3KQGA

Trimeric structure of langerin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
169
structure length
169
Chain Sequence
SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric structure of langerin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords C-type lectin domain family 4 member K
total genus 54
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kqgA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3kqgA02
4M3LA 3WSRA 4YMDA 2ORJA 4XE5B 3G8LA 3SWFA 3G84A 3CFWA 1BYFA 3O8ZA 5AVYB 1BJ3A 3TNUA 4S0UA 4WUXA 1KWUA 1UMRC 3LIEA 1SB2A 1X2TB 3P8MC 1F00I 4N33A 5AW3B 1V4LB 2YHFA 1IO4A 5AVWB 1OWAA 1BCJ1 1B08A 3CDGF 3P7HA 4KI1E 3BX4A 1C3AB 1KWYA 1KWZA 1JWIA 4UXMA 1TLGA 5AW2B 1H88A 1QO3C 4IOPA 1RDM1 2R5BA 2RIEA 4ZETA 1KZC1 3HE4B 1UKMB 4KMB1 3TYYA 3V4QA 3UBUA 1HQ8A 1BCH1 1RDJ1 3VMXA 5AVZB 2WTYA 1J34A 1KX0A 2N9BA 3BDWB 1T8DA 4LC1A 1T2KD 2W6AA 4J6PA 4N32A 1WK1A 3ALSA 1BJ3B 4ZRVA 1LITA 1YPOA 1UMRA 3ALTA 2R32A 4WRCA 1KWVA 1E8IA 1CSBA 4C7NA 1WMYA 3L9JC 2P2UA 5APQA 2QM8A 1F02I 4KHXA 4GJXA 4CSYA 2MSBA 1BUUA 1MFZA 1HWTC 1KZD1 1KZE1 3WBRA 1WMZA 3GPRC 1KZB1 5AW5B 4M1GA 3M06A 3WBPA 1DY0A 1SB2B 1X2TA 1V7PA 1UKMA 3G8KA 2VUVA 5AVXB 2Z5HA 1X8YA 4I6MC 4HYTB 3IKRA 3BX4B 1KWWA 5FFSA 2GO0A 3ZHGA 4C46A 2E3XC 3P7GA 3P5EA 3M9HA 5APYA 2VRSA 3HUPA 1WT9A 2WWWA 2XR6A 3HTKA 3NMDA 2C9LY 3A7OA 4GK1A 3LIDA 5FFTA 2BPHA 1HBWA 2YO2A 3FF9A 3L37A 4QKGA 1FIFA 2GGUA 1IJKC 1RDK1 3TK1A 1IODA 2BPDA 3V5BA 3VMZA 1K9JA 1U0NC 3CADA 1O7CT 4ZESA 4WR9A 1Y17A 2ZFCA 3C8JA 5CMZA 4N38A 1DY2A 2H2RA 4EZMG 5LGKE 3M0DA 4AQRD 3VN0A 1IXXA 1G1SA 1K9IA 3ZHGD 4YLIA 3GPRA 2GGXA 1U0OB 5AW9B 1HUPA 1XARA 5KTHA 4EOTA 2P67A 1P4LD 2KMB1 5J6GG 5APVA 4M17A 3IKQA 3I5CA 1GK6A 2IPPA 2ZWKA 5AW4B 1H89A 4WUWA 5B1RA 1GU5A 3P7FA 3L35A 1TN3A 1X2WB 1E87A 1HUCA 5AW6B 1TDQB 4AUWA 3UBUB 2WPSA 1T8CA 4GJ0A 3ALUA 3MD0A 4PDCA 1YPQA 5AW8B 1UOSB 4DZOA 1S9KE 1IXXB 3NCXA 2OX9A 1GD2E 2JJLA 4RESB 5AVUB 1CI6A 2H7HA 3FF7C 3M0AA 3A5TA 5APTA 1DY1A 2BRSA 2AFPA 3KMB1 3PAKA 4AYCA 3IKPA 4J6MA 4GI0A 3BDWA 2ZQKA 2WPQA 5AW0B 4LQFA 3HE5A 1MV8A 1OZ7B 1NAFA 3G83A 1J35A 5B1WA 3L36A 5AVTB 5APSA 1FOSE 1MSBA 1KQLA 2C9NY 2WT7A 1DH3A 1H8AA 4KZWA 5APUA 2ORKA 1UV0A 4J6JA 3IKNA 4JYBA 1V4LA 1WT9B 1MUUA 3WWKA 2KV3A 4I2LC 2RICA 4AK8A 4J6QA 4G9AA 3NCWA 5M62A 4M18A 3CDGE 3VYIA 3A2AA 3TNUB 4IOPB 2E3XB 3FF8C 3T3AA 3M91A 4WCOA 1YXKA 3HE5B 1YTTA 3M9BA 3IR9A 3GPRD 3B8EB 1ESLA 2W27A 3UIAA 1GZ2A 2PY2A 1QDDA 1A02F 3P7KA 2OX8A 1FOSF 1JWIB 1OZ7A 1S9KD 3VYKA 3WHDA 2E43A 4QKIA 3WWKC 4DN8A 2CL8A 1T2KC 2XR5A 4GT1A 3A3YB 3NFQA 4C9FA 1E5UI 2WT7B 2IT5A 5AVQB 5APWA 4J6LA 2IT6A 3P32A 1PW9A 4GKOG 1KG0C 2VRPA 3K7BA 1MUQA 5KTIA 1V7PB 2OS9A 4WQQA 1KOEA 2Q5UA 2Z5IA 2MTIA 1GK4A 5AVSB 1UOSA 3C8KD 2I83A 1RTM1 3WWKB 2P7JA 1RDL1 3NTNA 4N37A 3DBZA 5APXA 2XU6A 1KCGA 1CI6B 1UEXA 1A02J 1BNLA 4KZVA 2YNYA 2ZIBA 1FVUA 1RDN1 1YPUA 1KX1A 3RS1A 2XV5A 5AVVB 1RJHA 1NWQA 2BPEA 2H2TB 1J35B 1RDO1 1HJBA 2XZRA 1SL5A 1GU4A 1IJKB 2C6UA 1O7BT 1HYRA 1IODB 2RIDA 3VTPC 1YXJA 1FAVA 3G81A 1JNMA 1JUNA 1DV8A 4N36A 3WH2A 1GZLA 2E42A 2RIAA 5AW1B 5F2QA 2YO3A 4B86A 2Q3IA 1C3AA 2M94A 3C22A 1FVUB 1CZQA 5FFRA 1AFB1 3WH3A 2Q7CA 4C7NB 2VRPB 3GPRB 1U0OA 1U0NB 2RIBA 3HE4A 3PARA 4WRFA 4QKHA 3M9ZA 3P5FA 1J34B 3V4WA 1GTWA 1RDI1 1Y17B 4MTHA 3WBQA 4ZRWA 1AFA1 