;  1LKA A;  3SV6 A;  3A83 A;  4Y79 A;  2R3U A;  2ZI2 H;  1UTJ A;  1TIO A;  4NIW A;  2GZ7 A;  1KXA A;  1GMC G;  3G01 A;  2BDB A;  1VJ7 A;  3DFL A;  4MDS A;  1SG8 B;  1TMB H;  4FUG A;  1WXR A;  3BG4 C;  2VJ1 A;  4Y8X A;  4X2V A;  1FY8 E;  1GJ6 A;  1SGY E;  5FAH A;  4DUR A;  2CQZ A;  5L6N H;  1DM4 B;  2VH6 A;  4Y0Z E;  1QIX B;  5T6G A;  2GV6 A;  1PPC E;  1NRQ H;  2JH0 D;  1UVU H;  1G2M A;  4NIV A;  5EW1 H;  2WPD D;  2BDA A;  4X1Q U;  1YPH C;  2QF4 A;  2ZHQ H;  1C1Q A;  2ANM H;  2FZZ A;  2H9H A;  1G3E A;  1FAK H;  4FUI A;  1HXE H;  3KH1 A;  1VQR A;  1KXD A;  1X7A C;  4MPW A;  4F48 B;  4ZH8 A;  4X6M A;  4U30 A;  4LRL A;  4ISH H;  3BTQ E;  2GVF A;  1YP9 A;  2KM0 A;  3UR6 A;  2LP6 A;  1THS H;  3T28 A;  1DFP A;  1C2I A;  1ORF A;  2G4T A;  3RU4 D;  3C27 B;  1O5D H;  2H2Z A;  2D2D A;  1W7X H;  2GD4 B;  3PMH B;  1OWD A;  4OS7 A;  5AFZ H;  1O5F H;  1AZ8 A;  2GKV E;  5FPY A;  1UTP A;  2YNA A;  5FL7 D;  1TON A;  3BF6 H;  3EST A;  1D3T B;  2W3K A;  5J4S A;  4JYT A;  2Z9G A;  2BYA X;  3F2H A;  2IJO B;  1TA2 A;  3MFJ A;  3SV9 A;  1NFW A;  1TWX B;  2BTC E;  1EZS C;  1QA0 A;  1GJ9 B;  1V6D A;  1MAB B;  1SB1 H;  1TNG A;  1RTF B;  2HLD D;  1E79 D;  1HDT H;  1RFN A;  1TB6 H;  5FCR A;  3SBK A;  1J16 A;  3M61 U;  1ZMN A;  1RIW B;  2AH4 X;  3NQW A;  1MQ5 A;  2VIW A;  4MLM A;  4K8B A;  5ABW A;  4NFF A;  2QXH A;  3A85 A;  1FQ3 A;  4RN6 A;  1O2L A;  5FBI A;  3U69 H;  3LDX H;  5AF9 H;  1GJ4 H;  1J17 T;  4BZC A;  2CN0 H;  1C2H A;  1EUF A;  4AG1 A;  1OP8 A;  3OY5 U;  4I33 A;  1C5T A;  2KCP A;  1C2E A;  2RDE A;  3BTK E;  3PLK A;  2NWN A;  3RXL A;  3LIW A;  1BHX F;  1EPT C;  4IBL H;  1O30 A;  1V2J T;  2TGP Z;  2FOD A;  5TK7 A;  2PW8 H;  1K21 H;  3QTO H;  4U32 A;  3S9C A;  1W0Z U;  1ZMJ A;  1H8E D;  2A31 A;  1O3O A;  3NUM A;  2AFQ B;  2K0Q A;  3P92 A;  3ZVC A;  1BMF D;  4DW2 U;  3E6P H;  3BV9 B;  4UDW H;  4AYY B;  1TBZ H;  2OD3 B;  1Q2W A;  2PAR A;  1WBG B;  2ZDV H;  3DHK H;  1T32 A;  2GMT C;  1C1P A;  3AAU A;  4X8T H;  1O3A A;  2BVS H;  4INK A;  3TK9 A;  1GCD A;  3SGB E;  4AN7 A;  1AUJ A;  2ZFS A;  4NG9 H;  4Q7X A;  1SLV