3KQ5A

Crystal structure of an uncharacterized protein from coxiella burnetii
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
376
structure length
360
Chain Sequence
NQFYKPGMLVPVFSAAGLLKNGRYQFLLQQIETLSLLPTEQYAQLYEALVYRFVEFVQVLPIRLDEPLCSLMNEGLLRGVNSLNHYIQNHPEATPLERYALFSAGLLLEVAHAVVNQKIFITDEEGNFIKQWNPFSGPLIDDVETKHYKIMPLSSYYQRNIPSITPILVRQLLPDEGFLWLTSDMRVFSDWMQALRDDGRFEHVLQLFKHKNIDGLFNTLPALPVNLQDSPATAHADAFLNWLKEALATNQIKVNTSDAGVHVIPEGVFLEKTGIFKQYIDLHVNVPVNLFTVYQQFGNLFGLTKLSGIDYRFEQLFDALKRKSKMGFAGLSPTREGVLIADPNLIFTRGEIPSATYLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical cytosolic protein
total genus 118
structure length 360
sequence length 376
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.40 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 3kq5A01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 3kq5A02
2IPQX 3KQ5A
chains in the Genus database with same CATH superfamily
1C5ZB 1EPTB 2WPKS 1FNIA 4QFZA 1ZJDA 3ZVGA 3QZRA 1O2NA 1V2QT 4ME4A 1TNLA 1PJPA 1BZXE 1Y3XA 3RC5A 2FLRH 2JETC 1GBIA 4MDZA 1SOZA 2ZDNA 2GV6A 1GHBF 1MABB 1CT0E 2FOMB 2VVUA 1RTFB 1ZPBA 3F1SB 1RS0A 3A82A 1AKSB 3RMOH 5LGOA 2TPIZ 4K8YA 2A4RA 4I32A 1C1RA 1P2MA 4AOQA 1C5QA 3ESTA 3W1EA 2BX3A 2GMTC 2ANWA 2ZIQH 1CGJE 2BOKA 1MQ5A 1OWIA 1ZZZA 2FS8A 2W7SA 1JRTA 1HBTH 1ZTJA 4XDEA 2FLBH 1GHAG 4L7WA 2QXHA 2ZDKA 5EW2H 3L33A 4JZ1A 1W0YH 1GBFA 1UK2A 3LGUA 4CH8B 2B9LA 2PSXA 2ZU5A 7KMEH 4FVDA 3TK6A 4B75A 1CU1A 1S85A 1TFXA 1DSUA 1EJNA 4GUXA 1Z1IA 3K6ZA 3TU7H 1BHXB 1OKXA 2Q6GA 1Q31A 5DO4H 1F0TA 4QT8C 1S0RA 1FIWA 2H2ZA 1H9HE 3F2GA 2GZ9A 2TBSA 3TIUA 1EAWA 1ETSH 4AB9A 2A1DB 1TNJA 3T27A 2ANMH 2PFEA 1BHXF 1EAIA 5AO0A 4ESTE 1QB6A 1MAXA 4Q80A 1LHFH 1ZTLA 3TNSA 4JZDH 2ZI2H 4CH2B 4ZROA 4I8KA 4AB8A 5TK6A 1HXFH 1JOUB 1XKAC 3ZZ7A 4B2BA 3FP6E 1GJDB 5T3HA 1QQUA 4ACBA 2FPZA 1UCYK 2VJ1A 3EE0B 1SGRE 4ZWEA 3CNRA 4N71A 4D7FA 4UDWH 4X6OA 4XDSA 1ELCA 1F92A 1KY9A 1LPKB 2IJOB 1RRKA 3MOCA 2EC9H 2H1UA 2RDLA 5CE1A 2ZDAH 2J5UA 1IQFA 3R0FA 1HJ9A 1ZSKA 4FUFA 3RXDA 6LPRA 2WV5A 1O2KA 2P95A 3ZZ3A 4N6WA 3ZVAA 1EFRD 2W3KA 4I7YH 1SPJA 1X7AC 1TRNA 4ABEA 1ID5H 1C5RA 1ZMNA 4A7IB 2ZZUH 2AS9A 3RU4D 3UWJH 2ZQ1A 3M7TA 1KIGH 1SKYE 2HGTH 1LVMA 1TALA 3GCHB 2M5TA 1P2JA 1TGNA 1O2OA 3BTQE 1Z7KA 4B6EA 3CS7A 3KN2A 4Y8YA 5HM9A 1VCQA 1T8NA 2QF5A 1QCPA 1AI8H 2ZA5A 2ZGHA 5C20A 1FMGA 1OSSA 1HAYB 2QC2A 3ATKA 1O3JA 1SGFG 1KDQA 3ZVDA 1YPKH 2OC1A 5FL7D 3SJIA 4ZH8A 1ZTKA 3FO8D 4P00A 1LPGB 1TQ7B 2P3TB 2THFB 3S7HB 5C94A 3OEHD 4ZKSU 1OOKB 2FOBA 4Q63A 5FBEA 2XXLA 3QN7A 2A5AA 3E8LA 2TGAA 3RXEA 2TGPZ 4IN2A 1EOLA 4ZHMU 8LPRA 4X1PU 2O8TA 4NA9H 1YPLH 1P03A 2W5EA 2YMSC 4YOGA 1WBGB 3T62A 2RCEA 4OM9A 5C3NA 1YC0A 4RXSA 2PHBA 3Q76A 1PPGE 2BVSH 3NXPA 3A7VA 5B6OA 2XC5A 2P16A 1TX7A 1NESE 3TH3H 1OWJA 3CENA 1TBZH 2VIOA 1CE5A 1LHEH 1G2MA 3M36A 4I33A 5JBCS 3S69A 2WINI 1BTWA 2BD5A 2CF8H 2P93A 2ZFQH 3GY6A 3LC3A 1PQ5A 3O8DA 1S6LA 2KX4A 1O2WA 1AB9B 4GAWA 2BMGB 2O8MA 3U28C 2ZWLH 2QYIA 3UOPA 1SHHB 2GZ8A 1TYNA 1HGTH 3RF0A 2QF3A 1C1PA 1BBRE 1O2XA 2QN5T 4JZEH 1GBBA 1HXEH 1NTPA 3KIDU 2H6MA 3RXHA 3EE7A 3BTFE 2BXUH 1HAXB 1C2JA 3PMBB 2FX4A 1ELVA 1PPBH 2SGFE 2BDBA 1KXAA 3BEUA 1TMBH 1UTQA 2VH6A 1MTUA 7ESTE 4BANB 3RUOA 2GTBA 3FFGA 2FXRA 1UTOA 4TWYA 3BSQA 2WYGA 2WV9A 3FANA 4CR5A 1UCYE 1CHOG 3VB3A 4IMZA 1P2QA 1ZYOA 3HPTB 4H6TA 3RXFA 4CRFA 3ATLA 4RKOB 3MU8A 4MLMA 1AVXA 1QR3E 1UVSH 3U69H 1AIXH 3GY7A 1C2GA 4MNVA 2J94A 4YTAA 3T29A 1O33A 5EQRA 4BZCA 2FI4E 1GI5A 1HAIH 1XXDA 3QK1A 3LKWA 1SLXB 1TOMH 1TE0A 3A7ZA 3FN8A 1SLWB 2FOFA 2WPIS 1AD8H 2WV4A 3RDZA 4O3UA 1AWHB 1QQ4A 2WHXA 1ZSLA 1JIMA 1FI8A 1GMHF 2A31A 2WPHS 1T4UH 4A92A 2GVFA 2L74A 4HGCA 2OK5A 1S6FA 3GCHC 1O32A 3UTUH 3HKJB 3L3TA 7GCHF 1GBAA 2PARA 4BAOB 1SGYE 1LVBA 1S5SA 4Q7HA 4WVPE 3NKKA 5FX5A 2Q14A 2PLXA 2CHAB 3F9FA 2BVRH 3MH5A 2BM2A 2CK3D 4XFQA 2OD3B 4X6MA 3SJOA 2O6IA 2G00A 2ODYB 2BD8A 1BB0B 3QDZB 3ZZ9A 5E0JA 3FAOA 3M35A 5DP4A 3UFAA 1TONA 1EQ9A 1TRMA 4Q7ZA 2YNAA 1JXPA 1JBUH 1O2TA 3E6PH 1G3BA 4QQWA 1NRNH 3RXRA 4DURA 3RMMH 4LK4A 5JDUB 1UVTH 1CA8B 1P8VC 2XBXA 1F5LA 3RXJA 1NS3A 2J34A 1GPZA 1DANH 3RMNH 4NCYA 1IHSH 2SFAA 4CRCA 1DUEA 2A4QA 1LHDH 1O38A 2B8OH 2V0BA 3KQCA 1A0LA 5TK8A 3A8CA 2F83A 3MNXA 1C1SA 2XNIA 1FY3A 5TK9A 4MPVA 3VB5A 1J16A 2H5CA 4NG9H 1O5FH 3KYFA 1QIXB 1ZRKA 1BRCE 2OBOA 3HATH 2Y82A 1BRAA 1H8IH 2D26C 3SNBA 2XNDD 3TJOA 1AWFH 2Y7XA 2D1JA 5EW1H 1O2RA 1A0JA 3JZ1B 2NU0E 1ZGVA 1FY8E 4UE7H 1SFQB 2JIZD 3TJVA 1E37B 4MG3A 3SHCH 4GCHF 4X1RU 3U8OH 2GCHF 1T32A 1EXFA 1VGCB 4OS4A 4WMEA 3UIRA 1HPGA 2PWXA 3QTVH 1QBVH 3PLPA 1EUFA 1TPSA 1FX0B 4F55A 2HNTC 1J8AA 3UOUA 3VGCB 4MLFB 4HG6A 1C4V2 3VPKA 1NU9A 3HGPA 2BDHA 3SU0A 1GI7B 1EZXC 1C2MA 1DPOA 2SNWA 2W26A 2P59A 2C3SA 4WWYA 5AO2A 1P57B 2GJGA 2R2MB 4ZWGA 2FDAA 4ZUHA 1SR5C 1EKBB 2VINA 1V6DA 4L1JB 3M5MA 4A6LA 1OS8A 3KNXA 3AK5A 1HLTH 3MH4A 4TPIZ 4XSKU 3AVZA 2I6SA 1OWEA 4AC9A 1QURH 1ELDE 2V35A 1F0RA 4UONA 2GCTB 2QA9E 1AFQB 1DWBH 3IITA 1V2MT 2PW8H 2LP6A 3UR9A 3LPRA 1ZLRA 3M3TA 5FPSA 5A8YA 1YLDA 4TNXA 2AEIH 5HGGA 1C2EA 2HALA 3LGVA 1VCPA 3PRBA 1AKSA 3ZZAA 5F8TA 1Y5UT 2ZNKH 3BTGE 4GLYA 2F9NA 2GCTC 1G9IE 4F49A 5HIYA 3SU3A 4XRNA 2KAIA 3KQEA 3DT0H 1E38B 2BD2A 3DUXH 5G4BA 4DIIH 4D7GA 2ZTZA 2Y5HA 1A5GH 1O2PA 1GCTC 1H9LB 1K1NA 2K0QA 4Y8XA 3P8FA 3HGNA 3LGWA 4AFSA 3SK9A 1OHHD 4Y7AA 1NRSH 4ZCNA 4B6FA 1DVAH 3P70B 1QBOA 3E16B 2Q1JA 3SNEA 1DOJA 3I7AA 1MU8B 4B71A 1RJXB 1C5PA 5BRRE 1O3CA 2KCAA 3MHWU 4Y76A 4UFFH 1O5GH 2EA3A 1SG8B 3SGQE 2P3FH 4XBBA 4I8JA 1HAVA 8GCHG 1Y5BT 5AFYH 2ZDLA 3SUFA 4YT7H 1O3IA 1TBQH 1UTNA 1XX7A 3G01A 1A3BH 1AFQC 4AFUA 3TJNA 2OC7A 9ESTA 3MNBA 3S0NA 3U9AH 4LZ1H 5EXMA 1SQOA 1TPAE 2GD4B 3A8DA 1UJ1A 2HPQH 1CT4E 4CRBA 3SU1A 4WMDA 2AIPA 4JYUH 2CHAC 3MU4A 1AZZA 2F91A 3BTDE 5TJXA 5TCCA 6CHAC 2Q6DA 1GBMA 3SJ8A 1GL0E 3SZEA 1MQ6A 4MNXA 