3KQ5A

Crystal structure of an uncharacterized protein from coxiella burnetii
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
376
structure length
360
Chain Sequence
NQFYKPGMLVPVFSAAGLLKNGRYQFLLQQIETLSLLPTEQYAQLYEALVYRFVEFVQVLPIRLDEPLCSLMNEGLLRGVNSLNHYIQNHPEATPLERYALFSAGLLLEVAHAVVNQKIFITDEEGNFIKQWNPFSGPLIDDVETKHYKIMPLSSYYQRNIPSITPILVRQLLPDEGFLWLTSDMRVFSDWMQALRDDGRFEHVLQLFKHKNIDGLFNTLPALPVNLQDSPATAHADAFLNWLKEALATNQIKVNTSDAGVHVIPEGVFLEKTGIFKQYIDLHVNVPVNLFTVYQQFGNLFGLTKLSGIDYRFEQLFDALKRKSKMGFAGLSPTREGVLIADPNLIFTRGEIPSATYLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Coxiella burnetii
rcsb
source organism Coxiella burnetii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical cytosolic protein
total genus 118
structure length 360
sequence length 376
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.40 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 3kq5A01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 3kq5A02
2IPQX 3KQ5A
chains in the Genus database with same CATH superfamily
3SNBA 2QC2A 4ISHH 2BLWA 3ZVFA 1F0RA 1UCYK 3F0OA 4Z0KA 1CSOE 5EW2H 1ZMJA 1C2EA 1P2MA 4X8VH 1EP5A 1NFUA 5JBBS 3MU8A 1SKYE 1GI1A 1NM6A 4JMYA 5EPNA 1UTOA 2A7JA 1DXPA 3ZZ4A 5KECA 2FLBH 2W6JD 1YNBA 4X6MA 4UFDH 1QA7A 1C2LA 1TGSZ 4FOUC 5TJXA 1GHBF 1TYNA 4IMZA 4X9EA 1K1OA 3M7UA 1DPOA 1MQ6A 2W3IA 1GMHF 1O31A 1WTGH 2J94A 2P3FH 2BOHB 2TPIZ 2A7CA 6GCHF 1E1QD 4A92A 5DP9A 2BY5X 3RXKA 1C4Y2 3MYWA 1OYTH 2G4UA 1JWTA 1PPBH 1JOUB 1MQ5A 1KXCA 2AMQA 1BTHH 4GPGA 7GCHF 1XUGA 3FAOA 4GAWA 4JYVH 2WV4A 4MPXA 1EUFA 1EZSC 3G01A 3UNSA 2VINA 2VB0A 1W7XH 2FODA 1PPHE 3MH5A 4ZXYH 4ISLA 5AO4A 4X6NA 2Z3DA 1GCTB 2NWNA 5BRRE 1YPHE 1D3QB 1AE8H 4JZ1A 3GY6A 3PLPA 2EEKA 1ZJDA 2PGBB 1FAXA 3UFAA 1CBWC 4LOYH 1XX7A 5C0UA 2GCTB 1VITF 3BIUH 3Q76A 2Y81A 3GY5A 1BMMH 1SGNE 3SNCA 4CR5A 3GCTF 3LOXA 3MH6A 4FU8A 3ZZ3A 5DK1A 1GI0A 4P02A 1EPTB 4I8GA 3VEQB 4CRFA 1ABIH 3GICB 2R9PA 1ZMNA 3EE0B 2HNTF 1Z8GA 4NWLA 1AFQB 4X8UH 1CHGA 2PKAA 5IDKA 4B74A 1J8AA 4WF8A 1ZHRA 2J4IA 1OYQA 1AO5A 3M36A 5FAHA 2BD4A 2VGCC 2GMTC 3QDZB 1V2WT 5TK6A 2GKVE 3TMCA 1C2FA 1IQJA 2R2MB 4ZWEA 2F91A 1LHCH 5KGOA 1UTNA 9LPRA 1O5DH 2HALA 1ELGA 4YZUA 2ZP0H 1KY9A 1GGDB 2BVSH 1PQ5A 2G55A 5K0HA 1GJAB 3SU6A 3TK6A 4WMDA 3LPRA 3IG6B 1O2GH 5TK8A 1S6FA 2W6ID 1ZPCA 4D76A 4BAOB 2XBYA 8GCHF 1KYNA 1LPZB 2XC0A 3WWFA 2IJOB 1QCPA 2C8ZB 1GDUA 3SQHE 2RA3A 1CT4E 3LIWA 2ZTYA 3F9EA 1A4WH 4NZQA 1OSSA 1L1GA 1UTLM 4BTIB 1ZSJA 2KAIB 1P04A 1VCQA 2PTCE 3SU1A 1O3AA 3PTBA 1ZSLA 1FNIA 2HVXA 1MZAA 1V2PT 2ZEBA 5HM2A 3W94A 6GCHG 2M2AA 1LKAA 2P8OC 1P57B 3AVZA 4X2WA 1V2QT 2FX6A 1Z6EA 3M5NA 1S6HA 1SGPE 1MCVA 1FMGA 2XBXA 3BSQA 1T7CA 1V2LT 2ZECA 2F43B 3SV6A 1C2DA 4BZCA 2QV1A 5TK9A 1G3EA 1HJ9A 1TNIA 2SFAA 3SU0A 1GL1A 4N6WA 4GLYA 3TH4H 1RTKA 1DX5M 2VH0A 3MTYA 4I8LA 4NSVA 3S9AA 5DP6A 2YMSD 1C5OH 3VB7A 1C4U2 3QTOH 3SV2H 1BBRH 2XNDD 4TNPA 1QRXA 3S7KB 1D6WA 1TPAE 4BXSA 4X8TH 3SV8A 1QR3E 2G4TA 2UWLA 2O8MA 1LHDH 3GCHB 4ZHMU 3T26A 2D26C 1BZXE 5H4IB 1GBTA 3S7HB 1GMCG 2FMJA 2JETC 3ATKA 1JRTA 4CRDA 1ZHMA 1A5GH 5C0TA 1OPHB 2B7DH 4OS1A 2AEIH 1GI8B 2PP6A 1SQAA 1YPGH 2ANMH 1CT0E 2XCNA 1V2UT 2CF8H 1MTNB 1ID5H 1LHGH 1SHHB 3SJ9A 1IQKA 1H9LB 1BBRE 1HIAB 3I77A 1SBWA 1AB9B 4KGAA 4ZWGA 1DUEA 1P03A 1FPCH 1NU7B 2BLQA 3S0NA 1C5TA 3B23B 3KQ5A 4HFPB 1QY6A 3BTHE 3ZZ5A 1TOCB 3A82A 2UUKB 4QQYA 1L1NA 1TGCA 1QB1A 4IC6A 1BBRK 3SZNA 1P02A 1J15A 4AG1A 1L0ZA 1F5KU 4H6TA 3KQCA 2NU0E 4BAQB 4ZKRU 2B5TB 3OYPA 2GZ4A 1V2VT 4VGCC 3M7TA 1HGTH 2C8XB 3BTWE 4MZ7A 4AB8A 1VR1H 3P6ZB 2VH6A 4IN1A 1O3HA 3KF2A 1W11U 2AHME 1QL8A 3TH2H 3TITA 5F8XA 3KH1A 3P17H 1GVKB 4OGXA 8LPRA 3SNDA 1H9IE 1WV7H 3GY8A 4TY6A 4TYDA 2ILNA 1ZMLA 4Y8ZA 2BQWB 1GMCF 5FX6A 3SW2B 3SNEA 2JKHA 2F9UA 2PWXA 4GVUA 1ELCA 2XYAA 2BHGA 3HI0A 3PRDA 5HKKD 1GJ5H 2G5VA 1O2LA 1YCPK 1E34B 3E8LA 4GHQA 4AORA 1O5BB 1DFPA 2J98A 2BD3A 4OS2A 4YM9A 2O6IA 3VG8A 8GCHG 3STIA 1J14A 3U1JB 3IRHA 1UJ1A 1GI6A 1ACBE 5DP7A 3TJUA 2KFWA 1BQYA 1Z1IA 1ZYOA 2R3UA 4BNRA 2DUCA 3K6YA 1GDNA 3RXDA 3EYDA 4B75A 3GDSA 3F3BA 1LHFH 1UTPA 3U98H 4ACAA 5E2PA 3T28A 2V3OH 1ZJKA 2GVFA 3M37A 4CH2B 3ZZ8A 1HAIH 3N99A 1GGDC 1GHWH 2QE7D 1BDAA 1T31A 2PHBA 2XXLA 2OD3B 2BDHA 2ZO3H 4ZAEA 2FOCA 1AQ7A 5CHAC 2ZF0H 4R8ZA 3TM8A 1K1IA 2ZCKP 4OS7A 5F6MA 1LO6A 1GHAG 2W3KA 4Q2CA 4CRAA 5C17A 3BIVH 4CRBA 1HAZB 1OP0A 1UO6A 1ZRKA 1BTYA 1NTPA 1N6YA 3UB0A 3H5CB 1D3DB 3RXJA 1DLEA 1BJUA 3ZYEA 1P9SA 1OWIA 1TGBA 3E91A 3BEUA 3MFJA 5DG6A 4B6FA 4H4FA 3TK5A 1QRZA 2ODYB 4BZBA 2OGIA 3VB3A 4ZCNA 3QX5H 4Y8XA 4CHAB 5EG4A 2ZC9H 1TFXA 1GHXH 5ESTE 3RXSA 1TRMA 1NT1A 1A2CH 5DP3A 3A83A 4TT3D 4Y76A 1AGJA 3TH3H 2FOBA 5FL7D 3BTDE 1UCYE 3RXCA 1GI3A 4NIYA 2ZDKA 2ZPQA 1WDIA 4FUJA 3A7XA 2Q14A 1C1OA 1H8DH 4IS5A 3RXQA 1E36B 2B0FA 3T27A 1E1RD 1Y59T 1UVTH 1S5SA 3PO1B 1O5FH 3M1TA 4MLMA 1T8MA 2ZDMA 1LVBA 1AE5A 4DJZB 3PLBA 3OY6U 3ODDA 1BITA 3LGIA 1UW7A 2O8TA 1O0DH 3CCGA 2OP9A 2Q1JA 1A7SA 4ABDA 3EQ0H 1C5XB 1WAYB 3QWCH 4YLQH 5T6FA 4AYYB 4WVPE 2A2XH 1SOZA 3SI4H 4BTTB 1QL9A 2FXRA 5DSFA 2STBE 4DT7B 3DHKH 3A8AA 1TBZH 5E0GA 3ZIAD 4ABEA 1SPJA 2KCOA 1YCPM 5FPTA 4TWWA 5JYIA 3MO9A 2JH6D 1TNLA 2BZAA 1XM1A 1MTSA 1WUNH 1AB9C 1H9HE 2PKSB 2YNAA 1MMJN 1FY5A 1QL7A 1QA0A 3D62A 5A8XA 2SNVA 1TONA 4Q80A 3ZZBA 1O2MA 1W0JD 4XRNA 4DG4A 1LVOA 1O5EH 2CMYA 2VGCB 1TGNA 5TCAA 3UQOA 5LGOA 2KCAA 2WPIS 4Q63A 2P16A 2KR7A 1CE5A 1HXFH 1GHBG 4VGCB 3SK9A 4RKOB 1W0YH 1QB9A 5EOKA 2RFKC 2R2WU 3VB5A 3UOUA 2AMPA 4QT8C 2XBVA 1C2KA 1GI4A 1DSUA 2VIDA 7LPRA 2G51A 2QYIA 1O38A 2ANYA 2TGTA 1F0SA 3PYHA 1PPZA 3V0XA 3A8BA 3NRLA 1AUJA 4MDSA 4K8BA 5E8EH 2D2DA 2BVXH 2ZGJA 4NIVA 5A8YA 5EJ1A 1O2VA 3RXTA 1RJXB 2XOKD 1EAUA 4RT1A 1KTTB 1YPEH 3CS0A 3SNAA 1XKAC 2AS9A 2CV3A 2W7UA 1ZTJA 1QNJA 2WV9A 4FUBA 4TPYA 4CRCA 2TGPZ 1C2GA 1BMAA 2FEQH 4DT4A 5EW1H 2R3YA 4XFQA 2ZGHA 2W7SA 