2WPRA 1J2JB 1SP4A 1SL6A 3P5HA 4E52A 1G1RA 1UEXB 1FM5A 1PWBA 1OXZA 3MGNA 1KWTA 2BASA 5AW7B 1G1TA 4J6KA 1YYCA 1KMB1 2R3CA 2KP8A 3KQGA 1SLQA 3P5DA 4LU5A 1R13A 2N40A 2LS8A 5AVRB 4C16A 1G1QA 4J6NA 3PAQA 1HTNA 3OAKA 4PP8A 3VMYA 1XPHA 4CAJA 2PF5A 1KZA1 4N34A 1BV4A 4N35A 1X2WA 4GKGA 2R5DA 1EGIA 3P5GA 1FIHA 2ZXEB 1B6EA 3T97A 4WREA 3CCKA 3KDPB 1G2CB 5B1XA 1EGGA 4UWWA 1MPUA 5K8YA 1AFD1 1SL4A 4QKJA 1R14A 3NXSA 4JYCA 1CWVA 1JA3A 1KWXA 4G96A 1H8UA 3VPPA 2VUZA 3VLGA 3FD4A 1P1ZD 3PBFA 2QM7A 3VYJA 1JZNA 3P5IA
chains in the Genus database with same CATH superfamily
4W7ZA 1RE3C 4JBZA 3Q5PA 4YMDA 2ORJA 2ZVNB 1L0LJ 3G84A 2JWAA 5KJ7A 3CFWA 1BDDA 1OX3A 3L73G 4W7YA 1SB2A 1X2TB 4BXLA 1V4LB 2YHFA 4LLHA 3U1AA 1IO4A 5AVWB 2M5AB 3P7HA 1GW4A 1L4AA 2MJZA 5B66E 1S3JA 1IK7A 1LTAC 1JWIA 4UXMA 2R5BA 1LNQA 1AJYA 1PGPA 1BGYD 2JEEA 4GODA 4N78D 3V4QA 3UBUA 1SQQE 1RF1A 4PV1C 1J34A 3FX0A 2ZXXA 4J6PA 4N32A 1BJ3B 4ZRVA 1LITA 1LWUA 5KKZC 3B5NC 2R32A 3PTZA 1EZVE 1E5WA 1FBMA 2H8PD 1L0ND 5APQA 1LJ2A 4KHXA 1LP1A 3V2RA 4PD4I 2E76B 2ZYDA 2MSBA 1BUUA 5CJ0A 1HWTC 4XFJA 3WBRA 4PD4E 3GPRC 5AW5B 3CL3D 4H44C 2SPZA 2A45G 3G3ZA 1NVOA 1RF0C 1X8YA 1PGJA 1NU1K 5FFSA 1S5LH 2E3XC 1SQVD 1AA0A 2QE7H 2B87A 2VRSA 3HUPA 1JY2P 1RQVA 2Q6QA 2QG4A 3JC22 2BEQD 1Q7YQ 1NTKG 2K9JA 1FZGA 3FWLA 2C9LY 3A7OA 1IFIA 3LIDA 5FFTA 3H1LD 3L37A 1DIPA 4N3YB 1FIFA 2E74C 1IJKC 2J59M 1VQPP 2Z4EA 3H32A 1K9JA 4PJ0E 1O7CT 2FXOA 2Q9IA 1Y17A 2ZFCA 2Q3EA 1S2EA 1YQ3C 5LGKE 1SQPG 1KN7A 3SWYA 4AQRD 1G1SA 4YLIA 3GPRA 2B88A 5BU5A 1AQ5A 1GDTA 1ZW0A 2FBWC 1U0OB 4H44B 4EOTA 5J6GG 1HGZA 1SFCD 2FKWB 4M17A 3RK3B 2B89A 1JTHB 4L76A 3AE2C 3B71A 1H89A 1U57A 2O3JA 1GU5A 1NKZB 3L35A 2B87B 3L72D 1E87A 1GL2B 1TDQB 1NHLA 4AUWA 1FZBA 4GJ0A 4PDCA 2M0BA 2KLUA 1S5LX 1FS0E 1KYOD 1KB9H 3NCXA 4HH2A 3RGUA 1JOCA 5AVUB 1Z56A 1DY1A 3PAKA 4AYCA 1NTMG 3RK3C 4D6TD 3N7NA 3G9RA 3HRNA 1WRGA 2WPQA 2ZVOB 3VOPA 1MV8A 1OZ7B 3L75J 1NAFA 2IZ1A 3L36A 4LGDE 3SFEC 1KILE 1EDKA 1G1IA 3O6QA 3G4SP 2PP6A 3MUDC 1IFJA 1UV0A 2YKQA 1M1JA 1ZXGA 1NYHA 1WT9B 1VQKP 3WWKA 5M62A 1Q2NA 3AEBC 3VYIA 3L71D 1MZ9A 3A2AA 4IOPB 2KS1B 3T3AA 3M91A 2IYPA 1VDFA 3IR9A 2W27A 1KZUB 3GG2A 2OYOA 2E76C 3BRVB 3AEEC 1BDCA 1JWIB 2XNXA 1YI2P 1N7SC 1SVFA 5B5EH 1SQVJ 4YTPC 3B5ND 2W83C 1Q86Q 1SQBD 1T2KC 3A3YB 1E5UI 3OA7A 5AVQB 2GA1A 2IT5A 1JY3O 1SQQG 1SQPK 4IFMA 3H1IE 4OVNF 4GKOG 4U3FG 1KILB 4ASVA 5CCGA 1VQOP 1SQVK 1YTZT 4TLFA 1G2CA 4IL6E 3CC7P 2OS9A 1ZRTE 2Q5UA 2MTIA 2KB7P 5APXA 3HUSA 1KCGA 1BNLA 4KZVA 1DEEG 3L73E 3I56P 1RDN1 2ZIBA 1USEA 5CBOA 1RJHA 2N1TC 2P58A 4PD4H 3CXHH 4OGQD 5B5EE 4GIFA 1YITP 3USSA 3E7KA 1SL5A 2GUVA 3CCLP 1GW3A 2FYUD 4U7JA 3VTPC 3D6ZA 5BVZA 3Q5RA 2OYIB 3H1IJ 1RY3A 3T97B 2E42A 1EDIA 5F2QA 3H25A 2YO3A 2W8ZA 3HUSB 1CZQA 5FFRA 3S1KA 4GOEA 3PARA 3MIWA 4QKHA 2A06E 1LT9A 3P5FA 3H1KJ 4ZRWA 1AFA1 2WPRA 1SL6A 3VP8A 4IL6H 3MGNA 1LTJB 1FZEA 2KP8A 1SLQA 3P5DA 2KSEA 2N40A 2H89C 1Y8AA 5AVRB 2FYNC 1G1QA 3CXHD 2KYVA 4H0LC 1MKMA 2E75C 2G8YA 2OYHB 1X2WA 2QJYC 1J1EC 2R5DA 1M8OB 5KJ7C 3CCVP 1SQVE 3Q2YA 1KFNA 2CPBA 4UWWA 1LTJA 1LTJC 1AFD1 1URQA 4QKJA 1R14A 3NXSA 1OW8A 4JYCA 2AEJA 4OH8B 2YMKA 1PPJE 3FWNA 2VUZA 1M1JB 1PGQA 1P84I 3RL0g 2GUSA 3AEAC 2R3SA 2WQYC 1JMBA 4H13B 1X79B 3SWFA 1WT6A 3Q1MA 2QIWA 4S0UA 4R4LA 4EI2A 3LIEA 1F00I 4R4MA 3V2QA 1B08A 3CDGF 2OYIC 1SQXJ 