4ABJA 2ZQ2A 5C1UA 9LPRA 3RU4T 3BTKE 1O2LA 3UPEA 1Y8TA 3O8RA 5EJZA 1GVLA 2BY7X 4ASHA 1BQYA 3MNCA 3D23A 4D8NA 8KME2 2C4FH 2CJIA 4FUGA 4TO2A 2VGCC 3HK6B 1P11E 4OS1A 1CQQA 1CGIE 2BQ6B 2ESTE 2IN2A 2BY9X 1YY3A 2BQWB 4MZ7A 1H4WA 1LO6A 2XWBI 4XOJA 1KTSB 1ZMJA 3AW0A 3SV7A 3PROA 4XBCA 5DP6A 2PGQB 3GYLB 3ZZ6A 3ATIA 1DITH 1FY1A 1ZPZA 4TWWA 1Z71A 1O2ZA 2NU1E 1T31A 3U8RH 5AVDA 2R0LA 1YPGH 2CQZA 1F5KU 4I31A 5C2ZA 1INCA 4SGBE 4TT3D 2C8WB 4FUJA 1EATA 2Y80A 1O2JA 1PPCE 4QG0A 2R3YA 1P9SA 1P2OA 3LOXA 4K8BA 1EB2A 1O36A 2QY0B 3KQDA 1A3EH 1THPB 2O9QA 2FMJA 1P02A 3PV4A 2QXIA 1NC6A 3E0PB 5E2PA 1K1JA 1RTKA 1XXFA 3QZQA 5C67A 2ZPRA 5HM2A 2V3HH 5C5NA 4B2AA 1WTHD 2W6JD 2VWOA 2KCOA 1C2DA 2PTCE 4KTSA 3PRDA 2QF4A 4CBNA 3NZIA 1GJAB 3DA9B 2KR7A 1XM1A 4DVAU 3T5FH 1GI9B 1TAWA 1NT1A 5FBIA 4A1XA 1C5WB 4OS2A 1BTPA 3EA7A 3EGKH 1T8LA 1W8BH 1V2PT 5AHGH 1YPHC 5DP7A 1GGDB 1C1TA 1H9IE 1L2EA 3KQ5A 1HAHH 3RMLH 1GDQA 1GJ8B 2ZCHP 3MU0A 1E34B 5AO1A 3QTOH 5EU8A 3DSOA 2J9NA 1SSXA 2H9HA 3RXBA 2I6QA 1COWD 1ZJKA 3Q77A 1IQIA 2J38A 1T8MA 4Y6DA 1W7XH 2WYJA 3DFLA 1NBMD 1UVOA 4Y0YE 1GBTA 1GJ6A 3RXGA 1GMCF 4ISLA 2ZU1A 4X6NA 4U32A 1YM0A 1OPHB 3P8GA 2IPHA 5L30H 1KYNA 4XE4A 2CF9H 3TGJE 2PKAB 4RXOA 1O3MA 1V3XA 2KFWA 3ZV8A 2O08A 1QA0A 3MU5A 3BN9A 3BTWE 5HIZA 2W6ID 4X8TH 5A2MH 1IOEA 3M7UA 3EA9A 1KLTA 5FHTA 5CHAC 4E7NA 1OWHA 1VJAU 1CT2E 1O2IA 2TGDA 1Y59T 1BTZA 1KXCA 2Z9JA 3LDXH 1H8HD 1SGFA 5FCKA 3E1XB 1WU1A 4X2WA 2HPPH 3U1JB 5JB9S 5GJ4B 5GCHF 1S6HA 1SQRA 1VR1H 3TM8A 1KXBA 1CO7E 1JMOH 3I78A 1FN6A 5CMXH 4BXSA 4LXBH 3RXKA 5LPFA 2R2WU 1HAOH 5DP3A 4VGCC 1AVGH 1DX5M 1P05A 3ZVCA 5GXPA 1SFIA 1QJ7B 4Q2DA 4D76A 1LHGH 3O8CA 1GJ4H 1HIAB 4JZFH 2XC0A 4NA8A 5GWZA 1GI0A 2FOHA 4RI0A 4Y11E 1O37A 2XOKD 3KQBA 8ESTE 4MNWA 3MMGA 1ANCA 4IGDA 3PO1B 1C5OH 1V2OT 1VJ9U 1K28D 4Q2KA 5EXLA 1EX3A 1S82A 1YPMH 3UUZA 3TMBA 1F7ZA 2OBQA 4Y0ZE 1DDJA 4YT6H 1HIAA 2C8YB 3AW1A 1LPZB 1RIWC 1N8OC 3I29A 3KHVA 4FXGH 5TK7A 1BJUA 3D65E 3GOVB 1YCPK 5C0UA 4BTIB 3ENSB 4AGKA 3VGCC 1MTWA 1HB0B 1Q3XA 6GCHF 5LPEA 1P06A 2RG3A 3MO9A 5T6FA 3BG4C 3NCLA 4E06H 3OAAD 1C2IA 1ZSJA 1DT2A 3CP7A 2PR3A 4BZBA 3F68H 2J2UA 1V2ST 2JKHA 1O3EA 4DCDA 5K0HA 3DD2H 1FZZA 4O03A 3RU4E 1MCVA 1NFYA 3GS9A 1SVPA 2A7HA 3F2FA 2AHME 2SNVA 4K1SA 2OGIA 5DSFA 3SYJA 1GMDG 2QGRA 4BXWA 3SU2A 1W2KH 1B0EA 4NWKA 2JH0D 4DT7B 1WTGH 3RM0H 1GI3A 3BIUH 1YCPM 4UFDH 4INHA 2Z3CA 5C0TA 2CN0H 3PB1E 1FJSA 2F9PA 2OINA 2QIQA 3P95A 3RXQA 3SQHE 5A8ZA 4CR9A 1ZHMA 5GNDA 2AFQB 4WJG2 1B0FA 1ACBE 3GY5A 3RLYH 1SGIB 5GDSH 1WYKA 5E2OA 1KLIH 2ULLA 2KAIB 4X0WU 4AZ2B 2XYAA 1FQ3A 1SGPE 1HNEE 1FUJA 1KLJH 3A83A 1UCYH 1K0HA 3VXEH 3F9EA 1K1PA 4YLUA 3LT3A 3RC6A 2GDEH 1VQRA 1Z8IB 1GVZA 2FI3E 1KDQB 2BD9A 1K1LA 2A4GA 4MLNA 1IQMA 2GT8A 1OXGA 4X1NU 1GMDF 4BAHB 5DP9A 5L6NH 3GY4A 2DQBA 1SGNE 1ELTA 4O9VA 3QLPH 2BDIA 2VWNA 2ZFSA 4QFYA 2LPRA 3S4LA 2VH0A 1GL1A 2G8TA 3H7TA 3A89A 1EZUC 1O2MA 2HVXA 1UTLM 1OP0A 2O8WA 2G4UA 3AAUA 3ZZ5A 1V2JT 5J4QA 3WW7A 1FLEE 3FP7E 2FOAA 3I77A 1XVMA 1ELEE 2SGQE 4B73A 1AUJA 2XCNA 1EZSC 3QUMP 3ITIA 1D4PB 1NY22 5DP5A 4U30A 3T2NA 1ANDA 1GBLA 1E36B 2PTNA 2ANYA 2YOLA 2RFKC 4QG1A 1DLKB 4ZHAA 1DY9A 5KGOA 1FN8A 4GSOA 1MTVA 4TPYA 1TB6H 4Q4LA 4BAMB 1SMFE 4JK5A 4L7EA 3CS0A 4GHTA 3A8BA 5JBBS 3RXVA 1YP9A 4KELA 1BTUA 2J98B 1XUFA 2H9TH 2ZTYA 4TSFD 3BF6H 3UR6A 2J95A 1KXDA 3SO3A 3RLWH 4BAQB 2A32A 4TNQA 4AGJA 4ASUD 3OY6U 2VIQA 1W0JD 1QL9A 1IQJA 3MQKC 1K2I1 1UW7A 3PWBA 2V3OH 3V0XA 3U1NA 2FTLE 4Z6AH 4RXPA 5EJLA 1NPMA 4LZ4B 5EQQA 1EOJA 5GCHG 2QAAA 3SU6A 1YPHE 2XC4A 2BXTH 3RXUA 2ZPSA 4INKA 1DS2E 1ORFA 2PUQH 3TK5A 2FIRH 1MH0A 1C4Y2 1HV7A 1DWDH 2DUCA 3MO6A 3PLBA 4Z1MD 2RA3A 1ESAA 1GDNA 3SNAA 4BOHA 4X1QU 1WDIA 3NR1A 3LH1A 1GI2A 2IJD1 2FI5E 1H8ED 2WSSD 2FZZA 2UUKB 1UHBA 3M5NA 2CV3A 1P12E 1HRTH 2GCHG 3BTHE 4TO6A 1O3KA 3SV6A 4Y7BA 1MTSA 3SKDA 1BMFD 1XUGA 3F3BA 3UNRA 1A1RA 5DN6D 2Q6FA 3TK9A 1GWAA 1DWEH 1IAUA 3VB7A 1YWUA 1AB9C 1AFEH 1LQDB 1C5YB 1G3EA 1N6YA 1RXPA 1ANBA 1IQNA 2A4OA 2UUJB 4CRGA 2QE7D 4B74A 1DWCH 1L1NA 3GCTF 2GV7A 1VKYA 1ELAA 1YPEH 4NFFA 4K1TA 1G3DA 1TGSZ 4Y10E 3T28A 1HAZB 2PUXB 3BG8A 1A0HB 4RSPA 2A5KA 4RXQA 1G2LA 2A2QH 1VGCC 3OYPA 4K69A 1TRYA 1GHAF 1Z8RA 3N99A 4DY7B 5C5OA 3GICB 4JYTA 1BRBE 3V7TA 1FAXA 1VITG 2B7DH 5CDFE 1AE5A 1BBRK 3URDA 2ZDMA 1NFWA 1TABE 2A0QB 3ZZCA 1E35B 5HKKD 3A7TA 2G4TA 5A0AE 4NSVA 1GDUA 1EPTA 4YXWD 4E05H 1MU6B 1W12U 1CA0B 1CVWH 4XD7D 4CREA 1C5NH 3P3QA 1DSTA 1T7CA 5JPMH 3BV9B 3TMDA 2TGTA 1J9CH 1O39A 3AASA 1C5TA 1QRWA 3BTEE 3NPSA 1NRRH 1FPHH 3RXAA 3F0PA 3STJA 1ESTA 1TNIA 2HLCA 2BY5X 1S83A 4ZHLU 1D9IA 2BYAX 2LNCA 3F2HA 1BTHH 1BMMH 1BMNH 3LGIA 3U1IB 1O3BA 2BLOA 1NFUA 1BTYA 3K65B 4FU9A 1G36A 4RXRA 3C27B 2JJ1D 2ZCKP 2OUAA 1C1OA 1E1QD 2AIQA 1LTOA 5E8EH 2J97A 3RXOA 1MBMA 1F5RA 3TLOA 4UFGH 3DSGA 1MKWK 1S81A 1UTPA 1P10A 3A81A 4MQAA 2FESH 2BZ6H 1ZOMA 3LC5A 5EODA 4H6SB 1SI5H 1SBWA 1TGBA 3MYWA 3NWUA 2EI6A 2OCVB 3BTME 2GMTB 2FM2A 1LVOA 1TMTH 1QRXA 1QL8A 2SGEE 1WQSA 2ZU4A 5H4IB 1GJ5H 2YMSB 2ZHQH 4QG2A 1W10U 6ESTA 2AERH 4I8HA 1LCYA 2BHGA 4DOQA 1SQAA 3QWCH 2NWNA 4NIVA 1PPEE 5GPIB 1O3HA 1S84A 2XTTB 2F9BH 4WXVA 2QXJA 1PPFE 2C90B 2WZQA 2ZPQA 4MPXA 1UTMA 4ZAEA 1GBDA 1O2SA 1DUAA 2ZC9H 1V2UT 1XUIA 5AO3A 1QA7A 4SGAE 5ABWA 2VWLA 5IK2D 1V2RT 4X2YA 1O2YA 3GCTG 3SU4A 1GI4A 3OFND 4JZIA 2GZ7A 1EB1H 2TIOA 1QY6A 4IN1A 2R0KA 1JIRA 3L6PA 2BDAA 5J4SA 4X2VA 1C4U2 1P2NA 3FZDA 1K1IA 2A2XH 3UB0A 4K5ZA 2XBYA 5FPTA 1Z6EA 1TMUH 4U01A 2EY4C 3RXIA 1Y3VA 1N6XA 1C9PA 1WQVH 4R0IA 1TA2A 2VIWA 2Y7ZA 3KL6A 2XBWA 2ZHDA 1GBJA 4BTTB 4NA7A 3GW7A 2FYQA 2XWAA 1XX9A 2OQUA 2VNTA 4P02A 2J4IA 2ASUB 5T6DA 3SI4H 4DIHH 2JDID 4B2CA 2BLVA 4MTBA 2P94A 3RXSA 5HXFA 2ANKH 4CHAB 1E0FD 1SGQE 1QJ6B 4ZXXH 4Q7YA 4FUCA 1W0KD 3BEIB 3F9GA 3U98H 1F0UA 1QNJA 4ISOA 1A46H 5HMAA 2Z7FE 5JBTA 1ARBA 1GCTB 2HEKA 2HLDD 3A7YA 3GY3A 1KSNA 