3LT3A 3SJ8A 3OE7D 2O08A 1A0JA 3VGCB 1F5LA 3A89A 1SB1H 1SFQB 4MVNA 3M7QA 2G52A 3A8DA 1DXWA 2KM0A 1C5ZB 2WHXA 1S0QA 3BF6H 2ZHQH 2IPQX 4B2BA 2RCEA 5DN6D 1P2OA 5EQRA 1HV7A 1TRYA 2VVVA 4ASUD 4MLFB 1G3DA 3SJOA 4AOQA 2PV9B 1SC8U 2ZHFH 1Y3VA 1AKSB 3LH3A 3RXGA 1SGDE 2XRCA 1XUFA 4IW4E 3V12A 4WH8A 3TK9A 2A4QA 5EXLA 1MU6B 3A81A 3MNBA 2K8IA 5C20A 2BMGB 2GP9B 2BQ6B 1TPSA 1ETSH 5JBCS 1IOEA 1MCTA 2OQUA 3NK8A 2FLOA 1OKXA 4YESB 2A5AA 4QQZA 1YYY1 4YT6H 1VITG 2J9NA 1ESTA 3GCHC 4RXQA 4MLNA 2O9QA 1YKTA 1P2KA 2FTLE 3OEED 4CH8B 4AX9H 5F53A 4H6SB 2Z9LA 4Y79A 5FCRA 3SN8A 3URCA 2BB4A 3DSGA 4ABFA 1DSTA 4XBCA 2YMSC 1F0UA 1TOMH 3RXBA 1K2I1 7GCHG 4I7YH 1GJDB 1V6DA 3IITA 4JZIA 4D9RA 1ZOMA 3LONA 1P10A 2QN5T 1RTFB 4NA7A 4E7NA 4GUXA 1IQEA 2FM2A 1Y3UA 2A1DB 1YC0A 2KAIA 4LXBH 3MO6A 3B8JA 2HPQH 5CMXH 1EJAA 2Y7ZA 2YNBA 4AYVB 4ACBA 1EAIA 1C1PA 1UVUH 2J2UA 1QJ6B 3EGKH 4INLA 2FWWA 2EI8A 4HI3A 2WPDD 4DIHH 1PPGE 2VIWA 1GVLA 1O2OA 2EC9H 3SUEA 5AF9H 2GX4A 5AHGH 1O3CA 3HPTB 1BRCE 2ZKSA 2CHAB 1UK2A 1E79D 3OX7U 3VXEH 2BDBA 1OWEA 3M3TA 1YPMH 4ABHA 1YWUA 1MABB 1V2RT 4LRLA 1V3XA 2Z6BD 3RDZA 3RM0H 1O2PA 2BDIA 5HMAA 4TO0A 1NU9A 4GSOA 3LU9B 5FPYA 5A0BA 5EQQA 1WBGB 1QFKH 1DITH 2JIZD 5C94A 1LHEH 2ZGXH 1J17T 3SKDA 2JJ1D 4Y71A 5JBAS 2R0KA 4ABGA 1Z6JH 1RRKA 1GMDG 5IK2D 1L4ZA 4DOQA 1GG6B 2GZ9A 3WY8A 2GV6A 3AW0A 1BIOA 1GBMA 4A5TS 3QO6A 4FETA 1BA8B 3EA8A 2FOMB 3OEHD 1GCTC 3A84A 4WH6A 3RXPA 1ZRBA 4ZMAH 3ATWA 4BAKB 1RD3B 4MPUA 1BJVA 1EX3A 2PGQB 3KHVA 2BX4A 3I29A 2P3TB 1SGIB 1AI8H 2VIPA 1QQUA 5KEDA 5EXMA 1C1RA 3TGJE 1DY9A 4NCYA 4DCDA 4NA8A 4MDZA 1EPTC 5F8ZA 2RG3A 4RXRA 1GWAA 1SGRE 4IN2A 1TMBH 1EZUC 2F9NA 5JBTA 1AFQC 4ME4A 3TLOA 1K1NA 1AVGH 4X1QU 2OC1A 1UK4A 3ZVBA 3LKWA 2ZQ1A 4Q2DA 5T6DA 3T5FH 1LTOA 3RXEA 1EASA 2GMTB 1W8BH 5EJZA 3W95A 4E7RG 1MKWH 3BTGE 4DMBA 5C5OA 2NU3E 1O3MA 1QHRB 2RDEA 1A5IA 2TRMA 4X8SH 4CHAC 3DFJA 3V3MA 3H7OA 3OTJE 4Y7BA 4MPVA 1A0HB 3F2GA 3P95A 5K7RA 1W2KH 3U28C 1NRQH 4ISIH 7ESTE 4CR9A 3KCGH 1EJMA 1KLTA 1SGFG 3MWIU 3E0NB 1WU1A 1AMHA 1SR5C 3AAVA 4YO9A 2GD4B 3FZZA 1V2KT 1AIXH 3P92A 2PFEA 1RS0A 2OQ5A 3O8CA 3QK1A 4XD7D 2Z9KA 1DVAH 3BTEE 3U8OH 3A86A 2BM2A 4QG0A 2EQNA 3STJA 3TPIZ 4ABAA 1XVOA 3MU0A 1FI8A 2OC8A 2XBWA 3BEFB 2AERH 2BLVA 1O5GH 2SGAA 1TQ7B 3U69H 3N7DA 1UVSH 1NO9H 1HAHH 2VWOA 1O3BA 2ZTZA 3A7WA 4Q7YA 1C9TA 1EFRD 3MZOA 1N8OC 4DURA 2VIQA 5DO4H 4GCHF 3UTUH 2HVYB 2F4LA 4J1YA 1ZLRA 1EZQA 1O32A 3KNXA 1H8ED 3UPEA 4XOJA 3K9XB 1HPGA 1GBCA 4ISNA 1FIZA 3GY4A 2FP7B 1SOTA 3Q3KA 1UHBB 2ZFQH 3S9BA 5C67A 1EAWA 1K21H 4ABIA 3PB1E 4M7GA 4FUHA 1C5QA 2AGGX 3F68H 4AB9A 2I6SA 1O3IA 1UK3A 1LQDB 4FUDA 2GV7A 1RFNA 4N71A 1AKSA 5HGGA 4D7GA 3MQKC 1ELDE 1SVPA 4K3JA 4QFYA 4X1SU 3RXLA 4BOHA 3RMMH 1WOFA 2OC7A 1K1LA 5TK7A 1DWEH 1PQAA 1TABE 4UD9H 2VWLA 1SLVB 2ZU5A 3SORA 2ZU1A 1DLKB 1M9UA 1ZZZA 1TMUH 1S81A 1U6QA 2WZQA 1VZQH 1Y5AT 3RU4T 3T62A 3RXRA 4XBDA 3QN7A 5EQSA 1KXAA 1G3BA 1GDQA 1TWXB 4DW2U 3PMAB 3V7TA 1K22H 3BTKE 2SGDE 4MNXA 1MBQA 4A6LA 3GS9A 2LP6A 4WWYA 3RLWH 4TO5A 1GBEA 1SLXB 1JXPA 2Q6DA 2Q6GA 1FUJA 3DSPA 3MH7A 3RUOA 2C3SA 1C5SA 4TNZA 1THPB 3CP7A 3GYLB 4NIWA 1TBQH 1HRTH 1Z1JA 3HGPA 4ZROA 2O8LA 1NRNH 4NGAH 1T4VH 3PRBA 1DT2A 1O2YA 3QZRA 4A7IB 3ZZAA 1ZGVA 1GG6C 1O5AB 3OSYA 3M5LA 4AFZA 3F9GA 1V2OT 5DPAA 3UOPA 4QFZA 1UVPA 5L30H 4YXWD 5HXFA 4I8HA 1LMWB 1U6ZA 1HYLA 1UHBA 3RXUA 3F9FA 4NZLA 1OWKA 2KCYA 1LQEA 3KGPA 5AO3A 3RXMA 1A3EH 2BY7X 3M3SA 1YGCH 1NRRH 1HAOH 3DSOA 1BRAA 2C93B 3PLKA 2HEKA 3FN8A 5L2ZH 5GNDA 1NRSH 1O2QA 3F6UH 4L7EA 1G9IE 1KLJH 1GHAF 1YP9A 2BDAA 1K28D 2ALPA 4B76A 3CS7A 4O3UA 2AIPA 5ABWA 2KX4A 3FANA 5HIZA 3MO3A 4LZ4B 3BTTE 4OS4A 3RXVA 4ZKOU 2WPHS 1MU8B 1P01A 1BTZA 3GOVB 1HAPH 1AZ8A 1FQ3A 2Z9GA 1PPCE 4JCNA 2JDID 3P8GA 3WWBA 4K1EA 5FBIA 5A0AE 4D8NA 4Y10E 5B6LA 4IMQA 2J98B 2CQZA 1SGTA 3UWJH 1TQ0B 1WTHD 4TO3A 1RIWB 1H8IH 3IWMA 1INCA 1HAVA 2FESH 2VIVA 1VQRA 2QXGA 3ZZDA 3GISB 3ZV8A 4A1XA 3D65E 1IHTH 1O5CB 1OX1A 1VJ9U 3HK3B 1UCYH 3RC6A 1C1WH 2O8WA 1FV9A 3PV4A 1IHSH 3HK6B 4Q4LA 3ZVEA 1DY8A 3FO8D 3UY9A 1DWDH 3P8FA 1COWD 1ZHPA 2VVUA 2CXVA 3TNTA 1IQLA 1ELBA 3N7OA 1HIAA 1FN8A 2A0QB 2ZHDA 1GI2A 2QCYA 4F4OC 1IQFA 3TNSA 1BT7A 5LPRA 4FXGH 4B1TA 1TX8A 3DFLA 2A4RA 2XWAA 3F1SB 1VGCC 4QFXA 4U01A 2A45B 3SU3A 1GBLA 1EB2A 5GIBA 1BMLA 2ANWA 1MH0A 1Y8TA 1O39A 5AVDA 1TRNA 2PUQH 3U8TH 4LK4A 1FAKH 3NXPA 1PYTD 1AN1E 1JBUH 2ZPRA 3BG4C 3LGWA 5I46H 1NY22 2J92A 4HGCA 1V2ST 1S83A 1TNJA 1DICA 2VBCA 5A8ZA 3TMBA 2EA3A 3UAIC 4IBLH 2A2QH 2XNIA 5L2YH 6CHAC 1ELFA 4F49A 1PPFE 1BRUP 2WUCA 1P05A 5HIYA 3PO1C 7KMEH 2Q6FA 3L33A 2J38A 1NFXA 1GBHA 5C1YA 3E16B 3OFND 3PWCA 3O8DA 5A09A 1CA0C 2XW9A 1Y5UT 3PMBB 3ZVAA 1O3FA 2BDCA 2Z94A 1LCYA 2HPPH 4ZHLU 3ATIA 3UQVA 1XUIA 3T25A 1JIMA 3OY5U 3LJJA 3ELAH 1TLDA 4FVBA 3KL6A 5DJ7A 2BZ6H 3K65B 1KLIH 1S84A 3MU1A 3ITIA 3P70B 3KEEA 3F2FA 3QGNB 1QIXB 2A4OA 3HATH 1F2SE 5CDFE 3BTQE 3CENA 1MD8A 1CGJE 3MNCA 1TGTA 4QQXA 2AMDA 1L1JA 2FOGA 2ZFPH 3PM3A 2K0QA 4U30A 2PKSC 3KQEA 3MHWU 3U1NA 1AWFH 2D1JA 1HBTH 4F55A 1P2NA 3E90B 2FS8A 4JK5A 1BMFD 3ZZCA 2DQBA 1ABJH 3FP8E 3P3QA 3EDXB 1SFIA 1KTSB 1ZPZA 1TNHA 4CREA 4CBOA 1V2JT 3RXAA 3TU7H 2ASUB 2FYRA 1IQGA 1D3PB 5T3HA 2ZU4A 1CQQA 4X1NU 5GJ4B 2W26A 2VIOA 4TO2A 3SGQE 5LH8A 4BTUB 3RMLH 1THSH 2CJIA 1SLUB 3FFGA 4CBNA 4X6OA 2B9LA 5AFYH 2ZGBH 1S85A 4B6EA 1BB0B 5HM9A 2P59A 2WPMS 2V35A 3TGIE 1ETRH 4PROA 1AVWA 5LPEA 1YLNA 3SQEE 2BXUH 4ZKNU 2ZPSA 1QB6A 1MKXH 1MAXA 2UWOA 2ZA5A 5CE1A 1Y3XA 5A0CA 3LC5A 4K8YA 1A61H 2PW8H 1S82A 1WQSA 3GCTG 5LPFA 2BY8X 3VGCC 3F0PA 1GHZA 1SHYA 1HFDA 3H7TA 3HKIB 4JYTA 2VWMA 2ZU3A 3NPSA 1W12U 2LELA 2UUJB 4B71A 3W1EA 4R0IA 4NG9H 1XX9A 3RXIA 4RXSA 1GJCB 1N8OB 2Z3EA 2BOKA 2TGAA 4ISOA 1C2HA 3LDXH 5ESBA 3M35A 1HJAC 3TJOA 3KIDU 1SI5H 1SGQE 1GVZA 1RIWC 2PSYA 1O2JA 5FXLA 1QJ1B 2ZCLP 2FOFA 4HTCH 4HG6A 4WJG2 4X0WU 1O2KA 1BOQA 1EATA 2SGQE 