4KI1E 3BX4A 2C0XA 3TF5A 1OZHA 3RK2B 3G6EP 1KWYA 5AW2B 4IOPA 1LGHB 2RIEA 1KZC1 1SS1A 1VPCA 1HQ8A 1JCDA 1BCH1 3R2PA 2WTYA 3L72G 2N9BA 3BDWB 1NTMK 1VQ6P 3A0HH 1T2KD 1P84E 1WK1A 3ALSA 1LWUC 1UMRA 3FXEA 2OTKE 2Y9ZA 5DJUB 1WMYA 3RL0D 2P2UA 2WSCJ 5B66H 3CCJP 1RQUA 4YXWH 2Y0DA 2K3RA 2G3AA 3RK2C 2HLOA 2RMZA 1JM0A 2YIUB 3E1RA 1KZB1 4M1GA 3H1LG 2FYUK 1DY0A 2NPSD 1V7PA 1UKMA 2O01H 2VUVA 4I6MC 1KYOH 1QGKB 4KJMA 3BX4B 2KIKA 4BRYB 3A0BH 3P7GA 3P5EA 4OGQC 1X0TA 1EZVD 1WT9A 2OGUA 3E1IA 2WWWA 2XR6A 4ZKUA 1BGYJ 1IC2A 2M3EA 2V4HA 4GK1A 2HFED 4QKGA 2O1JA 2E74B 2GGUA 4I1LA 3L4FA 3C1LA 1RDK1 4DOJA 1NU1D 2JP3A 2HODB 1LTIC 1L2PA 4H44D 1N8RQ 4WR9A 2LXCB 2K9YA 3L73D 2QJPC 2OYIA 3F89A 3C8JA 4N38A 1DY2A 2H2RA 2ZYGA 1K9IA 2D2CD 5H2FH 3L71J 2GGXA 4YXDC 1L4AB 5AW9B 1HUPA 4JQ0D 2PGDA 2FXMA 1P4LD 2KMB1 2KUBA 3HD7A 3LW5J 3HD7C 2IPPA 1SQBG 5AW4B 4WUWA 5B1RA 1KILA 3P7FA 3SSUA 2E74D 3CC2P 1BGYE 2KSJA 3UBUB 1PP9G 1T8CA 1YPQA 1IFPA 1IXXB 2AXTH 3PJSK 4WB4A 5KJ7D 2AXCA 3AE6C 4RESB 3H1LJ 1CI6A 5APTA 1YJWP 1BCCE 2R44A 2RKLA 2D2CB 1WMKA 1UIIA 4OWFA 5TJHA 2AFPA 3KMB1 2O1KA 5AW0B 4WVZA 5C39A 1W2EA 4UB6E 2A06G 3G83A 5AVTB 5CBNA 1EC5A 2FFDB 2WT7A 1LP1B 3QWOC 3EFGA 5CHXA 3PH0A 5APUA 4RJTA 5KTBA 3Q3DA 2DW3A 4J6JA 1W5CE 2JKVA 1V4LA 3CXHI 3H1JD 4EIJA 2RICA 2JDIH 5KLVE 4G9AA 1FJPA 1YJ9P 2N1TB 1IFDA 1BSHA 2HPCA 1NTZK 3FF8C 1K04A 1FC2C 2YKPA 1YIJP 2WSEJ 2P1JA 3GPRD 4W80A 2M3BA 3II6A 1N73B 1Y9BA 4HB1A 3F5HA 5L8RJ 3O6QB 1OMIA 3IN6A 3P7KA 3LW5H 2QA4P 1KC8Q 1VF5C 1OZ7A 3VYKA 2YXQB 2E43A 5KAIE 4DN8A 2HG5D 2N1TA 2LR2A 4U3FE 5APWA 4WY4D 4J6LA 1Q90D 2IT6A 3P32A 2VRPA 1YQ4C 3R4YA 2OTJP 1PGOA 1M90Q 4YPCA 1K05A 1KV4A 4WQQA 1N73C 1GK4A 1R5LA 2ITAA 1DD3A 3NTNA 4N37A 2XU6A 2A45I 2WSFJ 2BCCG 1A02J 2E76D 3MZWB 1NTKK 1YPUA 4ZMDA 4O9BA 3RS1A 3W68A 3D71A 1JCCA 1NWQA 1J35B 1RDO1 3KZIH 2QJKC 4RO0A 1IJKB 5CCGD 4H13C 1ZRTD 1VQNP 1UIXA 1FE6A 1QL1A 1N7LA 5CCHA 1ZN5A 3JSVC 2Q7CA 4C7NB 2VRPB 5KLIB 3AE1C 1USDA 1U0OA 2RIBA 4QMAA 3CX5H 1M56D 2D2CC 1VQLP 4WRFA 1S4XA 3L74J 4KT0J 3V4WA 2LXBA 4MTHA 1SP4A 3IAOA 4E52A 1KMIZ 1P84H 1G1RA 2JWDA 1FM5A 1JMMA 1PWBA 1G1TA 4J6KA 1M1KQ 3KPEA 4LU5A 1R13A 2LS8A 1BE3G 4I7ZC 1R8EA 4DT0A 4PP8A 1KILD 2YIUC 1CW5A 3PHLA 1S1CX 4CAJA 2PF5A 3H1KG 3C8VA 3CPWO 1GL2C 1FIHA 3D70A 1GL2A 2ZXEB 1N73A 3H1JJ 1HGVA 3D6YA 3T97A 3WU2H 3H1ID 3QH9A 4L73A 4H0LB 1VQMP 1NAYA 1MPUA 1URQC 4XA4A 2ZT9D 4U3FJ 1KWXA 3TSIA 1L4AC 4JF7A 2HR3A 4UB6H 1FDOA 2FYZA 3FD4A 2O01N 1P1ZD 1NTZD 3H1KD 3PBFA 2QM7A 3VYJA 3H1HD 1EQ7A 1XTGB 3S4RA 3CX5E 3CCUP 1SQBK 3EFFK 3O8ZA 5AVYB 2I1KA 1BJ3A 3TNUA 1QVFO 3AECC 4NPEA 2ZT9B 1UMRC 1NTKE 2E5YA 1SQXG 4TT3H 2IYOA 1FJKA 4N6JA 3WUTA 3PP5A 1C3AB 1KWZA 3M0DC 1TLGA 1H88A 1QO3C 1RDM1 4ZETA 2WPVB 4KMB1 2IBZE 1R5SA 1RDJ1 3VMXA 1SQVG 2L5GB 3WMM0 1FZAA 1KX0A 2W6AA 1K73Q 3SWKA 4WRCA 3U1CA 1E8IA 1CSBA 1NTKD 2HODA 4C7NA 2NZ2A 2QM8A 1F02I 3HTKB 1EZVG 3A0HE 3GHGC 4GJXA 2FYUE 4CSYA 1LT9B 1KZD1 1HVVA 1N7SB 1WMZA 1AFOA 1W2BO 3TGUJ 1SB2B 1X2TA 1NTZE 1VQ7P 3G8KA 3H6PA 3GF7A 1NTZJ 4HYTB 3IKRA 1KQSO 3ABVC 1ZMEC 4BWNA 1KWWA 2GO0A 3ZHGA 3BRTB 4C46A 1P84D 3M9HA 5APYA 2QVAA 1ZLLA 3B5NA 3B4SA 1L0NG 2FY8A 2V7QJ 3NMDA 2ZYAA 1HBWA 4OGQB 2WSEH 1NTMJ 2NRGA 3CCQP 1ZR2A 1IODA 2BPDA 3VMZA 4ZESA 2AEFA 3CX5D 2N9YB 3H1JG 1QLED 3GMAA 2C0WA 2J58A 3CX5I 3M0DA 3ZHGD 2KK7A 3TDKA 