B;  2DQB A;  3O8C A;  3P95 A;  1ZSJ A;  2AIQ A;  2BDY A;  4H6S B;  4WMF A;  1HIA B;  3RXE A;  2SGE E;  2RA3 A;  4HFP B;  5C17 A;  1A0H B;  4UE7 H;  1ARC A;  1O3P B;  3FP6 E;  3C1K A;  1MTW A;  1ELT A;  1XUJ A;  4ZXY H;  3PRO A;  1ZOM A;  1SPJ A;  4DT7 B;  3U28 C;  3GY5 A;  4ISO A;  4DOQ A;  4TO5 A;  4Q2D A;  4ABB A;  2OQU A;  4FU7 A;  1TPO A;  1UHB B;  2L6O A;  3K6Z A;  3KCG H;  4QG1 A;  1C2M A;  3RC6 A;  1EZU C;  1GBL A;  3H7T A;  2GZ9 A;  3MO6 A;  3PB1 E;  3RXC A;  1PYT C;  4MG3 A;  2PLX A;  3BEI B;  3KF2 A;  3PTN A;  3BG2 A;  1Z1I A;  1UVT H;  1NTP A;  3ZVA A;  1Z8J B;  2QF3 A;  2O08 A;  1MQ6 A;  2F9P A;  5FXL A;  1EB2 A;  1CGI E;  3GDU A;  2OTV A;  3UR9 A;  1MZA A;  1PPF E;  2C8W B;  4BTU B;  1T4V H;  5AFY H;  2YMS D;  2ZFR H;  2EEK A;  2P16 A;  3VGC C;  5I25 A;  2HNT E;  3RU4 T;  4YLU A;  1WSS H;  2A45 B;  1HIA A;  1T8O A;  3Q76 A;  3B23 B;  3RMM H;  2IPH A;  3DT0 H;  4OS4 A;  1Y3V A;  2JIZ D;  1RTK A;  1O2K A;  2ZQ2 A;  2STB E;  5EOD A;  1GJ7 B;  4AOQ A;  1QJ7 B;  2ZWL H;  1SGT A;  3HC1 A;  2SGQ E;  3LGT A;  2PUX B;  3FN8 A;  1E35 B;  2W7S A;  3OSY A;  1ELC A;  2ZGH A;  4D9Q A;  3T26 A;  1UVO A;  3ZZ8 A;  3GY8 A;  3ZZ4 A;  3SK9 A;  2ZU1 A;  1SL3 A;  1G37 A;  3PO1 C;  5E2P A;  4X9E A;  1BOQ A;  4B73 A;  8LPR A;  4IN2 A;  1J8A A;  1WAY B;  1D3P B;  1BJU A;  1ETT H;  3RXT A;  1VCQ A;  5DG6 A;  3SYJ A;  2G55 A;  4EST E;  4XRN A;  1E38 B;  3ATM A;  2Q6G A;  1A5H A;  1GHV H;  2R0L A;  2ZGJ A;  1HB0 B;  1Z71 A;  1ZHM A;  2OXS A;  2EI8 A;  1KXE A;  1O38 A;  3K65 B;  2FOG A;  2BDC A;  2XBY A;  2W26 A;  9EST A;  4SGB E;  4ISI H;  4AC9 A;  2OC0 A;  3K2U A;  2VIO A;  1Z8G A;  1DY9 A;  2RFK C;  2HNT F;  2RCE A;  5TK6 A;  1P0S H;  2V0B A;  1AE5 A;  2R2M B;  1YC0 A;  1EPT A;  4ASH A;  1S5S A;  1UCY H;  4RXO A;  2QF0 A;  1VIT H;  4CR5 A;  2VWN A;  5K0H A;  1ZLR A;  5EXN A;  1P11 E;  2WIN I;  2VWL A;  2WYG A;  4FUF A;  1LO6 A;  5A0C A;  2C8Y B;  2ZZU H;  3NWU A;  1F0U A;  5LPE A;  1F0S A;  3VB5 A;  4INL A;  1HUT H;  3S7K B;  1WYK A;  5GND A;  2ZHF H;  4CBO A;  1C1R A;  3EAJ A;  1P05 A;  5TKA A;  3ZZB