3KQ5A

Crystal structure of an uncharacterized protein from coxiella burnetii
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
376
structure length
360
Chain Sequence
NQFYKPGMLVPVFSAAGLLKNGRYQFLLQQIETLSLLPTEQYAQLYEALVYRFVEFVQVLPIRLDEPLCSLMNEGLLRGVNSLNHYIQNHPEATPLERYALFSAGLLLEVAHAVVNQKIFITDEEGNFIKQWNPFSGPLIDDVETKHYKIMPLSSYYQRNIPSITPILVRQLLPDEGFLWLTSDMRVFSDWMQALRDDGRFEHVLQLFKHKNIDGLFNTLPALPVNLQDSPATAHADAFLNWLKEALATNQIKVNTSDAGVHVIPEGVFLEKTGIFKQYIDLHVNVPVNLFTVYQQFGNLFGLTKLSGIDYRFEQLFDALKRKSKMGFAGLSPTREGVLIADPNLIFTRGEIPSATYLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical cytosolic protein
publication title Crystal structure of an uncharacterized protein from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Structural genomics, unknown function
total genus 118
structure length 360
sequence length 376
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.40 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 3kq5A01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 3kq5A02
3KQ5A 2IPQX
chains in the Genus database with same CATH superfamily
4XBCA 4Y7BA 3KHVA 4K5ZA 3RXSA 4ZWGA 5FCRA 3CS7A 2IN2A 1UCYE 1XVOA 1J17T 4CRCA 5AFYH 8GCHG 4DCDA 1O2TA 1V2QT 4GVUA 4MNXA 5GWZA 1V2TT 4NFFA 1O2GH 2PP6A 2Z9GA 3AW0A 2V35A 3LKWA 2HPPH 1O35A 2BD4A 5ABWA 3ATMA 1YYY1 1QY6A 4KTUA 3C27B 2ZZUH 5C20A 5DP5A 3A7ZA 2G00A 2VH6A 2SNVA 2NU4E 1O31A 2Z9JA 2GGVB 1SQTA 4FU9A 3EAJA 4I86A 2O8LA 1GHBF 4MLMA 4YT6H 4B71A 1NRPH 3OTJE 3TITA 2QIQA 1INCA 3FANA 2HWLB 2BY5X 1VKYA 2P3TB 3LIWA 3TK9A 4UE7H 2XRCA 3E1XB 3ZZ7A 4Y0YE 3SJ8A 3GY6A 2QGRA 2BM2A 2PV9B 3ZVAA 1C5MD 2BDAA 1T8NA 3GY5A 1RTLA 3CNRA 3OSYA 1GDQA 1GBKA 2SGPE 3R0FA 2WYGA 1ZSJA 2FOMB 1O34A 4XDSA 3T62A 2EI7A 3GCTF 4RI0A 5KECA 2RDLA 2ZGXH 3ZZAA 4XSKU 2W6ID 6CHAB 1G36A 1W12U 1OWIA 2BQ7B 4ABEA 1EAIA 1ZHPA 2F3CE 1GWAA 3Q3YA 2Z9KA 3SV8A 1BTUA 2H5CA 4TPYA 4AG1A 2KFWA 4IS5A 4CRDA 1HB0B 1CQQA 1D9IA 1VJAU 1D6RA 3SNAA 1LHEH 2O6IA 2B5TB 4CBOA 5J4SA 4QG4A 3LC5A 1QFKH 4LOYH 3SZEA 1ELVA 1ANEA 2BY7X 3BEUA 4ZMAH 1P8VC 3V7TA 1P3CA 2J98A 5AO1A 5E2OA 2PFEA 1OXGA 1GBBA 1T4VH 4AB9A 2HPQH 1L1NA 1ABJH 4XBBA 1TAWA 3BG4B 3QZRA 2A5IA 1O2RA 2SGQE 1YCPM 1C5ZB 1BTHH 5HIZA 2VGCC 2FO9A 3VB7A 5EOKA 5E2PA 1IQLA 3BTGE 3DSGA 3F1SB 3SBKA 5CE1A 5B6LA 7GCHF 1W0KD 3GY3A 4IBLH 5C0TA 1HJAC 1HJ8A 3SU5A 3SGAE 4AOQA 2ZU1A 3CENA 1TPOA 1HAVA 3JZ1B 4A1VA 1G2LA 3VG8A 2EI8A 1UK4A 1UCYH 2QXIA 4BAKB 1G9IE 4Q63A 4OM9A 4K2YA 5AO3A 2HGTH 5C17A 4F48B 1O37A 4N6WA 2XCFA 3ODDA 2GDDA 5JB9S 1GJ6A 4AGKA 2BXTH 4X2WA 4HZHA 1SSXA 3IITA 1ZMJA 2ZGBH 3STIA 2OQ5A 1NN6A 1QZ8A 1T4UH 3M5OA 2TGDA 1V2ST 1F0SA 1O3AA 1E1RD 2PSYA 3VEQB 2FTMA 2GCTC 4SGAE 3V3MA 1AI8H 5EQSA 4IMQA 2FYQA 1P57B 1PPHE 2WUBA 3PROA 3A8BA 4I8LA 2VWOA 1C1MA 3ZVBA 1FPCH 3PWCA 1TX6A 2UUJB 3KIDU 4ISLA 4YOIA 4CRAA 1CHOF 2ZFTA 3H7OA 3K65B 3U8OH 5EIYA 1MTUA 8ESTE 2ZPQA 3OFND 5T6DA 1FNIA 2VH0A 3E16B 2Y7XA 1GDUA 1ESTA 2OINA 3ZV9A 3MYWA 4BTUB 2F9BH 1BRBE 1THPB 1ZYOA 2BXUH 2FPZA 2P8OC 2W5EA 4JCNA 1EPTC 2OBQA 1C2FA 1C2MA 5GXPA 1AWFH 2KM0A 4F49A 2VVCA 5BPEA 3GCOA 5TKAA 2GP9B 3HC1A 4BOHA 3M35A 5L30H 4H42U 4NA9H 2ZNKH 1DICA 5HM9A 1WDIA 4I8KA 1BMNH 5EPNA 1C1UH 5EXLA 2YNAA 1VITF 2C8YB 3OTPA 3UR9A 6GCHF 1MTNB 4TO2A 4WF8A 3MNXA 3KEEA 5CHAB 3RXRA 2THFB 4D7FA 1QCPA 5AF9H 4ABBA 2ASUB 1DUEA 2FOGA 4CRFA 4RT1A 2VWNA 2BLWA 2JH6D 1CBWB 1MKWH 4B76A 3FP6E 3NZIA 3RUOA 4Y10E 3UIRA 1YPHE 1XM1A 2KCPA 3H7TA 1W14U 1O5EH 4E06H 2HEKA 1SL3A 2C8WB 1YP9A 1BCUH 2R2WU 1DT2A 1YCPK 3SUFA 2JH5D 3WY8A 1P06A 1LCYA 1O38A 1DWDH 1C5WB 3O8RA 3DFJA 1RTFB 2HNTF 1SC8U 4U2WA 1NS3A 2BDIA 1DANH 4INLA 2KCAA 1BMLA 2QXHA 3RF0A 1EAWA 2CMYA 1C1RA 4MPWA 3TLOA 4Z6AH 5TJXA 3TM8A 2KCOA 1TRNA 3ELAH 3CS0A 2Z9LA 1D6WA 1E79D 2BX3A 1ELAA 4ABFA 4F4OC 1B5GH 2H1UA 5DP4A 5LPEA 6LPRA 1P2JA 3RXAA 4WY3A 1RIWC 1W10U 3GCHB 3B23B 1H9HE 1YOYA 1ZMLA 1DM4B 2A1DB 1B7XB 5JBAS 5F8TA 4U01A 3SI4H 2XCNA 4NWLA 3EA9A 1ARBA 3SNCA 2KZ4A 2GVFA 2VVUA 1EUFA 4BZBA 2UUFB 3KYGA 1DXPA 1TX7A 1W8BH 2YMSD 5IDKA 1YF4A 1A61H 2M2AA 1XVMA 2ZHFH 5ESBA 2TGTA 2QF4A 1V2LT 1JXPA 2Y6TA 3N99A 1ZSKA 1Y59T 3U1NA 3LGYA 2A31A 3RU4E 2YOLA 3O8BA 5AFZH 3RM2H 1ID5H 2AYWA 2BVRH 1YM0A 1QRXA 2XNIA 5T3HA 2K8IA 1GJ4H 1W3CA 1J8AA 4MNYA 1BT7A 2AEIH 1FZZA 1V2WT 4R8ZA 1AZZA 1LHCH 1MCTA 1ZR0A 4KELA 3RXBA 1FY1A 1SGDE 1T8OA 1ZTKA 5JBCS 1MUEB 1A7SA 1WTGH 2VWMA 1IQIA 2XWAA 2CXVA 3NKKA 3BTHE 1TA6A 4X9EA 1FXYA 3ATKA 3QUMP 4O03A 2Z6BD 2FLOA 4AFSA 1BTZA 1GI8B 2QA9E 1C2LA 3MNBA 1N6XA 3UNSA 2R0KA 5DKMA 1ELDE 2ZTYA 4JZDH 4IW4E 3UB0A 1GHXH 4L7WA 1EX3A 5C1XA 4ZXYH 9ESTA 2SGEE 1CA8B 2RDEA 2Q6DA 1QGFA 2PKAA 2J94A 1FUJA 1MKXH 2RCEA 2C8ZB 1QQUA 3QLPH 1HAPH 1QB6A 1HAHH 1AB9C 1O3HA 2H5DA 1K1MA 1ELGA 4DJZB 2J5UA 3TK6A 4ASHA 1HAOH 2Y5HA 1K1PA 2GMTB 4NFEA 3FAOA 4AFUA 1SGFG 4SGBE 4U30A 1FI8A 1GBIA 2FI5E 1LPGB 1C5OH 1AIXH 3BTTE 4XOJA 5HMAA 2ZDMA 2XC0A 2B8OH 3RMLH 1TGTA 2NU0E 4IN2A 1GJ8B 2XBYA 1AO5A 1Q2WA 1L4ZA 4B6EA 5DK1A 1NZQH 3SNEA 1PJPA 2SNWA 1C2KA 1ETSH 3MFJA 5GCHG 4YESB 2BMGB 1GBLA 1XX7A 1C2JA 3EYDA 2Z3EA 1RXPA 1D4PB 3A8AA 1Y5AT 2J95A 1PPBH 3ITIA 4A1XA 2BB4A 4YM9A 2WPDD 4ZWEA 3M5LA 2ILNA 1WV7H 4D9QA 1KXCA 3TPIZ 1SQAA 1TGBA 2ZC9H 1W11U 4AN7A 1GI3A 1BBRE 5C3NA 5HGGA 1DX5M 1QBVH 4ISIH 3ZVFA 1CVWH 2ODQA 1A4WH 1GGDC 4Z0KA 1GI4A 1HJAB 1SLWB 3GICB 1GMHF 2HLDD 3MU5A 2PGSA 3ENSB 1WOFA 1S84A 1MTSA 3TMDA 1P9UA 3AAUA 1K9OE 1AE5A 2IOTA 3Q00A 5DG6A 3UQVA 2BDYA 1MU6B 1IAUA 1UCYK 2WV5A 3BV9B 1OOKB 4DVAU 2ZFRH 3VGCC 1MQ5A 1BTWA 3MO3A 2EC9H 1GJBB 3DCLA 1GHYH 3R3GB 2ZGHA 1GBAA 1QA7A 1GI5A 3MI4A 5A2MH 4RT0A 1PFXC 3F2GA 3Q76A 1XX9A 2GZ9A 4Y8ZA 2BZAA 4AZ2B 4FVDA 1CGIE 2FLRH 4X8VH 2GJGA 3A7YA 4P00A 1MQ6A 1H8HD 1Q31A 5TK6A 3P8NA 1P2OA 3DUXH 4BTTB 1FJSA 4PROA 4DGJA 3U1JB 1G3CA 1MAXA 5GIBA 2V7QD 4FUIA 2HVXA 5EQRA 3ZZ3A 3ESTA 2OLGA 1P03A 2ZA5A 5GPIB 