3RK3E 2P67A 4U3FD 1L0NE 3CMAP 2CPSA 4EDFA 1KB9D 1NTKJ 1RHZB 1GK6A 2WMMA 4UB8H 1KILC 1RE4C 1TN3A 1HUCA 3AEFC 1NJIQ 3AEGC 3V6IA 3ALUA 3MD0A 3AE8C 5AW8B 1NTZG 1UOSB 1KTMA 2L91A 2OX9A 1XTCC 2WSFH 1JY2N 3AE7C 3FF7C 3M0AA 3CWBD 3A5TA 3H1JE 2BRSA 3RK3D 2Q1KA 4PV1B 4J6MA 4GI0A 1AV1A 1K8AQ 3BDWA 2OTLP 3HE5A 1J35A 5B1WA 3FXDA 1FOSE 1KD1Q 1L0LK 1KQLA 1IFNA 1DH3A 1H8AA 2AEMA 2KLVA 1K9MQ 4KZWA 4Y28J 2ZJSE 3WU2E 4N78E 1NTMD 1IFMA 1M7LA 3IKNA 4GDOA 4IOIH 1SQXK 2FYUJ 1EXIA 1MUUA 2FXPA 4CPGA 2KV3A 4I2LC 2BCCJ 4AK8A 4J6QA 5CCHC 4C7RA 3TNUB 2E3XB 1OW7A 1NKNA 4ZNCA 4WCOA 1JB0J 3UIAA 2FYUG 1GZ2A 3JCUH 2POHA 1JO5A 3GF3A 2PY2A 1H0TA 5KAFH 1AVOA 1LTGC 1JY2O 1S5LE 1NTME 3L74D 2E75B 1KYOI 1KYOE 3AE5C 4QKIA 3WWKC 2PRRA 2CL8A 2JO1A 3CMEP 3L70G 1NOHA 1QVGO 1ZV8A 1FDMA 3CC4P 2IBZG 2WSSH 2XKMA 1OVVA 3PLNA 3K7BA 1MUQA 5KTIA 4GOFA 1VF5B 1KOEA 2Z5IA 5AVSB 3C8KD 1T8ZA 1RTM1 2P7JA 2Y0CA 1OVUA 1OVRA 3DBZA 1U7JA 2BCCD 3V2NA 1SQXE 3CD6P 3H1KE 3FGAD 3B5NB 2KOGA 3RBZA 1YJNP 1KX1A 2KZJA 4PV1D 3W67A 2XV5A 5AVVB 1SQPE 3U59A 4Z1MH 2YMYA 1SQQK 2QEXP 2BPEA 2YKOA 1HJBA 5KLVD 2XZRA 1T3JA 1GU4A 2C6UA 1PFIA 1HYRA 1IODB 1HH0A 3G81A 1DV8A 3JCUE 4N36A 3WH2A 3L74G 1VL2A 2QSIA 1J1DB 2RIAA 5AW1B 1FZFA 4B86A 1C3AA 1JY3N 2M94A 3WH3A 3GPRB 1IZNB 3GW6A 3HE4A 3CWBJ 5TISH 3H32B 4IFFA 1GTWA 4DJGA 1Y17B 2KNCB 1J2JB 3AEDC 3ITKA 1HTLC 2JR8A 3N4XA 1UEXB 3AE9C 2WZ7A 5M1BA 1KWTA 2BASA 1BE3E 1SQBJ 1YYCA 4J6NA 3MP7B 2E75D 3PAQA 3C9IA 3OAKA 5KAIH 1HTNA 3VMYA 1XPHA 1JTHA 5GTIH 2BCCE 4H0LD 4WY4A 4N34A 1BV4A 4N35A 3A0BE 1AQTA 3IF4A 1EGIA 3P5GA 3TGUG 1LT9C 4Y99B 4HKZH 4WREA 4D6TG 1DEBA 1QL2A 1LTSC 5K8YA 4G96A 1N86A 1SFCC 3VPPA 1ZR4A 1KB9I 4WWIA 1LWUB 3CCSP 3P5IA 2OYHA 4M3LA 1HF9A 1RE3A 3WSRA 2K1AA 3G8LA 4XE5B 2OQQA 2KS1A 1E79H 1BYFA 2KXPB 2HPCB 2I1JA 3V2PA 3RL0B 4WUXA 2A06D 1KWUA 2W6BA 3P8MC 4N33A 5AW3B 1RF0A 1OWAA 1BCJ1 1NU1J 1L4AD 1PPJD 2LKMA 3L73J 1BE3D 3KYQA 5E79H 1FZCA 4ASWA 1L0LG 3HE4B 1UKMB 1T6AA 3TYYA 2K9JB 3WUVA 2IZ0A 2YXRB 5AVZB 2KNCA 1QX8A 1T8DA 4LC1A 1OIPA 1M57D 1YPOA 3BCCG 3ALTA 3CCMP 1KWVA 1FDIA 3GLMA 1VQ5P 4PJ0H 1YHQP 1BCCD 3L9JC 4UB8E 1Q81Q 2KZIA 3GHGA 3BCCE 1MFZA 2K88A 1KZE1 2PAJA 1JEKA 3RK2D 5KLVK 1LT1A 3M06A 4ZKPA 3BVHA 3WBPA 1EZVI 4A7PA 1U7MA 5AVXB 2M5AA 5KLVG 5E79E 2Z5HA 4HJGH 2PFXA 4L74A 3CCRP 1N7SD 1FU1A 1FZCB 1VQ9P 1BE3J 1SQBE 2V7QH 3HTKA 3G71P 1AVYA 1X22A 4WBAA 1KB9E 2BPHA 1T3UA 2NPSB 2XDJA 2YO2A 3FF9A 3KXDA 5KLIC 3TK1A 3L75E 3CADA 3V5BA 1VQ4P 1U0NC 1KFMA 1NGMB 1BCCJ 4D6TJ 2Y9YA 2RH0A 5CMZA 2IBZD 3IFMA 1BCCG 5GTHH 5KAFE 4EZMG 2UWJE 4BRYA 1IXXA 2MKVA 3VN0A 5BU8B 1FZCC 3RBXA 3MTUE 1BSNA 3MUDA 1XARA 5KTHA 1URQD 3H1HG 2RN0A 1PP9E 4D6TE 5APVA 1BGYG 1M1JC 2W90A 3IKQA 3I5CA 2ZWKA 1KQFB 3TGUE 2Y0EA 5KKZB 1RE4A 4WY4B 3KZIE 4K35A 1X2WB 4PD4D 5AW6B 2WPSA 2K37A 1RF1B 2H88C 3L71G 4DZOA 2J5UA 2E5TA 1S9KE 3CWBG 1GD2E 2JJLA 1DX7A 3SFDC 2H7HA 1Q82Q 2XNDH 2ZAEB 1H0TB 2IFNA 1NH4A 1D7MA 3IKPA 3KHUA 4K3AA 1IK9A 5EFWB 3OW2O 1PV3A 2ZQKA 4LQFA 1OFCX 5APSA 3BCCJ 1PL5A 3L72E 1MSBA 3CXHE 2C9NY 3I55P 2CK3H 3WUUA 3CI9A 1EDJA 1J1DC 3S9OA 1NU1E 3P8CE 2ORKA 1Y47A 1OW6A 3L74E 4JYBA 1SQPD 5KLVJ 2B9BA 5TISE 2W6JH 3NCWA 4M18A 3CDGE 1NU1G 2KI7B 2HYNA 3H1LE 1QEXA 1ZOYC 1YXKA 1PP9D 3HE5B 1YTTA 3M9BA 2FFDA 2AXTE 2FFDC 1TU3F 3B8EB 1ESLA 1ZP0C 3TGUD 3OJAB 1EDLA 1IJDB 3EWKA 2I8DA 