3PMHB 1WYKA 3PMJA 3FVFB 1O3KA 2Z9IA 1MD7A 1ELVA 1FZZA 3K2UA 3ATLA 1O2SA 1HB0B 1O34A 2XC4A 1T32A 1VCPA 5CHBA 2HWLB 4MNVA 1SMFE 2ZFTA 1W10U 1GBIA 2QAAA 1O3OA 1ZR0A 1NZQH 1TBRH 1G32B 2GGVB 3DT0H 5EPYA 1ELAA 4AGJA 4YOGA 2TBSA 1TB6H 3KQBA 2YMSB 4M9FA 1ANDA 1YLDA 1LKBA 2DE9A 1HAGE 1A3BH 1QURH 1SL3A 1YPLH 2CGAA 2PKAB 2UUFB 1EB1H 1F7ZA 3VB6A 2VWNA 2UWPA 2FO9A 4X1RU 4AZ2B 1MTUA 2PAQA 1JRSA 1P09A 3SGBE 4AG2A 1C5YB 1GBAA 1VJAU 1XMNB 1FY4A 3RMOH 4BAHB 1ZTLA 3KN2A 1C5PA 1GJ6A 3BG2A 1C1NA 2H9TH 3SUFA 1GI5A 3CNRA 1NROH 3FKSD 1KXDA 5FHTA 1O3DA 1P3CA 1T8LA 3MU4A 2GZ8A 5GCHG 3ZZ6A 4H42U 4NIXA 5JDUB 1CA0B 1BMNH 4E06H 1BCUH 3HC1A 3MNXA 3RF0A 5FPSA 1O35A 1Y5BT 1C5VA 2Y6TA 5FCKA 2QXHA 1ZTKA 2PUXB 2EI6A 2PQ7A 2H5DA 3GY3A 3OAAD 5E0JA 5EXNA 1NPMA 1W0KD 2OC0A 1FN6A 2FIRH 3GW7A 2THFB 3GY7A 3QZQA 1C4V2 1GPZA 2F3CE 3GDUA 4L1JB 4K1SA 3JZ1B 3A7TA 5BPEA 3ZVCA 1TX6A 4RT0A 3M3VA 1DANH 2M5TA 3DUXH 4LZ1H 4UFEH 2FI5E 2BVRH 4SGAE 2G5NA 5GPIB 4AFSA 2VU8E 3SV9A 4ESTE 1WSSH 2AH4X 3E3TA 3HKJB 1TNKA 1GBKA 4XBBA 5DP5A 1ELTA 1Y3WA 1W7GH 4DVAU 1ARBA 2STAE 1KIGH 1O2UA 3O8RA 5I25A 4XDSA 2FX4A 3QLPH 1NFYA 4KTSA 2CK3D 1P8VC 1O2IA 1EQ9A 3SO3A 2XCFA 1PFXC 4DIIH 4I8KA 3R0FA 4J2YB 2TIOA 2HLCA 3LGUA 2A4GA 4INHA 1P11E 2SGFE 1P9UA 4AGKA 1MTVA 2FOEA 4Z6AH 1MZDA 1TA2A 1DS2E 1IQNA 1OWHA 2J5UA 4OS6A 4X1PU 4KKDA 1YF4A 4Q7HA 5JPMH 4NA9H 1K9OE 1FY1A 4MCWA 1O2ZA 2B8OH 4UFFH 3UREA 2Z7FE 3RMNH 3U1IB 4RXOA 1O30A 1UVOA 1OXGA 3BN9A 1L2EA 2PGSA 1SQTA 1KXFA 1P2QA 1V2NT 1O2XA 5EODA 2ZCHP 2ZHWH 4Q7XA 2ESTE 1AWHB 1HJ8A 2C4FH 1BTWA 1TPOA 4DY7B 1P2IA 3BV9B 1T8NA 2ZDAH 4JZDH 2WUBA 1A5HA 2H5CA 3PV2A 4BAMB 1YPHC 4YOJA 2VJ1A 2Z3CA 4Y0YE 3RU4E 3RXFA 3T2NA 1QRWA 4D9QA 1G36A 3UR6A 3SGAE 1UTKA 2P95A 3GDVA 2IN2A 3URDA 2OBQA 1G3CA 2QF0A 4YLUA 4OGYA 2OINA 2OBOA 3HGNA 1GJ7B 1P3EA 2Y5GA 4XDEA 1FX0B 4JZEH 1G2MA 1VCWA 1E38B 1BRBE 2H6MA 1UTQA 4K1TA 5JB8S 1O2HA 3P8NA 4RI0A 1HLTH 3UNRA 3SU4A 1XKBC 3SOSA 5J4QA 1J16A 3NR1A 3RC5A 1TAWA 1VKYA 2F9PA 2QF5A 3FP7E 4RXPA 2F9BH 4FUGA 1E37B 1B0EA 1F0TA 4TY7A 1EZXC 4FU9A 4B2CA 2J34A 2V7QD 1H1BA 2ODPA 2YOLA 3FP6E 4IC5A 1C5LH 1SGEE 4NFEA 4O03A 5AFZH 2ZG0H 2BLOA 1H4WA 5GCHF 2Y5HA 4NWKA 5FBEA 2QF4A 4I31A 2QIQA 3U9AH 1TE0A 2W5EA 2O8UA 1MTNC 2ZFSA 1KMHB 4O9VA 5DP4A 2I6QA 1H8HD 1D4PB 1CVWH 2QGRA 1C2JA 2SGPE 1W14U 4ABJA 4UEHH 2G8TA 2H9HA 3BG8A 1GMHG 3SUGA 2G81E 4KTUA 4NSYA 3SU5A 2NU2E 3RM2H 2FOAA 4Y11E 1GI7B 3A8CA 3QGJA 1SSXA 4P00A 4K2YA 1B0FA 1O2NA 2HRVA 2PAUA 2RDLA 3QUMP 2EY4C 3C27B 4U2WA 2Z9JA 2ZHEH 2Y82A 1EKBB 4TWYA 4ABBA 1C1QA 1SGCA 4GHTA 1ESBA 1G30B 1GI9B 1XUKA 1TA6A 2WPKS 1K1JA 1C5RA 1O3NA 2FPZA 4B2AA 2JH5D 1T4UH 3LC3A 1MKWK 4TNYA 2NU4E 2WPJS 1O2RA 4TSFD 1K1MA 3RP2A 3LJOA 4ZH8A 1MBMA 1FY3A 3PV5A 2JJ2D 6ESTA 2C90B 2ZDNA 1C9PA 4JK6A 1CO7E 1XXFA 2ZQ2A 1Z71A 4QG4A 5AO1A 1O3PB 1IQIA 4I33A 2TGDA 2ULLA 3DA9B 4UE7H 1AD8H 2C8WB 2OTVA 2J95A 1QZ8A 1BTXA 1OWDA 3O8BA 2FDAA 4MQAA 3MEMA 2OXSA 3EAJA 1FIWA 3NUMA 2BY9X 5E2OA 5AO2A 1C1TA 4TNXA 2F83A 1Z8JB 4X2VA 3UIRA 1A0LA 3E6PH 3UUZA 4MPWA 3VFEA 4RSPA 3VB4A 5PTPA 1TNGA 3TVJB 4L7WA 1W0ZU 2GDDA 3P8OA 4KP0A 1XUHA 2QXJA 1XVMA 4K69A 1DWBH 4E05H 2WPLS 5JB9S 3FOAA 1PPEE 1AVXA 2FLRH 3SUDA 3TJVA 1NN6A 2ZU2A 3BEIB 5C1XA 4L1JA 1AUTC 1EP6A 1LVYA 2BD7A 1B5GH 1GHVH 3Q3YA 3F2HA 2C8YB 2HGTH 5B6OA 2JETB 3LGVA 1NC6A 2Y5FA 5TKAA 1WCZA 2ZNKH 2WINI 5GDSH 1ANCA 4HZHA 3SU2A 1W13U 2OLGA 2EI7A 5AO0A 1L4DA 5TCCA 3AK5A 1G37A 1AFEH 1F92A 3NQWA 2J97A 1C1MA 2ZTXA 1N6XA 2F9OA 3C1KA 3MU5A 1NFWA 5G4BA 4BXWA 1O36A 1TX7A 2Y7XA 1DUAA 4UONA 1S0RA 3VXFH 4JZFH 3GY2A 2FZZA 2QA9E 3B9FH 3L3TA 2GTBA 5L6NH 4AC9A 1HDTH 2WYJA 3AAUA 1DM4B 3DCLA 4TPIZ 2QY0B 3KQDA 2GJGA 3A7ZA 1QBOA 1O2WA 3LJXA 2CF9H 2DE8A 3T29A 1FXYA 3NWUA 1RXPA 1A46H 1X7AC 3A80A 3H09A 4ZHAA 2VNTA 5C2ZA 1GL0E 1QGFA 3GCOA 4Y6DA 2BD8A 3LGTA 3I78A 2JH0D 2BXTH 1XXDA 2UUYA 3N7EA 1PJPA 4WXIA 1Z8RA 5EGMA 1FJSA 1GMDF 2IPHA 2GCHF 2BYAX 4TNRA 2FOHA 1C5WB 3GCNA 2XC5A 3I7AA 4YT7H 4FUIA 1MKXK 4OS5A 3A88A 3BG4B 1WXRA 4UDWH 3ESTA 1O3EA 1SQRA 2V0BA 4RN6A 4WMEA 4TO1A 1YBWA 3UWIA 1SQOA 4INKA 1ZPBA 4QG1A 5J4SA 1K1PA 2HNTC 3FZDA 1OP8A 1S6LA 3SHAH 2FI4E 6CHAB 3S69A 2SNWA 1Q31A 3RXOA 9ESTA 1RTLA 1SG8B 1SGFA 1YLCA 2BD9A 4THNH 1K0HA 1CA8B 1YPJH 5EU8A 1ETTH 2G00A 1NESE 4I32A 1FLEE 3EE7A 1C1SA 1CT2E 2GCHG 1PYTC 1RGQA 4NFFA 3SHCH 1IAUA 2V6NA 2L74A 1KXEA 2OK5A 4WMFA 1ELEE 2FI3E 5ETXA 3Q3XA 1HUTH 1BUIA 1LDTT 2P94A 3AW1A 1GBBA 1KXBA 3GYMA 3S4LA 1DDJA 2A31A 1NBME 4A1VA 4XE4A 4I8JA 1HAYB 4Y7AA 1FPHH 1O33A 1C2IA 1LPKB 3RU4D 3EA7A 3MI4A 1LVMA 1PQ8A 1EXFA 3NZIA 1OWJA 2P3UB 1BTPA 4QQWA 1G2LA 1QJ7B 2QXIA 4U32A 4Y8YA 5SGAE 1IQMA 2ANKH 4B73A 5DGJA 1GBDA 2KCPA 2XTTB 1AZZA 3BTME 1AU8A 1QTFA 2GDEH 4SGBE 4BANB 3MMGA 1B7XB 1FDPA 1WQVH 3KYGA 4CRGA 1W3CA 1GBJA 4R8TB 1PQ7A 1NBMD 1V2TT 5EJLA 1FONA 2V3MA 2PR3A 3D23A 4QG2A 2GT8A 1BHXB 1V2MT 2GT7A 2IJD1 2ZGCA 4DGJA 5GXPA 2BTCE 2WYGA 3U8RH 4TNQA 4Y0ZE 5C5NA 2A32A 2D8WA 1ZSKA 2HNTE 1QBVH 3MNSA 1ESAA 2PLXA 3NCLA 2ALVA 1KDQA 3A7YA 3NKKA 3ZYDA 1EJNA 2PSXA 3VPKA 1C5UA 3SJKA 1P06A 4KTCA 5DP8A 1TALA 3UR9A 1D9IA 4MTBA 3L6PA 4ZUHA 2OUAA 1C1VH 2V3HH 2BDYA 2P8OB 4KELA 1VGCB 1DOJA 3EA9A 3RC4A 8ESTE 1GJ9B 1T8OA 1KSNA 4MNYA 1VITH 4FU7A 1XUJA 1Q2WA 2AGEX 1ANBA 4AFQA 3E1XB 1FY8E 1Y3YA 2WSSD 2RA0A 4TO6A 1GJ4H 4FUFA 2ZFRH 4K60A 2L6OA 4AFUA 1GHYH 1CGHA 1P12E 5FX5A 1F5RA 3M5MA 1J9CH 1O37A 2ZI2H 3ODFA 5F03A 1HAVB 1JIRA 2BY6X 2XWBI 1CU1A 3LGYA 1C5MD 2BQ7B 3A87A 1P2JA 1UMAH 2KZ4A 3OU0A 3R3GB 1SGYE 1D3TB 4X6PA 2FYQA 2H9EH 5DKMA 4ASHA 2ZWLH 4GCHG 1CBWB 2GCTC 1C5NH 1HCGA 4D7FA 1CGIE 2OCVB 2R0LA 2CHAC 1CHOG 3A7VA 3Q77A 5C1UA 1IQHA 1YCPH 4FUCA 1YPKH 3K6ZA 4Q7ZA 4A1TA 1O2TA 2P93A 2PARA 1MTWA 2HLDD 1EAXA 1OOKB 1OP2A 2K1QA 1GJBB 2VVCA 3KYFA 1DE7H 3SV7A 3A85A 3ENSB 2F9VA 4RKJB 1GBFA 2AFQB 2ZFFH 3MOCA 1ZGIA 1HXEH 5E0HA 4F48B 1KDQB 