A;  2ZPQ A;  4X8V H;  1P3C A;  3MMG A;  3Q3K A;  1CBW C;  3LGU A;  4RKJ B;  3AVZ A;  4OGX A;  1P03 A;  3U8T H;  1TNK A;  3V7T A;  1C2D A;  2ANW A;  3DSP A;  1Z8I B;  4A1V A;  4DG4 A;  1YCP H;  3A87 A;  1GBA A;  4YOG A;  3O8R A;  4D9R A;  3RLW H;  1W10 U;  4BAN B;  1KYN A;  3P8G A;  1C4V 2;  1ELF A;  4UFG H;  1KSN A;  4A1X A;  2FYQ A;  2ZDK A;  1DE7 H;  1QR3 E;  1GI4 A;  2R3Y A;  5PTP A;  1SOZ A;  1VJ9 U;  1Z7K A;  2CMY A;  2EQN A;  2F9N A;  4ABH A;  3B9F H;  1MTN B;  1G32 B;  2SGA A;  4B2B A;  4ABF A;  3URC A;  1DVA H;  2F9U A;  1NRP H;  1NES E;  4H42 U;  1O2O A;  3AAS A;  5F03 A;  4YXW D;  3SZN A;  1HYL A;  1O2W A;  3NXP A;  4FVD A;  4NFE A;  1EAI A;  1CA0 B;  1V2M T;  2BQ7 B;  4RKO B;  3TJV A;  5E0J A;  1NU9 A;  2DE9 A;  2HWL B;  1W2K H;  2PAU A;  4WXV A;  4Y8Z A;  2JKH A;  1QUR H;  1V2Q T;  2NU3 E;  2XBX A;  1GMD F;  4O03 A;  1YNB A;  2EI7 A;  3DUX H;  2SFA A;  3V13 A;  2XCN A;  2HVX A;  1JIM A;  4DCD A;  4RXR A;  3ZVG A;  3WWF A;  2ZEB A;  1SLU B;  1EP6 A;  2FXR A;  1A5I A;  3TGJ E;  1O3C A;  4TPI Z;  3KQ5 A;  2J98 B;  3SJI A;  4Q7Z A;  2B7D H;  3W95 A;  1FDP A;  1ZGI A;  1BBR E;  4AGK A;  3AW0 A;  2PAQ A;  1HRT H;  4FUB A;  1AFE H;  2VIP A;  1ZZZ A;  4QG0 A;  1GHB G;  2BD8 A;  2WUB A;  2B0F A;  2BB4 A;  3TH3 H;  5FPS A;  4IC5 A;  1ZHP A;  1ETR H;  2Z7F E;  3HGP A;  2LNC A;  4WMD A;  5HM9 A;  2BX4 A;  1E1Q D;  2C3S A;  3A7W A;  3MNX A;  3TMD A;  2ALV A;  3F0O A;  1KDQ B;  3KQC A;  3A81 A;  1UMA H;  3E16 B;  2BLQ A;  3FZZ A;  1GI0 A;  8GCH G;  2PKS C;  1JXP A;  2Q14 A;  4GLY A;  5GIB A;  1GBB A;  2QA9 E;  1FAX A;  2EC9 H;  2HNT C;  1TBQ H;  4A7I B;  1EJA A;  2J98 A;  3EQ0 H;  2CF8 H;  1GL0 E;  3QO6 A;  1TGC A;  1WQV H;  4Q7Y A;  5JB9 S;  3ZV9 A;  4SGA E;  1O0D H;  2BQW B;  5DP5 A;  2O6I A;  4WF8 A;  4ZHM U;  4DT4 A;  3F9G A;  1HAI H;  5AHG H;  2QY0 B;  2QC2 A;  2VIN A;  1YPM H;  2ZGX H;  2ZDN A;  2F9V A;  2ZIQ H;  2XBW A;  4Y6D A;  3LON A;  3N99 A;  1ELE E;  3BTH E;  5F8X A;  5HM2 A;  3H7O A;  2KAI A;  1QQU A;  4M9F A;  1BMN H;  1QBN A;  1Y3Y A;  3SGQ E;  3OEE D;  3NRL A;  4TNQ A;  2O8W