1QDDA 1SFCB 2BEZF 1YTZI 1A02F 3ZDMA 3L70J 3EQ2A 4I7ZB 2OX8A 1FOSF 2IX7C 3L72J 4L75A 1S9KD 1J1EB 3WHDA 1VF5D 4DCKA 2N1TD 2XR5A 4GT1A 1X9VA 3NFQA 4C9FA 4Y99C 2WT7B 2OARA 3CWBE 4MN4C 5H2FE 5CCHD 1YBKA 1VQ8P 3L71E 1RH5B 1PW9A 3L70E 4WY4C 1KG0C 1LTBC 5GTHE 2WITA 1V7PB 4IL6X 1LTTC 3CCEP 1GMJA 1UOSA 2I83A 3WWKB 2IDBA 1RDL1 3K5BA 3L75D 3AE3C 3HD7B 1CI6B 1UEXA 3H1HE 2WSCH 5CJ4A 2YNYA 1FVUA 1N7SA 1L0NK 1PIXA 1PP9J 1KORA 3RL0C 2H2TB 5K5GB 2QJPB 5CCGC 4IFDK 3L70D 1NO4A 3H1HJ 1O7BT 1EXJA 2GM4A 2RIDA 1YXJA 1FAVA 3L75G 4JPZB 1JNMA 1PPJG 1JUNA 3BASA 4H13D 3Q5SA 2QRXA 1GZLA 3VMAA 4EYYQ 3HUSC 2IFMA 2Q3IA 2NPSC 3C22A 2NPSA 1FVUB 1AFB1 1PZQA 1URQB 1HJ0A 1SQQD 1U0NB 2A45H 3AE4C 3M9ZA 1J34B 1RDI1 1DD4A 3WBQA 1MFTA 3P5HA 1KQGB 2QJKB 1OXZA 1RF1C 5AW7B 1L0LD 2R3CA 1KMB1 1SFCA 2M8RA 3KQGA 3BCCD 4C16A 3GHGB 1JY3P 3PRJA 1KZA1 3VP9A 3P8CD 2OYHC 1SQXD 2QJYB 4NPDA 4GKGA 3M9QA 2IBZI 3BATA 4RKUJ 4NPFX 3CLQA 1SQPJ 2P10A 2O01J 1B6EA 2H43A 5GTIE 1GL2D 2FYNB 5DJTB 1N2DC 3CCKA 3KDPB 1G2CB 5B1XA 1EGGA 2ZT9C 3H1IG 1SL4A 1JA3A 1CWVA 1L0LE 1H8UA 3HD7D 3MHVA 1G1JA 1SQQJ 2WVRA 3VLGA 1S72P 1L0NJ 1JZNA
chains in the Genus database with same CATH topology
4M3LA 4W7ZA 1RE3C 1RE3A 3WSRA 4YMDA 2ORJA 4XE5B 1X79B 3G8LA 1SQBK 3SWFA 3G84A 1WT6A 5KJ7A 3CFWA 1BYFA 3O8ZA 5AVYB 2I1KA 1BJ3A 3TNUA 2HPCB 4S0UA 2I1JA 3V2PA 3RL0B 4WUXA 1KWUA 1UMRC 2W6BA 4W7YA 3LIEA 1SB2A 1X2TB 3P8MC 1F00I 4N33A 5AW3B 1V4LB 2YHFA 4LLHA 3U1AA 1RF0A 1IO4A 5AVWB 1OWAA 1BCJ1 3V2QA 1B08A 3CDGF 2OYIC 3P7HA 1FJKA 4N6JA 1GW4A 1L4AA 2MJZA 3PP5A 3BX4A 4KI1E 2C0XA 1C3AB 3RK2B 1KWYA 1L4AD 2LKMA 1LTAC 1KWZA 3M0DC 1JWIA 4UXMA 3KYQA 1TLGA 5AW2B 1FZCA 1H88A 1QO3C 4IOPA 1RDM1 2R5BA 1LGHB 2RIEA 4ZETA 1KZC1 3HE4B 1UKMB 2JEEA 4N78D 4KMB1 3TYYA 3V4QA 3UBUA 1VPCA 1HQ8A 1JCDA 1RF1A 1BCH1 1RDJ1 3R2PA 3VMXA 5AVZB 2L5GB 3WMM0 2WTYA 1J34A 1FZAA 2N9BA 1KX0A 3BDWB 1NTMK 1T8DA 4LC1A 1T2KD 2W6AA 4J6PA 4N32A 1WK1A 3ALSA 1BJ3B 1LWUC 4ZRVA 1LITA 1LWUA 1YPOA 1UMRA 3B5NC 2R32A 3U1CA 3ALTA 1KWVA 4WRCA 1E8IA 1CSBA 1FBMA 1E5WA 2HODA 4C7NA 1WMYA 2H8PD 3RL0D 3L9JC 2P2UA 5APQA 2QM8A 1F02I 3HTKB 4KHXA 3V2RA 3GHGA 3GHGC 4GJXA 4CSYA 2MSBA 1BUUA 1LT9B 1MFZA 5CJ0A 3RK2C 1HWTC 2HLOA 1KZD1 1KZE1 1HVVA 3WBRA 2PAJA 1N7SB 3RK2D 1WMZA 1AFOA 3GPRC 1KZB1 5AW5B 5KLVK 4M1GA 3M06A 4ZKPA 2FYUK 3CL3D 3BVHA 1DY0A 3WBPA 2NPSD 1SB2B 1X2TA 1V7PA 1UKMA 2O01H 3G8KA 3H6PA 2VUVA 3G3ZA 2A45G 5AVXB 1RF0C 2Z5HA 1X8YA 4I6MC 4HYTB 3IKRA 3BX4B 1KWWA 1NU1K 5FFSA 1N7SD 2GO0A 3ZHGA 1FU1A 3BRTB 4C46A 2E3XC 3P7GA 3P5EA 3M9HA 5APYA 1FZCB 3B5NA 1ZLLA 2VRSA 3HUPA 1JY2P 1WT9A 3E1IA 2WWWA 2XR6A 4ZKUA 3HTKA 1IC2A 3NMDA 1FZGA 2C9LY 3A7OA 4WBAA 1IFIA 4GK1A 3LIDA 5FFTA 2BPHA 2HFED 1T3UA 2NPSB 2XDJA 2YO2A 3L37A 1HBWA 3FF9A 4QKGA 2O1JA 4N3YB 1FIFA 2GGUA 4I1LA 3L4FA 2WSEH 2J59M 1IJKC 3TK1A 1RDK1 2Z4EA 3H32A 4DOJA 1ZR2A 1IODA 2HODB 2BPDA 3V5BA 3VMZA 1K9JA 1U0NC 3CADA 1KFMA 1LTIC 1O7CT 4ZESA 4WR9A 2Q9IA 1Y17A 2ZFCA 2OYIA 3C8JA 5CMZA 3IFMA 4N38A 1DY2A 2H2RA 4EZMG 5LGKE 3SWYA 2C0WA 2J58A 3M0DA 3VN0A 4AQRD 5BU8B 1IXXA 1G1SA 1K9IA 1FZCC 3ZHGD 4YLIA 3GPRA 2GGXA 3MTUE 5BU5A 1AQ5A 1L4AB 1GDTA 5AW9B 1HUPA 3MUDA 1U0OB 1XARA 5KTHA 4EOTA 2FXMA 2P67A 1URQD 1P4LD 2KMB1 5J6GG 1HGZA 2CPSA 3HD7A 5APVA 1SFCD 2FKWB 1M1JC 3HD7C 4M17A 3RK3B 3IKQA 3I5CA 1GK6A 2IPPA 2ZWKA 