4IGDA 5HYOA 3ZVDA 3ATMA 1HAXB 4FVDA 5EIYA 1O3GA 2HOBA 3JZ2B 3ZZ9A 2ZDLA 1ARCA 1ORFA 3OTPA 2SGEE 3SI3H 4AN7A 1E35B 1YOYA 3SJIA 1EOJA 2LPRA 1A1RA 3TJNA 1CHOF 4I86A 2IOTA 2A5KA 1JMOH 1C1UH 4YTAA 1OHHD 1THRH 4MG3A 1Z7KA 2H2ZA 1QBNA 1TMTH 2A7HA 2H1UA 1ANEA 1LPGB 1Q3XA 3M61U 3PWBA 3TGKE 4XSKU 1TIOA 2AIQA 3E0PB 3TIUA 1TPPA 1QQ4A 3ZV9A 1OS8A 3QTVH 3F9HA 4Z1MD 2BX3A 2LNCA 4YOIA 1UTMA 2BDGA 3PROA 2ZZUH 3SZEA 3MH4A 3ZZ7A 3TMDA 2BD5A 2Y80A 2ZIQH 4O3TA 1AY6H 1DWCH 1MAYA 1MUEB 4FUEA 5A2MH 3ZVGA 2GZ7A 3RXHA 1GJ8B 4OM9A 1GCDA 2NU1E 6LPRA 1BTUA 2BD2A 3S9CA 4O97A 3PTNA 4JYUH 8KME2 5T6GA 5C3NA 3SYJA 2WV5A 4MNWA 1D6RA 4UFGH 4ZKSU 2PTNA 3DD2H 3Q00A 1P0SH 2QF3A 3SBKA 2FS9A 4X2YA 1EOLA 4K5ZA 4WY3A 2AYWA 2A5IA 5T1VA 1HJAB 5IYTA 1NRPH 1NS3A 4TO4A 3RLYH 1UTJA 1N1LA 5F8TA 3UNQA 3AASA 1VJ7A 1SLWB 3WW7A 1HNEE 4Q2KA 1C2MA 1YY3A 4WXVA 1E0FD 1YM0A 1O3JA 5GWZA 2CN0H 1BHXF 5CHAB 1Z8IB 1O3LA 3D49H 2FTMA 4ZXXH 4X2XA 1AHTH 3V13A 2AGIX 2ZDVH 3LH1A 3M5OA 3BTFE 2ODQA 1EPTA
chains in the Genus database with same CATH topology
4DMBA 4ZWGA 3LJXA 3KQ5A 2PARA 3BG2A 4TO5A 4TNYA 4QQYA 4BZBA 2OGIA 5TK8A 4TNZA 4QFXA 4QG2A 3HC1A 2GZ4A 3RF0A 4TNQA 4MZ7A 1YNBA 2O08A 2PQ7A 1YOYA 4QG4A 5AO1A 4X9EA 4TNRA 4QFZA 3KH1A 3I7AA 2Q14A 4LRLA 1U6ZA 2IPQX 3GW7A 3TMBA 3NR1A 3M1TA 4MLMA 4QG0A 4L1JB 5AO3A 4RXPA 3MEMA 4TO0A 4TO1A 4QG1A 4RXSA 3HI0A 5AO2A 4BZCA 4TNXA 5TK9A 3SKDA 2HEKA 3CCGA 3MZOA 4L7WA 4L7EA 5AO4A 4N6WA 2O6IA 3TMDA 3IRHA 2FLOA 4XDSA 1XX7A 4QQZA 4TNPA 4TO6A 4RXQA 4MLNA 4L1JA 5TKAA 4QQXA 4N71A 5AO0A 4QFYA 3U1NA 4MDZA 3S4LA 4TO4A 2CQZA 3NQWA 5TK7A 4RXRA 2PAUA 4TO3A 1VJ7A 2DQBA 1VQRA 3P3QA 4ME4A 4Q7HA 4R8ZA 5TK6A 3SK9A 3TM8A 3TMCA 4MCWA 4Q2CA 4ZWEA 4Q2DA 4TO2A 4RXOA 2PAQA 4QQWA 2PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPQ X;  3KQ5 A; 
#chains in the Genus database with same CATH topology
 3SNB A;  2QC2 A;  4ISH H;  2BLW A;  3ZVF A;  1F0R A;  1UCY K;  3F0O A;  4Z0K A;  1CSO E;  5EW2 H;  1ZMJ A;  1C2E A;  1P2M A;  4X8V H;  1EP5 A;  1NFU A;  5JBB S;  3MU8 A;  1SKY E;  1GI1 A;  1NM6 A;  4JMY A;  5EPN A;  1UTO A;  2A7J A;  1DXP A;  3ZZ4 A;  5KEC A;  2FLB H;  2W6J D;  1YNB A;  4X6M A;  4UFD H;  1QA7 A;  1C2L A;  1TGS Z;  4FOU C;  5TJX A;  1GHB F;  1TYN A;  4IMZ A;  4X9E A;  1K1O A;  3M7U A;  1DPO A;  1MQ6 A;  2W3I A;  1GMH F;  1O31 A;  1WTG H;  2J94 A;  2P3F H;  2BOH B;  2TPI Z;  2A7C A;  6GCH F;  1E1Q D;  4A92 A;  5DP9 A;  2BY5 X;  3RXK A;  1C4Y 2;  3MYW A;  1OYT H;  2G4U A;  1JWT A;  1PPB H;  1JOU B;  1MQ5 A;  1KXC A;  2AMQ A;  1BTH H;  4GPG A;  7GCH F;  1XUG A;  3FAO A;  4GAW A;  4JYV H;  2WV4 A;  4MPX A;  1EUF A;  1EZS C;  3G01 A;  3UNS A;  2VIN A;  2VB0 A;  1W7X H;  2FOD A;  1PPH E;  3MH5 A;  4ZXY H;  4ISL A;  5AO4 A;  4X6N A;  2Z3D A;  1GCT B;  2NWN A;  5BRR E;  1YPH E;  1D3Q B;  1AE8 H;  4JZ1 A;  3GY6 A;  3PLP A;  2EEK A;  1ZJD A;  2PGB B;  1FAX A;  3UFA A;  1CBW C;  4LOY H;  1XX7 A;  5C0U A;  2GCT B;  1VIT F;  3BIU H;  3Q76 A;  2Y81 A;  3GY5 A;  1BMM H;  1SGN E;  3SNC A;  4CR5 A;  3GCT F;  3LOX A;  3MH6 A;  4FU8 A;  3ZZ3 A;  5DK1 A;  1GI0 A;  4P02 A;  1EPT B;  4I8G A;  3VEQ B;  4CRF A;  1ABI H;  3GIC B;  2R9P A;  1ZMN A;  3EE0 B;  2HNT F;  1Z8G A;  4NWL A;  1AFQ B;  4X8U H;  1CHG A;  2PKA A;  5IDK A;  4B74 A;  1J8A A;  4WF8 A;  1ZHR A;  2J4I A;  1OYQ A;  1AO5 A;  3M36 A;  5FAH A;  2BD4 A;  2VGC C;  2GMT C;  3QDZ B;  1V2W T;  5TK6 A;  2GKV E;  3TMC A;  1C2F A;  1IQJ A;  2R2M B;  4ZWE A;  2F91 A;  1LHC H;  5KGO A;  1UTN A;  9LPR A;  1O5D H;  2HAL A;  1ELG A;  4YZU A;  2ZP0 H;  1KY9 A;  1GGD B;  2BVS H;  1PQ5 A;  2G55 A;  5K0H A;  1GJA B;  3SU6 A;  3TK6 A;  4WMD A;  3LPR A;  3IG6 B;  1O2G H;  5TK8 A;  1S6F A;  2W6I D;  1ZPC A;  4D76 A;  4BAO B;  2XBY A;  8GCH F;  1KYN A;  1LPZ B;  2XC0 A;  3WWF A;  2IJO B;  1QCP A;  2C8Z B;  1GDU A;  3SQH E;  2RA3 A;  1CT4 E;  3LIW A;  2ZTY A;  3F9E A;  1A4W H;  4NZQ A;  1OSS A;  1L1G A;  1UTL M;  4BTI B;  1ZSJ A;  2KAI B;  1P04 A;  1VCQ A;  2PTC E;  3SU1 A;  1O3A A;  3PTB A;  1ZSL A;  1FNI A;  2HVX A;  1MZA A;  1V2P T;  2ZEB A;  5HM2 A;  3W94 A;  6GCH G;  2M2A A;  1LKA A;  2P8O C;  1P57 B;  3AVZ A;  4X2W A;  1V2Q T;  2FX6 A;  1Z6E A;  3M5N A;  1S6H A;  1SGP E;  1MCV A;  1FMG A;  2XBX A;  3BSQ A;  1T7C A;  1V2L T;  2ZEC A;  2F43 B;  3SV6 A;  1C2D A;  4BZC A;  2QV1 A;  5TK9 A;  1G3E A;  1HJ9 A;  1TNI A;  2SFA A;  3SU0 A;  1GL1 A;  4N6W A;  4GLY A;  3TH4 H;  1RTK A;  1DX5 M;  2VH0 A;  3MTY A;  4I8L A;  4NSV A;  3S9A A;  5DP6 A;  2YMS D;  1C5O H;  3VB7 A;  1C4U 2;  3QTO H;  3SV2 H;  1BBR H;  2XND D;  4TNP A;  1QRX A;  3S7K B;  1D6W A;  1TPA E;  4BXS A;  4X8T H;  3SV8 A;  1QR3 E;  2G4T A;  2UWL A;  2O8M A;  1LHD H;  3GCH B;  4ZHM U;  3T26 A;  2D26 C;  1BZX E;  5H4I B;  1GBT A;  3S7H B;  1GMC G;  2FMJ A;  2JET C;  3ATK A;  1JRT A;  4CRD A;  1ZHM A;  1A5G H;  5C0T A;  1OPH B;  2B7D H;  4OS1 A;  2AEI H;  1GI8 B;  2PP6 A;  1SQA A;  1YPG H;  2ANM H;  1CT0 E;  2XCN A;  1V2U T;  2CF8 H;  1MTN B;  1ID5 H;  1LHG H;  1SHH B;  3SJ9 A;  1IQK A;  1H9L B;  1BBR E;  1HIA B;  3I77 A;  1SBW A;  1AB9 B;  4KGA A;  4ZWG A;  1DUE A;  1P03 A;  1FPC H;  1NU7 B;  2BLQ A;  3S0N A;  1C5T A;  3B23 B;  3KQ5 A;  4HFP B;  1QY6 A;  3BTH E;  3ZZ5 A;  1TOC B;  3A82 A;  2UUK B;  4QQY A;  1L1N A;  1TGC A;  1QB1 A;  4IC6 A;  1BBR K;  3SZN A;  1P02 A;  1J15 A;  4AG1 A;  1L0Z A;  1F5K U;  4H6T A;  3KQC A;  2NU0 E;  4BAQ B;  4ZKR U;  2B5T B;  3OYP A;  2GZ4 A;  1V2V T;  4VGC C;  3M7T A;  1HGT H;  2C8X B;  3BTW E;  4MZ7 A;  4AB8 A;  1VR1 H;  3P6Z B;  2VH6 A;  4IN1 A;  1O3H A;  3KF2 A;  1W11 U;  2AHM E;  1QL8 A;  3TH2 H;  3TIT A;  5F8X A;  3KH1 A;  3P17 H;  1GVK B;  4OGX A;  8LPR A;  3SND A;  1H9I E;  1WV7 H;  3GY8 A;  4TY6 A;  4TYD A;  2ILN A;  1ZML