2PKAA 2PP6A 2C8ZB 1GHZA 1L0ZA 2OC8A 2ZGJA 4X8SH 2Z9KA 1L1JA 2UWOA 3A84A 1UTJA 1PYTC 3OX7U 2XBVA 3GDSA 2KM0A 1VZQH 2ZHWH 1GBHA 4NZLA 4AFZA 4IMQA 2F9OA 2HNTF 3ATWA 3UY9A 4YM9A 1ZPCA 3V13A 4NIXA 3UREA 1HJ8A 2Z94A 1O5AB 4ISIH 1SQTA 1QJ1B 4X8UH 4NGAH 2VWMA 1ELFA 1OYTH 2UUFB 2BDGA 2B5TB 3H5CB 1XMNB 2GGVB 1O2GH 3TMCA 1QZ8A 2AMPA 3B23B 2ZTXA 2ZFPH 3TVJB 1SGDE 2BY8X 2JH5D 1DY8A 1NRQH 1O31A 1SGEE 1C1WH 3QGNB 2EI8A 3FVFB 1C2KA 4NFEA 4ZXYH 4JMYA 4TO0A 4A1VA 1F2SE 1THRH 2ZFFH 4OS5A 1O3LA 5LPRA 1N1LA 2DE8A 2PGBB 3K6YA 4ZKRU 1PQAA 3UQVA 2HVYB 3LJJA 3SUEA 1J15A 1VITH 3SUGA 4YOJA 4OGYA 3PV5A 3SJKA 2ZHEH 4HTCH 2XW9A 3SV9A 1TX8A 2XRCA 5KEDA 4YESB 1IQLA 4X1SU 2Z9IA 1SLVB 3M3VA 4UD9H 1MUEB 4O97A 5T1VA 3BEFB 3A87A 2FS9A 4U2WA 4A5TS 4RT1A 1A4WH 1KXEA 1OP2A 2ZDVH 4TNYA 1HUTH 1VCWA 1P3EA 3TNTA 1YGCH 1HYLA 2G55A 2J92A 1O2QA 2FYRA 1C9TA 2VVVA 5JBAS 1PFXC 4BAKB 4CHAC 3MZOA 1C1NA 4FOUC 2BZAA 2XCFA 2ZG0H 3QGJA 1SGCA 2QV1A 4ABBA 1AQ7A 1O5CB 1WAYB 1IHTH 1TX6A 2ZCLP 3S9AA 5DGJA 3EA8A 3Q3KA 1O2UA 4F4OC 2WUBA 1EPTC 2FX6A 2BDCA 4FUBA 2FTMA 4INLA 1GBKA 3PYHA 1O3AA 2WPMS 1GHWH 3SU5A 3VEQB 5BPEA 2TRMA 3QO6A 1QB1A 2WPLS 1NBME 3EYDA 1RTLA 2FO9A 1O5DH 1IQKA 4IS5A 5DK1A 3SOSA 5KECA 3T25A 1ABIH 4AYYB 4ABIA 1LDTT 2GZ4A 1ZRBA 1L4ZA 4QQZA 1P09A 4K2YA 4J1YA 1G3CA 3EDXB 1XUHA 3EAJA 4E7RG 1THSH 3K9XB 1GGDC 3FP8E 2JJ2D 1GHBG 2RDEA 3M37A 3IRHA 4R8ZA 2QXGA 3KGPA 3SJ9A 1YCPH 2BQ7B 2VBCA 3H7OA 2A5IA 4O3TA 4ABGA 1P0SH 2R3UA 4MCWA 2Y5FA 4MPUA 1P04A 1Y5AT 3PO1C 1AVWA 4K60A 1O3PB 4IW4E 1O5EH 4KTUA 2GP9B 3M7QA 1EP5A 3LJOA 2M2AA 5A8XA 2D8WA 3RXMA 4MNYA 1BITA 2IOTA 1QRZA 1AZ8A 1AE8H 1SL3A 2H9EH 1J14A 1GMHG 1N8OB 2NU4E 4HFPB 4MPWA 3LGTA 5F8XA 3STIA 1K21H 1AHTH 3M5OA 4ZKNU 4FU8A 3MEMA 4XBDA 3RP2A 1T4VH 4DGJA 2V7QD 4CRDA 4IC6A 2G81E 1GMCG 1V2TT 3N7DA 3HK3B 3SV8A 5EGMA 4NIYA 1O3DA 3H09A 3ZVEA 5L2YH 1A2CH 2Y5GA 1LVYA 2WUCA 2P3UB 2GX4A 4X9EA 1C5UA 1MCTA 1C5LH 5I25A 2AMQA 1GJ7B 5IYTA 1O0DH 5E0HA 2GDDA 3GDVA 4AX9H 1A5IA 1K1OA 3SNCA 4ZMAH 1SGTA 5A09A 2WPJS 2ZHFH 1GJCB 4M7GA 4TO5A 1C5VA 1DFPA 2ODQA 1QTFA 1MKXH 1V2LT 2ZP0H 2QCYA 1BTXA 3LONA 2NU3E 3R3GB 3ODFA 1A5HA 1B7XB 3NQWA 5EOKA 5DP8A 1E1RD 2Z3DA 2VIPA 3IWMA 1C5MD 1Y3WA 1FPCH 2D2DA 1PYTD 2Z9GA 4X6PA 1VITF 3TGKE 3OY5U 1SOTA 2PGSA 2CGAA 3MI4A 2P8OB 4ABAA 2FEQH 2IPQX 1W3CA 2ZGBH 1BMLA 4TNPA 2Z9LA 1QHRB 1MD8A 2ZKSA 4OS7A 4Q7XA 4TO3A 5FAHA 4LRLA 1C1MA 5AO4A 1HCGA 1UVPA 3Q3YA 3V3MA 5C1XA 2ZF0H 1DE7H 3W95A 1P9UA 1NU7B 1YLNA 3OSYA 1NN6A 3VB4A 5A0BA 3SV2H 5ESTE 3P8NA 3UQOA 2LELA 3SN8A 3N7OA 3IG6B 2PKSB 1W14U 4FU7A 4KP0A 1CHGA 2ALPA 3QX5H 3F9HA 3UNQA 1YLCA 3DHKH 3OTPA 1HFDA 4QQYA 1AUTC 3ZZDA 1MZDA 1J17T 4FETA 3C1KA 2O8UA 4NIWA 4DW2U 4BNRA 1BDAA 1LMWB 2PKSC 1FDPA 7LPRA 1FXYA 2ZFRH 1EZQA 1ARCA 1C5SA 3RM2H 3LJXA 3Q3XA 1YF4A 1OWKA 4TY6A 4ABHA 4I8GA 3ZVBA 1CHOF 1E79D 1S0QA 1YYY1 1GI1A 3E3TA 2OTVA 1TNHA 4I86A 2EQNA 5AF9H 2STAE 4D9RA 1AMHA 2VGCB 4IBLH 1TQ0B 3TJUA 4OS6A 1ZHPA 1TBRH 2VIVA 1YKTA 1ELGA 4KTCA 2VU8E 1YNBA 3ZYDA 3M3SA 4X8VH 3PMAB 1VJ7A 1GHVH 3A88A 1DM4B 2O8LA 3MH6A 5K7RA 3GY2A 5DPAA 2Y6TA 1UO6A 3OTJE 1DXWA 1GI6A 1UVUH 4TY7A 3ZZ4A 1HAVB 2NU2E 1ETTH 2AH4X 3HI0A 3ZV9A 2BX4A 2PSYA 1GBCA 1C5XB 5DG6A 3E91A 5TKAA 1O5BB 3M5LA 1TLDA 2BLWA 1C2FA 2RA0A 3B9FH 1P01A 2OQ5A 5IDKA 3GCOA 3LU9B 4HZHA 2HNTE 1H8DH 1V2KT 3E0NB 4QFXA 2BD7A 5T6GA 4GVUA 2C93B 2BD3A 3GY8A 2GT7A 5LH8A 2K1QA 1IQEA 3MWIU 4NWLA 1CBWC 1CSOE 2PAQA 1EJMA 2VVCA 2Z6BD 2L6OA 1W11U 4FUHA 5F03A 3S7KB 1M9UA 1GBEA 3SGAE 4VGCB 1NO9H 1JWTA 4DMBA 1O3OA 1TIOA 2Y81A 4QG4A 1WSSH 2W3IA 4CRAA 2OC0A 5I46H 1BJVA 4ISNA 2GKVE 1O3FA 2QF0A 4YO9A 4TO4A 1CBWB 4YOIA 4WF8A 4DG4A 1OWDA 3MU1A 2STBE 2SGDE 2BOHB 3B8JA 1EAXA 1D3TB 1IQGA 1BRUP 4B76A 1BIOA 2A7JA 1UHBB 3OE7D 1WV7H 1UTKA 4I8LA 1LKBA 2EEKA 5FX6A 1O2HA 4TO1A 3P17H 1PPHE 1G30B 1LQEA 1AU8A 1TGCA 3BTTE 3TPIZ 1P2IA 5L2ZH 1OP8A 4TNZA 2W7UA 3M61U 1BOQA 4GCHG 4YLQH 3ZZBA 2VIDA 5HYOA 4K1EA 1DLEA 3SHAH 3TITA 3KH1A 1TNGA 1P2KA 5ESBA 1C1QA 1TA6A 1GG6C 1XUKA 2BB4A 2OLGA 4FUIA 1U6QA 1G32B 5C17A 1KMHB 5GIBA 1FY5A 2SGAA 3KCGH 4RN6A 1GI8B 5E0GA 3A7WA 1O3GA 3PM3A 1O30A 5A0CA 1V2VT 1H1BA 2B0FA 3WWBA 3TH2H 1ZMLA 4QQXA 3RC4A 5EIYA 2BDYA 3WY8A 4J2YB 3E90B 1MAYA 1MMJN 3JZ2B 2FOGA 1GG6B 2AGIX 4OGXA 2YMSD 2HRVA 4PROA 4KKDA 4KGAA 3GISB 2F9VA 1ZR0A 2P8OC 3ZYEA 4GHQA 1MBQA 3LGYA 2HOBA 2J98A 3HC1A 1V2NT 4ACAA 1WUNH 4THNH 1FAKH 1Q2WA 1WOFA 1SLUB 1Y3YA 2UUYA 3FKSD 5FXLA 3A8AA 2CMYA 1GVKB 1NRPH 2KCYA 2ZGCA 4ABFA 1UK3A 1W13U 6CHAB 3BG4B 3Q00A 3ELAH 1K22H 4ISHH 2G5NA 2VB0A 4F48B 4RT0A 2FODA 4TNRA 2AMDA 4DJZB 2AGGX 4TYDA 1ESBA 5F6MA 1YPJH 3ZIAD 3VXFH 3MO3A 1IQHA 4ZKOU 1CGHA 3URCA 3CCGA 1JRSA 3GCNA 4H4FA 3KEEA 5JYIA 1QBNA 1HDTH 5F8ZA 1TNKA 4LOYH 1MZAA 3EQ0H 4A1TA 3MTYA 1OX1A 2YNBA 4FVBA 3P8OA 1PQ8A 1RIWB 3OEED 5EXNA 3SZNA 1TOCB 1YOYA 3DCLA 3O8BA 3F0OA 5FCRA 1D6WA 1W0ZU 1HAGE 1A7SA 6GCHG 1Z8GA 5JB8S 3PTBA 1K1MA 5ETXA 3SORA 2AYWA 3S9CA 2HWLB 3PMHB 1MTNC 3FZZA 3MH7A 4RKJB 1BUIA 5CHBA 3UNSA 1D3DB 1QL7A 2OP9A 2ILNA 3SNDA 1B5GH 2ZU2A 1WCZA 2K8IA 5F53A 3RXTA 4AG1A 1TPOA 1V2WT 1P3CA 3FOAA 1FIZA 5EPYA 1AN1E 8GCHF 4D9QA 1ZGIA 4JK6A 3A85A 4X2XA 3ZZ8A 1AY6H 4UEHH 3NRLA 2ODPA 3DFJA 4JYVH 3V12A 1HAPH 1SC8U 3A7XA 1O35A 2G5VA 3PWCA 5DKMA 1ANEA 1FV9A 2ZU3A 5TCAA 1BT7A 2FLOA 1D3PB 5AFZH 1QGFA 2ZO3H 1L1GA 1O34A 2AGEX 2ALVA 2BLQA 4WH8A 3GDUA 3SI3H 3UAIC 1C1UH 1LKAA 3A86A 5C1YA 3SW2B 2Z3EA 1BA8B 3HKIB 2ZEBA 2ZFTA 3AAVA 1PQ7A 1ZHRA 4AYVB 1RFNA 3PLKA 4Z0KA 1SHYA 4JCNA 3RXLA 1GHYH 1LHCH 4Y8ZA 3VFEA 1C2LA 1D3QB 1MTNB 1OYQA 4H42U 4L1JA 2FP7B 3SUDA 2DE9A 3PTNA 3TGIE 3P92A 2OXSA 3WWFA 3KF2A 1DICA 3F6UH 1EAUA 1ABJH 3PMJA 1O2VA 3BG2A 1UK4A 2SGPE 3BIVH 1MKWH 5PTPA 1TGTA 3TH4H 1KXFA 1AGJA 1EASA 4NSYA 1EJAA 3ODDA 3D49H 3W94A 1NROH 2R9PA 1MKXK 4UFEH 2BD4A 3P6ZB 1WXRA 5EQSA 2BY6X 1TPPA 4WH6A 