3PMBB 3PV5A 3ZZ8A 2ALPA 2Q1JA 2QXGA 3BN9A 4MDZA 5H4IB 3H5CB 1BZXE 5K0HA 3GY7A 2QC2A 1C2HA 1EB2A 3VB6A 3LOXA 2ZFQH 1TA2A 5DP3A 2ANYA 4I8GA 3F9GA 4X8UH 3TNSA 3IWMA 4OS5A 1MCVA 3OU0A 2P8OB 3VB5A 2ZU5A 2YMSB 3OAAD 1EPTB 2R3YA 3SUEA 2Q14A 4AYYB 3A8CA 3GS9A 1Z71A 4WXVA 2OCVB 2BD9A 1GBFA 1BQYA 1TOCB 1SGFA 3SORA 5C1UA 2A7JA 2HOBA 2ZCLP 5A0CA 1T31A 1OWDA 3BTKE 1P2MA 2BDGA 4B73A 1AWHB 2ZDLA 1Z7KA 3P92A 1BBRH 1THRH 3MH4A 4XBDA 5F53A 4BANB 1PPZA 3RXDA 3QK1A 4INHA 2J97A 1JWTA 4TT3D 1NESE 1ANDA 2BZ6H 3SU1A 8KME2 1F5LA 1MKWK 5G4BA 4NG9H 1GMCF 3RXQA 2DUCA 1TQ0B 1XUKA 1P2IA 4K1EA 1V2MT 1Z8IB 1SHHB 4A7IB 4TNZA 2FXRA 2EEKA 2FOCA 3HI0A 4X2VA 5EW2H 4ZKSU 1ZJKA 3RXKA 3PLPA 4Q2DA 1IQJA 1EPTA 4VGCB 3VB4A 4FUGA 1F0TA 4TNXA 4WJG2 1EB1H 1MZDA 1O3MA 1BMFD 1Y3UA 2STBE 1LKBA 4H6SB 5FL7D 4ACBA 1A3BH 1NFWA 4QFYA 1O2UA 1HLTH 3BTEE 5AVDA 1MBQA 4XRNA 4ZHLU 3GYLB 1AVGH 1C5NH 1QTFA 1UW7A 2UUKB 1HAZB 2VIPA 3GY2A 1KIGH 5A8YA 1WU1A 1K28D 2QXJA 1LVMA 4YT7H 1ELCA 3T27A 2XTTB 1A5IA 2UWPA 4UFFH 1CU1A 3O8CA 1O2VA 4X8SH 1PPCE 1WBGB 1FONA 1RD3B 2WPMS 4J2YB 4YOGA 2AGEX 2FMJA 4DW2U 3NCLA 1F5RA 1P12E 1C1OA 1CO7E 3PO1B 1H8DH 4ZXXH 1GHAG 1C5UA 3P8OA 2GD4B 1DS2E 1ZJDA 1FX0B 2QYIA 4TO6A 3BEFB 1UK2A 1U6ZA 2A4QA 3QDZB 3BG2A 3PTNA 1EOLA 4ZKRU 3MO9A 3SU3A 5EJZA 4IN1A 1NRSH 2IPHA 2J98B 3F0PA 1QL8A 1O3CA 4CRBA 1VGCC 2GCHF 1GMDG 4OGYA 3MZOA 1BHXF 1GL1A 3T5FH 4MZ7A 2HRVA 2V0BA 1C5TA 1SGTA 5FX5A 3Q3XA 1ARCA 1KXEA 3RDZA 2ZDAH 1EFRD 2FTLE 3PMAB 2H2ZA 7LPRA 3SV9A 1EJNA 4IMZA 4RXRA 4RXSA 2ZDVH 4X1PU 5F03A 1EATA 1EJMA 3UTUH 3GYMA 4ZKOU 2WPIS 1Y8TA 1C5YB 1C5SA 4X8TH 2BD2A 3SZNA 2QF5A 1HAVB 3GDUA 5L2YH 1NRQH 2BQWB 4FUEA 3IG6B 4P02A 7ESTE 2A5KA 2BX4A 2ESTE 2JIZD 2PAUA 4UDWH 1CGHA 2JH0D 4X1RU 1L0ZA 1MKXK 1KLIH 4AX9H 1V2RT 3TMCA 2BDCA 3OY6U 3DA9B 2BYAX 1KLTA 1WQVH 1GG6C 2TPIZ 3E6PH 4B74A 1GHBG 1P2KA 2AHME 1GBDA 1KXBA 3TGIE 4BTIB 4X1QU 3MQKC 2PLXA 1KMHB 2HNTC 1V2PT 3ZYEA 2OD3B 3I7AA 2CF8H 3A85A 3GCNA 1H9IE 4TNPA 1HJ9A 1NBMD 5EU8A 4TSFD 1A5HA 1J14A 2CN0H 2NWNA 5C1YA 4TO3A 2C8XB 5C2ZA 3P3QA 1G30B 3ZZ9A 3GCTG 2FX4A 3PM3A 1XUHA 4BXSA 1O2OA 1TNGA 3KF2A 1LHFH 1A46H 3S69A 4ZROA 1SI5H 2CHAB 3SNDA 2ZP0H 2A0QB 4ABHA 3T29A 1ZTJA 4GSOA 2LP6A 4F55A 1QR3E 3MEMA 3GW7A 2OK5A 1SGCA 3RXUA 1EP5A 1GJDB 3VFEA 1F5KU 3L3TA 2PAQA 1SLXB 3K6ZA 4H4FA 1MD7A 1TRMA 2SGDE 2ZTZA 2V3OH 3F6UH 1EZXC 2Y82A 2WV4A 3AVZA 3S9AA 3SYJA 1F7ZA 2A4RA 1AFQB 2O8WA 3A83A 3PTBA 4B6FA 1HIAB 3SV2H 4DIHH 5DO4H 3HPTB 1TOMH 5DJ7A 3ZVCA 1TPPA 2C3SA 1TNJA 2FLBH 3VGCB 1O0DH 2Z3DA 1ORFA 5DSFA 3G01A 1DPOA 1VQRA 3CCGA 1XUFA 3NQWA 1TGSZ 1HRTH 3M7UA 3BEIB 4AC9A 3DT0H 3QO6A 4TPIZ 7GCHG 3M3TA 1F2SE 1BIOA 1KLJH 2BTCE 3A82A 1YPJH 5ETXA 1O3IA 2J2UA 3TNTA 1HGTH 3ZIAD 2XC5A 5EXNA 3S4LA 5HIYA 2PTNA 1DY8A 1SQOA 3FZDA 2OUAA 2TRMA 4GHQA 1HDTH 1N1LA 1NBME 2FDAA 1O2SA 1QQ4A 1TMTH 1O3FA 1UTNA 1PPFE 4D76A 2W3KA 3N7DA 1C9PA 2J38A 2KX4A 1LQEA 1ZZZA 4ABJA 4UFGH 3MO6A 3A8DA 1C5RA 1HIAA 2WPHS 2ZFFH 1TBQH 2H6MA 1SQRA 1LPKB 1QHRB 2ODPA 4IC5A 1UTMA 3SHAH 3LPRA 4TY7A 4K8YA 1OWJA 4MDSA 1YNBA 4RKOB 4TO5A 2FEQH 1P02A 4LRLA 1C5PA 3F2FA 1K0HA 1X7AC 2Y5FA 2PGQB 4Y7AA 4ZHMU 4NGAH 2HLCA 1AQ7A 2L74A 1C2GA 1IQNA 3EA7A 3SUGA 3LGIA 5DP6A 3ATIA 2RA3A 4FU8A 3GDVA 3RXOA 2ZHWH 2P95A 3ZVGA 4AFZA 2HVYB 3VPKA 2TBSA 2VIWA 1CHOG 1RRKA 2IJOB 1D3PB 2VIQA 2ZGCA 1EASA 4NSYA 3S0NA 1FQ3A 4DG4A 3LGWA 4CR9A 1IQFA 1YPKH 4FUBA 5TK8A 1G3DA 5HM2A 1BBRK 2ZDKA 3KNXA 1G3EA 4ABGA 5EQQA 5FPYA 2J4IA 1O3EA 1SHYA 3AAVA 1AKSB 5FPTA 2XOKD 3SKDA 3ZZ4A 1GI0A 3F68H 2B0FA 4XE4A 5JDUB 3TIUA 3TH3H 3TJUA 4HG6A 1SGYE 2GT8A 4K8BA 1YC0A 1ZPCA 3A87A 2AMDA 1AZ8A 3DFLA 4UD9H 5GDSH 3PLBA 6GCHG 1VITG 5EXMA 4WMDA 1OPHB 3QGNB 4ABAA 1XUGA 3RP2A 5I46H 3S7KB 2BQ6B 4Q7ZA 1K1IA 1XKBC 2OC7A 2PKAB 5GJ4B 1HV7A 1G2MA 1BDAA 2KCYA 4DY7B 4E7NA 4Q7XA 1HAXB 1UTJA 2V3MA 1CGJE 3F2HA 1JIRA 3TJNA 3RXCA 1BTYA 4ISNA 1ZPZA 1SGRE 4O9VA 4CH2B 4GAWA 1YLCA 3PMJA 3PWBA 1O2YA 4H6TA 2ZO3H 4KP0A 2K0QA 1ANCA 1DWBH 2SGFE 3RC4A 4FUHA 2QN5T 2A2QH 1QJ1B 1WTHD 2CK3D 4BZCA 1O2IA 3ZYDA 1AKSA 4RXOA 3AASA 2J9NA 1OYTH 2R2MB 4ISOA 3TH4H 4ABDA 1RGQA 4INKA 4JK5A 3UWIA 2G8TA 2P59A 4E7RG 3VXFH 1YBWA 2F83A 1TMBH 1LVYA 1GJ7B 4QQZA 5JBTA 2IJD1 3BF6H 3M1TA 1HAIH 1VCWA 3N7OA 4LZ4B 1UVUH 2G55A 3DHKH 3MH7A 2GKVE 1AU8A 3FP7E 1LMWB 3SV7A 3T26A 3TJOA 2O08A 3PV4A 1O30A 4YOJA 1MBMA 1QB1A 3ZZ5A 4QG2A 2OC0A 3W1EA 3A7WA 4A5TS 1B0FA 3TU7H 4GCHF 1VGCB 1ZRBA 2GT7A 1WQSA 1RFNA 2VWLA 2VIVA 4BNRA 1XKAC 4XDEA 4JK6A 2FESH 2VJ1A 4KTSA 4WH6A 1OSSA 1O2LA 1UTLM 2F9PA 3MU0A 3NRLA 2PKSC 3QX5H 2WUCA 3B9FH 4DURA 1P2QA 2PHBA 3SHCH 3M37A 6CHAC 1XXDA 3OY5U 1KSNA 2ANMH 4L7EA 4DT7B 5PTPA 5JB8S 3ZVDA 1LHGH 1COWD 2PUQH 2VB0A 2WINI 1TGCA 1IQEA 1RS0A 2AIQA 3QN7A 2QF3A 2ZF0H 1ETTH 4JYTA 1Q3XA 2BLVA 1E35B 5EODA 3KQBA 1ZTLA 3Q3KA 2AGGX 2WSSD 1D3DB 4I8JA 1TNIA 4MNWA 3E0NB 2G5VA 1P09A 1O2WA 4M7GA 4GPGA 3BTDE 1NFUA 4ASUD 2GDEH 1E1QD 5F8ZA 1AUJA 5EW1H 3MU4A 2PGBB 1B0EA 1C2DA 1O36A 2FI3E 5AO4A 5LPFA 4ZAEA 1MTVA 2BLOA 3FZZA 2VGCB 1W0YH 3P95A 1GBCA 1SR5C 2V3HH 4IC6A 3SN8A 3HATH 3U28C 1CT2E 3F9FA 3RXGA 3MTYA 3E8LA 2FOFA 3FP8E 1PYTC 1W7XH 1Y3WA 1UVOA 4Z1MD 2TGAA 3JZ2B 3BTFE 1V2VT 2G4UA 4JZFH 3A81A 4UEHH 1O2HA 3UOPA 1AN1E 1CE5A 2VINA 1KXFA 5CDFE 2A4OA 2DE9A 2D8WA 1NU7B 4FETA 3UR6A 3QWCH 5HKKD 2P16A 1F0RA 1HNEE 3D62A 3EA8A 1LKAA 5AO2A 2FZZA 3RU4T 4ACAA 4NIVA 2F9NA 4Y0ZE 2O8MA 1QJ7B 1S5SA 1UTOA 2ZQ1A 1TX8A 1QL9A 3V0XA 1FIZA 4WMEA 4WH8A 2W7UA 3SJIA 1ANBA 3SI3H 1FN8A 3UPEA 1O2NA 1S0QA 5C67A 1HXEH 3I29A 1D3TB 2GCTB 1O3BA 1Y5BT 4OS7A 5TCCA 5DP9A 5HYOA 2G5NA 1C9TA 3QTVH 3SQHE 1O5GH 1PQ5A 1LVBA 1GMHG 1K21H 4YXWD 1G37A 5TK9A 2BD7A 1H1BA 4WWYA 4JZ1A 4X6MA 3M5NA 1XMNB 1C1WH 2ZHQH 4GLYA 3DD2H 2TIOA 4MCWA 4DMBA 5A8ZA 1RJXB 3K9XB 1BTPA 3I78A 1JRTA 2ZGJA 1P9SA 1W13U 4FVBA 4HGCA 5E0JA 1SMFE 2Q6GA 2M5TA 1DSTA 5JPMH 3BTME 5L2ZH 