A;  4Y8Z A;  2BQW B;  1GMC F;  5FX6 A;  3SW2 B;  3SNE A;  2JKH A;  2F9U A;  2PWX A;  4GVU A;  1ELC A;  2XYA A;  2BHG A;  3HI0 A;  3PRD A;  5HKK D;  1GJ5 H;  2G5V A;  1O2L A;  1YCP K;  1E34 B;  3E8L A;  4GHQ A;  4AOR A;  1O5B B;  1DFP A;  2J98 A;  2BD3 A;  4OS2 A;  4YM9 A;  2O6I A;  3VG8 A;  8GCH G;  3STI A;  1J14 A;  3U1J B;  3IRH A;  1UJ1 A;  1GI6 A;  1ACB E;  5DP7 A;  3TJU A;  2KFW A;  1BQY A;  1Z1I A;  1ZYO A;  2R3U A;  4BNR A;  2DUC A;  3K6Y A;  1GDN A;  3RXD A;  3EYD A;  4B75 A;  3GDS A;  3F3B A;  1LHF H;  1UTP A;  3U98 H;  4ACA A;  5E2P A;  3T28 A;  2V3O H;  1ZJK A;  2GVF A;  3M37 A;  4CH2 B;  3ZZ8 A;  1HAI H;  3N99 A;  1GGD C;  1GHW H;  2QE7 D;  1BDA A;  1T31 A;  2PHB A;  2XXL A;  2OD3 B;  2BDH A;  2ZO3 H;  4ZAE A;  2FOC A;  1AQ7 A;  5CHA C;  2ZF0 H;  4R8Z A;  3TM8 A;  1K1I A;  2ZCK P;  4OS7 A;  5F6M A;  1LO6 A;  1GHA G;  2W3K A;  4Q2C A;  4CRA A;  5C17 A;  3BIV H;  4CRB A;  1HAZ B;  1OP0 A;  1UO6 A;  1ZRK A;  1BTY A;  1NTP A;  1N6Y A;  3UB0 A;  3H5C B;  1D3D B;  3RXJ A;  1DLE A;  1BJU A;  3ZYE A;  1P9S A;  1OWI A;  1TGB A;  3E91 A;  3BEU A;  3MFJ A;  5DG6 A;  4B6F A;  4H4F A;  3TK5 A;  1QRZ A;  2ODY B;  4BZB A;  2OGI A;  3VB3 A;  4ZCN A;  3QX5 H;  4Y8X A;  4CHA B;  5EG4 A;  2ZC9 H;  1TFX A;  1GHX H;  5EST E;  3RXS A;  1TRM A;  1NT1 A;  1A2C H;  5DP3 A;  3A83 A;  4TT3 D;  4Y76 A;  1AGJ A;  3TH3 H;  2FOB A;  5FL7 D;  3BTD E;  1UCY E;  3RXC A;  1GI3 A;  4NIY A;  2ZDK A;  2ZPQ A;  1WDI A;  4FUJ A;  3A7X A;  2Q14 A;  1C1O A;  1H8D H;  4IS5 A;  3RXQ A;  1E36 B;  2B0F A;  3T27 A;  1E1R D;  1Y59 T;  1UVT H;  1S5S A;  3PO1 B;  1O5F H;  3M1T A;  4MLM A;  1T8M A;  2ZDM A;  1LVB A;  1AE5 A;  4DJZ B;  3PLB A;  3OY6 U;  3ODD A;  1BIT A;  3LGI A;  1UW7 A;  2O8T A;  1O0D H;  3CCG A;  2OP9 A;  2Q1J A;  1A7S A;  4ABD A;  3EQ0 H;  1C5X B;  1WAY B;  3QWC H;  4YLQ H;  5T6F A;  4AYY B;  4WVP E;  2A2X H;  1SOZ A;  3SI4 H;  4BTT B;  1QL9 A;  2FXR A;  5DSF A;  2STB E;  4DT7 B;  3DHK H;  3A8A A;  1TBZ H;  5E0G A;  3ZIA D;  4ABE A;  1SPJ A;  2KCO A;  1YCP M;  5FPT A;  4TWW A;  5JYI A;  3MO9 A;  2JH6 D;  1TNL A;  2BZA A;  1XM1 A;  1MTS A;  1WUN H;  1AB9 C;  1H9H E;  2PKS B;  2YNA A;  1MMJ N;  1FY5 A;  1QL7 A;  1QA0 A;  3D62 A;  5A8X A;  2SNV A;  1TON A;  4Q80 A;  3ZZB A;  1O2M A;  1W0J D;  4XRN A;  4DG4 A;  1LVO A;  1O5E H;  2CMY A;  2VGC B;  1TGN A;  5TCA A;  3UQO A;  5LGO A;  2KCA A;  2WPI S;  4Q63 A;  2P16 A;  2KR7 A;  1CE5 A;  1HXF H;  1GHB G;  4VGC B;  3SK9 A;  4RKO B;  1W0Y H;  1QB9 A;  5EOK A;  2RFK C;  2R2W U;  3VB5 A;  3UOU A;  2AMP A;  4QT8 C;  2XBV A;  1C2K A;  1GI4 A;  1DSU A;  2VID A;  7LPR A;  2G51 A;  2QYI A;  1O38 A;  2ANY A;  2TGT A;  1F0S A;  3PYH A;  1PPZ A;  3V0X A;  3A8B A;  3NRL A;  1AUJ A;  4MDS A;  4K8B A;  5E8E H;  2D2D A;  2BVX H;  2ZGJ A;  4NIV A;  5A8Y A;  5EJ1 A;  1O2V A;  3RXT A;  1RJX B;  2XOK D;  1EAU A;  4RT1 A;  1KTT B;  1YPE H;  3CS0 A;  3SNA A;  1XKA C;  2AS9 A;  2CV3 A;  2W7U A;  1ZTJ A;  1QNJ A;  2WV9 A;  4FUB A;  4TPY A;  4CRC A;  2TGP Z;  1C2G A;  1BMA A;  2FEQ H;  4DT4 A;  5EW1 H;  2R3Y A;  4XFQ A;  2ZGH A;  2W7S A;  3LT3 A;  3SJ8 A;  3OE7 D;  2O08 A;  1A0J A;  3VGC B;  1F5L A;  3A89 A;  1SB1 H;  1SFQ B;  4MVN A;  3M7Q A;  2G52 A;  3A8D A;  1DXW A;  2KM0 A;  1C5Z B;  2WHX A;  1S0Q A;  3BF6 H;  2ZHQ H;  2IPQ X;  4B2B A;  2RCE A;  5DN6 D;  1P2O A;  5EQR A;  1HV7 A;  1TRY A;  2VVV A;  4ASU D;  4MLF B;  1G3D A;  3SJO A;  4AOQ A;  2PV9 B;  1SC8 U;  2ZHF H;  1Y3V A;  1AKS B;  3LH3 A;  3RXG A;  1SGD E;  2XRC A;  1XUF A;  4IW4 E;  3V12 A;  4WH8 A;  3TK9 A;  2A4Q A;  5EXL A;  1MU6 B;  3A81 A;  3MNB A;  2K8I A;  5C20 A;  2BMG B;  2GP9 B;  2BQ6 B;  1TPS A;  1ETS H;  5JBC S;  1IOE A;  1MCT A;  2OQU A;  3NK8 A;  2FLO A;  1OKX A;  4YES B;  2A5A A;  4QQZ A;  1YYY 1;  4YT6 H;  1VIT G;  2J9N A;  1EST A;  3GCH C;  4RXQ A;  4MLN A;  2O9Q A;  1YKT A;  1P2K A;  2FTL E;  3OEE D;  4CH8 B;  4AX9 H;  5F53 A;  4H6S B;  2Z9L A;  4Y79 A;  5FCR A;  3SN8 A;  3URC A;  2BB4 A;  3DSG A;  4ABF A;  1DST A;  4XBC A;  2YMS C;  1F0U A;  1TOM H;  3RXB A;  1K2I 1;  7GCH G;  4I7Y H;  1GJD B;  1V6D A;  3IIT A;  4JZI A;  4D9R A;  1ZOM A;  3LON A;  1P10 A;  2QN5 T;  1RTF B;  4NA7 A;  4E7N A;  4GUX A;  1IQE A;  2FM2 A;  1Y3U A;  2A1D B;  1YC0 A;  2KAI A;  4LXB H;  3MO6 A;  3B8J A;  2HPQ H;  5CMX H;  1EJA A;  2Y7Z A;  2YNB A;  4AYV B;  4ACB A;  1EAI A;  1C1P A;  1UVU H;  2J2U A;  1QJ6 B;  3EGK H;  4INL A;  2FWW A;  2EI8 A;  4HI3 A;  2WPD D;  4DIH H;  1PPG E;  2VIW A;  1GVL A;  1O2O A;  2EC9 H;  3SUE A;  5AF9 H;  2GX4 A;  5AHG H;  1O3C A;  3HPT B;  1BRC E;  2ZKS A;  2CHA B;  1UK2 A;  1E79 D;  3OX7 U;  3VXE H;  2BDB A;  1OWE A;  3M3T A;  1YPM H;  4ABH A;  1YWU A;  1MAB B;  1V2R T;  4LRL A;  1V3X A;  2Z6B D;  3RDZ A;  3RM0 H;  1O2P A;  2BDI A;  5HMA A;  4TO0 A;  1NU9 A;  4GSO A;  3LU9 B;  5FPY A;  5A0B A;  5EQQ A;  1WBG B;  1QFK H;  1DIT H;  2JIZ D;  5C94 A;  1LHE H;  2ZGX H;  1J17 T;  3SKD A;  2JJ1 D;  4Y71 A;  5JBA S;  2R0K A;  4ABG A;  1Z6J H;  1RRK A;  1GMD G;  5IK2 D;  1L4Z A;  4DOQ A;  1GG6 B;  2GZ9 A;  3WY8 A;  2GV6 A;  3AW0 A;  1BIO A;  1GBM A;  4A5T S;  3QO6 A;  4FET A;  1BA8 B;  3EA8 A;  2FOM B;  3OEH D;  1GCT C;  3A84 A;  4WH6 A;  3RXP A;  1ZRB A;  4ZMA H;  3ATW A;  4BAK B;  1RD3 B;  4MPU A;  1BJV A;  1EX3 A;  2PGQ B;  3KHV A;  2BX4 A;  3I29 A;  2P3T B;  1SGI B;  1AI8 H;  2VIP A;  1QQU A;  5KED A;  5EXM A;  1C1R A;  3TGJ E;  1DY9 A;  4NCY A;  4DCD A;  4NA8 A;  4MDZ A;  1EPT C;  5F8Z A;  2RG3 A;  4RXR A;  1GWA A;  1SGR E;  4IN2 A;  1TMB H;  1EZU C;  2F9N A;  5JBT A;  1AFQ C;  4ME4 A;  3TLO A;  1K1N A;  1AVG H;  4X1Q U;  2OC1 A;  1UK4 A;  3ZVB A;  3LKW A;  2ZQ1 A;  4Q2D A;  5T6D A;  3T5F H;  1LTO A;  3RXE A;  1EAS