4WMFA 2ZECA 1C1VH 2A7CA 1W7GH 3MFJA 2KCPA 2PV9B 1Z6JH 3A80A 3ZVFA 2G51A 1Z1JA 2PQ7A 1XKBC 2UWLA 3K2UA 2BTCE 5CHAB 4IC5A 1RGQA 3U8TH 4AN7A 4FUDA 4CBOA 3RXCA 1Y3UA 3LIWA 1XVOA 4HI3A 1K9OE 1MD7A 3LH3A 1HJAB 2FWWA 4MDSA 1GJ9B 3NK8A 1GJBB 4AG2A 4Y79A 2EI7A 1QFKH 4ABDA 1DXPA 4R8TB 1QB9A 1KTTB 1A61H 1BBRH 1TWXB 3ATMA 4K3JA 2G52A 4DT4A 3S9BA 1U6ZA 7GCHG 4Q2CA 2F3CE 4Y71A 1GHXH 5DJ7A 4B1TA 1FONA 4BTUB 2C8XB 1NFXA 1HJAC 3VB6A 3M1TA 1XUJA 1BCUH 2WPDD 3KYGA 2PAUA 1L4DA 3OU0A 5EJ1A 3RXPA 3N7EA 5B6LA 3UWIA 4MVNA 1SB1H 3PV2A 1UMAH 2F9UA 4AORA 1ELBA 3DSPA 1FY4A 1PPZA 3SGBE 4YZUA 1GCDA 3NUMA 1RD3B 4WY3A 1D6RA 5EG4A 2H5DA 5FPYA 4AFQA 2KZ4A 4FUEA 4NZQA 2V3MA 3VG8A 3D62A 1NM6A 4GPGA 1G37A 4WXIA 1CA0C 1Z8JB 1F0SA 1YBWA 1NZQH 2JH6D 1C2HA 2F43B 1O3NA 2FOCA 2ZGXH 4M9FA 1ETRH 3T26A 3SBKA 2CXVA 3GYMA 2JETB 1T8OA 5SGAE 2A45B 2BVXH 3MNSA 2FOEA 1EP6A 3SQEE 2F4LA 2V6NA 1BMAA 1AO5A 5EPNA 2UWPA
chains in the Genus database with same CATH topology
2CQZA 3NQWA 4ZWEA 4QFZA 4N71A 4QQWA 3TM8A 4ME4A 3BG2A 4XDSA 4QG0A 4TNRA 4MDZA 3RF0A 3SK9A 2PAQA 2GZ4A 2PGSA 4Q2DA 1VQRA 2IPQX 4QQZA 4TNPA 3NR1A 3CCGA 4TO3A 5TK8A 4LRLA 4QG2A 5AO4A 4DMBA 5TK9A 4QG4A 4MLNA 4N6WA 3I7AA 4TO6A 3SKDA 2DQBA 2PQ7A 3TMCA 4TO4A 4QFYA 1YOYA 3S4LA 3IRHA 4R8ZA 4TO0A 4L7WA 1XX7A 4QQYA 3TMBA 5AO3A 4MCWA 4TO1A 5TK7A 4TNZA 3KQ5A 1U6ZA 4RXQA 3LJXA 4Q2CA 5AO1A 3KH1A 4MLMA 3M1TA 3MEMA 4QG1A 4BZBA 2PAUA 4BZCA 4TNYA 5AO2A 4ZWGA 1YNBA 1VJ7A 4L7EA 2FLOA 4L1JB 3GW7A 3P3QA 4QQXA 4X9EA 4RXOA 2OGIA 3TMDA 3MZOA 5AO0A 2O08A 4TO2A 2PARA 4RXSA 3HI0A 4Q7HA 2Q14A 4TNQA 3HC1A 4MZ7A 5TKAA 4TNXA 5TK6A 4TO5A 2O6IA 4RXRA 3U1NA 2HEKA 4RXPA 4QFXA 4L1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPQ X;  3KQ5 A; 
#chains in the Genus database with same CATH topology
 1C5Z B;  1EPT B;  2WPK S;  1FNI A;  4QFZ A;  1ZJD A;  3ZVG A;  3QZR A;  1O2N A;  1V2Q T;  4ME4 A;  1TNL A;  1PJP A;  1BZX E;  1Y3X A;  3RC5 A;  2FLR H;  2JET C;  1GBI A;  4MDZ A;  1SOZ A;  2ZDN A;  2GV6 A;  1GHB F;  1MAB B;  1CT0 E;  2FOM B;  2VVU A;  1RTF B;  1ZPB A;  3F1S B;  1RS0 A;  3A82 A;  1AKS B;  3RMO H;  5LGO A;  2TPI Z;  4K8Y A;  2A4R A;  4I32 A;  1C1R A;  1P2M A;  4AOQ A;  1C5Q A;  3EST A;  3W1E A;  2BX3 A;  2GMT C;  2ANW A;  2ZIQ H;  1CGJ E;  2BOK A;  1MQ5 A;  1OWI A;  1ZZZ A;  2FS8 A;  2W7S A;  1JRT A;  1HBT H;  1ZTJ A;  4XDE A;  2FLB H;  1GHA G;  4L7W A;  2QXH A;  2ZDK A;  5EW2 H;  3L33 A;  4JZ1 A;  1W0Y H;  1GBF A;  1UK2 A;  3LGU A;  4CH8 B;  2B9L A;  2PSX A;  2ZU5 A;  7KME H;  4FVD A;  3TK6 A;  4B75 A;  1CU1 A;  1S85 A;  1TFX A;  1DSU A;  1EJN A;  4GUX A;  1Z1I A;  3K6Z A;  3TU7 H;  1BHX B;  1OKX A;  2Q6G A;  1Q31 A;  5DO4 H;  1F0T A;  4QT8 C;  1S0R A;  1FIW A;  2H2Z A;  1H9H E;  3F2G A;  2GZ9 A;  2TBS A;  3TIU A;  1EAW A;  1ETS H;  4AB9 A;  2A1D B;  1TNJ A;  3T27 A;  2ANM H;  2PFE A;  1BHX F;  1EAI A;  5AO0 A;  4EST E;  1QB6 A;  1MAX A;  4Q80 A;  1LHF H;  1ZTL A;  3TNS A;  4JZD H;  2ZI2 H;  4CH2 B;  4ZRO A;  4I8K A;  4AB8 A;  5TK6 A;  1HXF H;  1JOU B;  1XKA C;  3ZZ7 A;  4B2B A;  3FP6 E;  1GJD B;  5T3H A;  1QQU A;  4ACB A;  2FPZ A;  1UCY K;  2VJ1 A;  3EE0 B;  1SGR E;  4ZWE A;  3CNR A;  4N71 A;  4D7F A;  4UDW H;  4X6O A;  4XDS A;  1ELC A;  1F92 A;  1KY9 A;  1LPK B;  2IJO B;  1RRK A;  3MOC A;  2EC9 H;  2H1U A;  2RDL A;  5CE1 A;  2ZDA H;  2J5U A;  1IQF A;  3R0F A;  1HJ9 A;  1ZSK A;  4FUF A;  3RXD A;  6LPR A;  2WV5 A;  1O2K A;  2P95 A;  3ZZ3 A;  4N6W A;  3ZVA A;  1EFR D;  2W3K A;  4I7Y H;  1SPJ A;  1X7A C;  1TRN A;  4ABE A;  1ID5 H;  1C5R A;  1ZMN A;  4A7I B;  2ZZU H;  2AS9 A;  3RU4 D;  3UWJ H;  2ZQ1 A;  3M7T A;  1KIG H;  1SKY E;  2HGT H;  1LVM A;  1TAL A;  3GCH B;  2M5T A;  1P2J A;  1TGN A;  1O2O A;  3BTQ E;  1Z7K A;  4B6E A;  3CS7 A;  3KN2 A;  4Y8Y A;  5HM9 A;  1VCQ A;  1T8N A;  2QF5 A;  1QCP A;  1AI8 H;  2ZA5 A;  2ZGH A;  5C20 A;  1FMG A;  1OSS A;  1HAY B;  2QC2 A;  3ATK A;  1O3J A;  1SGF G;  1KDQ A;  3ZVD A;  1YPK H;  2OC1 A;  5FL7 D;  3SJI A;  4ZH8 A;  1ZTK A;  3FO8 D;  4P00 A;  1LPG B;  1TQ7 B;  2P3T B;  2THF B;  3S7H B;  5C94 A;  3OEH D;  4ZKS U;  1OOK B;  2FOB A;  4Q63 A;  5FBE A;  2XXL A;  3QN7 A;  2A5A A;  3E8L A;  2TGA A;  3RXE A;  2TGP Z;  4IN2 A;  1EOL A;  4ZHM U;  8LPR A;  4X1P U;  2O8T A;  4NA9 H;  1YPL H;  1P03 A;  2W5E A;  2YMS C;  4YOG A;  1WBG B;  3T62 A;  2RCE A;  4OM9 A;  5C3N A;  1YC0 A;  4RXS A;  2PHB A;  3Q76 A;  1PPG E;  2BVS H;  3NXP A;  3A7V A;  5B6O A;  2XC5 A;  2P16 A;  1TX7 A;  1NES E;  3TH3 H;  1OWJ A;  3CEN A;  1TBZ H;  2VIO A;  1CE5 A;  1LHE H;  1G2M A;  3M36 A;  4I33 A;  5JBC S;  3S69 A;  2WIN I;  1BTW A;  2BD5 A;  2CF8 H;  2P93 A;  2ZFQ H;  3GY6 A;  3LC3 A;  1PQ5 A;  3O8D A;  1S6L A;  2KX4 A;  1O2W A;  1AB9 B;  4GAW A;  2BMG B;  2O8M A;  3U28 C;  2ZWL H;  2QYI A;  3UOP A;  1SHH B;  2GZ8 A;  1TYN A;  1HGT H;  3RF0 A;  2QF3 A;  1C1P A;  1BBR E;  1O2X A;  2QN5 T;  4JZE H;  1GBB A;  1HXE H;  1NTP A;  3KID U;  2H6M A;  3RXH A;  3EE7 A;  3BTF E;  2BXU H;  1HAX B;  1C2J A;  3PMB B;  2FX4 A;  1ELV A;  1PPB H;  2SGF E;  2BDB A;  1KXA A;  3BEU A;  1TMB H;  1UTQ A;  2VH6 A;  1MTU A;  7EST E;  4BAN B;  3RUO A;  2GTB A;  3FFG A;  2FXR A;  1UTO A;  4TWY A;  3BSQ A;  2WYG A;  2WV9 A;  3FAN A;  4CR5 A;  1UCY E;  1CHO G;  3VB3 A;  4IMZ A;  1P2Q A;  1ZYO A;  3HPT B;  4H6T A;  3RXF A;  4CRF A;  3ATL A;  4RKO B;  3MU8 A;  4MLM A;  1AVX A;  1QR3 E;  1UVS H;  3U69 H;  1AIX H;  3GY7 A;  1C2G A;  4MNV A;  2J94 A;  4YTA A;  3T29 A;  1O33 A;  5EQR A;  4BZC A;  2FI4 E;  1GI5 A;  1HAI H;  1XXD A;  3QK1 A;  3LKW A;  1SLX B;  1TOM H;  1TE0 A;  3A7Z A;  3FN8 A;  1SLW B;  2FOF A;  2WPI S;  1AD8 H;  2WV4 A;  3RDZ A;  4O3U A;  1AWH B;  1QQ4 A;  2WHX A;  1ZSL A;  1JIM A;  1FI8 A;  1GMH F;  2A31 