1PPGE 1TPAE 1IQGA 3BSQA 1O3DA 1V2NT 3F3BA 3VB3A 1K2I1 1VCQA 4Q2KA 8LPRA 2VBCA 3P6ZB 2WHXA 4LZ1H 3S7HB 3MWIU 2BY9X 1O2PA 5DP7A 5EGMA 1ZLRA 1T8LA 2XNDD 1HUTH 4A6LA 4OS4A 5E0GA 4TNQA 3DSPA 2C90B 1MTNC 1ZRKA 2FI4E 1ETRH 2BVXH 1P2NA 5C5NA 5CHAC 1C1NA 3D65E 2AS9A 1DFPA 4B2CA 5TCAA 4CBNA 1TPSA 3A7XA 3URCA 1CBWC 5LGOA 1E38B 4TWYA 1S82A 3U9AH 1V6DA 4WMFA 2F9UA 4X6PA 1J15A 4FUDA 4LXBH 3PLKA 3HGNA 4ZUHA 2ANKH 2FX6A 4KKDA 3F9EA 1NM6A 1E34B 1OWEA 1UHBA 4ABIA 1BUIA 3M36A 1UTQA 4TY6A 1EZUC 1FY5A 1SOTA 7KMEH 8GCHF 1AHTH 1O2QA 3M61U 2G81E 1P10A 3MMGA 5C0UA 1WSSH 4NIXA 2ZCKP 1V2UT 1RIWB 4K1TA 3T25A 2DQBA 2AFQB 3RC5A 4BXWA 2ANWA 1O5DH 3P8GA 3RMMH 1MAYA 4L1JA 2D26C 3TH2H 2J34A 1LTOA 4NA7A 4Y8XA 1GL0E 5DP8A 3WW7A 4K1SA 3RM0H 2G51A 1A3EH 1TBRH 3OX7U 3SOSA 3LONA 5T6GA 3ODFA 3LDXH 4YLQH 1GMCG 1FN6A 1KXDA 1T32A 2H9TH 5BRRE 3BTWE 1AD8H 4B1TA 3QGJA 1DOJA 1VJ7A 5DN6D 1YWUA 2LNCA 3A86A 2G4TA 3L33A 1HPGA 3PRBA 1MTWA 4Q80A 1DDJA 1TGNA 3WWBA 3OEHD 1Y3VA 4JMYA 4OS1A 1UVSH 4WVPE 1QL7A 3TMBA 2W7SA 1XUIA 3GY8A 3N7EA 1AGJA 1DWEH 1TNKA 5HXFA 1N8OC 2BY8X 1Z8GA 3SU6A 4NSVA 4K69A 1DUAA 2B9LA 1CA0C 3ATLA 3GOVB 2NU2E 3FN8A 5FXLA 2Z94A 1AE8H 3A89A 1D3QB 1GHVH 2FYRA 1C4V2 1GCTC 3M7QA 2C93B 1CSOE 1EXFA 5A0BA 4BAHB 1TLDA 4TYDA 3RXMA 1BJUA 1NO9H 2V6NA 5A8XA 2BD3A 1O5AB 4TNRA 3GDSA 2W26A 5E8EH 1OP2A 1A0HB 5T1VA 2CV3A 3U98H 1O33A 1FIWA 2Y80A 1C2EA 1ZMNA 1NC6A 1Y3YA 1GI2A 2JDID 2Y5GA 2GX4A 1THSH 1AB9B 1QRZA 1UK3A 2A2XH 5SGAE 4Y76A 3ZV8A 5FBIA 3NWUA 1ZOMA 1DY9A 4YZUA 2PKSB 5KGOA 3SO3A 2ZPRA 5K7RA 1DWCH 2A7CA 1NFYA 2FODA 2GMTC 1YPHC 4FU7A 2FP7B 3OYPA 5C5OA 1QURH 2F4LA 2ZECA 2EI6A 4X0WU 1NROH 1IQMA 1E37B 2H9HA 1P05A 4Y8YA 3RXLA 2GCHG 2JETC 1BOQA 1SFIA 2WYJA 1S6HA 1TFXA 4R0IA 1Z6JH 5C94A 1O2JA 2KAIB 4TO1A 3O8DA 3L6PA 1P11E 3WWFA 1YPMH 1HFDA 4NZQA 2D2DA 2OP9A 3LT3A 3MNCA 2WV9A 1UO6A 2AERH 1O3KA 1W7GH 2Z9IA 3SNBA 1AFEH 3AK5A 5FAHA 3UREA 2LELA 2PTCE 4I32A 5GNDA 1BRAA 4KTCA 4NCYA 3UY9A 3QZQA 3FVFB 2VIDA 4Q4LA 5AHGH 4JZIA 2A32A 4RXPA 2PWXA 4BAQB 1Y3XA 5T6FA 3F0OA 1GGDB 4FUFA 2ZWLH 2Z3CA 3BIUH 3UNRA 4TO4A 1M9UA 4DOQA 4CHAC 4UFEH 1Z1JA 2XBVA 1EJAA 2NU1E 2ZI2H 4MLNA 3RLWH 4MQAA 3A88A 3SV6A 1YY3A 1BITA 3UNQA 1SLUB 1GI1A 4Y71A 1O32A 3ATWA 1IHTH 1K1JA 3T2NA 2ZU4A 1BMMH 1EAXA 2KAIA 1WAYB 4BAOB 1SFQB 2H9EH 3MOCA 1AVWA 4J1YA 1FPHH 5EJ1A 4UFDH 4IGDA 2STAE 3EE0B 3TJVA 2BOHB 1QBNA 1J16A 1UTKA 3UAIC 1C5LH 4Y11E 1TNLA 1C2IA 3U69H 5CMXH 2CGAA 2IPQX 5L6NH 2FS8A 1GHZA 3SJOA 4GHTA 3M5MA 1YPGH 3NPSA 5JYIA 1KXAA 4X6OA 1W0JD 5FHTA 4ME4A 4DIIH 4KGAA 1O3JA 1TB6H 2OTVA 1P04A 4JYUH 2B7DH 1S83A 3PRDA 3RMNH 1BHXB 1HCGA 1T8MA 3RXHA 1O3LA 4YLUA 2ZDNA 1SB1H 3OE7D 4D8NA 1NTPA 1EP6A 1L2EA 1H4WA 2TGPZ 2PUXB 2A4GA 2W6JD 3P70B 1TBZH 4I31A 3IRHA 1FAXA 2OGIA 1U6QA 1W2KH 1CHGA 1GHWH 4X6NA 1T7CA 3RXTA 5DPAA 1WXRA 4B2BA 1H8IH 3SGBE 1MZAA 2Y7ZA 3UFAA 4U32A 1AMHA 1UMAH 3ZZCA 2OBOA 1L4DA 2W3IA 1HAYB 4HI3A 1GBEA 3MH5A 4Q2CA 2YMSC 4ZHAA 1YKTA 1O2ZA 1SGPE 3LJXA 1LPZB 4I7YH 1GJCB 3Q77A 2ZFSA 1BTXA 2GZ7A 2O8UA 3U8RH 5AO0A 4OS2A 4RN6A 4Y6DA 4CRGA 1ZHMA 3UWJH 1C1PA 1JIMA 4ISHH 4MTBA 4NWKA 3E3TA 2WZQA 3RU4D 1OHHD 1S85A 2CQZA 1TRYA 1CT4E 1SGEE 2O9QA 3NK8A 2QY0B 1O5BB 1SOZA 1EZQA 1YGCH 3DSOA 3SJ9A 2Y81A 3NR1A 2FIRH 1ABIH 3VXEH 4THNH 1GI7B 5KEDA 1V2OT 2ZCHP 5DGJA 2NU3E 4ZH8A 2HNTE 3LU9B 1F92A 3LJJA 5EJLA 2R3UA 1YLDA 2R0LA 1TABE 3LC3A 1DITH 1ZGIA 2SFAA 2A45B 3ZZBA 2BOKA 2R9PA 1Z1IA 2UWOA 2ALVA 1TONA 1FLEE 4VGCC 4ESTE 3RC6A 1E0FD 1FY8E 1TIOA 1AVXA 1SBWA 4FOUC 2BDBA 3KQDA 3U1IB 1OP8A 3MHWU 4Y79A 1H8ED 2Q6FA 1MMJN 4X1SU 3P17H 1LQDB 1S81A 4AGJA 2XWBI 1NY22 2ZIQH 1C4U2 2L6OA 2BDHA 3SJKA 2ZTXA 1A2CH 3HK3B 1ZPBA 2GZ8A 3ZVEA 1NT1A 3MH6A 1C5XB 2EA3A 5E0HA 3P8FA 2BY6X 4MPVA 1V2JT 3RXIA 1A1RA 2AGIX 3RXEA 2EY4C 1SPJA 3STJA 1UVTH 2GZ4A 3GISB 1SLVB 1A0JA 3PV2A 1O5CB 3PO1C 3A7VA 1S6FA 4TO0A 2VU8E 4R8TB 1K1OA 1K1LA 1VCPA 2WPKS 4GUXA 2SGAA 3RMOH 3TVJB 2PW8H 4TWWA 2QE7D 4QT8C 1RTKA 1C4Y2 4HTCH 4QG0A 1HBTH 4QQWA 3E0PB 1PQ8A 1N8OB 1C5VA 4MLFB 1FAKH 1ELTA 2GTBA 2GV7A 2P3FH 4CREA 3PMHB 1CA0B 3KYFA 2D1JA 3KQEA 2F91A 1KTSB 2A7HA 3BG8A 3D23A 3EDXB 1C1TA 3MU8A 3UQOA 3S9BA 4AFQA 3HKJB 1OYQA 3KQCA 3E90B 1MU8B 3FO8D 2FOHA 1VITH 1GBHA 1GCTB 4HFPB 5GCHF 3QTOH 3SU4A 1O3NA 1KYNA 1LVOA 4NA8A 1HAGE 4RKJB 1W0ZU 1PQAA 2XXLA 3PB1E 1LHDH 1GVZA 2BD5A 3NXPA 4D9RA 2AH4X 1BMAA 1MABB 2F9OA 2ZQ2A 1DVAH 2XW9A 1BJVA 3K6YA 5EG4A 1E36B 3KQ5A 2QF0A 3EGKH 5ESTE 1GI6A 1GPZA 1XUJA 2ZU2A 2ZFPH 1ESBA 2AMPA 2LPRA 3MU1A 1ZSLA 2PQ7A 3RXVA 2PR3A 1A0LA 1QJ6B 1TYNA 1FV9A 1V3XA 3SUDA 4QG1A 1KY9A 1GG6B 2F43B 4DT4A 3PYHA 1TNHA 3M7TA 1O2MA 1TQ7B 4E05H 1FDPA 2PARA 1K1NA 4MPUA 3TK5A 1TWXB 4GCHG 2JETB 1SGIB 3RXJA 5A0AE 1S6LA 2FWWA 1UJ1A 1AY6H 2P94A 2XYAA 2FOBA 4FUCA 3A80A 5IYTA 1IQKA 3LH3A 1BB0B 4LK4A 5F6MA 1ESAA 2OQUA 1YPEH 3BG4C 1Y5UT 2ZHDA 1GI9B 3RLYH 3W95A 1YLNA 4Q7YA 1P3EA 1EAUA 3OEED 5J4QA 1IQHA 2WPLS 4AYVB 4D7GA 2XBXA 2J92A 1SG8B 4JZEH 1OWKA 5F8XA 1Z6EA 2AIPA 2XC4A 2CHAC 9LPRA 5FCKA 6ESTA 1YPLH 1PQ7A 2UWLA 5A09A 1OS8A 4JYVH 2QV1A 4NZLA 3BIVH 4MNVA 1K22H 2JJ1D 4XFQA 3LJOA 2JJ2D 3EQ0H 4X2XA 5FPSA 1VZQH 3T28A 2I6QA 4CHAB 1TE0A 1VR1H 1O3PB 2CF9H 1FY3A 2OXSA 2I6SA 1O3OA 2DE8A 1L1JA 4MPXA 2VNTA 3TGJE 1QBOA 2PSXA 4NIWA 1AFQC 2QAAA 2BLQA 2VIOA 1C5QA 3F9HA 1ELFA 4O97A 1L1GA 2Z7FE 1DE7H 2GV6A 2ZPSA 2KR7A 3MNSA 1EZSC 1QA0A 1VJ9U 1DLKB 1FMGA 1QRWA 4QQXA 1F0UA 1GJ9B 2FM2A 2WPJS 4A92A 4K60A 2RG3A 5B6OA 1GJAB 1EOJA 1GJ5H 2CJIA 2P93A 4ZKNU 3SW2B 4FXGH 3ZZDA 5LH8A 2RFKC 3K2UA 2ZU3A 2HALA 3V12A 3V13A 1OWHA 1WYKA 3U8TH 2FS9A 3D49H 4X2YA 4OGXA 3SGQE 3HGPA 1IHSH 4UONA 4M9FA 4B2AA 5JBBS 2O8TA 4ZCNA 2ZKSA 1GVLA 1DLEA 3AW1A 3UOUA 4RXQA 4A1TA 1KDQB 4FUJA 1DSUA 1JMOH 3RXPA 4YTAA 1HXFH 2EQNA 1NFXA 1O2XA 1UHBB 1H9LB 1SVPA 1ZHRA 3LGTA 1GBTA 2VVVA 3FKSD 2BD8A 4AG2A 3E91A 1O39A 1KTTB 1DXWA 1SGQE 2XBWA 