A;  2GMT B;  1W8B H;  5EJZ A;  3W95 A;  4E7R G;  1MKW H;  3BTG E;  4DMB A;  5C5O A;  2NU3 E;  1O3M A;  1QHR B;  2RDE A;  1A5I A;  2TRM A;  4X8S H;  4CHA C;  3DFJ A;  3V3M A;  3H7O A;  3OTJ E;  4Y7B A;  4MPV A;  1A0H B;  3F2G A;  3P95 A;  5K7R A;  1W2K H;  3U28 C;  1NRQ H;  4ISI H;  7EST E;  4CR9 A;  3KCG H;  1EJM A;  1KLT A;  1SGF G;  3MWI U;  3E0N B;  1WU1 A;  1AMH A;  1SR5 C;  3AAV A;  4YO9 A;  2GD4 B;  3FZZ A;  1V2K T;  1AIX H;  3P92 A;  2PFE A;  1RS0 A;  2OQ5 A;  3O8C A;  3QK1 A;  4XD7 D;  2Z9K A;  1DVA H;  3BTE E;  3U8O H;  3A86 A;  2BM2 A;  4QG0 A;  2EQN A;  3STJ A;  3TPI Z;  4ABA A;  1XVO A;  3MU0 A;  1FI8 A;  2OC8 A;  2XBW A;  3BEF B;  2AER H;  2BLV A;  1O5G H;  2SGA A;  1TQ7 B;  3U69 H;  3N7D A;  1UVS H;  1NO9 H;  1HAH H;  2VWO A;  1O3B A;  2ZTZ A;  3A7W A;  4Q7Y A;  1C9T A;  1EFR D;  3MZO A;  1N8O C;  4DUR A;  2VIQ A;  5DO4 H;  4GCH F;  3UTU H;  2HVY B;  2F4L A;  4J1Y A;  1ZLR A;  1EZQ A;  1O32 A;  3KNX A;  1H8E D;  3UPE A;  4XOJ A;  3K9X B;  1HPG A;  1GBC A;  4ISN A;  1FIZ A;  3GY4 A;  2FP7 B;  1SOT A;  3Q3K A;  1UHB B;  2ZFQ H;  3S9B A;  5C67 A;  1EAW A;  1K21 H;  4ABI A;  3PB1 E;  4M7G A;  4FUH A;  1C5Q A;  2AGG X;  3F68 H;  4AB9 A;  2I6S A;  1O3I A;  1UK3 A;  1LQD B;  4FUD A;  2GV7 A;  1RFN A;  4N71 A;  1AKS A;  5HGG A;  4D7G A;  3MQK C;  1ELD E;  1SVP A;  4K3J A;  4QFY A;  4X1S U;  3RXL A;  4BOH A;  3RMM H;  1WOF A;  2OC7 A;  1K1L A;  5TK7 A;  1DWE H;  1PQA A;  1TAB E;  4UD9 H;  2VWL A;  1SLV B;  2ZU5 A;  3SOR A;  2ZU1 A;  1DLK B;  1M9U A;  1ZZZ A;  1TMU H;  1S81 A;  1U6Q A;  2WZQ A;  1VZQ H;  1Y5A T;  3RU4 T;  3T62 A;  3RXR A;  4XBD A;  3QN7 A;  5EQS A;  1KXA A;  1G3B A;  1GDQ A;  1TWX B;  4DW2 U;  3PMA B;  3V7T A;  1K22 H;  3BTK E;  2SGD E;  4MNX A;  1MBQ A;  4A6L A;  3GS9 A;  2LP6 A;  4WWY A;  3RLW H;  4TO5 A;  1GBE A;  1SLX B;  1JXP A;  2Q6D A;  2Q6G A;  1FUJ A;  3DSP A;  3MH7 A;  3RUO A;  2C3S A;  1C5S A;  4TNZ A;  1THP B;  3CP7 A;  3GYL B;  4NIW A;  1TBQ H;  1HRT H;  1Z1J A;  3HGP A;  4ZRO A;  2O8L A;  1NRN H;  4NGA H;  1T4V H;  3PRB A;  1DT2 A;  1O2Y A;  3QZR A;  4A7I B;  3ZZA A;  1ZGV A;  1GG6 C;  1O5A B;  3OSY A;  3M5L A;  4AFZ A;  3F9G A;  1V2O T;  5DPA A;  3UOP A;  4QFZ A;  1UVP A;  5L30 H;  4YXW D;  5HXF A;  4I8H A;  1LMW B;  1U6Z A;  1HYL A;  1UHB A;  3RXU A;  3F9F A;  4NZL A;  1OWK A;  2KCY A;  1LQE A;  3KGP A;  5AO3 A;  3RXM A;  1A3E H;  2BY7 X;  3M3S A;  1YGC H;  1NRR H;  1HAO H;  3DSO A;  1BRA A;  2C93 B;  3PLK A;  2HEK A;  3FN8 A;  5L2Z H;  5GND A;  1NRS H;  1O2Q A;  3F6U H;  4L7E A;  1G9I E;  1KLJ H;  1GHA F;  1YP9 A;  2BDA A;  1K28 D;  2ALP A;  4B76 A;  3CS7 A;  4O3U A;  2AIP A;  5ABW A;  2KX4 A;  3FAN A;  5HIZ A;  3MO3 A;  4LZ4 B;  3BTT E;  4OS4 A;  3RXV A;  4ZKO U;  2WPH S;  1MU8 B;  1P01 A;  1BTZ A;  3GOV B;  1HAP H;  1AZ8 A;  1FQ3 A;  2Z9G A;  1PPC E;  4JCN A;  2JDI D;  3P8G A;  3WWB A;  4K1E A;  5FBI A;  5A0A E;  4D8N A;  4Y10 E;  5B6L A;  4IMQ A;  2J98 B;  2CQZ A;  1SGT A;  3UWJ H;  1TQ0 B;  1WTH D;  4TO3 A;  1RIW B;  1H8I H;  3IWM A;  1INC A;  1HAV A;  2FES H;  2VIV A;  1VQR A;  2QXG A;  3ZZD A;  3GIS B;  3ZV8 A;  4A1X A;  3D65 E;  1IHT H;  1O5C B;  1OX1 A;  1VJ9 U;  3HK3 B;  1UCY H;  3RC6 A;  1C1W H;  2O8W A;  1FV9 A;  3PV4 A;  1IHS H;  3HK6 B;  4Q4L A;  3ZVE A;  1DY8 A;  3FO8 D;  3UY9 A;  1DWD H;  3P8F A;  1COW D;  1ZHP A;  2VVU A;  2CXV A;  3TNT A;  1IQL A;  1ELB A;  3N7O A;  1HIA A;  1FN8 A;  2A0Q B;  2ZHD A;  1GI2 A;  2QCY A;  4F4O C;  1IQF A;  3TNS A;  1BT7 A;  5LPR A;  4FXG H;  4B1T A;  1TX8 A;  3DFL A;  2A4R A;  2XWA A;  3F1S B;  1VGC C;  4QFX A;  4U01 A;  2A45 B;  3SU3 A;  1GBL A;  1EB2 A;  5GIB A;  1BML A;  2ANW A;  1MH0 A;  1Y8T A;  1O39 A;  5AVD A;  1TRN A;  2PUQ H;  3U8T H;  4LK4 A;  1FAK H;  3NXP A;  1PYT D;  1AN1 E;  1JBU H;  2ZPR A;  3BG4 C;  3LGW A;  5I46 H;  1NY2 2;  2J92 A;  4HGC A;  1V2S T;  1S83 A;  1TNJ A;  1DIC A;  2VBC A;  5A8Z A;  3TMB A;  2EA3 A;  3UAI C;  4IBL H;  2A2Q H;  2XNI A;  5L2Y H;  6CHA C;  1ELF A;  4F49 A;  1PPF E;  1BRU P;  2WUC A;  1P05 A;  5HIY A;  3PO1 C;  7KME H;  2Q6F A;  3L33 A;  2J38 A;  1NFX A;  1GBH A;  5C1Y A;  3E16 B;  3OFN D;  3PWC A;  3O8D A;  5A09 A;  1CA0 C;  2XW9 A;  1Y5U T;  3PMB B;  3ZVA A;  1O3F A;  2BDC A;  2Z94 A;  1LCY A;  2HPP H;  4ZHL U;  3ATI A;  3UQV A;  1XUI A;  3T25 A;  1JIM A;  3OY5 U;  3LJJ A;  3ELA H;  1TLD A;  4FVB A;  3KL6 A;  5DJ7 A;  2BZ6 H;  3K65 B;  1KLI H;  1S84 A;  3MU1 A;  3ITI A;  3P70 B;  3KEE A;  3F2F A;  3QGN B;  1QIX B;  2A4O A;  3HAT H;  1F2S E;  5CDF E;  3BTQ E;  3CEN A;  1MD8 A;  1CGJ E;  3MNC A;  1TGT A;  4QQX A;  2AMD A;  1L1J A;  2FOG A;  2ZFP H;  3PM3 A;  2K0Q A;  4U30 A;  2PKS C;  3KQE A;  3MHW U;  3U1N A;  1AWF H;  2D1J A;  1HBT H;  4F55 A;  1P2N A;  3E90 B;  2FS8 A;  4JK5 A;  1BMF D;  3ZZC A;  2DQB A;  1ABJ H;  3FP8 E;  3P3Q A;  3EDX B;  1SFI A;  1KTS B;  1ZPZ A;  1TNH A;  4CRE A;  4CBO A;  1V2J T;  3RXA A;  3TU7 H;  2ASU B;  2FYR A;  1IQG A;  1D3P B;  5T3H A;  2ZU4 A;  1CQQ A;  4X1N U;  5GJ4 B;  2W26 A;  2VIO A;  4TO2 A;  3SGQ E;  5LH8 A;  4BTU B;  3RML H;  1THS H;  2CJI A;  1SLU B;  3FFG A;  4CBN A;  4X6O A;  2B9L A;  5AFY H;  2ZGB H;  1S85 A;  4B6E A;  1BB0 B;  5HM9 A;  2P59 A;  2WPM S;  2V35 A;  3TGI E;  1ETR H;  4PRO A;  1AVW A;  5LPE A;  1YLN A;  3SQE E;  2BXU H;  4ZKN U;  2ZPS A;  1QB6 A;  1MKX H;  1MAX A;  2UWO A;  2ZA5 A;  5CE1 A;  1Y3X A;  5A0C A;  3LC5 A;  4K8Y A;  1A61 H;  2PW8 H;  1S82 A;  1WQS A;  3GCT G;  5LPF A;  2BY8 X;  3VGC C;  3F0P A;  1GHZ A;  1SHY A;  1HFD A;  3H7T A;  3HKI B;  4JYT A;  2VWM A;  2ZU3 A;  3NPS A;  1W12 U;  2LEL A;  2UUJ B;  4B71 A;  3W1E A;  4R0I A;  4NG9 H;  1XX9 A;  3RXI A;  4RXS A;  1GJC B;  1N8O B;  2Z3E A;  2BOK A;  