1JTHB 5AW4B 1H89A 4WUWA 5B1RA 1KILC 1RE4A 4WY4B 1KILA 1RE4C 1NKZB 1GU5A 3P7FA 3L35A 1TN3A 1X2WB 1E87A 1GL2B 1HUCA 5AW6B 2KSJA 1TDQB 1NHLA 4AUWA 3UBUB 1FZBA 2WPSA 1T8CA 4GJ0A 3ALUA 3MD0A 1RF1B 1YPQA 4PDCA 5AW8B 1UOSB 4DZOA 1S9KE 1IXXB 3NCXA 4HH2A 4WB4A 5KJ7D 2OX9A 1GD2E 1XTCC 2JJLA 4RESB 2WSFH 1DX7A 1JOCA 1JY2N 5AVUB 1CI6A 2H7HA 3FF7C 3M0AA 3A5TA 5APTA 1Z56A 1DY1A 2BRSA 3RK3D 2IFNA 2AFPA 3KMB1 3PAKA 4AYCA 1NH4A 3RK3C 3IKPA 2O1KA 4J6MA 3N7NA 1IK9A 4GI0A 3HRNA 1WRGA 3BDWA 2ZQKA 2WPQA 5AW0B 4LQFA 3VOPA 1W2EA 3HE5A 1MV8A 1OZ7B 1NAFA 3G83A 1J35A 5B1WA 3L36A 5AVTB 5APSA 1FOSE 4LGDE 1MSBA 1L0LK 2FFDB 1KQLA 2C9NY 1IFNA 2WT7A 1G1IA 1H8AA 3CI9A 1DH3A 3EFGA 2KLVA 5CHXA 1J1DC 2PP6A 4KZWA 1IFJA 5APUA 3P8CE 4N78E 2ORKA 1UV0A 2YKQA 5KTBA 4J6JA 1IFMA 1M7LA 3IKNA 1M1JA 4JYBA 1V4LA 1SQXK 1WT9B 1MUUA 3WWKA 2KV3A 4I2LC 4EIJA 2RICA 4C9FA 4AK8A 4J6QA 5CCHC 4G9AA 1FJPA 3NCWA 5M62A 2N1TB 1IFDA 4M18A 4C7RA 3CDGE 3VYIA 1MZ9A 2HYNA 3A2AA 3TNUB 1NTZK 2HPCA 4IOPB 2E3XB 3FF8C 1NKNA 3M91A 3T3AA 4WCOA 1YXKA 3HE5B 2YKPA 1YTTA 3M9BA 2FFDA 2P1JA 2FFDC 1VDFA 3IR9A 3GPRD 3B8EB 1ESLA 2W27A 4W80A 1KZUB 2M3BA 3II6A 3UIAA 1N73B 3OJAB 1GZ2A 2POHA 1JO5A 1IJDB 2PY2A 1QDDA 1SFCB 1YTZI 1A02F 3EQ2A 1LTGC 1JY2O 3BRVB 3P7KA 2OX8A 3LW5H 1FOSF 1JWIB 2IX7C 2XNXA 1N7SC 1SVFA 1OZ7A 1S9KD 1J1EB 3VYKA 3B5ND 3WHDA 2E43A 2N1TD 4QKIA 3WWKC 4DN8A 2HG5D 1T2KC 2CL8A 4GT1A 3A3YB 3NFQA 1X9VA 2N1TA 2XR5A 4Y99C 2WT7B 2OARA 3OA7A 5AVQB 1E5UI 1NOHA 5APWA 2IT5A 1JY3O 1SQPK 4IFMA 1ZV8A 4WY4D 1FDMA 4J6LA 2XKMA 5CCHD 2IT6A 3P32A 1PW9A 4GKOG 1KILB 4WY4C 5CCGA 1KG0C 1SQVK 2VRPA 3K7BA 1MUQA 1LTBC 5KTIA 2WITA 1YTZT 1V7PB 1G2CA 2OS9A 4WQQA 1N73C 2Q5UA 2Z5IA 1KOEA 1LTTC 1GK4A 2MTIA 5AVSB 1UOSA 3C8KD 2I83A 1T8ZA 1RTM1 3WWKB 2P7JA 1RDL1 2KB7P 3NTNA 4N37A 3DBZA 3V2NA 5APXA 2XU6A 3HD7B 2A45I 3HUSA 1KCGA 1CI6B 1UEXA 1A02J 1BNLA 2WSCH 3B5NB 4KZVA 5CJ4A 2KOGA 2YNYA 2ZIBA 1FVUA 1RDN1 1NTKK 1YPUA 1N7SA 4O9BA 1L0NK 1KX1A 3RS1A 2XV5A 5AVVB 1RJHA 2N1TC 1JCCA 3U59A 1NWQA 2YMYA 1SQQK 2BPEA 4GIFA 3RL0C 1J35B 2H2TB 2YKOA 5CCGC 1HJBA 4IFDK 1RDO1 2XZRA 1SL5A 1T3JA 1NO4A 2GUVA 1GU4A 1GW3A 1IJKB 2C6UA 5CCGD 1O7BT 1PFIA 1HYRA 2GM4A 1IODB 2RIDA 3VTPC 1YXJA 1FAVA 1HH0A 3G81A 1JNMA 1JUNA 1DV8A 4N36A 3BASA 5BVZA 3WH2A 2OYIB 1QL1A 1N7LA 1GZLA 1RY3A 1J1DB 2E42A 2RIAA 5AW1B 5F2QA 1FZFA 2YO3A 4B86A 3HUSC 2IFMA 2Q3IA 1JY3N 5CCHA 2NPSC 1C3AA 2M94A 2NPSA 3HUSB 1ZN5A 1FVUB 1CZQA 3C22A 1AFB1 5FFRA 3WH3A 2Q7CA 4C7NB 1URQB 2VRPB 3GPRB 1U0OA 1U0NB 2RIBA 3HE4A 3PARA 3MIWA 2A45H 4QKHA 4WRFA 3M9ZA 3H32B 1LT9A 3P5FA 1J34B 4IFFA 3V4WA 1GTWA 1RDI1 1Y17B 4MTHA 3WBQA 4ZRWA 1AFA1 2WPRA 1J2JB 1SP4A 1SL6A 3P5HA 4E52A 1HTLC 3N4XA 1G1RA 1UEXB 3VP8A 1FM5A 1JMMA 1PWBA 2WZ7A 1OXZA 3MGNA 1RF1C 1KWTA 1LTJB 2BASA 5AW7B 1G1TA 4J6KA 2R3CA 1YYCA 1SFCA 1FZEA 2M8RA 2KP8A 3KQGA 1KMB1 1SLQA 3KPEA 3P5DA 4LU5A 1R13A 2N40A 2LS8A 5AVRB 4C16A 1G1QA 4J6NA 3GHGB 3PAQA 3C9IA 3OAKA 2KYVA 1HTNA 1KILD 4PP8A 3VMYA 1JY3P 1CW5A 1XPHA 1JTHA 4CAJA 2OYHB 2PF5A 1KZA1 4WY4A 3VP9A 4N34A 3P8CD 2OYHC 1BV4A 4N35A 1X2WA 1J1EC 4GKGA 3M9QA 3BATA 2R5DA 1EGIA 3P5GA 3CLQA 1GL2C 1FIHA 2ZXEB 1GL2A 1LT9C 1N73A 1B6EA 4Y99B 5KJ7C 2H43A 1HGVA 1GL2D 3T97A 4WREA 1DEBA 1N2DC 1KFNA 3CCKA 1QL2A 2CPBA 3KDPB 1G2CB 5B1XA 1LTSC 1EGGA 4UWWA 1MPUA 1LTJA 1LTJC 5K8YA 1URQC 