5TK7A 1ACBE 1PYTD 3KL6A 3SK9A 1V2KT 4QFZA 1C1VH 1ELEE 1P01A 3W94A 1FY4A 1JBUH 5I25A 1SGNE 4TNYA 1ZGVA 3B8JA 1GBMA 5FBEA 2ODYB 2BVSH 1IOEA 1JOUB 1BRCE 1QNJA 1NRNH 1ELBA 1EQ9A 4I8HA 4L1JB 2G52A 1QIXB 2ZG0H 4YO9A 3FOAA 1BRUP 2P3UB 4QQYA 3RXFA 1C1SA 3FFGA 3SQEE 1UVPA 5LPRA 3URDA 3TGKE 4B75A 3C1KA 1Z8JB 2FOAA 1XXFA 1YCPH 2YNBA 1A5GH 1OP0A 3KCGH 2QCYA 1NU9A 4X1NU 3HK6B 4NIYA 1OKXA 1WUNH 3NUMA 1KDQA 2A5AA 2K1QA 4I33A 1GVKB 2AMQA 1LDTT 1P0SH 1QB9A 1BA8B 1S0RA 3EE7A 1O2KA 4Q7HA 4MG3A 5EPYA 3LGVA 4RSPA 1PPEE 1TMUH 4O3TA 2UUYA 4N71A 1EKBB 1SKYE 1O3GA 1LO6A 3I77A 2FOEA 3A7TA 3BTQE 4AORA 4CH8B 3KN2A 3GY4A 1GDNA 1MD8A 3H09A 2RA0A 4OS6A 4O3UA 5IK2D 1N6YA 1GHAF 1J9CH 3LH1A 3GCHC 4AB8A 1G32B 3KH1A 4K3JA 1OX1A 1AUTC 2C4FH 1TALA 1Z8RA 5CHBA 4CR5A 2F9VA 1MH0A 1G3BA 1O5FH 2BHGA 1JRSA 3M3SA 4MVNA 3HKIB 3S9CA 2ZHEH 4QFXA 1GBJA 2OC8A 3LGUA 1NRRH 1WCZA 4WXIA 4XD7D 1GMDF 4BAMB 1C1QA 3A84A 2JKHA 5FX6A 3SU2A 2OC1A 3ZZ6A 3CP7A 1HYLA 1UTPA 1GCDA 3UUZA 3SU0A 1NPMA 2ULLA 1CT0E 3KGPA 2ZEBA 3M3VA
chains in the Genus database with same CATH topology
3TMCA 4L7WA 4QG1A 4Q2DA 4ZWGA 4TNXA 4BZCA 4TNRA 4RXOA 2PARA 2IPQX 5TK7A 4QFYA 2HEKA 3SK9A 4QFZA 4TNYA 3I7AA 4ME4A 4QQZA 5AO3A 1YNBA 4TO5A 3M1TA 5TK6A 4LRLA 4TNPA 4N6WA 5AO2A 4TO3A 3P3QA 4L1JB 2O08A 4QQYA 4MLMA 3RF0A 4QG2A 3IRHA 2OGIA 3TM8A 4MDZA 3MEMA 2GZ4A 3GW7A 2DQBA 4TO1A 4TO0A 1YOYA 5TK8A 2PAQA 1XX7A 4L1JA 4TO6A 4XDSA 1U6ZA 4QG0A 2Q14A 3BG2A 4Q2CA 4QQWA 4Q7HA 4BZBA 3LJXA 4ZWEA 5TK9A 4N71A 3SKDA 4L7EA 5AO0A 3MZOA 1VJ7A 4MZ7A 4MCWA 3U1NA 4DMBA 4RXPA 1VQRA 3CCGA 4QQXA 3NQWA 2O6IA 2CQZA 4RXRA 3KH1A 3TMBA 4QG4A 4RXSA 4TO4A 4R8ZA 2PGSA 4MLNA 3NR1A 3TMDA 5AO1A 4QFXA 5TKAA 3HC1A 4X9EA 3S4LA 2PAUA 3KQ5A 2FLOA 5AO4A 4TNZA 2PQ7A 4RXQA 3HI0A 4TNQA 4TO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQ5 A;  2IPQ X; 
#chains in the Genus database with same CATH topology
 4XBC A;  4Y7B A;  3KHV A;  4K5Z A;  3RXS A;  4ZWG A;  5FCR A;  3CS7 A;  2IN2 A;  1UCY E;  1XVO A;  1J17 T;  4CRC A;  5AFY H;  8GCH G;  4DCD A;  1O2T A;  1V2Q T;  4GVU A;  4MNX A;  5GWZ A;  1V2T T;  4NFF A;  1O2G H;  2PP6 A;  2Z9G A;  3AW0 A;  2V35 A;  3LKW A;  2HPP H;  1O35 A;  2BD4 A;  5ABW A;  3ATM A;  1YYY 1;  1QY6 A;  4KTU A;  3C27 B;  2ZZU H;  5C20 A;  5DP5 A;  3A7Z A;  2G00 A;  2VH6 A;  2SNV A;  2NU4 E;  1O31 A;  2Z9J A;  2GGV B;  1SQT A;  4FU9 A;  3EAJ A;  4I86 A;  2O8L A;  1GHB F;  4MLM A;  4YT6 H;  4B71 A;  1NRP H;  3OTJ E;  3TIT A;  2QIQ A;  1INC A;  3FAN A;  2HWL B;  2BY5 X;  1VKY A;  2P3T B;  3LIW A;  3TK9 A;  4UE7 H;  2XRC A;  3E1X B;  3ZZ7 A;  4Y0Y E;  3SJ8 A;  3GY6 A;  2QGR A;  2BM2 A;  2PV9 B;  3ZVA A;  1C5M D;  2BDA A;  1T8N A;  3GY5 A;  1RTL A;  3CNR A;  3OSY A;  1GDQ A;  1GBK A;  2SGP E;  3R0F A;  2WYG A;  1ZSJ A;  2FOM B;  1O34 A;  4XDS A;  3T62 A;  2EI7 A;  3GCT F;  4RI0 A;  5KEC A;  2RDL A;  2ZGX H;  3ZZA A;  4XSK U;  2W6I D;  6CHA B;  1G36 A;  1W12 U;  1OWI A;  2BQ7 B;  4ABE A;  1EAI A;  1ZHP A;  2F3C E;  1GWA A;  3Q3Y A;  2Z9K A;  3SV8 A;  1BTU A;  2H5C A;  4TPY A;  4AG1 A;  2KFW A;  4IS5 A;  4CRD A;  1HB0 B;  1CQQ A;  1D9I A;  1VJA U;  1D6R A;  3SNA A;  1LHE H;  2O6I A;  2B5T B;  4CBO A;  5J4S A;  4QG4 A;  3LC5 A;  1QFK H;  4LOY H;  3SZE A;  1ELV A;  1ANE A;  2BY7 X;  3BEU A;  4ZMA H;  1P8V C;  3V7T A;  1P3C A;  2J98 A;  5AO1 A;  5E2O A;  2PFE A;  1OXG A;  1GBB A;  1T4V H;  4AB9 A;  2HPQ H;  1L1N A;  1ABJ H;  4XBB A;  1TAW A;  3BG4 B;  3QZR A;  2A5I A;  1O2R A;  2SGQ E;  1YCP M;  1C5Z B;  1BTH H;  5HIZ A;  2VGC C;  2FO9 A;  3VB7 A;  5EOK A;  5E2P A;  1IQL A;  3BTG E;  3DSG A;  3F1S B;  3SBK A;  5CE1 A;  5B6L A;  7GCH F;  1W0K D;  3GY3 A;  4IBL H;  5C0T A;  1HJA C;  1HJ8 A;  3SU5 A;  3SGA E;  4AOQ A;  2ZU1 A;  3CEN A;  1TPO A;  1HAV A;  3JZ1 B;  4A1V A;  1G2L A;  3VG8 A;  2EI8 A;  1UK4 A;  1UCY H;  2QXI A;  4BAK B;  1G9I E;  4Q63 A;  4OM9 A;  4K2Y A;  5AO3 A;  2HGT H;  5C17 A;  4F48 B;  1O37 A;  4N6W A;  2XCF A;  3ODD A;  2GDD A;  5JB9 S;  1GJ6 A;  4AGK A;  2BXT H;  4X2W A;  4HZH A;  1SSX A;  3IIT A;  1ZMJ A;  2ZGB H;  3STI A;  2OQ5 A;  1NN6 A;  1QZ8 A;  1T4U H;  3M5O A;  2TGD A;  1V2S T;  1F0S A;  1O3A A;  1E1R D;  2PSY A;  3VEQ B;  2FTM A;  2GCT C;  4SGA E;  3V3M A;  1AI8 H;  5EQS A;  4IMQ A;  2FYQ A;  1P57 B;  1PPH E;  2WUB A;  3PRO A;  3A8B A;  4I8L A;  2VWO A;  1C1M A;  3ZVB A;  1FPC H;  3PWC A;  1TX6 A;  2UUJ B;  3KID U;  4ISL A;  4YOI A;  4CRA A;  1CHO F;  2ZFT A;  3H7O A;  3K65 B;  3U8O H;  5EIY A;  1MTU A;  8EST E;  2ZPQ A;  3OFN D;  5T6D A;  1FNI A;  2VH0 A;  3E16 B;  2Y7X A;  1GDU A;  1EST A;  2OIN A;  3ZV9 A;  3MYW A;  4BTU B;  2F9B H;  1BRB E;  1THP B;  1ZYO A;  2BXU H;  2FPZ A;  2P8O C;  2W5E A;  4JCN A;  1EPT C;  2OBQ A;  1C2F A;  1C2M A;  5GXP A;  1AWF H;  2KM0 A;  4F49 A;  2VVC A;  5BPE A;  3GCO A;  5TKA A;  2GP9 B;  3HC1 A;  4BOH A;  3M35 A;  5L30 H;  4H42 U;  4NA9 H;  2ZNK H;  1DIC A;  5HM9 A;  1WDI A;  4I8K A;  1BMN H;  5EPN A;  1C1U H;  5EXL A;  2YNA A;  1VIT F;  2C8Y B;  3OTP A;  3UR9 A;  6GCH F;  1MTN B;  4TO2 A;  4WF8 A;  3MNX A;  3KEE A;  5CHA B;  3RXR A;  2THF B;  4D7F A;  1QCP A;  5AF9 H;  4ABB A;  2ASU B;  1DUE A;  2FOG A;  4CRF A;  4RT1 A;  2VWN A;  2BLW A;  2JH6 D;  1CBW B;  1MKW H;  4B76 A;  3FP6 E;  3NZI A;  3RUO A;  4Y10 E;  3UIR A;  1YPH E;  1XM1 A;  2KCP A;  3H7T A;  1W14 U;  1O5E H;  4E06 H;  2HEK A;  1SL3 A;  2C8W B;  1YP9 A;  1BCU H;  2R2W U;  1DT2 A;  1YCP K;  3SUF A;  2JH5 D;  3WY8 A;  1P06 A;  1LCY A;  1O38 A;  1DWD H;  1C5W B;  3O8R A;  3DFJ A;  1RTF B;  2HNT F;  1SC8 U;  4U2W A;  1NS3 A;  2BDI A;  1DAN H;  4INL A;  2KCA A;  1BML A;  2QXH A;  3RF0 A;  1EAW A;  2CMY A;  1C1R A;  4MPW A;  3TLO A;  4Z6A H;  5TJX A;  3TM8 A;  2KCO A;  1TRN A;  3ELA H;  3CS0 A;  2Z9L