A;  2WPH S;  1T4U H;  4A92 A;  2GVF A;  2L74 A;  4HGC A;  2OK5 A;  1S6F A;  3GCH C;  1O32 A;  3UTU H;  3HKJ B;  3L3T A;  7GCH F;  1GBA A;  2PAR A;  4BAO B;  1SGY E;  1LVB A;  1S5S A;  4Q7H A;  4WVP E;  3NKK A;  5FX5 A;  2Q14 A;  2PLX A;  2CHA B;  3F9F A;  2BVR H;  3MH5 A;  2BM2 A;  2CK3 D;  4XFQ A;  2OD3 B;  4X6M A;  3SJO A;  2O6I A;  2G00 A;  2ODY B;  2BD8 A;  1BB0 B;  3QDZ B;  3ZZ9 A;  5E0J A;  3FAO A;  3M35 A;  5DP4 A;  3UFA A;  1TON A;  1EQ9 A;  1TRM A;  4Q7Z A;  2YNA A;  1JXP A;  1JBU H;  1O2T A;  3E6P H;  1G3B A;  4QQW A;  1NRN H;  3RXR A;  4DUR A;  3RMM H;  4LK4 A;  5JDU B;  1UVT H;  1CA8 B;  1P8V C;  2XBX A;  1F5L A;  3RXJ A;  1NS3 A;  2J34 A;  1GPZ A;  1DAN H;  3RMN H;  4NCY A;  1IHS H;  2SFA A;  4CRC A;  1DUE A;  2A4Q A;  1LHD H;  1O38 A;  2B8O H;  2V0B A;  3KQC A;  1A0L A;  5TK8 A;  3A8C A;  2F83 A;  3MNX A;  1C1S A;  2XNI A;  1FY3 A;  5TK9 A;  4MPV A;  3VB5 A;  1J16 A;  2H5C A;  4NG9 H;  1O5F H;  3KYF A;  1QIX B;  1ZRK A;  1BRC E;  2OBO A;  3HAT H;  2Y82 A;  1BRA A;  1H8I H;  2D26 C;  3SNB A;  2XND D;  3TJO A;  1AWF H;  2Y7X A;  2D1J A;  5EW1 H;  1O2R A;  1A0J A;  3JZ1 B;  2NU0 E;  1ZGV A;  1FY8 E;  4UE7 H;  1SFQ B;  2JIZ D;  3TJV A;  1E37 B;  4MG3 A;  3SHC H;  4GCH F;  4X1R U;  3U8O H;  2GCH F;  1T32 A;  1EXF A;  1VGC B;  4OS4 A;  4WME A;  3UIR A;  1HPG A;  2PWX A;  3QTV H;  1QBV H;  3PLP A;  1EUF A;  1TPS A;  1FX0 B;  4F55 A;  2HNT C;  1J8A A;  3UOU A;  3VGC B;  4MLF B;  4HG6 A;  1C4V 2;  3VPK A;  1NU9 A;  3HGP A;  2BDH A;  3SU0 A;  1GI7 B;  1EZX C;  1C2M A;  1DPO A;  2SNW A;  2W26 A;  2P59 A;  2C3S A;  4WWY A;  5AO2 A;  1P57 B;  2GJG A;  2R2M B;  4ZWG A;  2FDA A;  4ZUH A;  1SR5 C;  1EKB B;  2VIN A;  1V6D A;  4L1J B;  3M5M A;  4A6L A;  1OS8 A;  3KNX A;  3AK5 A;  1HLT H;  3MH4 A;  4TPI Z;  4XSK U;  3AVZ A;  2I6S A;  1OWE A;  4AC9 A;  1QUR H;  1ELD E;  2V35 A;  1F0R A;  4UON A;  2GCT B;  2QA9 E;  1AFQ B;  1DWB H;  3IIT A;  1V2M T;  2PW8 H;  2LP6 A;  3UR9 A;  3LPR A;  1ZLR A;  3M3T A;  5FPS A;  5A8Y A;  1YLD A;  4TNX A;  2AEI H;  5HGG A;  1C2E A;  2HAL A;  3LGV A;  1VCP A;  3PRB A;  1AKS A;  3ZZA A;  5F8T A;  1Y5U T;  2ZNK H;  3BTG E;  4GLY A;  2F9N A;  2GCT C;  1G9I E;  4F49 A;  5HIY A;  3SU3 A;  4XRN A;  2KAI A;  3KQE A;  3DT0 H;  1E38 B;  2BD2 A;  3DUX H;  5G4B A;  4DII H;  4D7G A;  2ZTZ A;  2Y5H A;  1A5G H;  1O2P A;  1GCT C;  1H9L B;  1K1N A;  2K0Q A;  4Y8X A;  3P8F A;  3HGN A;  3LGW A;  4AFS A;  3SK9 A;  1OHH D;  4Y7A A;  1NRS H;  4ZCN A;  4B6F A;  1DVA H;  3P70 B;  1QBO A;  3E16 B;  2Q1J A;  3SNE A;  1DOJ A;  3I7A A;  1MU8 B;  4B71 A;  1RJX B;  1C5P A;  5BRR E;  1O3C A;  2KCA A;  3MHW U;  4Y76 A;  4UFF H;  1O5G H;  2EA3 A;  1SG8 B;  3SGQ E;  2P3F H;  4XBB A;  4I8J A;  1HAV A;  8GCH G;  1Y5B T;  5AFY H;  2ZDL A;  3SUF A;  4YT7 H;  1O3I A;  1TBQ H;  1UTN A;  1XX7 A;  3G01 A;  1A3B H;  1AFQ C;  4AFU A;  3TJN A;  2OC7 A;  9EST A;  3MNB A;  3S0N A;  3U9A H;  4LZ1 H;  5EXM A;  1SQO A;  1TPA E;  2GD4 B;  3A8D A;  1UJ1 A;  2HPQ H;  1CT4 E;  4CRB A;  3SU1 A;  4WMD A;  2AIP A;  4JYU H;  2CHA C;  3MU4 A;  1AZZ A;  2F91 A;  3BTD E;  5TJX A;  5TCC A;  6CHA C;  2Q6D A;  1GBM A;  3SJ8 A;  1GL0 E;  3SZE A;  1MQ6 A;  4MNX A;  4ABJ A;  2ZQ2 A;  5C1U A;  9LPR A;  3RU4 T;  3BTK E;  1O2L A;  3UPE A;  1Y8T A;  3O8R A;  5EJZ A;  1GVL A;  2BY7 X;  4ASH A;  1BQY A;  3MNC A;  3D23 A;  4D8N A;  8KME 2;  2C4F H;  2CJI A;  4FUG A;  4TO2 A;  2VGC C;  3HK6 B;  1P11 E;  4OS1 A;  1CQQ A;  1CGI E;  2BQ6 B;  2EST E;  2IN2 A;  2BY9 X;  1YY3 A;  2BQW B;  4MZ7 A;  1H4W A;  1LO6 A;  2XWB I;  4XOJ A;  1KTS B;  1ZMJ A;  3AW0 A;  3SV7 A;  3PRO A;  4XBC A;  5DP6 A;  2PGQ B;  3GYL B;  3ZZ6 A;  3ATI A;  1DIT H;  1FY1 A;  1ZPZ A;  4TWW A;  1Z71 A;  1O2Z A;  2NU1 E;  1T31 A;  3U8R H;  5AVD A;  2R0L A;  1YPG H;  2CQZ A;  1F5K U;  4I31 A;  5C2Z A;  1INC A;  4SGB E;  4TT3 D;  2C8W B;  4FUJ A;  1EAT A;  2Y80 A;  1O2J A;  1PPC E;  4QG0 A;  2R3Y A;  1P9S A;  1P2O A;  3LOX A;  4K8B A;  1EB2 A;  1O36 A;  2QY0 B;  3KQD A;  1A3E H;  1THP B;  2O9Q A;  2FMJ A;  1P02 A;  3PV4 A;  2QXI A;  1NC6 A;  3E0P B;  5E2P A;  1K1J A;  1RTK A;  1XXF A;  3QZQ A;  5C67 A;  2ZPR A;  5HM2 A;  2V3H H;  5C5N A;  4B2A A;  1WTH D;  2W6J D;  2VWO A;  2KCO A;  1C2D A;  2PTC E;  4KTS A;  3PRD A;  2QF4 A;  4CBN A;  3NZI A;  1GJA B;  3DA9 B;  2KR7 A;  1XM1 A;  4DVA U;  3T5F H;  1GI9 B;  1TAW A;  1NT1 A;  5FBI A;  4A1X A;  1C5W B;  4OS2 A;  1BTP A;  3EA7 A;  3EGK H;  1T8L A;  1W8B H;  1V2P T;  5AHG H;  1YPH C;  5DP7 A;  1GGD B;  1C1T A;  1H9I E;  1L2E A;  3KQ5 A;  1HAH H;  3RML H;  1GDQ A;  1GJ8 B;  2ZCH P;  3MU0 A;  1E34 B;  5AO1 A;  3QTO H;  5EU8 A;  3DSO A;  2J9N A;  1SSX A;  2H9H A;  3RXB A;  2I6Q A;  1COW D;  1ZJK A;  3Q77 A;  1IQI A;  2J38 A;  1T8M A;  4Y6D A;  1W7X H;  2WYJ A;  3DFL A;  1NBM D;  1UVO A;  4Y0Y E;  1GBT A;  1GJ6 A;  3RXG A;  1GMC F;  4ISL A;  2ZU1 A;  4X6N A;  4U32 A;  1YM0 A;  1OPH B;  3P8G A;  2IPH A;  5L30 H;  1KYN A;  4XE4 A;  2CF9 H;  3TGJ E;  2PKA B;  4RXO A;  1O3M A;  1V3X A;  2KFW A;  3ZV8 A;  2O08 A;  1QA0 A;  3MU5 A;  3BN9 A;  3BTW E;  5HIZ A;  2W6I D;  4X8T H;  5A2M H;  1IOE A;  3M7U A;  3EA9 A;  1KLT A;  5FHT A;  5CHA C;  4E7N A;  1OWH A;  1VJA U;  1CT2 E;  1O2I A;  2TGD A;  1Y59 T;  1BTZ A;  1KXC A;  2Z9J A;  3LDX H;  1H8H D;  1SGF A;  5FCK A;  3E1X B;  1WU1 A;  4X2W A;  2HPP H;  3U1J B;  5JB9 S;  5GJ4 B;  5GCH F;  1S6H A;  1SQR A;  1VR1 H;  3TM8 A;  1KXB A;  1CO7 E;  1JMO H;  3I78 A;  1FN6 A;  5CMX H;  4BXS A;  4LXB H;  3RXK A;  5LPF A;  2R2W U;  1HAO H;  5DP3 A;  4VGC C;  1AVG H;  1DX5 M;  1P05 A;  3ZVC A;  5GXP A;  1SFI A;  1QJ7 B;  4Q2D A;  4D76 A;  1LHG H;  3O8C A;  1GJ4 H;  1HIA B;  4JZF H;  2XC0 A;  4NA8 A;  