2TGA A;  4ISO A;  1C2H A;  3LDX H;  5ESB A;  3M35 A;  1HJA C;  3TJO A;  3KID U;  1SI5 H;  1SGQ E;  1GVZ A;  1RIW C;  2PSY A;  1O2J A;  5FXL A;  1QJ1 B;  2ZCL P;  2FOF A;  4HTC H;  4HG6 A;  4WJG 2;  4X0W U;  1O2K A;  1BOQ A;  1EAT A;  2SGQ E;  3PMH B;  1WYK A;  3PMJ A;  3FVF B;  1O3K A;  2Z9I A;  1MD7 A;  1ELV A;  1FZZ A;  3K2U A;  3ATL A;  1O2S A;  1HB0 B;  1O34 A;  2XC4 A;  1T32 A;  1VCP A;  5CHB A;  2HWL B;  4MNV A;  1SMF E;  2ZFT A;  1W10 U;  1GBI A;  2QAA A;  1O3O A;  1ZR0 A;  1NZQ H;  1TBR H;  1G32 B;  2GGV B;  3DT0 H;  5EPY A;  1ELA A;  4AGJ A;  4YOG A;  2TBS A;  1TB6 H;  3KQB A;  2YMS B;  4M9F A;  1AND A;  1YLD A;  1LKB A;  2DE9 A;  1HAG E;  1A3B H;  1QUR H;  1SL3 A;  1YPL H;  2CGA A;  2PKA B;  2UUF B;  1EB1 H;  1F7Z A;  3VB6 A;  2VWN A;  2UWP A;  2FO9 A;  4X1R U;  4AZ2 B;  1MTU A;  2PAQ A;  1JRS A;  1P09 A;  3SGB E;  4AG2 A;  1C5Y B;  1GBA A;  1VJA U;  1XMN B;  1FY4 A;  3RMO H;  4BAH B;  1ZTL A;  3KN2 A;  1C5P A;  1GJ6 A;  3BG2 A;  1C1N A;  2H9T H;  3SUF A;  1GI5 A;  3CNR A;  1NRO H;  3FKS D;  1KXD A;  5FHT A;  1O3D A;  1P3C A;  1T8L A;  3MU4 A;  2GZ8 A;  5GCH G;  3ZZ6 A;  4H42 U;  4NIX A;  5JDU B;  1CA0 B;  1BMN H;  4E06 H;  1BCU H;  3HC1 A;  3MNX A;  3RF0 A;  5FPS A;  1O35 A;  1Y5B T;  1C5V A;  2Y6T A;  5FCK A;  2QXH A;  1ZTK A;  2PUX B;  2EI6 A;  2PQ7 A;  2H5D A;  3GY3 A;  3OAA D;  5E0J A;  5EXN A;  1NPM A;  1W0K D;  2OC0 A;  1FN6 A;  2FIR H;  3GW7 A;  2THF B;  3GY7 A;  3QZQ A;  1C4V 2;  1GPZ A;  2F3C E;  3GDU A;  4L1J B;  4K1S A;  3JZ1 B;  3A7T A;  5BPE A;  3ZVC A;  1TX6 A;  4RT0 A;  3M3V A;  1DAN H;  2M5T A;  3DUX H;  4LZ1 H;  4UFE H;  2FI5 E;  2BVR H;  4SGA E;  2G5N A;  5GPI B;  4AFS A;  2VU8 E;  3SV9 A;  4EST E;  1WSS H;  2AH4 X;  3E3T A;  3HKJ B;  1TNK A;  1GBK A;  4XBB A;  5DP5 A;  1ELT A;  1Y3W A;  1W7G H;  4DVA U;  1ARB A;  2STA E;  1KIG H;  1O2U A;  3O8R A;  5I25 A;  4XDS A;  2FX4 A;  3QLP H;  1NFY A;  4KTS A;  2CK3 D;  1P8V C;  1O2I A;  1EQ9 A;  3SO3 A;  2XCF A;  1PFX C;  4DII H;  4I8K A;  3R0F A;  4J2Y B;  2TIO A;  2HLC A;  3LGU A;  2A4G A;  4INH A;  1P11 E;  2SGF E;  1P9U A;  4AGK A;  1MTV A;  2FOE A;  4Z6A H;  1MZD A;  1TA2 A;  1DS2 E;  1IQN A;  1OWH A;  2J5U A;  4OS6 A;  4X1P U;  4KKD A;  1YF4 A;  4Q7H A;  5JPM H;  4NA9 H;  1K9O E;  1FY1 A;  4MCW A;  1O2Z A;  2B8O H;  4UFF H;  3URE A;  2Z7F E;  3RMN H;  3U1I B;  4RXO A;  1O30 A;  1UVO A;  1OXG A;  3BN9 A;  1L2E A;  2PGS A;  1SQT A;  1KXF A;  1P2Q A;  1V2N T;  1O2X A;  5EOD A;  2ZCH P;  2ZHW H;  4Q7X A;  2EST E;  1AWH B;  1HJ8 A;  2C4F H;  1BTW A;  1TPO A;  4DY7 B;  1P2I A;  3BV9 B;  1T8N A;  2ZDA H;  4JZD H;  2WUB A;  1A5H A;  2H5C A;  3PV2 A;  4BAM B;  1YPH C;  4YOJ A;  2VJ1 A;  2Z3C A;  4Y0Y E;  3RU4 E;  3RXF A;  3T2N A;  1QRW A;  4D9Q A;  1G36 A;  3UR6 A;  3SGA E;  1UTK A;  2P95 A;  3GDV A;  2IN2 A;  3URD A;  2OBQ A;  1G3C A;  2QF0 A;  4YLU A;  4OGY A;  2OIN A;  2OBO A;  3HGN A;  1GJ7 B;  1P3E A;  2Y5G A;  4XDE A;  1FX0 B;  4JZE H;  1G2M A;  1VCW A;  1E38 B;  1BRB E;  2H6M A;  1UTQ A;  4K1T A;  5JB8 S;  1O2H A;  3P8N A;  4RI0 A;  1HLT H;  3UNR A;  3SU4 A;  1XKB C;  3SOS A;  5J4Q A;  1J16 A;  3NR1 A;  3RC5 A;  1TAW A;  1VKY A;  2F9P A;  2QF5 A;  3FP7 E;  4RXP A;  2F9B H;  4FUG A;  1E37 B;  1B0E A;  1F0T A;  4TY7 A;  1EZX C;  4FU9 A;  4B2C A;  2J34 A;  2V7Q D;  1H1B A;  2ODP A;  2YOL A;  3FP6 E;  4IC5 A;  1C5L H;  1SGE E;  4NFE A;  4O03 A;  5AFZ H;  2ZG0 H;  2BLO A;  1H4W A;  5GCH F;  2Y5H A;  4NWK A;  5FBE A;  2QF4 A;  4I31 A;  2QIQ A;  3U9A H;  1TE0 A;  2W5E A;  2O8U A;  1MTN C;  2ZFS A;  1KMH B;  4O9V A;  5DP4 A;  2I6Q A;  1H8H D;  1D4P B;  1CVW H;  2QGR A;  1C2J A;  2SGP E;  1W14 U;  4ABJ A;  4UEH H;  2G8T A;  2H9H A;  3BG8 A;  1GMH G;  3SUG A;  2G81 E;  4KTU A;  4NSY A;  3SU5 A;  2NU2 E;  3RM2 H;  2FOA A;  4Y11 E;  1GI7 B;  3A8C A;  3QGJ A;  1SSX A;  4P00 A;  4K2Y A;  1B0F A;  1O2N A;  2HRV A;  2PAU A;  2RDL A;  3QUM P;  2EY4 C;  3C27 B;  4U2W A;  2Z9J A;  2ZHE H;  2Y82 A;  1EKB B;  4TWY A;  4ABB A;  1C1Q A;  1SGC A;  4GHT A;  1ESB A;  1G30 B;  1GI9 B;  1XUK A;  1TA6 A;  2WPK S;  1K1J A;  1C5R A;  1O3N A;  2FPZ A;  4B2A A;  2JH5 D;  1T4U H;  3LC3 A;  1MKW K;  4TNY A;  2NU4 E;  2WPJ S;  1O2R A;  4TSF D;  1K1M A;  3RP2 A;  3LJO A;  4ZH8 A;  1MBM A;  1FY3 A;  3PV5 A;  2JJ2 D;  6EST A;  2C90 B;  2ZDN A;  1C9P A;  4JK6 A;  1CO7 E;  1XXF A;  2ZQ2 A;  1Z71 A;  4QG4 A;  5AO1 A;  1O3P B;  1IQI A;  4I33 A;  2TGD A;  2ULL A;  3DA9 B;  4UE7 H;  1AD8 H;  2C8W B;  2OTV A;  2J95 A;  1QZ8 A;  1BTX A;  1OWD A;  3O8B A;  2FDA A;  4MQA A;  3MEM A;  2OXS A;  3EAJ A;  1FIW A;  3NUM A;  2BY9 X;  5E2O A;  5AO2 A;  1C1T A;  4TNX A;  2F83 A;  1Z8J B;  4X2V A;  3UIR A;  1A0L A;  3E6P H;  3UUZ A;  4MPW A;  3VFE A;  4RSP A;  3VB4 A;  5PTP A;  1TNG A;  3TVJ B;  4L7W A;  1W0Z U;  2GDD A;  3P8O A;  4KP0 A;  1XUH A;  2QXJ A;  1XVM A;  4K69 A;  1DWB H;  4E05 H;  2WPL S;  5JB9 S;  3FOA A;  1PPE E;  1AVX A;  2FLR H;  3SUD A;  3TJV A;  1NN6 A;  2ZU2 A;  3BEI B;  5C1X A;  4L1J A;  1AUT C;  1EP6 A;  1LVY A;  2BD7 A;  1B5G H;  1GHV H;  3Q3Y A;  3F2H A;  2C8Y B;  2HGT H;  5B6O A;  2JET B;  3LGV A;  1NC6 A;  2Y5F A;  5TKA A;  1WCZ A;  2ZNK H;  2WIN I;  5GDS H;  1ANC A;  4HZH A;  3SU2 A;  1W13 U;  2OLG A;  2EI7 A;  5AO0 A;  1L4D A;  5TCC A;  3AK5 A;  1G37 A;  1AFE H;  1F92 A;  3NQW A;  2J97 A;  1C1M A;  2ZTX A;  1N6X A;  2F9O A;  3C1K A;  3MU5 A;  1NFW A;  5G4B A;  4BXW A;  1O36 A;  1TX7 A;  2Y7X A;  1DUA A;  4UON A;  1S0R A;  3VXF H;  4JZF H;  3GY2 A;  2FZZ A;  2QA9 E;  3B9F H;  3L3T A;  2GTB A;  5L6N H;  4AC9 A;  1HDT H;  2WYJ A;  3AAU A;  1DM4 B;  3DCL A;  4TPI Z;  2QY0 B;  3KQD A;  2GJG A;  3A7Z A;  1QBO A;  1O2W A;  3LJX A;  2CF9 H;  2DE8 A;  3T29 A;  