A;  1D6W A;  1E79 D;  2BX3 A;  1ELA A;  4ABF A;  4F4O C;  1B5G H;  2H1U A;  5DP4 A;  5LPE A;  6LPR A;  1P2J A;  3RXA A;  4WY3 A;  1RIW C;  1W10 U;  3GCH B;  3B23 B;  1H9H E;  1YOY A;  1ZML A;  1DM4 B;  2A1D B;  1B7X B;  5JBA S;  5F8T A;  4U01 A;  3SI4 H;  2XCN A;  4NWL A;  3EA9 A;  1ARB A;  3SNC A;  2KZ4 A;  2GVF A;  2VVU A;  1EUF A;  4BZB A;  2UUF B;  3KYG A;  1DXP A;  1TX7 A;  1W8B H;  2YMS D;  5IDK A;  1YF4 A;  1A61 H;  2M2A A;  1XVM A;  2ZHF H;  5ESB A;  2TGT A;  2QF4 A;  1V2L T;  1JXP A;  2Y6T A;  3N99 A;  1ZSK A;  1Y59 T;  3U1N A;  3LGY A;  2A31 A;  3RU4 E;  2YOL A;  3O8B A;  5AFZ H;  3RM2 H;  1ID5 H;  2AYW A;  2BVR H;  1YM0 A;  1QRX A;  2XNI A;  5T3H A;  2K8I A;  1GJ4 H;  1W3C A;  1J8A A;  4MNY A;  1BT7 A;  2AEI H;  1FZZ A;  1V2W T;  4R8Z A;  1AZZ A;  1LHC H;  1MCT A;  1ZR0 A;  4KEL A;  3RXB A;  1FY1 A;  1SGD E;  1T8O A;  1ZTK A;  5JBC S;  1MUE B;  1A7S A;  1WTG H;  2VWM A;  1IQI A;  2XWA A;  2CXV A;  3NKK A;  3BTH E;  1TA6 A;  4X9E A;  1FXY A;  3ATK A;  3QUM P;  4O03 A;  2Z6B D;  2FLO A;  4AFS A;  1BTZ A;  1GI8 B;  2QA9 E;  1C2L A;  3MNB A;  1N6X A;  3UNS A;  2R0K A;  5DKM A;  1ELD E;  2ZTY A;  4JZD H;  4IW4 E;  3UB0 A;  1GHX H;  4L7W A;  1EX3 A;  5C1X A;  4ZXY H;  9EST A;  2SGE E;  1CA8 B;  2RDE A;  2Q6D A;  1QGF A;  2PKA A;  2J94 A;  1FUJ A;  1MKX H;  2RCE A;  2C8Z B;  1QQU A;  3QLP H;  1HAP H;  1QB6 A;  1HAH H;  1AB9 C;  1O3H A;  2H5D A;  1K1M A;  1ELG A;  4DJZ B;  2J5U A;  3TK6 A;  4ASH A;  1HAO H;  2Y5H A;  1K1P A;  2GMT B;  4NFE A;  3FAO A;  4AFU A;  1SGF G;  4SGB E;  4U30 A;  1FI8 A;  1GBI A;  2FI5 E;  1LPG B;  1C5O H;  1AIX H;  3BTT E;  4XOJ A;  5HMA A;  2ZDM A;  2XC0 A;  2B8O H;  3RML H;  1TGT A;  2NU0 E;  4IN2 A;  1GJ8 B;  2XBY A;  1AO5 A;  1Q2W A;  1L4Z A;  4B6E A;  5DK1 A;  1NZQ H;  3SNE A;  1PJP A;  2SNW A;  1C2K A;  1ETS H;  3MFJ A;  5GCH G;  4YES B;  2BMG B;  1GBL A;  1XX7 A;  1C2J A;  3EYD A;  2Z3E A;  1RXP A;  1D4P B;  3A8A A;  1Y5A T;  2J95 A;  1PPB H;  3ITI A;  4A1X A;  2BB4 A;  4YM9 A;  2WPD D;  4ZWE A;  3M5L A;  2ILN A;  1WV7 H;  4D9Q A;  1KXC A;  3TPI Z;  1SQA A;  1TGB A;  2ZC9 H;  1W11 U;  4AN7 A;  1GI3 A;  1BBR E;  5C3N A;  5HGG A;  1DX5 M;  1QBV H;  4ISI H;  3ZVF A;  1CVW H;  2ODQ A;  1A4W H;  1GGD C;  4Z0K A;  1GI4 A;  1HJA B;  1SLW B;  3GIC B;  1GMH F;  2HLD D;  3MU5 A;  2PGS A;  3ENS B;  1WOF A;  1S84 A;  1MTS A;  3TMD A;  1P9U A;  3AAU A;  1K9O E;  1AE5 A;  2IOT A;  3Q00 A;  5DG6 A;  3UQV A;  2BDY A;  1MU6 B;  1IAU A;  1UCY K;  2WV5 A;  3BV9 B;  1OOK B;  4DVA U;  2ZFR H;  3VGC C;  1MQ5 A;  1BTW A;  3MO3 A;  2EC9 H;  1GJB B;  3DCL A;  1GHY H;  3R3G B;  2ZGH A;  1GBA A;  1QA7 A;  1GI5 A;  3MI4 A;  5A2M H;  4RT0 A;  1PFX C;  3F2G A;  3Q76 A;  1XX9 A;  2GZ9 A;  4Y8Z A;  2BZA A;  4AZ2 B;  4FVD A;  1CGI E;  2FLR H;  4X8V H;  2GJG A;  3A7Y A;  4P00 A;  1MQ6 A;  1H8H D;  1Q31 A;  5TK6 A;  3P8N A;  1P2O A;  3DUX H;  4BTT B;  1FJS A;  4PRO A;  4DGJ A;  3U1J B;  1G3C A;  1MAX A;  5GIB A;  2V7Q D;  4FUI A;  2HVX A;  5EQR A;  3ZZ3 A;  3EST A;  2OLG A;  1P03 A;  2ZA5 A;  5GPI B;  3PMB B;  3PV5 A;  3ZZ8 A;  2ALP A;  2Q1J A;  2QXG A;  3BN9 A;  4MDZ A;  5H4I B;  3H5C B;  1BZX E;  5K0H A;  3GY7 A;  2QC2 A;  1C2H A;  1EB2 A;  3VB6 A;  3LOX A;  2ZFQ H;  1TA2 A;  5DP3 A;  2ANY A;  4I8G A;  3F9G A;  4X8U H;  3TNS A;  3IWM A;  4OS5 A;  1MCV A;  3OU0 A;  2P8O B;  3VB5 A;  2ZU5 A;  2YMS B;  3OAA D;  1EPT B;  2R3Y A;  3SUE A;  2Q14 A;  4AYY B;  3A8C A;  3GS9 A;  1Z71 A;  4WXV A;  2OCV B;  2BD9 A;  1GBF A;  1BQY A;  1TOC B;  1SGF A;  3SOR A;  5C1U A;  2A7J A;  2HOB A;  2ZCL P;  5A0C A;  1T31 A;  1OWD A;  3BTK E;  1P2M A;  2BDG A;  4B73 A;  1AWH B;  2ZDL A;  1Z7K A;  3P92 A;  1BBR H;  1THR H;  3MH4 A;  4XBD A;  5F53 A;  4BAN B;  1PPZ A;  3RXD A;  3QK1 A;  4INH A;  2J97 A;  1JWT A;  4TT3 D;  1NES E;  1AND A;  2BZ6 H;  3SU1 A;  8KME 2;  1F5L A;  1MKW K;  5G4B A;  4NG9 H;  1GMC F;  3RXQ A;  2DUC A;  1TQ0 B;  1XUK A;  1P2I A;  4K1E A;  1V2M T;  1Z8I B;  1SHH B;  4A7I B;  4TNZ A;  2FXR A;  2EEK A;  2FOC A;  3HI0 A;  4X2V A;  5EW2 H;  4ZKS U;  1ZJK A;  3RXK A;  3PLP A;  4Q2D A;  1IQJ A;  1EPT A;  4VGC B;  3VB4 A;  4FUG A;  1F0T A;  4TNX A;  4WJG 2;  1EB1 H;  1MZD A;  1O3M A;  1BMF D;  1Y3U A;  2STB E;  1LKB A;  4H6S B;  5FL7 D;  4ACB A;  1A3B H;  1NFW A;  4QFY A;  1O2U A;  1HLT H;  3BTE E;  5AVD A;  1MBQ A;  4XRN A;  4ZHL U;  3GYL B;  1AVG H;  1C5N H;  1QTF A;  1UW7 A;  2UUK B;  1HAZ B;  2VIP A;  3GY2 A;  1KIG H;  5A8Y A;  1WU1 A;  1K28 D;  2QXJ A;  1LVM A;  4YT7 H;  1ELC A;  3T27 A;  2XTT B;  1A5I A;  2UWP A;  4UFF H;  1CU1 A;  3O8C A;  1O2V A;  4X8S H;  1PPC E;  1WBG B;  1FON A;  1RD3 B;  2WPM S;  4J2Y B;  4YOG A;  2AGE X;  2FMJ A;  4DW2 U;  3NCL A;  1F5R A;  1P12 E;  1C1O A;  1CO7 E;  3PO1 B;  1H8D H;  4ZXX H;  1GHA G;  1C5U A;  3P8O A;  2GD4 B;  1DS2 E;  1ZJD A;  1FX0 B;  2QYI A;  4TO6 A;  3BEF B;  1UK2 A;  1U6Z A;  2A4Q A;  3QDZ B;  3BG2 A;  3PTN A;  1EOL A;  4ZKR U;  3MO9 A;  3SU3 A;  5EJZ A;  4IN1 A;  1NRS H;  2IPH A;  2J98 B;  3F0P A;  1QL8 A;  1O3C A;  4CRB A;  1VGC C;  2GCH F;  1GMD G;  4OGY A;  3MZO A;  1BHX F;  1GL1 A;  3T5F H;  4MZ7 A;  2HRV A;  2V0B A;  1C5T A;  1SGT A;  5FX5 A;  3Q3X A;  1ARC A;  1KXE A;  3RDZ A;  2ZDA H;  1EFR D;  2FTL E;  3PMA B;  2H2Z A;  7LPR A;  3SV9 A;  1EJN A;  4IMZ A;  4RXR A;  4RXS A;  2ZDV H;  4X1P U;  5F03 A;  1EAT A;  1EJM A;  3UTU H;  3GYM A;  4ZKO U;  2WPI S;  1Y8T A;  1C5Y B;  1C5S A;  4X8T H;  2BD2 A;  3SZN A;  2QF5 A;  1HAV B;  3GDU A;  5L2Y H;  1NRQ H;  2BQW B;  4FUE A;  3IG6 B;  4P02 A;  7EST E;  2A5K A;  2BX4 A;  2EST E;  2JIZ D;  2PAU A;  4UDW H;  1CGH A;  2JH0 D;  4X1R U;  1L0Z A;  1MKX K;  1KLI H;  4AX9 H;  1V2R T;  3TMC A;  2BDC A;  3OY6 U;  