1AFD1 1URQA 1SL4A 4QKJA 4XA4A 1R14A 3NXSA 4JYCA 1CWVA 1JA3A 1KWXA 4G96A 1H8UA 1N86A 1SFCC 3HD7D 3TSIA 1G1JA 1L4AC 4JF7A 4OH8B 1ZR4A 3VPPA 2FYZA 2VUZA 1M1JB 3VLGA 3FD4A 1LWUB 2GUSA 1P1ZD 3PBFA 2QM7A 3VYJA 1EQ7A 1XTGB 1JZNA 3P5IA 2OYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3L A;  3WSR A;  4YMD A;  2ORJ A;  4XE5 B;  3G8L A;  3SWF A;  3G84 A;  3CFW A;  1BYF A;  3O8Z A;  5AVY B;  1BJ3 A;  3TNU A;  4S0U A;  4WUX A;  1KWU A;  1UMR C;  3LIE A;  1SB2 A;  1X2T B;  3P8M C;  1F00 I;  4N33 A;  5AW3 B;  1V4L B;  2YHF A;  1IO4 A;  5AVW B;  1OWA A;  1BCJ 1;  1B08 A;  3CDG F;  3P7H A;  4KI1 E;  3BX4 A;  1C3A B;  1KWY A;  1KWZ A;  1JWI A;  4UXM A;  1TLG A;  5AW2 B;  1H88 A;  1QO3 C;  4IOP A;  1RDM 1;  2R5B A;  2RIE A;  4ZET A;  1KZC 1;  3HE4 B;  1UKM B;  4KMB 1;  3TYY A;  3V4Q A;  3UBU A;  1HQ8 A;  1BCH 1;  1RDJ 1;  3VMX A;  5AVZ B;  2WTY A;  1J34 A;  1KX0 A;  2N9B A;  3BDW B;  1T8D A;  4LC1 A;  1T2K D;  2W6A A;  4J6P A;  4N32 A;  1WK1 A;  3ALS A;  1BJ3 B;  4ZRV A;  1LIT A;  1YPO A;  1UMR A;  3ALT A;  2R32 A;  4WRC A;  1KWV A;  1E8I A;  1CSB A;  4C7N A;  1WMY A;  3L9J C;  2P2U A;  5APQ A;  2QM8 A;  1F02 I;  4KHX A;  4GJX A;  4CSY A;  2MSB A;  1BUU A;  1MFZ A;  1HWT C;  1KZD 1;  1KZE 1;  3WBR A;  1WMZ A;  3GPR C;  1KZB 1;  5AW5 B;  4M1G A;  3M06 A;  3WBP A;  1DY0 A;  1SB2 B;  1X2T A;  1V7P A;  1UKM A;  3G8K A;  2VUV A;  5AVX B;  2Z5H A;  1X8Y A;  4I6M C;  4HYT B;  3IKR A;  3BX4 B;  1KWW A;  5FFS A;  2GO0 A;  3ZHG A;  4C46 A;  2E3X C;  3P7G A;  3P5E A;  3M9H A;  5APY A;  2VRS A;  3HUP A;  1WT9 A;  2WWW A;  2XR6 A;  3HTK A;  3NMD A;  2C9L Y;  3A7O A;  4GK1 A;  3LID A;  5FFT A;  2BPH A;  1HBW A;  2YO2 A;  3FF9 A;  3L37 A;  4QKG A;  1FIF A;  2GGU A;  1IJK C;  1RDK 1;  3TK1 A;  1IOD A;  2BPD A;  3V5B A;  3VMZ A;  1K9J A;  1U0N C;  3CAD A;  1O7C T;  4ZES A;  4WR9 A;  1Y17 A;  2ZFC A;  3C8J A;  5CMZ A;  4N38 A;  1DY2 A;  2H2R A;  4EZM G;  5LGK E;  3M0D A;  4AQR D;  3VN0 A;  1IXX A;  1G1S A;  1K9I A;  3ZHG D;  4YLI A;  3GPR A;  2GGX A;  1U0O B;  5AW9 B;  1HUP A;  1XAR A;  5KTH A;  4EOT A;  2P67 A;  1P4L D;  2KMB 1;  5J6G G;  5APV A;  4M17 A;  3IKQ A;  3I5C A;  1GK6 A;  2IPP A;  2ZWK A;  5AW4 B;  1H89 A;  4WUW A;  5B1R A;  1GU5 A;  3P7F A;  3L35 A;  1TN3 A;  1X2W B;  1E87 A;  1HUC A;  5AW6 B;  1TDQ B;  4AUW A;  3UBU B;  2WPS A;  1T8C A;  4GJ0 A;  3ALU A;  3MD0 A;  4PDC A;  1YPQ A;  5AW8 B;  1UOS B;  4DZO A;  1S9K E;  1IXX B;  3NCX A;  2OX9 A;  1GD2 E;  2JJL A;  4RES B;  5AVU B;  1CI6 A;  2H7H A;  3FF7 C;  3M0A A;  3A5T A;  5APT A;  1DY1 A;  2BRS A;  2AFP A;  3KMB 1;  3PAK A;  4AYC A;  3IKP A;  4J6M A;  4GI0 A;  3BDW A;  2ZQK A;  2WPQ A;  5AW0 B;  4LQF A;  3HE5 A;  1MV8 A;  1OZ7 B;  1NAF A;  3G83 A;  1J35 A;  5B1W A;  3L36 A;  5AVT B;  5APS A;  1FOS E;  1MSB A;  1KQL A;  2C9N Y;  2WT7 A;  1DH3 A;  1H8A A;  4KZW A;  5APU A;  2ORK A;  1UV0 A;  4J6J A;  3IKN A;  4JYB A;  1V4L A;  1WT9 B;  1MUU A;  3WWK A;  2KV3 A;  4I2L C;  2RIC A;  4AK8 A;  4J6Q A;  4G9A A;  3NCW A;  5M62 A;  4M18 A;  3CDG E;  3VYI A;  3A2A A;  3TNU B;  4IOP B;  2E3X B;  3FF8 C;  3T3A A;  3M91 A;  4WCO A;  1YXK A;  3HE5 B;  1YTT A;  3M9B A;  3IR9 A;  3GPR D;  3B8E B;  1ESL A;  2W27 A;  3UIA A;  1GZ2 A;  2PY2 A;  1QDD A;  1A02 F;  3P7K