A;  2PR3 A;  4ZAE A;  3ENS B;  1HXF H;  4AGJ A;  3GY6 A;  1PJP A;  1QRW A;  4CH8 B;  1C5R A;  1O5E H;  2ZCL P;  4GHQ A;  1O36 A;  2BY9 X;  1BUI A;  5LPF A;  2Y7Z A;  2F83 A;  2STA E;  4FVB A;  3K9X B;  3KYG A;  3MH7 A;  4IMQ A;  4ABD A;  5EPN A;  1QRZ A;  2PKA B;  2THF B;  2V3M A;  4HI3 A;  1LHD H;  2J2U A;  3MU1 A;  1K28 D;  4DGJ A;  4MZ7 A;  2OIN A;  1QHR B;  1P04 A;  2ZDL A;  1GMD G;  1C5Q A;  4QQZ A;  1P2Q A;  3N7O A;  1SQT A;  3PMJ A;  1SGP E;  3SNC A;  3UUZ A;  1GGD B;  2FES H;  1DX5 M;  5EST E;  2AGG X;  2HEK A;  1O5G H;  3CS7 A;  1P2I A;  1P2J A;  1OOK B;  3TLO A;  4A5T S;  1WQS A;  1K1N A;  2OK5 A;  2FMJ A;  3S4L A;  1BMM H;  1Y8T A;  2WUC A;  3ZVE A;  3MZO A;  5GPI B;  4X1S U;  1BQY A;  1GVL A;  1JBU H;  2CV3 A;  5A8Z A;  1W13 U;  2BD2 A;  3DSG A;  3NKK A;  3A89 A;  1XVM A;  4K8Y A;  4NA8 A;  3CCG A;  4TNR A;  1CHO F;  5EQR A;  2W6J D;  1O2X A;  2JET B;  3SND A;  1Y3X A;  4JZE H;  3SO3 A;  1BTW A;  2PKA A;  1V2O T;  5JDU B;  1K1J A;  3F2G A;  2F9O A;  3RXV A;  1YBW A;  4Y0Y E;  4MTB A;  5AVD A;  5FX5 A;  1GI1 A;  1IHT H;  1Y5B T;  2BDI A;  2PGB B;  2K8I A;  3FO8 D;  4KTU A;  4CHA C;  1XKB C;  2QXI A;  3A7X A;  3DSO A;  1MTV A;  2QCY A;  1Z6J H;  2NU4 E;  1PPE E;  4YO9 A;  1YM0 A;  4KEL A;  1HAG E;  1MU6 B;  2YMS C;  5DGJ A;  1C5Y B;  1OXG A;  1SGF G;  3D65 E;  1BTU A;  1D6W A;  1OP2 A;  3SV7 A;  1D9I A;  3I77 A;  5E2O A;  2PV9 B;  1GHA G;  4AFZ A;  3ITI A;  2HPQ H;  3URD A;  4KGA A;  1NT1 A;  1W11 U;  1KIG H;  3TIU A;  2CF9 H;  1LMW B;  1E34 B;  2ZTX A;  1WV7 H;  1HLT H;  2WPL S;  3M3V A;  2I6S A;  3FOA A;  3ZZ6 A;  2TGT A;  2Z3C A;  1ESA A;  2P95 A;  1AB9 B;  1K1L A;  5C5N A;  3VEQ B;  3TMC A;  3FP7 E;  9LPR A;  3UIR A;  1AIX H;  3SU1 A;  2G51 A;  1NFU A;  2PP6 A;  3LGY A;  4I7Y H;  1FPC H;  2R9P A;  1LCY A;  6GCH F;  1GG6 B;  4HTC H;  1GBM A;  2A5K A;  1TPS A;  1UCY K;  2WSS D;  4CRD A;  2KR7 A;  3ZYE A;  3GYL B;  3LGI A;  1ZTJ A;  3E0P B;  2GT7 A;  2QV1 A;  3SUF A;  1LPK B;  1H8H D;  1QCP A;  3UB0 A;  3SHC H;  3F1S B;  3P8N A;  4XBD A;  3F9H A;  1TFX A;  3DA9 B;  5FX6 A;  2K1Q