3DA9 B;  2BYA X;  1KLT A;  1WQV H;  1GG6 C;  2TPI Z;  3E6P H;  4B74 A;  1GHB G;  1P2K A;  2AHM E;  1GBD A;  1KXB A;  3TGI E;  4BTI B;  4X1Q U;  3MQK C;  2PLX A;  1KMH B;  2HNT C;  1V2P T;  3ZYE A;  2OD3 B;  3I7A A;  2CF8 H;  3A85 A;  3GCN A;  1H9I E;  4TNP A;  1HJ9 A;  1NBM D;  5EU8 A;  4TSF D;  1A5H A;  1J14 A;  2CN0 H;  2NWN A;  5C1Y A;  4TO3 A;  2C8X B;  5C2Z A;  3P3Q A;  1G30 B;  3ZZ9 A;  3GCT G;  2FX4 A;  3PM3 A;  1XUH A;  4BXS A;  1O2O A;  1TNG A;  3KF2 A;  1LHF H;  1A46 H;  3S69 A;  4ZRO A;  1SI5 H;  2CHA B;  3SND A;  2ZP0 H;  2A0Q B;  4ABH A;  3T29 A;  1ZTJ A;  4GSO A;  2LP6 A;  4F55 A;  1QR3 E;  3MEM A;  3GW7 A;  2OK5 A;  1SGC A;  3RXU A;  1EP5 A;  1GJD B;  3VFE A;  1F5K U;  3L3T A;  2PAQ A;  1SLX B;  3K6Z A;  4H4F A;  1MD7 A;  1TRM A;  2SGD E;  2ZTZ A;  2V3O H;  3F6U H;  1EZX C;  2Y82 A;  2WV4 A;  3AVZ A;  3S9A A;  3SYJ A;  1F7Z A;  2A4R A;  1AFQ B;  2O8W A;  3A83 A;  3PTB A;  4B6F A;  1HIA B;  3SV2 H;  4DIH H;  5DO4 H;  3HPT B;  1TOM H;  5DJ7 A;  3ZVC A;  1TPP A;  2C3S A;  1TNJ A;  2FLB H;  3VGC B;  1O0D H;  2Z3D A;  1ORF A;  5DSF A;  3G01 A;  1DPO A;  1VQR A;  3CCG A;  1XUF A;  3NQW A;  1TGS Z;  1HRT H;  3M7U A;  3BEI B;  4AC9 A;  3DT0 H;  3QO6 A;  4TPI Z;  7GCH G;  3M3T A;  1F2S E;  1BIO A;  1KLJ H;  2BTC E;  3A82 A;  1YPJ H;  5ETX A;  1O3I A;  2J2U A;  3TNT A;  1HGT H;  3ZIA D;  2XC5 A;  5EXN A;  3S4L A;  5HIY A;  2PTN A;  1DY8 A;  1SQO A;  3FZD A;  2OUA A;  2TRM A;  4GHQ A;  1HDT H;  1N1L A;  1NBM E;  2FDA A;  1O2S A;  1QQ4 A;  1TMT H;  1O3F A;  1UTN A;  1PPF E;  4D76 A;  2W3K A;  3N7D A;  1C9P A;  2J38 A;  2KX4 A;  1LQE A;  1ZZZ A;  4ABJ A;  4UFG H;  3MO6 A;  3A8D A;  1C5R A;  1HIA A;  2WPH S;  2ZFF H;  1TBQ H;  2H6M A;  1SQR A;  1LPK B;  1QHR B;  2ODP A;  4IC5 A;  1UTM A;  3SHA H;  3LPR A;  4TY7 A;  4K8Y A;  1OWJ A;  4MDS A;  1YNB A;  4RKO B;  4TO5 A;  2FEQ H;  1P02 A;  4LRL A;  1C5P A;  3F2F A;  1K0H A;  1X7A C;  2Y5F A;  2PGQ B;  4Y7A A;  4ZHM U;  4NGA H;  2HLC A;  1AQ7 A;  2L74 A;  1C2G A;  1IQN A;  3EA7 A;  3SUG A;  3LGI A;  5DP6 A;  3ATI A;  2RA3 A;  4FU8 A;  3GDV A;  3RXO A;  2ZHW H;  2P95 A;  3ZVG A;  4AFZ A;  2HVY B;  3VPK A;  2TBS A;  2VIW A;  1CHO G;  1RRK A;  2IJO B;  1D3P B;  2VIQ A;  2ZGC A;  1EAS A;  4NSY A;  3S0N A;  1FQ3 A;  4DG4 A;  3LGW A;  4CR9 A;  1IQF A;  1YPK H;  4FUB A;  5TK8 A;  1G3D A;  5HM2 A;  1BBR K;  2ZDK A;  3KNX A;  1G3E A;  4ABG A;  5EQQ A;  5FPY A;  2J4I A;  1O3E A;  1SHY A;  3AAV A;  1AKS B;  5FPT A;  2XOK D;  3SKD A;  3ZZ4 A;  1GI0 A;  3F68 H;  2B0F A;  4XE4 A;  5JDU B;  3TIU A;  3TH3 H;  3TJU A;  4HG6 A;  1SGY E;  2GT8 A;  4K8B A;  1YC0 A;  1ZPC A;  3A87 A;  2AMD A;  1AZ8 A;  3DFL A;  4UD9 H;  5GDS H;  3PLB A;  6GCH G;  1VIT G;  5EXM A;  4WMD A;  1OPH B;  3QGN B;  4ABA A;  1XUG A;  3RP2 A;  5I46 H;  3S7K B;  2BQ6 B;  4Q7Z A;  1K1I A;  1XKB C;  2OC7 A;  2PKA B;  5GJ4 B;  1HV7 A;  1G2M A;  1BDA A;  2KCY A;  4DY7 B;  4E7N A;  4Q7X A;  1HAX B;  1UTJ A;  2V3M A;  1CGJ E;  3F2H A;  1JIR A;  3TJN A;  3RXC A;  1BTY A;  4ISN A;  1ZPZ A;  1SGR E;  4O9V A;  4CH2 B;  4GAW A;  1YLC A;  3PMJ A;  3PWB A;  1O2Y A;  4H6T A;  2ZO3 H;  4KP0 A;  2K0Q A;  1ANC A;  1DWB H;  2SGF E;  3RC4 A;  4FUH A;  2QN5 T;  2A2Q H;  1QJ1 B;  1WTH D;  2CK3 D;  4BZC A;  1O2I A;  3ZYD A;  1AKS A;  4RXO A;  3AAS A;  2J9N A;  1OYT H;  2R2M B;  4ISO A;  3TH4 H;  4ABD A;  1RGQ A;  4INK A;  4JK5 A;  3UWI A;  2G8T A;  2P59 A;  4E7R G;  3VXF H;  1YBW A;  2F83 A;  1TMB H;  1LVY A;  1GJ7 B;  4QQZ A;  5JBT A;  2IJD 1;  3BF6 H;  3M1T A;  1HAI H;  1VCW A;  3N7O A;  4LZ4 B;  1UVU H;  2G55 A;  3DHK H;  3MH7 A;  2GKV E;  1AU8 A;  3FP7 E;  1LMW B;  3SV7 A;  3T26 A;  3TJO A;  2O08 A;  3PV4 A;  1O30 A;  4YOJ A;  1MBM A;  1QB1 A;  3ZZ5 A;  4QG2 A;  2OC0 A;  3W1E A;  3A7W A;  4A5T S;  1B0F A;  3TU7 H;  4GCH F;  1VGC B;  1ZRB A;  2GT7 A;  1WQS A;  1RFN A;  2VWL A;  2VIV A;  4BNR A;  1XKA C;  4XDE A;  4JK6 A;  2FES H;  2VJ1 A;  4KTS A;  4WH6 A;  1OSS A;  1O2L A;  1UTL M;  2F9P A;  3MU0 A;  3NRL A;  2PKS C;  3QX5 H;  2WUC A;  3B9F H;  4DUR A;  1P2Q A;  2PHB A;  3SHC H;  3M37 A;  6CHA C;  1XXD A;  3OY5 U;  1KSN A;  2ANM H;  4L7E A;  4DT7 B;  5PTP A;  5JB8 S;  3ZVD A;  1LHG H;  1COW D;  2PUQ H;  2VB0 A;  2WIN I;  1TGC A;  1IQE A;  1RS0 A;  2AIQ A;  3QN7 A;  2QF3 A;  2ZF0 H;  1ETT H;  4JYT A;  1Q3X A;  2BLV A;  1E35 B;  5EOD A;  3KQB A;  1ZTL A;  3Q3K A;  2AGG X;  2WSS D;  1D3D B;  4I8J A;  1TNI A;  4MNW A;  3E0N B;  2G5V A;  1P09 A;  1O2W A;  4M7G A;  4GPG A;  3BTD E;  1NFU A;  4ASU D;  2GDE H;  1E1Q D;  5F8Z A;  1AUJ A;  5EW1 H;  3MU4 A;  2PGB B;  1B0E A;  1C2D A;  1O36 A;  2FI3 E;  5AO4 A;  5LPF A;  4ZAE A;  1MTV A;  2BLO A;  3FZZ A;  2VGC B;  1W0Y H;  3P95 A;  1GBC A;  1SR5 C;  2V3H H;  4IC6 A;  3SN8 A;  3HAT H;  3U28 C;  1CT2 E;  3F9F A;  3RXG A;  3MTY A;  3E8L A;  2FOF A;  3FP8 E;  1PYT C;  1W7X H;  1Y3W A;  1UVO A;  4Z1M D;  2TGA A;  3JZ2 B;  3BTF E;  1V2V T;  2G4U A;  4JZF H;  3A81 A;  4UEH H;  1O2H A;  3UOP A;  1AN1 E;  1CE5 A;  2VIN A;  1KXF A;  5CDF E;  2A4O A;  2DE9 A;  2D8W A;  1NU7 B;  4FET A;  3UR6 A;  3QWC H;  5HKK D;  2P16 A;  1F0R A;  1HNE E;  3D62 A;  3EA8 A;  1LKA A;  5AO2 A;  2FZZ A;  3RU4 T;  4ACA A;  4NIV A;  2F9N A;  4Y0Z E;  2O8M A;  1QJ7 B;  1S5S A;  1UTO A;  2ZQ1 A;  1TX8 A;  1QL9 A;  3V0X A;  1FIZ A;  4WME A;  4WH8 A;  2W7U A;  3SJI A;  1ANB A;  3SI3 H;  1FN8 A;  3UPE A;  1O2N A;  1S0Q A;  5C67 A;  1HXE H;  3I29 A;  1D3T B;  2GCT B;  1O3B A;  1Y5B T;  4OS7 A;  5TCC A;  5DP9 A;  5HYO A;  2G5N A;  1C9T A;  3QTV H;  3SQH E;  1O5G H;  1PQ5 A;  1LVB A;  1GMH G;  1K21 H;  4YXW D;  1G37 A;  5TK9 A;  2BD7 A;  1H1B A;  4WWY A;  4JZ1 A;  4X6M A;  3M5N A;  1XMN B;  1C1W H;  2ZHQ H;  4GLY A;  3DD2 