5GWZ A;  1GI0 A;  2FOH A;  4RI0 A;  4Y11 E;  1O37 A;  2XOK D;  3KQB A;  8EST E;  4MNW A;  3MMG A;  1ANC A;  4IGD A;  3PO1 B;  1C5O H;  1V2O T;  1VJ9 U;  1K28 D;  4Q2K A;  5EXL A;  1EX3 A;  1S82 A;  1YPM H;  3UUZ A;  3TMB A;  1F7Z A;  2OBQ A;  4Y0Z E;  1DDJ A;  4YT6 H;  1HIA A;  2C8Y B;  3AW1 A;  1LPZ B;  1RIW C;  1N8O C;  3I29 A;  3KHV A;  4FXG H;  5TK7 A;  1BJU A;  3D65 E;  3GOV B;  1YCP K;  5C0U A;  4BTI B;  3ENS B;  4AGK A;  3VGC C;  1MTW A;  1HB0 B;  1Q3X A;  6GCH F;  5LPE A;  1P06 A;  2RG3 A;  3MO9 A;  5T6F A;  3BG4 C;  3NCL A;  4E06 H;  3OAA D;  1C2I A;  1ZSJ A;  1DT2 A;  3CP7 A;  2PR3 A;  4BZB A;  3F68 H;  2J2U A;  1V2S T;  2JKH A;  1O3E A;  4DCD A;  5K0H A;  3DD2 H;  1FZZ A;  4O03 A;  3RU4 E;  1MCV A;  1NFY A;  3GS9 A;  1SVP A;  2A7H A;  3F2F A;  2AHM E;  2SNV A;  4K1S A;  2OGI A;  5DSF A;  3SYJ A;  1GMD G;  2QGR A;  4BXW A;  3SU2 A;  1W2K H;  1B0E A;  4NWK A;  2JH0 D;  4DT7 B;  1WTG H;  3RM0 H;  1GI3 A;  3BIU H;  1YCP M;  4UFD H;  4INH A;  2Z3C A;  5C0T A;  2CN0 H;  3PB1 E;  1FJS A;  2F9P A;  2OIN A;  2QIQ A;  3P95 A;  3RXQ A;  3SQH E;  5A8Z A;  4CR9 A;  1ZHM A;  5GND A;  2AFQ B;  4WJG 2;  1B0F A;  1ACB E;  3GY5 A;  3RLY H;  1SGI B;  5GDS H;  1WYK A;  5E2O A;  1KLI H;  2ULL A;  2KAI B;  4X0W U;  4AZ2 B;  2XYA A;  1FQ3 A;  1SGP E;  1HNE E;  1FUJ A;  1KLJ H;  3A83 A;  1UCY H;  1K0H A;  3VXE H;  3F9E A;  1K1P A;  4YLU A;  3LT3 A;  3RC6 A;  2GDE H;  1VQR A;  1Z8I B;  1GVZ A;  2FI3 E;  1KDQ B;  2BD9 A;  1K1L A;  2A4G A;  4MLN A;  1IQM A;  2GT8 A;  1OXG A;  4X1N U;  1GMD F;  4BAH B;  5DP9 A;  5L6N H;  3GY4 A;  2DQB A;  1SGN E;  1ELT A;  4O9V A;  3QLP H;  2BDI A;  2VWN A;  2ZFS A;  4QFY A;  2LPR A;  3S4L A;  2VH0 A;  1GL1 A;  2G8T A;  3H7T A;  3A89 A;  1EZU C;  1O2M A;  2HVX A;  1UTL M;  1OP0 A;  2O8W A;  2G4U A;  3AAU A;  3ZZ5 A;  1V2J T;  5J4Q A;  3WW7 A;  1FLE E;  3FP7 E;  2FOA A;  3I77 A;  1XVM A;  1ELE E;  2SGQ E;  4B73 A;  1AUJ A;  2XCN A;  1EZS C;  3QUM P;  3ITI A;  1D4P B;  1NY2 2;  5DP5 A;  4U30 A;  3T2N A;  1AND A;  1GBL A;  1E36 B;  2PTN A;  2ANY A;  2YOL A;  2RFK C;  4QG1 A;  1DLK B;  4ZHA A;  1DY9 A;  5KGO A;  1FN8 A;  4GSO A;  1MTV A;  4TPY A;  1TB6 H;  4Q4L A;  4BAM B;  1SMF E;  4JK5 A;  4L7E A;  3CS0 A;  4GHT A;  3A8B A;  5JBB S;  3RXV A;  1YP9 A;  4KEL A;  1BTU A;  2J98 B;  1XUF A;  2H9T H;  2ZTY A;  4TSF D;  3BF6 H;  3UR6 A;  2J95 A;  1KXD A;  3SO3 A;  3RLW H;  4BAQ B;  2A32 A;  4TNQ A;  4AGJ A;  4ASU D;  3OY6 U;  2VIQ A;  1W0J D;  1QL9 A;  1IQJ A;  3MQK C;  1K2I 1;  1UW7 A;  3PWB A;  2V3O H;  3V0X A;  3U1N A;  2FTL E;  4Z6A H;  4RXP A;  5EJL A;  1NPM A;  4LZ4 B;  5EQQ A;  1EOJ A;  5GCH G;  2QAA A;  3SU6 A;  1YPH E;  2XC4 A;  2BXT H;  3RXU A;  2ZPS A;  4INK A;  1DS2 E;  1ORF A;  2PUQ H;  3TK5 A;  2FIR H;  1MH0 A;  1C4Y 2;  1HV7 A;  1DWD H;  2DUC A;  3MO6 A;  3PLB A;  4Z1M D;  2RA3 A;  1ESA A;  1GDN A;  3SNA A;  4BOH A;  4X1Q U;  1WDI A;  3NR1 A;  3LH1 A;  1GI2 A;  2IJD 1;  2FI5 E;  1H8E D;  2WSS D;  2FZZ A;  2UUK B;  1UHB A;  3M5N A;  2CV3 A;  1P12 E;  1HRT H;  2GCH G;  3BTH E;  4TO6 A;  1O3K A;  3SV6 A;  4Y7B A;  1MTS A;  3SKD A;  1BMF D;  1XUG A;  3F3B A;  3UNR A;  1A1R A;  5DN6 D;  2Q6F A;  3TK9 A;  1GWA A;  1DWE H;  1IAU A;  3VB7 A;  1YWU A;  1AB9 C;  1AFE H;  1LQD B;  1C5Y B;  1G3E A;  1N6Y A;  1RXP A;  1ANB A;  1IQN A;  2A4O A;  2UUJ B;  4CRG A;  2QE7 D;  4B74 A;  1DWC H;  1L1N A;  3GCT F;  2GV7 A;  1VKY A;  1ELA A;  1YPE H;  4NFF A;  4K1T A;  1G3D A;  1TGS Z;  4Y10 E;  3T28 A;  1HAZ B;  2PUX B;  3BG8 A;  1A0H B;  4RSP A;  2A5K A;  4RXQ A;  1G2L A;  2A2Q H;  1VGC C;  3OYP A;  4K69 A;  1TRY A;  1GHA F;  1Z8R A;  3N99 A;  4DY7 B;  5C5O A;  3GIC B;  4JYT A;  1BRB E;  3V7T A;  1FAX A;  1VIT G;  2B7D H;  5CDF E;  1AE5 A;  1BBR K;  3URD A;  2ZDM A;  1NFW A;  1TAB E;  2A0Q B;  3ZZC A;  1E35 B;  5HKK D;  3A7T A;  2G4T A;  5A0A E;  4NSV A;  1GDU A;  1EPT A;  4YXW D;  4E05 H;  1MU6 B;  1W12 U;  1CA0 B;  1CVW H;  4XD7 D;  4CRE A;  1C5N H;  3P3Q A;  1DST A;  1T7C A;  5JPM H;  3BV9 B;  3TMD A;  2TGT A;  1J9C H;  1O39 A;  3AAS A;  1C5T A;  1QRW A;  3BTE E;  3NPS A;  1NRR H;  1FPH H;  3RXA A;  3F0P A;  3STJ A;  1EST A;  1TNI A;  2HLC A;  2BY5 X;  1S83 A;  4ZHL U;  1D9I A;  2BYA X;  2LNC A;  3F2H A;  1BTH H;  1BMM H;  1BMN H;  3LGI A;  3U1I B;  1O3B A;  2BLO A;  1NFU A;  1BTY A;  3K65 B;  4FU9 A;  1G36 A;  4RXR A;  3C27 B;  2JJ1 D;  2ZCK P;  2OUA A;  1C1O A;  1E1Q D;  2AIQ A;  1LTO A;  5E8E H;  2J97 A;  3RXO A;  1MBM A;  1F5R A;  3TLO A;  4UFG H;  3DSG A;  1MKW K;  1S81 A;  1UTP A;  1P10 A;  3A81 A;  4MQA A;  2FES H;  2BZ6 H;  1ZOM A;  3LC5 A;  5EOD A;  4H6S B;  1SI5 H;  1SBW A;  1TGB A;  3MYW A;  3NWU A;  2EI6 A;  2OCV B;  3BTM E;  2GMT B;  2FM2 A;  1LVO A;  1TMT H;  1QRX A;  1QL8 A;  2SGE E;  1WQS A;  2ZU4 A;  5H4I B;  1GJ5 H;  2YMS B;  2ZHQ H;  4QG2 A;  1W10 U;  6EST A;  2AER H;  4I8H A;  1LCY A;  2BHG A;  4DOQ A;  1SQA A;  3QWC H;  2NWN A;  4NIV A;  1PPE E;  5GPI B;  1O3H A;  1S84 A;  2XTT B;  2F9B H;  4WXV A;  2QXJ A;  1PPF E;  2C90 B;  2WZQ A;  2ZPQ A;  4MPX A;  1UTM A;  4ZAE A;  1GBD A;  1O2S A;  1DUA A;  2ZC9 H;  1V2U T;  1XUI A;  5AO3 A;  1QA7 A;  4SGA E;  5ABW A;  2VWL A;  5IK2 D;  1V2R T;  4X2Y A;  1O2Y A;  3GCT G;  3SU4 A;  1GI4 A;  3OFN D;  4JZI A;  2GZ7 A;  1EB1 H;  2TIO A;  1QY6 A;  4IN1 A;  2R0K A;  1JIR A;  3L6P A;  2BDA A;  5J4S A;  4X2V A;  1C4U 2;  1P2N A;  3FZD A;  1K1I A;  2A2X H;  3UB0 A;  4K5Z A;  2XBY A;  5FPT A;  1Z6E A;  1TMU H;  4U01 A;  2EY4 C;  3RXI A;  1Y3V A;  1N6X A;  1C9P A;  1WQV H;  4R0I A;  1TA2 A;  2VIW A;  2Y7Z A;  3KL6 A;  2XBW A;  2ZHD A;  1GBJ A;  4BTT B;  4NA7 A;  3GW7 A;  2FYQ A;  2XWA A;  1XX9 A;  2OQU A;  2VNT A;  4P02 A;  