A;  3JZ1 B;  1O2P A;  3AK5 A;  1LPZ B;  2NU0 E;  3ZZ7 A;  1GI5 A;  1O32 A;  2FTM A;  1OWE A;  4X8U H;  4GSO A;  1A2C H;  2ZDM A;  1MKW H;  1DST A;  1THP B;  1ARB A;  1TBR H;  1ZPZ A;  1UTK A;  1GVK B;  4VGC C;  1UW7 A;  1XVO A;  1GBK A;  1MKX H;  3KNX A;  4YTA A;  3MNC A;  3SNE A;  1BT7 A;  2AEI H;  5AO0 A;  4GVU A;  2CGA A;  4UD9 H;  2WV9 A;  4FU9 A;  5JBC S;  2CXV A;  2D8W A;  2WPK S;  2XYA A;  2A7H A;  5AO3 A;  1N8O B;  1JOU B;  3N7E A;  5EJZ A;  1CHO G;  3RC4 A;  5L30 H;  1HAX B;  1O3I A;  3HGN A;  5A8X A;  1CGJ E;  3QN7 A;  2RA0 A;  1SGI B;  5HYO A;  1P3E A;  1TOC B;  3HK3 B;  4GCH F;  3U8R H;  2ZU2 A;  4HZH A;  4ZHA A;  3RML H;  3FP8 E;  3BTD E;  5CHA B;  3U98 H;  1LKB A;  2Z6B D;  1H1B A;  3RMN H;  4NWK A;  1Z1J A;  1K0H A;  1SGC A;  1TA6 A;  2Y5H A;  4QG2 A;  4WH6 A;  6CHA B;  1F0T A;  3SI4 H;  7EST E;  1KLJ H;  4YES B;  3KGP A;  6EST A;  3T27 A;  1PQ8 A;  4WVP E;  3TU7 H;  4RSP A;  4Y7A A;  2QN5 T;  3FKS D;  1L4D A;  1O5C B;  2XNI A;  4K1S A;  2ZP0 H;  4U01 A;  1GVZ A;  5HIY A;  1ABI H;  1ZSL A;  4UEH H;  2OP9 A;  2ULL A;  1LHG H;  1THR H;  2YNB A;  3A82 A;  3GCH B;  4JYV H;  3PM3 A;  3RXK A;  4NCY A;  2A4R A;  1AZZ A;  2FYR A;  3ODF A;  2Q6F A;  4E7R G;  4TO0 A;  1S83 A;  4TO2 A;  4Y11 E;  1ANB A;  1YLC A;  2A32 A;  4WXI A;  3S9B A;  2C4F H;  1RRK A;  3RM2 H;  1GI7 B;  1YPK H;  3BSQ A;  1RD3 B;  1GJ8 B;  4JZI A;  3BTE E;  4TNZ A;  6GCH G;  4IN1 A;  1A1R A;  1MZD A;  1S6H A;  3OAA D;  3O8D A;  1OP0 A;  5TK9 A;  1CSO E;  4TNY A;  2I6Q A;  4YLQ H;  3Q00 A;  5DP4 A;  1YGC H;  2ZTZ A;  1O31 A;  1OSS A;  3OYP A;  1HAH H;  1TX6 A;  2ZQ1 A;  3UNR A;  4CRF A;  4B76 A;  2O8M A;  1HJA B;  1NRN H;  3BN9 A;  3D49 H;  1QJ6 B;  2VVC A;  1EAW A;  5FHT A;  1P2M A;  3TK6 A;  2VWO A;  1TYN A;  3UNS A;  3I78 A;  4Q2K A;  2XWA A;  2ODQ A;  3RMO H;  4K3J A;  3M37 A;  1T8M A;  3ZIA D;  3BG4 B;  1F5K U;  4Z6A H;  4FU8 A;  1EOL A;  2G4U A;  3LT3 A;  4NA7 A;  4X1P U;  1PPZ A;  1YCP M;  2ZPR A;  1PPB H;  2LPR A;  4D7G A;  2QF5 A;  4X6P A;  3UOU A;  2VB0 A;  1O3L A;  2ZF0 H;  3BIV H;  2FIR H;  4Q4L A;  4BAH