H;  2TIO A;  4MCW A;  4DMB A;  5A8Z A;  1RJX B;  3K9X B;  1BTP A;  3I78 A;  1JRT A;  2ZGJ A;  1P9S A;  1W13 U;  4FVB A;  4HGC A;  5E0J A;  1SMF E;  2Q6G A;  2M5T A;  1DST A;  5JPM H;  3BTM E;  5L2Z H;  1PPG E;  1TPA E;  1IQG A;  3BSQ A;  1O3D A;  1V2N T;  3F3B A;  3VB3 A;  1K2I 1;  1VCQ A;  4Q2K A;  8LPR A;  2VBC A;  3P6Z B;  2WHX A;  4LZ1 H;  3S7H B;  3MWI U;  2BY9 X;  1O2P A;  5DP7 A;  5EGM A;  1ZLR A;  1T8L A;  2XND D;  1HUT H;  4A6L A;  4OS4 A;  5E0G A;  4TNQ A;  3DSP A;  2C90 B;  1MTN C;  1ZRK A;  2FI4 E;  1ETR H;  2BVX H;  1P2N A;  5C5N A;  5CHA C;  1C1N A;  3D65 E;  2AS9 A;  1DFP A;  4B2C A;  5TCA A;  4CBN A;  1TPS A;  3A7X A;  3URC A;  1CBW C;  5LGO A;  1E38 B;  4TWY A;  1S82 A;  3U9A H;  1V6D A;  4WMF A;  2F9U A;  4X6P A;  1J15 A;  4FUD A;  4LXB H;  3PLK A;  3HGN A;  4ZUH A;  2ANK H;  2FX6 A;  4KKD A;  3F9E A;  1NM6 A;  1E34 B;  1OWE A;  1UHB A;  4ABI A;  1BUI A;  3M36 A;  1UTQ A;  4TY6 A;  1EZU C;  1FY5 A;  1SOT A;  7KME H;  8GCH F;  1AHT H;  1O2Q A;  3M61 U;  2G81 E;  1P10 A;  3MMG A;  5C0U A;  1WSS H;  4NIX A;  2ZCK P;  1V2U T;  1RIW B;  4K1T A;  3T25 A;  2DQB A;  2AFQ B;  3RC5 A;  4BXW A;  2ANW A;  1O5D H;  3P8G A;  3RMM H;  1MAY A;  4L1J A;  2D26 C;  3TH2 H;  2J34 A;  1LTO A;  4NA7 A;  4Y8X A;  1GL0 E;  5DP8 A;  3WW7 A;  4K1S A;  3RM0 H;  2G51 A;  1A3E H;  1TBR H;  3OX7 U;  3SOS A;  3LON A;  5T6G A;  3ODF A;  3LDX H;  4YLQ H;  1GMC G;  1FN6 A;  1KXD A;  1T32 A;  2H9T H;  5BRR E;  3BTW E;  1AD8 H;  4B1T A;  3QGJ A;  1DOJ A;  1VJ7 A;  5DN6 D;  1YWU A;  2LNC A;  3A86 A;  2G4T A;  3L33 A;  1HPG A;  3PRB A;  1MTW A;  4Q80 A;  1DDJ A;  1TGN A;  3WWB A;  3OEH D;  1Y3V A;  4JMY A;  4OS1 A;  1UVS H;  4WVP E;  1QL7 A;  3TMB A;  2W7S A;  1XUI A;  3GY8 A;  3N7E A;  1AGJ A;  1DWE H;  1TNK A;  5HXF A;  1N8O C;  2BY8 X;  1Z8G A;  3SU6 A;  4NSV A;  4K69 A;  1DUA A;  2B9L A;  1CA0 C;  3ATL A;  3GOV B;  2NU2 E;  3FN8 A;  5FXL A;  2Z94 A;  1AE8 H;  3A89 A;  1D3Q B;  1GHV H;  2FYR A;  1C4V 2;  1GCT C;  3M7Q A;  2C93 B;  1CSO E;  1EXF A;  5A0B A;  4BAH B;  1TLD A;  4TYD A;  3RXM A;  1BJU A;  1NO9 H;  2V6N A;  5A8X A;  2BD3 A;  1O5A B;  4TNR A;  3GDS A;  2W26 A;  5E8E H;  1OP2 A;  1A0H B;  5T1V A;  2CV3 A;  3U98 H;  1O33 A;  1FIW A;  2Y80 A;  1C2E A;  1ZMN A;  1NC6 A;  1Y3Y A;  1GI2 A;  2JDI D;  2Y5G A;  2GX4 A;  1THS H;  1AB9 B;  1QRZ A;  1UK3 A;  2A2X H;  5SGA E;  4Y76 A;  3ZV8 A;  5FBI A;  3NWU A;  1ZOM A;  1DY9 A;  4YZU A;  2PKS B;  5KGO A;  3SO3 A;  2ZPR A;  5K7R A;  1DWC H;  2A7C A;  1NFY A;  2FOD A;  2GMT C;  1YPH C;  4FU7 A;  2FP7 B;  3OYP A;  5C5O A;  1QUR H;  2F4L A;  2ZEC A;  2EI6 A;  4X0W U;  1NRO H;  1IQM A;  1E37 B;  2H9H A;  1P05 A;  4Y8Y A;  3RXL A;  2GCH G;  2JET C;  1BOQ A;  1SFI A;  2WYJ A;  1S6H A;  1TFX A;  4R0I A;  1Z6J H;  5C94 A;  1O2J A;  2KAI B;  4TO1 A;  3O8D A;  3L6P A;  1P11 E;  3WWF A;  1YPM H;  1HFD A;  4NZQ A;  2D2D A;  2OP9 A;  3LT3 A;  3MNC A;  2WV9 A;  1UO6 A;  2AER H;  1O3K A;  1W7G H;  2Z9I A;  3SNB A;  1AFE H;  3AK5 A;  5FAH A;  3URE A;  2LEL A;  2PTC E;  4I32 A;  5GND A;  1BRA A;  4KTC A;  4NCY A;  3UY9 A;  3QZQ A;  3FVF B;  2VID A;  4Q4L A;  5AHG H;  4JZI A;  2A32 A;  4RXP A;  2PWX A;  4BAQ B;  1Y3X A;  5T6F A;  3F0O A;  1GGD B;  4FUF A;  2ZWL H;  2Z3C A;  3BIU H;  3UNR A;  4TO4 A;  1M9U A;  4DOQ A;  4CHA C;  4UFE H;  1Z1J A;  2XBV A;  1EJA A;  2NU1 E;  2ZI2 H;  4MLN A;  3RLW H;  4MQA A;  3A88 A;  3SV6 A;  1YY3 A;  1BIT A;  3UNQ A;  1SLU B;  1GI1 A;  4Y71 A;  1O32 A;  3ATW A;  1IHT H;  1K1J A;  3T2N A;  2ZU4 A;  1BMM H;  1EAX A;  2KAI A;  1WAY B;  4BAO B;  1SFQ B;  2H9E H;  3MOC A;  1AVW A;  4J1Y A;  1FPH H;  5EJ1 A;  4UFD H;  4IGD A;  2STA E;  3EE0 B;  3TJV A;  2BOH B;  1QBN A;  1J16 A;  1UTK A;  3UAI C;  1C5L H;  4Y11 E;  1TNL A;  1C2I A;  3U69 H;  5CMX H;  2CGA A;  2IPQ X;  5L6N H;  2FS8 A;  1GHZ A;  3SJO A;  4GHT A;  3M5M A;  1YPG H;  3NPS A;  5JYI A;  1KXA A;  4X6O A;  1W0J D;  5FHT A;  4ME4 A;  4DII H;  4KGA A;  1O3J A;  1TB6 H;  2OTV A;  1P04 A;  4JYU H;  2B7D H;  1S83 A;  3PRD A;  3RMN H;  1BHX B;  1HCG A;  1T8M A;  3RXH A;  1O3L A;  4YLU A;  2ZDN A;  1SB1 H;  3OE7 D;  4D8N A;  1NTP A;  1EP6 A;  1L2E A;  1H4W A;  2TGP Z;  2PUX B;  2A4G A;  2W6J D;  3P70 B;  1TBZ H;  4I31 A;  3IRH A;  1FAX A;  2OGI A;  1U6Q A;  1W2K H;  1CHG A;  1GHW H;  4X6N A;  1T7C A;  3RXT A;  5DPA A;  1WXR A;  4B2B A;  1H8I H;  3SGB E;  1MZA A;  2Y7Z A;  3UFA A;  4U32 A;  1AMH A;  1UMA H;  3ZZC A;  2OBO A;  1L4D A;  2W3I A;  1HAY B;  4HI3 A;  1GBE A;  3MH5 A;  4Q2C A;  2YMS C;  4ZHA A;  1YKT A;  1O2Z A;  1SGP E;  3LJX A;  1LPZ B;  4I7Y H;  1GJC B;  3Q77 A;  2ZFS A;  1BTX A;  2GZ7 A;  2O8U A;  3U8R H;  5AO0 A;  4OS2 A;  4RN6 A;  4Y6D A;  4CRG A;  1ZHM A;  3UWJ H;  1C1P A;  1JIM A;  4ISH H;  4MTB A;  4NWK A;  3E3T A;  2WZQ A;  3RU4 D;  1OHH D;  1S85 A;  2CQZ A;  1TRY A;  1CT4 E;  1SGE E;  2O9Q A;  3NK8 A;  2QY0 B;  1O5B B;  1SOZ A;  1EZQ A;  1YGC H;  3DSO A;  3SJ9 A;  2Y81 A;  3NR1 A;  2FIR H;  1ABI H;  3VXE H;  4THN H;  1GI7 B;  5KED A;  1V2O T;  2ZCH P;  5DGJ A;  2NU3 E;  4ZH8 A;  2HNT E;  3LU9 B;  1F92 A;  3LJJ A;  5EJL A;  2R3U A;  1YLD A;  2R0L A;  1TAB E;  3LC3 A;  1DIT H;  1ZGI A;  2SFA A;  2A45 B;  3ZZB A;  2BOK A;  2R9P A;  1Z1I A;  2UWO A;  2ALV A;  1TON A;  1FLE E;  4VGC C;  4EST E;  3RC6 A;  1E0F D;  1FY8 E;  1TIO A;  1AVX A;  1SBW A;  4FOU C;  2BDB A;  3KQD A;  3U1I B;  1OP8 A;  3MHW U;  4Y79 A;  1H8E D;  2Q6F A;  1MMJ N;  4X1S U;  3P17 H;  1LQD B;  1S81 A;  4AGJ A;  2XWB I;  1NY2 2;  2ZIQ H;  1C4U 2;  2L6O A;  2BDH A;  3SJK A;  2ZTX A;  1A2C H;  3HK3 B;  1ZPB A;  2GZ8 A;  3ZVE A;  1NT1 A;  3MH6 A;  1C5X B;  2EA3 A;  5E0H A;  3P8F A;  2BY6 X;  4MPV A;  1V2J T;  3RXI A;  1A1R A;  