1FXY A;  3NWU A;  1RXP A;  1A46 H;  1X7A C;  3A80 A;  3H09 A;  4ZHA A;  2VNT A;  5C2Z A;  1GL0 E;  1QGF A;  3GCO A;  4Y6D A;  2BD8 A;  3LGT A;  3I78 A;  2JH0 D;  2BXT H;  1XXD A;  2UUY A;  3N7E A;  1PJP A;  4WXI A;  1Z8R A;  5EGM A;  1FJS A;  1GMD F;  2IPH A;  2GCH F;  2BYA X;  4TNR A;  2FOH A;  1C5W B;  3GCN A;  2XC5 A;  3I7A A;  4YT7 H;  4FUI A;  1MKX K;  4OS5 A;  3A88 A;  3BG4 B;  1WXR A;  4UDW H;  3EST A;  1O3E A;  1SQR A;  2V0B A;  4RN6 A;  4WME A;  4TO1 A;  1YBW A;  3UWI A;  1SQO A;  4INK A;  1ZPB A;  4QG1 A;  5J4S A;  1K1P A;  2HNT C;  3FZD A;  1OP8 A;  1S6L A;  3SHA H;  2FI4 E;  6CHA B;  3S69 A;  2SNW A;  1Q31 A;  3RXO A;  9EST A;  1RTL A;  1SG8 B;  1SGF A;  1YLC A;  2BD9 A;  4THN H;  1K0H A;  1CA8 B;  1YPJ H;  5EU8 A;  1ETT H;  2G00 A;  1NES E;  4I32 A;  1FLE E;  3EE7 A;  1C1S A;  1CT2 E;  2GCH G;  1PYT C;  1RGQ A;  4NFF A;  3SHC H;  1IAU A;  2V6N A;  2L74 A;  1KXE A;  2OK5 A;  4WMF A;  1ELE E;  2FI3 E;  5ETX A;  3Q3X A;  1HUT H;  1BUI A;  1LDT T;  2P94 A;  3AW1 A;  1GBB A;  1KXB A;  3GYM A;  3S4L A;  1DDJ A;  2A31 A;  1NBM E;  4A1V A;  4XE4 A;  4I8J A;  1HAY B;  4Y7A A;  1FPH H;  1O33 A;  1C2I A;  1LPK B;  3RU4 D;  3EA7 A;  3MI4 A;  1LVM A;  1PQ8 A;  1EXF A;  3NZI A;  1OWJ A;  2P3U B;  1BTP A;  4QQW A;  1G2L A;  1QJ7 B;  2QXI A;  4U32 A;  4Y8Y A;  5SGA E;  1IQM A;  2ANK H;  4B73 A;  5DGJ A;  1GBD A;  2KCP A;  2XTT B;  1AZZ A;  3BTM E;  1AU8 A;  1QTF A;  2GDE H;  4SGB E;  4BAN B;  3MMG A;  1B7X B;  1FDP A;  1WQV H;  3KYG A;  4CRG A;  1W3C A;  1GBJ A;  4R8T B;  1PQ7 A;  1NBM D;  1V2T T;  5EJL A;  1FON A;  2V3M A;  2PR3 A;  3D23 A;  4QG2 A;  2GT8 A;  1BHX B;  1V2M T;  2GT7 A;  2IJD 1;  2ZGC A;  4DGJ A;  5GXP A;  2BTC E;  2WYG A;  3U8R H;  4TNQ A;  4Y0Z E;  5C5N A;  2A32 A;  2D8W A;  1ZSK A;  2HNT E;  1QBV H;  3MNS A;  1ESA A;  2PLX A;  3NCL A;  2ALV A;  1KDQ A;  3A7Y A;  3NKK A;  3ZYD A;  1EJN A;  2PSX A;  3VPK A;  1C5U A;  3SJK A;  1P06 A;  4KTC A;  5DP8 A;  1TAL A;  3UR9 A;  1D9I A;  4MTB A;  3L6P A;  4ZUH A;  2OUA A;  1C1V H;  2V3H H;  2BDY A;  2P8O B;  4KEL A;  1VGC B;  1DOJ A;  3EA9 A;  3RC4 A;  8EST E;  1GJ9 B;  1T8O A;  1KSN A;  4MNY A;  1VIT H;  4FU7 A;  1XUJ A;  1Q2W A;  2AGE X;  1ANB A;  4AFQ A;  3E1X B;  1FY8 E;  1Y3Y A;  2WSS D;  2RA0 A;  4TO6 A;  1GJ4 H;  4FUF A;  2ZFR H;  4K60 A;  2L6O A;  4AFU A;  1GHY H;  1CGH A;  1P12 E;  5FX5 A;  1F5R A;  3M5M A;  1J9C H;  1O37 A;  2ZI2 H;  3ODF A;  5F03 A;  1HAV B;  1JIR A;  2BY6 X;  2XWB I;  1CU1 A;  3LGY A;  1C5M D;  2BQ7 B;  3A87 A;  1P2J A;  1UMA H;  2KZ4 A;  3OU0 A;  3R3G B;  1SGY E;  1D3T B;  4X6P A;  2FYQ A;  2H9E H;  5DKM A;  4ASH A;  2ZWL H;  4GCH G;  1CBW B;  2GCT C;  1C5N H;  1HCG A;  4D7F A;  1CGI E;  2OCV B;  2R0L A;  2CHA C;  1CHO G;  3A7V A;  3Q77 A;  5C1U A;  1IQH A;  1YCP H;  4FUC A;  1YPK H;  3K6Z A;  4Q7Z A;  4A1T A;  1O2T A;  2P93 A;  2PAR A;  1MTW A;  2HLD D;  1EAX A;  1OOK B;  1OP2 A;  2K1Q A;  1GJB B;  2VVC A;  3KYF A;  1DE7 H;  3SV7 A;  3A85 A;  3ENS B;  2F9V A;  4RKJ B;  1GBF A;  2AFQ B;  2ZFF H;  3MOC A;  1ZGI A;  1HXE H;  5E0H A;  4F48 B;  1KDQ B;  4IGD A;  5HYO A;  3ZVD A;  3ATM A;  1HAX B;  4FVD A;  5EIY A;  1O3G A;  2HOB A;  3JZ2 B;  3ZZ9 A;  2ZDL A;  1ARC A;  1ORF A;  3OTP A;  2SGE E;  3SI3 H;  4AN7 A;  1E35 B;  1YOY A;  3SJI A;  1EOJ A;  2LPR A;  1A1R A;  3TJN A;  1CHO F;  4I86 A;  2IOT A;  2A5K A;  1JMO H;  1C1U H;  4YTA A;  1OHH D;  1THR H;  4MG3 A;  1Z7K A;  2H2Z A;  1QBN A;  1TMT H;  2A7H A;  2H1U A;  1ANE A;  1LPG B;  1Q3X A;  3M61 U;  3PWB A;  3TGK E;  4XSK U;  1TIO A;  2AIQ A;  3E0P B;  3TIU A;  1TPP A;  1QQ4 A;  3ZV9 A;  1OS8 A;  3QTV H;  3F9H A;  4Z1M D;  2BX3 A;  2LNC A;  4YOI A;  1UTM A;  2BDG A;  3PRO A;  2ZZU H;  3SZE A;  3MH4 A;  3ZZ7 A;  3TMD A;  2BD5 A;  2Y80 A;  2ZIQ H;  4O3T A;  1AY6 H;  1DWC H;  1MAY A;  1MUE B;  4FUE A;  5A2M H;  3ZVG A;  2GZ7 A;  3RXH A;  1GJ8 B;  4OM9 A;  1GCD A;  2NU1 E;  6LPR A;  1BTU A;  2BD2 A;  3S9C A;  4O97 A;  3PTN A;  4JYU H;  8KME 2;  5T6G A;  5C3N A;  3SYJ A;  2WV5 A;  4MNW A;  1D6R A;  4UFG H;  4ZKS U;  2PTN A;  3DD2 H;  3Q00 A;  1P0S H;  2QF3 A;  3SBK A;  2FS9 A;  4X2Y A;  1EOL A;  4K5Z A;  4WY3 A;  2AYW A;  2A5I A;  5T1V A;  1HJA B;  5IYT A;  1NRP H;  1NS3 A;  4TO4 A;  3RLY H;  1UTJ A;  1N1L A;  5F8T A;  3UNQ A;  3AAS A;  1VJ7 A;  1SLW B;  3WW7 A;  1HNE E;  4Q2K A;  1C2M A;  1YY3 A;  4WXV A;  1E0F D;  1YM0 A;  1O3J A;  5GWZ A;  2CN0 H;  1BHX F;  5CHA B;  1Z8I B;  1O3L A;  3D49 H;  2FTM A;  4ZXX H;  4X2X A;  1AHT H;  3V13 A;  2AGI X;  2ZDV H;  3LH1 A;  3M5O A;  3BTF E;  2ODQ A;  1EPT A; 
#chains in the Genus database with same CATH homology
 4DMB A;  4ZWG A;  3LJX A;  3KQ5 A;  2PAR A;  3BG2 A;  4TO5 A;  4TNY A;  4QQY A;  4BZB A;  2OGI A;  5TK8 A;  4TNZ A;  4QFX A;  4QG2 A;  3HC1 A;  2GZ4 A;  3RF0 A;  4TNQ A;  4MZ7 A;  1YNB A;  2O08 A;  2PQ7 A;  1YOY A;  4QG4 A;  5AO1 A;  4X9E A;  4TNR A;  4QFZ A;  3KH1 A;  3I7A A;  2Q14 A;  4LRL A;  1U6Z A;  2IPQ X;  3GW7 A;  3TMB A;  3NR1 A;  3M1T A;  4MLM A;  4QG0 A;  4L1J B;  5AO3 A;  4RXP A;  3MEM A;  4TO0 A;  4TO1 A;  4QG1 A;  4RXS A;  3HI0 A;  5AO2 A;  4BZC A;  4TNX A;  5TK9 A;  3SKD A;  2HEK A;  3CCG A;  3MZO A;  4L7W A;  4L7E A;  5AO4 A;  4N6W A;  2O6I A;  3TMD A;  3IRH A;  2FLO A;  4XDS A;  1XX7 A;  4QQZ A;  4TNP A;  4TO6 A;  4RXQ A;  4MLN A;  4L1J A;  5TKA A;  4QQX A;  4N71 A;  5AO0 A;  4QFY A;  3U1N A;  4MDZ A;  3S4L A;  4TO4 A;  2CQZ A;  3NQW A;  5TK7 A;  4RXR A;  2PAU A;  4TO3 A;  1VJ7 A;  2DQB A;  1VQR A;  3P3Q A;  4ME4 A;  4Q7H A;  4R8Z A;  5TK6 A;  3SK9 A;  3TM8 A;  3TMC A;  4MCW A;  4Q2C A;  4ZWE A;  4Q2D A;  4TO2 A;  4RXO A;  2PAQ A;  4QQW A;  2PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...