2J4I A;  2ASU B;  5T6D A;  3SI4 H;  4DIH H;  2JDI D;  4B2C A;  2BLV A;  4MTB A;  2P94 A;  3RXS A;  5HXF A;  2ANK H;  4CHA B;  1E0F D;  1SGQ E;  1QJ6 B;  4ZXX H;  4Q7Y A;  4FUC A;  1W0K D;  3BEI B;  3F9G A;  3U98 H;  1F0U A;  1QNJ A;  4ISO A;  1A46 H;  5HMA A;  2Z7F E;  5JBT A;  1ARB A;  1GCT B;  2HEK A;  2HLD D;  3A7Y A;  3GY3 A;  1KSN A;  2PKA A;  2PP6 A;  2C8Z B;  1GHZ A;  1L0Z A;  2OC8 A;  2ZGJ A;  4X8S H;  2Z9K A;  1L1J A;  2UWO A;  3A84 A;  1UTJ A;  1PYT C;  3OX7 U;  2XBV A;  3GDS A;  2KM0 A;  1VZQ H;  2ZHW H;  1GBH A;  4NZL A;  4AFZ A;  4IMQ A;  2F9O A;  2HNT F;  3ATW A;  3UY9 A;  4YM9 A;  1ZPC A;  3V13 A;  4NIX A;  3URE A;  1HJ8 A;  2Z94 A;  1O5A B;  4ISI H;  1SQT A;  1QJ1 B;  4X8U H;  4NGA H;  2VWM A;  1ELF A;  1OYT H;  2UUF B;  2BDG A;  2B5T B;  3H5C B;  1XMN B;  2GGV B;  1O2G H;  3TMC A;  1QZ8 A;  2AMP A;  3B23 B;  2ZTX A;  2ZFP H;  3TVJ B;  1SGD E;  2BY8 X;  2JH5 D;  1DY8 A;  1NRQ H;  1O31 A;  1SGE E;  1C1W H;  3QGN B;  2EI8 A;  3FVF B;  1C2K A;  4NFE A;  4ZXY H;  4JMY A;  4TO0 A;  4A1V A;  1F2S E;  1THR H;  2ZFF H;  4OS5 A;  1O3L A;  5LPR A;  1N1L A;  2DE8 A;  2PGB B;  3K6Y A;  4ZKR U;  1PQA A;  3UQV A;  2HVY B;  3LJJ A;  3SUE A;  1J15 A;  1VIT H;  3SUG A;  4YOJ A;  4OGY A;  3PV5 A;  3SJK A;  2ZHE H;  4HTC H;  2XW9 A;  3SV9 A;  1TX8 A;  2XRC A;  5KED A;  4YES B;  1IQL A;  4X1S U;  2Z9I A;  1SLV B;  3M3V A;  4UD9 H;  1MUE B;  4O97 A;  5T1V A;  3BEF B;  3A87 A;  2FS9 A;  4U2W A;  4A5T S;  4RT1 A;  1A4W H;  1KXE A;  1OP2 A;  2ZDV H;  4TNY A;  1HUT H;  1VCW A;  1P3E A;  3TNT A;  1YGC H;  1HYL A;  2G55 A;  2J92 A;  1O2Q A;  2FYR A;  1C9T A;  2VVV A;  5JBA S;  1PFX C;  4BAK B;  4CHA C;  3MZO A;  1C1N A;  4FOU C;  2BZA A;  2XCF A;  2ZG0 H;  3QGJ A;  1SGC A;  2QV1 A;  4ABB A;  1AQ7 A;  1O5C B;  1WAY B;  1IHT H;  1TX6 A;  2ZCL P;  3S9A A;  5DGJ A;  3EA8 A;  3Q3K A;  1O2U A;  4F4O C;  2WUB A;  1EPT C;  2FX6 A;  2BDC A;  4FUB A;  2FTM A;  4INL A;  1GBK A;  3PYH A;  1O3A A;  2WPM S;  1GHW H;  3SU5 A;  3VEQ B;  5BPE A;  2TRM A;  3QO6 A;  1QB1 A;  2WPL S;  1NBM E;  3EYD A;  1RTL A;  2FO9 A;  1O5D H;  1IQK A;  4IS5 A;  5DK1 A;  3SOS A;  5KEC A;  3T25 A;  1ABI H;  4AYY B;  4ABI A;  1LDT T;  2GZ4 A;  1ZRB A;  1L4Z A;  4QQZ A;  1P09 A;  4K2Y A;  4J1Y A;  1G3C A;  3EDX B;  1XUH A;  3EAJ A;  4E7R G;  1THS H;  3K9X B;  1GGD C;  3FP8 E;  2JJ2 D;  1GHB G;  2RDE A;  3M37 A;  3IRH A;  4R8Z A;  2QXG A;  3KGP A;  3SJ9 A;  1YCP H;  2BQ7 B;  2VBC A;  3H7O A;  2A5I A;  4O3T A;  4ABG A;  1P0S H;  2R3U A;  4MCW A;  2Y5F A;  4MPU A;  1P04 A;  1Y5A T;  3PO1 C;  1AVW A;  4K60 A;  1O3P B;  4IW4 E;  1O5E H;  4KTU A;  2GP9 B;  3M7Q A;  1EP5 A;  3LJO A;  2M2A A;  5A8X A;  2D8W A;  3RXM A;  4MNY A;  1BIT A;  2IOT A;  1QRZ A;  1AZ8 A;  1AE8 H;  1SL3 A;  2H9E H;  1J14 A;  1GMH G;  1N8O B;  2NU4 E;  4HFP B;  4MPW A;  3LGT A;  5F8X A;  3STI A;  1K21 H;  1AHT H;  3M5O A;  4ZKN U;  4FU8 A;  3MEM A;  4XBD A;  3RP2 A;  1T4V H;  4DGJ A;  2V7Q D;  4CRD A;  4IC6 A;  2G81 E;  1GMC G;  1V2T T;  3N7D A;  3HK3 B;  3SV8 A;  5EGM A;  4NIY A;  1O3D A;  3H09 A;  3ZVE A;  5L2Y H;  1A2C H;  2Y5G A;  1LVY A;  2WUC A;  2P3U B;  2GX4 A;  4X9E A;  1C5U A;  1MCT A;  1C5L H;  5I25 A;  2AMQ A;  1GJ7 B;  5IYT A;  1O0D H;  5E0H A;  2GDD A;  3GDV A;  4AX9 H;  1A5I A;  1K1O A;  3SNC A;  4ZMA H;  1SGT A;  5A09 A;  2WPJ S;  2ZHF H;  1GJC B;  4M7G A;  4TO5 A;  1C5V A;  1DFP A;  2ODQ A;  1QTF A;  1MKX H;  1V2L T;  2ZP0 H;  2QCY A;  1BTX A;  3LON A;  2NU3 E;  3R3G B;  3ODF A;  1A5H A;  1B7X B;  3NQW A;  5EOK A;  5DP8 A;  1E1R D;  2Z3D A;  2VIP A;  3IWM A;  1C5M D;  1Y3W A;  1FPC H;  2D2D A;  1PYT D;  2Z9G A;  4X6P A;  1VIT F;  3TGK E;  3OY5 U;  1SOT A;  2PGS A;  2CGA A;  3MI4 A;  2P8O B;  4ABA A;  2FEQ H;  2IPQ X;  1W3C A;  2ZGB H;  1BML A;  4TNP A;  2Z9L A;  1QHR B;  1MD8 A;  2ZKS A;  4OS7 A;  4Q7X A;  4TO3 A;  5FAH A;  4LRL A;  1C1M A;  5AO4 A;  1HCG A;  1UVP A;  3Q3Y A;  3V3M A;  5C1X A;  2ZF0 H;  1DE7 H;  3W95 A;  1P9U A;  1NU7 B;  1YLN A;  3OSY A;  1NN6 A;  3VB4 A;  5A0B A;  3SV2 H;  5EST E;  3P8N A;  3UQO A;  2LEL A;  3SN8 A;  3N7O A;  3IG6 B;  2PKS B;  1W14 U;  4FU7 A;  4KP0 A;  1CHG A;  2ALP A;  3QX5 H;  3F9H A;  3UNQ A;  1YLC A;  3DHK H;  3OTP A;  1HFD A;  4QQY A;  1AUT C;  3ZZD A;  1MZD A;  1J17 T;  4FET A;  3C1K A;  2O8U A;  4NIW A;  4DW2 U;  4BNR A;  1BDA A;  1LMW B;  2PKS C;  1FDP A;  7LPR A;  1FXY A;  2ZFR H;  1EZQ A;  1ARC A;  1C5S A;  3RM2 H;  3LJX A;  3Q3X A;  1YF4 A;  1OWK A;  4TY6 A;  4ABH A;  4I8G A;  3ZVB A;  1CHO F;  1E79 D;  1S0Q A;  1YYY 1;  1GI1 A;  3E3T A;  2OTV A;  1TNH A;  4I86 A;  2EQN A;  5AF9 H;  2STA E;  4D9R A;  1AMH A;  2VGC B;  4IBL H;  1TQ0 B;  3TJU A;  4OS6 A;  1ZHP A;  1TBR H;  2VIV A;  1YKT A;  1ELG A;  4KTC A;  2VU8 E;  1YNB A;  3ZYD A;  3M3S A;  4X8V H;  3PMA B;  1VJ7 A;  1GHV H;  3A88 A;  1DM4 B;  2O8L A;  3MH6 A;  5K7R A;  3GY2 A;  5DPA A;  2Y6T A;  1UO6 A;  3OTJ E;  1DXW A;  1GI6 A;  1UVU H;  4TY7 A;  3ZZ4 A;  1HAV B;  2NU2 E;  1ETT H;  2AH4 X;  3HI0 A;  3ZV9 A;  2BX4 A;  2PSY A;  1GBC A;  1C5X B;  5DG6 A;  3E91 A;  5TKA A;  1O5B B;  3M5L A;  1TLD A;  2BLW A;  1C2F A;  2RA0 A;  3B9F H;  1P01 A;  2OQ5 A;  5IDK A;  3GCO A;  3LU9 B;  4HZH A;  2HNT E;  1H8D H;  1V2K T;  3E0N B;  4QFX A;  2BD7 A;  5T6G A;  4GVU A;  2C93 B;  2BD3 A;  3GY8 A;  2GT7 A;  5LH8 A;  2K1Q A;  1IQE A;  3MWI U;  4NWL A;  1CBW C;  1CSO E;  2PAQ A;  1EJM A;  2VVC A;  2Z6B D;  2L6O A;  1W11 U;  4FUH A;  5F03 A;  3S7K B;  1M9U A;  1GBE A;  3SGA E;  4VGC B;  1NO9 H;  1JWT A;  4DMB A;  1O3O A;  1TIO A;  2Y81 A;  4QG4 A;  1WSS H;  2W3I A;  4CRA A;  2OC0 A;  5I46 H;  1BJV A;  4ISN A;  2GKV E;  1O3F A;  2QF0 A;  4YO9 A;  4TO4 A;  1CBW B;  4YOI