2AGI X;  3RXE A;  2EY4 C;  1SPJ A;  3STJ A;  1UVT H;  2GZ4 A;  3GIS B;  1SLV B;  1A0J A;  3PV2 A;  1O5C B;  3PO1 C;  3A7V A;  1S6F A;  4TO0 A;  2VU8 E;  4R8T B;  1K1O A;  1K1L A;  1VCP A;  2WPK S;  4GUX A;  2SGA A;  3RMO H;  3TVJ B;  2PW8 H;  4TWW A;  2QE7 D;  4QT8 C;  1RTK A;  1C4Y 2;  4HTC H;  4QG0 A;  1HBT H;  4QQW A;  3E0P B;  1PQ8 A;  1N8O B;  1C5V A;  4MLF B;  1FAK H;  1ELT A;  2GTB A;  2GV7 A;  2P3F H;  4CRE A;  3PMH B;  1CA0 B;  3KYF A;  2D1J A;  3KQE A;  2F91 A;  1KTS B;  2A7H A;  3BG8 A;  3D23 A;  3EDX B;  1C1T A;  3MU8 A;  3UQO A;  3S9B A;  4AFQ A;  3HKJ B;  1OYQ A;  3KQC A;  3E90 B;  1MU8 B;  3FO8 D;  2FOH A;  1VIT H;  1GBH A;  1GCT B;  4HFP B;  5GCH F;  3QTO H;  3SU4 A;  1O3N A;  1KYN A;  1LVO A;  4NA8 A;  1HAG E;  4RKJ B;  1W0Z U;  1PQA A;  2XXL A;  3PB1 E;  1LHD H;  1GVZ A;  2BD5 A;  3NXP A;  4D9R A;  2AH4 X;  1BMA A;  1MAB B;  2F9O A;  2ZQ2 A;  1DVA H;  2XW9 A;  1BJV A;  3K6Y A;  5EG4 A;  1E36 B;  3KQ5 A;  2QF0 A;  3EGK H;  5EST E;  1GI6 A;  1GPZ A;  1XUJ A;  2ZU2 A;  2ZFP H;  1ESB A;  2AMP A;  2LPR A;  3MU1 A;  1ZSL A;  2PQ7 A;  3RXV A;  2PR3 A;  1A0L A;  1QJ6 B;  1TYN A;  1FV9 A;  1V3X A;  3SUD A;  4QG1 A;  1KY9 A;  1GG6 B;  2F43 B;  4DT4 A;  3PYH A;  1TNH A;  3M7T A;  1O2M A;  1TQ7 B;  4E05 H;  1FDP A;  2PAR A;  1K1N A;  4MPU A;  3TK5 A;  1TWX B;  4GCH G;  2JET B;  1SGI B;  3RXJ A;  5A0A E;  1S6L A;  2FWW A;  1UJ1 A;  1AY6 H;  2P94 A;  2XYA A;  2FOB A;  4FUC A;  3A80 A;  5IYT A;  1IQK A;  3LH3 A;  1BB0 B;  4LK4 A;  5F6M A;  1ESA A;  2OQU A;  1YPE H;  3BG4 C;  1Y5U T;  2ZHD A;  1GI9 B;  3RLY H;  3W95 A;  1YLN A;  4Q7Y A;  1P3E A;  1EAU A;  3OEE D;  5J4Q A;  1IQH A;  2WPL S;  4AYV B;  4D7G A;  2XBX A;  2J92 A;  1SG8 B;  4JZE H;  1OWK A;  5F8X A;  1Z6E A;  2AIP A;  2XC4 A;  2CHA C;  9LPR A;  5FCK A;  6EST A;  1YPL H;  1PQ7 A;  2UWL A;  5A09 A;  1OS8 A;  4JYV H;  2QV1 A;  4NZL A;  3BIV H;  4MNV A;  1K22 H;  2JJ1 D;  4XFQ A;  3LJO A;  2JJ2 D;  3EQ0 H;  4X2X A;  5FPS A;  1VZQ H;  3T28 A;  2I6Q A;  4CHA B;  1TE0 A;  1VR1 H;  1O3P B;  2CF9 H;  1FY3 A;  2OXS A;  2I6S A;  1O3O A;  2DE8 A;  1L1J A;  4MPX A;  2VNT A;  3TGJ E;  1QBO A;  2PSX A;  4NIW A;  1AFQ C;  2QAA A;  2BLQ A;  2VIO A;  1C5Q A;  3F9H A;  1ELF A;  4O97 A;  1L1G A;  2Z7F E;  1DE7 H;  2GV6 A;  2ZPS A;  2KR7 A;  3MNS A;  1EZS C;  1QA0 A;  1VJ9 U;  1DLK B;  1FMG A;  1QRW A;  4QQX A;  1F0U A;  1GJ9 B;  2FM2 A;  2WPJ S;  4A92 A;  4K60 A;  2RG3 A;  5B6O A;  1GJA B;  1EOJ A;  1GJ5 H;  2CJI A;  2P93 A;  4ZKN U;  3SW2 B;  4FXG H;  3ZZD A;  5LH8 A;  2RFK C;  3K2U A;  2ZU3 A;  2HAL A;  3V12 A;  3V13 A;  1OWH A;  1WYK A;  3U8T H;  2FS9 A;  3D49 H;  4X2Y A;  4OGX A;  3SGQ E;  3HGP A;  1IHS H;  4UON A;  4M9F A;  4B2A A;  5JBB S;  2O8T A;  4ZCN A;  2ZKS A;  1GVL A;  1DLE A;  3AW1 A;  3UOU A;  4RXQ A;  4A1T A;  1KDQ B;  4FUJ A;  1DSU A;  1JMO H;  3RXP A;  4YTA A;  1HXF H;  2EQN A;  1NFX A;  1O2X A;  1UHB B;  1H9L B;  1SVP A;  1ZHR A;  3LGT A;  1GBT A;  2VVV A;  3FKS D;  2BD8 A;  4AG2 A;  3E91 A;  1O39 A;  1KTT B;  1DXW A;  1SGQ E;  2XBW A;  5TK7 A;  1ACB E;  1PYT D;  3KL6 A;  3SK9 A;  1V2K T;  4QFZ A;  1C1V H;  1ELE E;  1P01 A;  3W94 A;  1FY4 A;  1JBU H;  5I25 A;  1SGN E;  4TNY A;  1ZGV A;  3B8J A;  1GBM A;  5FBE A;  2ODY B;  2BVS H;  1IOE A;  1JOU B;  1BRC E;  1QNJ A;  1NRN H;  1ELB A;  1EQ9 A;  4I8H A;  4L1J B;  2G52 A;  1QIX B;  2ZG0 H;  4YO9 A;  3FOA A;  1BRU P;  2P3U B;  4QQY A;  3RXF A;  1C1S A;  3FFG A;  3SQE E;  1UVP A;  5LPR A;  3URD A;  3TGK E;  4B75 A;  3C1K A;  1Z8J B;  2FOA A;  1XXF A;  1YCP H;  2YNB A;  1A5G H;  1OP0 A;  3KCG H;  2QCY A;  1NU9 A;  4X1N U;  3HK6 B;  4NIY A;  1OKX A;  1WUN H;  3NUM A;  1KDQ A;  2A5A A;  2K1Q A;  4I33 A;  1GVK B;  2AMQ A;  1LDT T;  1P0S H;  1QB9 A;  1BA8 B;  1S0R A;  3EE7 A;  1O2K A;  4Q7H A;  4MG3 A;  5EPY A;  3LGV A;  4RSP A;  1PPE E;  1TMU H;  4O3T A;  2UUY A;  4N71 A;  1EKB B;  1SKY E;  1O3G A;  1LO6 A;  3I77 A;  2FOE A;  3A7T A;  3BTQ E;  4AOR A;  4CH8 B;  3KN2 A;  3GY4 A;  1GDN A;  1MD8 A;  3H09 A;  2RA0 A;  4OS6 A;  4O3U A;  5IK2 D;  1N6Y A;  1GHA F;  1J9C H;  3LH1 A;  3GCH C;  4AB8 A;  1G32 B;  3KH1 A;  4K3J A;  1OX1 A;  1AUT C;  2C4F H;  1TAL A;  1Z8R A;  5CHB A;  4CR5 A;  2F9V A;  1MH0 A;  1G3B A;  1O5F H;  2BHG A;  1JRS A;  3M3S A;  4MVN A;  3HKI B;  3S9C A;  2ZHE H;  4QFX A;  1GBJ A;  2OC8 A;  3LGU A;  1NRR H;  1WCZ A;  4WXI A;  4XD7 D;  1GMD F;  4BAM B;  1C1Q A;  3A84 A;  2JKH A;  5FX6 A;  3SU2 A;  2OC1 A;  3ZZ6 A;  3CP7 A;  1HYL A;  1UTP A;  1GCD A;  3UUZ A;  3SU0 A;  1NPM A;  2ULL A;  1CT0 E;  3KGP A;  2ZEB A;  3M3V A; 
#chains in the Genus database with same CATH homology
 3TMC A;  4L7W A;  4QG1 A;  4Q2D A;  4ZWG A;  4TNX A;  4BZC A;  4TNR A;  4RXO A;  2PAR A;  2IPQ X;  5TK7 A;  4QFY A;  2HEK A;  3SK9 A;  4QFZ A;  4TNY A;  3I7A A;  4ME4 A;  4QQZ A;  5AO3 A;  1YNB A;  4TO5 A;  3M1T A;  5TK6 A;  4LRL A;  4TNP A;  4N6W A;  5AO2 A;  4TO3 A;  3P3Q A;  4L1J B;  2O08 A;  4QQY A;  4MLM A;  3RF0 A;  4QG2 A;  3IRH A;  2OGI A;  3TM8 A;  4MDZ A;  3MEM A;  2GZ4 A;  3GW7 A;  2DQB A;  4TO1 A;  4TO0 A;  1YOY A;  5TK8 A;  2PAQ A;  1XX7 A;  4L1J A;  4TO6 A;  4XDS A;  1U6Z A;  4QG0 A;  2Q14 A;  3BG2 A;  4Q2C A;  4QQW A;  4Q7H A;  4BZB A;  3LJX A;  4ZWE A;  5TK9 A;  4N71 A;  3SKD A;  4L7E A;  5AO0 A;  3MZO A;  1VJ7 A;  4MZ7 A;  4MCW A;  3U1N A;  4DMB A;  4RXP A;  1VQR A;  3CCG A;  4QQX A;  3NQW A;  2O6I A;  2CQZ A;  4RXR A;  3KH1 A;  3TMB A;  4QG4 A;  4RXS A;  4TO4 A;  4R8Z A;  2PGS A;  4MLN A;  3NR1 A;  3TMD A;  5AO1 A;  4QFX A;  5TKA A;  3HC1 A;  4X9E A;  3S4L A;  2PAU A;  3KQ5 A;  2FLO A;  5AO4 A;  4TNZ A;  2PQ7 A;  4RXQ A;  3HI0 A;  4TNQ A;  4TO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...