B;  6LPR A;  1GI3 A;  3GW7 A;  2ZNK H;  3OFN D;  1TPA E;  1B0E A;  1A3B H;  2QXG A;  4D8N A;  1FPH H;  2PGQ B;  3F3B A;  3K6Y A;  3MO3 A;  2J9N A;  5C67 A;  1D3Q B;  4GCH G;  1QY6 A;  5AO1 A;  2B8O H;  1ZYO A;  1SQO A;  4D76 A;  1Y5U T;  2O9Q A;  5I46 H;  3QWC H;  3H5C B;  4KKD A;  1XUH A;  1SBW A;  2HOB A;  1SSX A;  3CP7 A;  2BVR H;  4HGC A;  1F5L A;  5J4Q A;  4X2X A;  2WYJ A;  1GBE A;  3MYW A;  1UTQ A;  2A2Q H;  1RS0 A;  2GZ4 A;  2VBC A;  2W6I D;  1IQF A;  5C2Z A;  3L33 A;  4YOJ A;  1B5G H;  3MU0 A;  3KQB A;  2Z9K A;  1LPG B;  1GL1 A;  1MD8 A;  2C90 B;  7GCH F;  1OS8 A;  4U2W A;  4O3T A;  2J95 A;  1AY6 H;  2HVY B;  3EE7 A;  4I8G A;  3RU4 E;  2XCF A;  1FXY A;  3FAN A;  4GAW A;  3KL6 A;  1WCZ A;  2J92 A;  5JBT A;  3LJO A;  1ZPC A;  2BVX H;  3O8B A;  2ZG0 H;  3SNB A;  1ACB E;  2UWP A;  2Y81 A;  2SGP E;  1EJM A;  1MCT A;  2XC4 A;  4AG2 A;  1W0J D;  1TMT H;  2ZU3 A;  1F92 A;  1RTL A;  1OX1 A;  5C1U A;  3M35 A;  2PSX A;  4TO3 A; 
#chains in the Genus database with same CATH homology
 4QG4 A;  3KQ5 A;  4RXQ A;  4BZB A;  4TO6 A;  1VJ7 A;  2HEK A;  4RXS A;  4TNP A;  4ZWE A;  2DQB A;  2CQZ A;  5TK6 A;  3SKD A;  2PAQ A;  4XDS A;  2IPQ X;  3S4L A;  3U1N A;  4QG0 A;  3MZO A;  4QQW A;  4L7W A;  4QQY A;  2FLO A;  4RXO A;  4R8Z A;  5AO0 A;  3TMB A;  3KH1 A;  3CCG A;  1VQR A;  4TNR A;  3TMD A;  4MLN A;  4L1J A;  4TO5 A;  2PAR A;  4Q2D A;  4LRL A;  5AO3 A;  1YOY A;  4QG1 A;  5AO2 A;  4QQZ A;  3GW7 A;  2Q14 A;  3BG2 A;  4RXP A;  5AO4 A;  5TKA A;  5AO1 A;  4QQX A;  4ME4 A;  3P3Q A;  3I7A A;  2O08 A;  4QG2 A;  3IRH A;  4QFY A;  5TK8 A;  4TNX A;  3HI0 A;  2O6I A;  4TO1 A;  2PGS A;  3NR1 A;  4QFZ A;  4MCW A;  3TM8 A;  4Q7H A;  3M1T A;  2GZ4 A;  1U6Z A;  3NQW A;  4MLM A;  4DMB A;  3HC1 A;  4Q2C A;  4ZWG A;  4TNQ A;  3TMC A;  4BZC A;  2OGI A;  4TO0 A;  4TO2 A;  3SK9 A;  4L7E A;  4X9E A;  4TO4 A;  4L1J B;  1XX7 A;  5TK7 A;  2PAU A;  2PQ7 A;  4QFX A;  3MEM A;  4TNZ A;  1YNB A;  4MZ7 A;  3RF0 A;  4N71 A;  3LJX A;  5TK9 A;  4N6W A;  4RXR A;  4TNY A;  4MDZ A;  4TO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...