A;  4WF8 A;  4DG4 A;  1OWD A;  3MU1 A;  2STB E;  2SGD E;  2BOH B;  3B8J A;  1EAX A;  1D3T B;  1IQG A;  1BRU P;  4B76 A;  1BIO A;  2A7J A;  1UHB B;  3OE7 D;  1WV7 H;  1UTK A;  4I8L A;  1LKB A;  2EEK A;  5FX6 A;  1O2H A;  4TO1 A;  3P17 H;  1PPH E;  1G30 B;  1LQE A;  1AU8 A;  1TGC A;  3BTT E;  3TPI Z;  1P2I A;  5L2Z H;  1OP8 A;  4TNZ A;  2W7U A;  3M61 U;  1BOQ A;  4GCH G;  4YLQ H;  3ZZB A;  2VID A;  5HYO A;  4K1E A;  1DLE A;  3SHA H;  3TIT A;  3KH1 A;  1TNG A;  1P2K A;  5ESB A;  1C1Q A;  1TA6 A;  1GG6 C;  1XUK A;  2BB4 A;  2OLG A;  4FUI A;  1U6Q A;  1G32 B;  5C17 A;  1KMH B;  5GIB A;  1FY5 A;  2SGA A;  3KCG H;  4RN6 A;  1GI8 B;  5E0G A;  3A7W A;  1O3G A;  3PM3 A;  1O30 A;  5A0C A;  1V2V T;  1H1B A;  2B0F A;  3WWB A;  3TH2 H;  1ZML A;  4QQX A;  3RC4 A;  5EIY A;  2BDY A;  3WY8 A;  4J2Y B;  3E90 B;  1MAY A;  1MMJ N;  3JZ2 B;  2FOG A;  1GG6 B;  2AGI X;  4OGX A;  2YMS D;  2HRV A;  4PRO A;  4KKD A;  4KGA A;  3GIS B;  2F9V A;  1ZR0 A;  2P8O C;  3ZYE A;  4GHQ A;  1MBQ A;  3LGY A;  2HOB A;  2J98 A;  3HC1 A;  1V2N T;  4ACA A;  1WUN H;  4THN H;  1FAK H;  1Q2W A;  1WOF A;  1SLU B;  1Y3Y A;  2UUY A;  3FKS D;  5FXL A;  3A8A A;  2CMY A;  1GVK B;  1NRP H;  2KCY A;  2ZGC A;  4ABF A;  1UK3 A;  1W13 U;  6CHA B;  3BG4 B;  3Q00 A;  3ELA H;  1K22 H;  4ISH H;  2G5N A;  2VB0 A;  4F48 B;  4RT0 A;  2FOD A;  4TNR A;  2AMD A;  4DJZ B;  2AGG X;  4TYD A;  1ESB A;  5F6M A;  1YPJ H;  3ZIA D;  3VXF H;  3MO3 A;  1IQH A;  4ZKO U;  1CGH A;  3URC A;  3CCG A;  1JRS A;  3GCN A;  4H4F A;  3KEE A;  5JYI A;  1QBN A;  1HDT H;  5F8Z A;  1TNK A;  4LOY H;  1MZA A;  3EQ0 H;  4A1T A;  3MTY A;  1OX1 A;  2YNB A;  4FVB A;  3P8O A;  1PQ8 A;  1RIW B;  3OEE D;  5EXN A;  3SZN A;  1TOC B;  1YOY A;  3DCL A;  3O8B A;  3F0O A;  5FCR A;  1D6W A;  1W0Z U;  1HAG E;  1A7S A;  6GCH G;  1Z8G A;  5JB8 S;  3PTB A;  1K1M A;  5ETX A;  3SOR A;  2AYW A;  3S9C A;  2HWL B;  3PMH B;  1MTN C;  3FZZ A;  3MH7 A;  4RKJ B;  1BUI A;  5CHB A;  3UNS A;  1D3D B;  1QL7 A;  2OP9 A;  2ILN A;  3SND A;  1B5G H;  2ZU2 A;  1WCZ A;  2K8I A;  5F53 A;  3RXT A;  4AG1 A;  1TPO A;  1V2W T;  1P3C A;  3FOA A;  1FIZ A;  5EPY A;  1AN1 E;  8GCH F;  4D9Q A;  1ZGI A;  4JK6 A;  3A85 A;  4X2X A;  3ZZ8 A;  1AY6 H;  4UEH H;  3NRL A;  2ODP A;  3DFJ A;  4JYV H;  3V12 A;  1HAP H;  1SC8 U;  3A7X A;  1O35 A;  2G5V A;  3PWC A;  5DKM A;  1ANE A;  1FV9 A;  2ZU3 A;  5TCA A;  1BT7 A;  2FLO A;  1D3P B;  5AFZ H;  1QGF A;  2ZO3 H;  1L1G A;  1O34 A;  2AGE X;  2ALV A;  2BLQ A;  4WH8 A;  3GDU A;  3SI3 H;  3UAI C;  1C1U H;  1LKA A;  3A86 A;  5C1Y A;  3SW2 B;  2Z3E A;  1BA8 B;  3HKI B;  2ZEB A;  2ZFT A;  3AAV A;  1PQ7 A;  1ZHR A;  4AYV B;  1RFN A;  3PLK A;  4Z0K A;  1SHY A;  4JCN A;  3RXL A;  1GHY H;  1LHC H;  4Y8Z A;  3VFE A;  1C2L A;  1D3Q B;  1MTN B;  1OYQ A;  4H42 U;  4L1J A;  2FP7 B;  3SUD A;  2DE9 A;  3PTN A;  3TGI E;  3P92 A;  2OXS A;  3WWF A;  3KF2 A;  1DIC A;  3F6U H;  1EAU A;  1ABJ H;  3PMJ A;  1O2V A;  3BG2 A;  1UK4 A;  2SGP E;  3BIV H;  1MKW H;  5PTP A;  1TGT A;  3TH4 H;  1KXF A;  1AGJ A;  1EAS A;  4NSY A;  1EJA A;  3ODD A;  3D49 H;  3W94 A;  1NRO H;  2R9P A;  1MKX K;  4UFE H;  2BD4 A;  3P6Z B;  1WXR A;  5EQS A;  2BY6 X;  1TPP A;  4WH6 A;  4WMF A;  2ZEC A;  1C1V H;  2A7C A;  1W7G H;  3MFJ A;  2KCP A;  2PV9 B;  1Z6J H;  3A80 A;  3ZVF A;  2G51 A;  1Z1J A;  2PQ7 A;  1XKB C;  2UWL A;  3K2U A;  2BTC E;  5CHA B;  4IC5 A;  1RGQ A;  3U8T H;  4AN7 A;  4FUD A;  4CBO A;  3RXC A;  1Y3U A;  3LIW A;  1XVO A;  4HI3 A;  1K9O E;  1MD7 A;  3LH3 A;  1HJA B;  2FWW A;  4MDS A;  1GJ9 B;  3NK8 A;  1GJB B;  4AG2 A;  4Y79 A;  2EI7 A;  1QFK H;  4ABD A;  1DXP A;  4R8T B;  1QB9 A;  1KTT B;  1A61 H;  1BBR H;  1TWX B;  3ATM A;  4K3J A;  2G52 A;  4DT4 A;  3S9B A;  1U6Z A;  7GCH G;  4Q2C A;  2F3C E;  4Y71 A;  1GHX H;  5DJ7 A;  4B1T A;  1FON A;  4BTU B;  2C8X B;  1NFX A;  1HJA C;  3VB6 A;  3M1T A;  1XUJ A;  1BCU H;  2WPD D;  3KYG A;  2PAU A;  1L4D A;  3OU0 A;  5EJ1 A;  3RXP A;  3N7E A;  5B6L A;  3UWI A;  4MVN A;  1SB1 H;  3PV2 A;  1UMA H;  2F9U A;  4AOR A;  1ELB A;  3DSP A;  1FY4 A;  1PPZ A;  3SGB E;  4YZU A;  1GCD A;  3NUM A;  1RD3 B;  4WY3 A;  1D6R A;  5EG4 A;  2H5D A;  5FPY A;  4AFQ A;  2KZ4 A;  4FUE A;  4NZQ A;  2V3M A;  3VG8 A;  3D62 A;  1NM6 A;  4GPG A;  1G37 A;  4WXI A;  1CA0 C;  1Z8J B;  1F0S A;  1YBW A;  1NZQ H;  2JH6 D;  1C2H A;  2F43 B;  1O3N A;  2FOC A;  2ZGX H;  4M9F A;  1ETR H;  3T26 A;  3SBK A;  2CXV A;  3GYM A;  2JET B;  1T8O A;  5SGA E;  2A45 B;  2BVX H;  3MNS A;  2FOE A;  1EP6 A;  3SQE E;  2F4L A;  2V6N A;  1BMA A;  1AO5 A;  5EPN A;  2UWP A; 
#chains in the Genus database with same CATH homology
 2CQZ A;  3NQW A;  4ZWE A;  4QFZ A;  4N71 A;  4QQW A;  3TM8 A;  4ME4 A;  3BG2 A;  4XDS A;  4QG0 A;  4TNR A;  4MDZ A;  3RF0 A;  3SK9 A;  2PAQ A;  2GZ4 A;  2PGS A;  4Q2D A;  1VQR A;  2IPQ X;  4QQZ A;  4TNP A;  3NR1 A;  3CCG A;  4TO3 A;  5TK8 A;  4LRL A;  4QG2 A;  5AO4 A;  4DMB A;  5TK9 A;  4QG4 A;  4MLN A;  4N6W A;  3I7A A;  4TO6 A;  3SKD A;  2DQB A;  2PQ7 A;  3TMC A;  4TO4 A;  4QFY A;  1YOY A;  3S4L A;  3IRH A;  4R8Z A;  4TO0 A;  4L7W A;  1XX7 A;  4QQY A;  3TMB A;  5AO3 A;  4MCW A;  4TO1 A;  5TK7 A;  4TNZ A;  3KQ5 A;  1U6Z A;  4RXQ A;  3LJX A;  4Q2C A;  5AO1 A;  3KH1 A;  4MLM A;  3M1T A;  3MEM A;  4QG1 A;  4BZB A;  2PAU A;  4BZC A;  4TNY A;  5AO2 A;  4ZWG A;  1YNB A;  1VJ7 A;  4L7E A;  2FLO A;  4L1J B;  3GW7 A;  3P3Q A;  4QQX A;  4X9E A;  4RXO A;  2OGI A;  3TMD A;  3MZO A;  5AO0 A;  2O08 A;  4TO2 A;  2PAR A;  4RXS A;  3HI0 A;  4Q7H A;  2Q14 A;  4TNQ A;  3HC1 A;  4MZ7 A;  5TKA A;  4TNX A;  5TK6 A;  4TO5 A;  2O6I A;  4RXR A;  3U1N A;  2HEK A;  4RXP A;  4QFX A;  4L1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...