A;  2OX8 A;  1FOS F;  1JWI B;  1OZ7 A;  1S9K D;  3VYK A;  3WHD A;  2E43 A;  4QKI A;  3WWK C;  4DN8 A;  2CL8 A;  1T2K C;  2XR5 A;  4GT1 A;  3A3Y B;  3NFQ A;  4C9F A;  1E5U I;  2WT7 B;  2IT5 A;  5AVQ B;  5APW A;  4J6L A;  2IT6 A;  3P32 A;  1PW9 A;  4GKO G;  1KG0 C;  2VRP A;  3K7B A;  1MUQ A;  5KTI A;  1V7P B;  2OS9 A;  4WQQ A;  1KOE A;  2Q5U A;  2Z5I A;  2MTI A;  1GK4 A;  5AVS B;  1UOS A;  3C8K D;  2I83 A;  1RTM 1;  3WWK B;  2P7J A;  1RDL 1;  3NTN A;  4N37 A;  3DBZ A;  5APX A;  2XU6 A;  1KCG A;  1CI6 B;  1UEX A;  1A02 J;  1BNL A;  4KZV A;  2YNY A;  2ZIB A;  1FVU A;  1RDN 1;  1YPU A;  1KX1 A;  3RS1 A;  2XV5 A;  5AVV B;  1RJH A;  1NWQ A;  2BPE A;  2H2T B;  1J35 B;  1RDO 1;  1HJB A;  2XZR A;  1SL5 A;  1GU4 A;  1IJK B;  2C6U A;  1O7B T;  1HYR A;  1IOD B;  2RID A;  3VTP C;  1YXJ A;  1FAV A;  3G81 A;  1JNM A;  1JUN A;  1DV8 A;  4N36 A;  3WH2 A;  1GZL A;  2E42 A;  2RIA A;  5AW1 B;  5F2Q A;  2YO3 A;  4B86 A;  2Q3I A;  1C3A A;  2M94 A;  3C22 A;  1FVU B;  1CZQ A;  5FFR A;  1AFB 1;  3WH3 A;  2Q7C A;  4C7N B;  2VRP B;  3GPR B;  1U0O A;  1U0N B;  2RIB A;  3HE4 A;  3PAR A;  4WRF A;  4QKH A;  3M9Z A;  3P5F A;  1J34 B;  3V4W A;  1GTW A;  1RDI 1;  1Y17 B;  4MTH A;  3WBQ A;  4ZRW A;  1AFA 1;  2WPR A;  1J2J B;  1SP4 A;  1SL6 A;  3P5H A;  4E52 A;  1G1R A;  1UEX B;  1FM5 A;  1PWB A;  1OXZ A;  3MGN A;  1KWT A;  2BAS A;  5AW7 B;  1G1T A;  4J6K A;  1YYC A;  1KMB 1;  2R3C A;  2KP8 A;  3KQG A;  1SLQ A;  3P5D A;  4LU5 A;  1R13 A;  2N40 A;  2LS8 A;  5AVR B;  4C16 A;  1G1Q A;  4J6N A;  3PAQ A;  1HTN A;  3OAK A;  4PP8 A;  3VMY A;  1XPH A;  4CAJ A;  2PF5 A;  1KZA 1;  4N34 A;  1BV4 A;  4N35 A;  1X2W A;  4GKG A;  2R5D A;  1EGI A;  3P5G A;  1FIH A;  2ZXE B;  1B6E A;  3T97 A;  4WRE A;  3CCK A;  3KDP B;  1G2C B;  5B1X A;  1EGG A;  4UWW A;  1MPU A;  5K8Y A;  1AFD 1;  1SL4 A;  4QKJ A;  1R14 A;  3NXS A;  4JYC A;  1CWV A;  1JA3 A;  1KWX A;  4G96 A;  1H8U A;  3VPP A;  2VUZ A;  3VLG A;  3FD4 A;  1P1Z D;  3PBF A;  2QM7 A;  3VYJ A;  1JZN A;  3P5I A; 
#chains in the Genus database with same CATH topology
 4W7Z A;  1RE3 C;  4JBZ A;  3Q5P A;  4YMD A;  2ORJ A;  2ZVN B;  1L0L J;  3G84 A;  2JWA A;  5KJ7 A;  3CFW A;  1BDD A;  1OX3 A;  3L73 G;  4W7Y A;  1SB2 A;  1X2T B;  4BXL A;  1V4L B;  2YHF A;  4LLH A;  3U1A A;  1IO4 A;  5AVW B;  2M5A B;  3P7H A;  1GW4 A;  1L4A A;  2MJZ A;  5B66 E;  1S3J A;  1IK7 A;  1LTA C;  1JWI A;  4UXM A;  2R5B A;  1LNQ A;  1AJY A;  1PGP A;  1BGY D;  2JEE A;  4GOD A;  4N78 D;  3V4Q A;  3UBU A;  1SQQ E;  1RF1 A;  4PV1 C;  1J34 A;  3FX0 A;  2ZXX A;  4J6P A;  4N32 A;  1BJ3 B;  4ZRV A;  1LIT A;  1LWU A;  5KKZ C;  3B5N C;  2R32 A;  3PTZ A;  1EZV E;  1E5W A;  1FBM A;  2H8P D;  1L0N D;  5APQ A;  1LJ2 A;  4KHX A;  1LP1 A;  3V2R A;  4PD4 I;  2E76 B;  2ZYD A;  2MSB A;  1BUU A;  5CJ0 A;  1HWT C;  4XFJ A;  3WBR A;  4PD4 E;  3GPR C;  5AW5 B;  3CL3 D;  4H44 C;  2SPZ A;  2A45 G;  3G3Z A;  1NVO A;  1RF0 C;  1X8Y A;  1PGJ A;  1NU1 K;  5FFS A;  1S5L H;  2E3X C;  1SQV D;  1AA0 A;  2QE7 H;  2B87 A;  2VRS A;  3HUP A;  1JY2 P;  1RQV A;  2Q6Q A;  2QG4 A;  3JC2 2;  2BEQ D;  1Q7Y Q;  1NTK G;  2K9J A;  1FZG A;  3FWL A;  2C9L Y;  3A7O A;  1IFI A;  3LID A;  5FFT A;  3H1L D;  3L37 A;  1DIP A;  4N3Y B;  1FIF A;  2E74 C;  1IJK C;  2J59 M;  1VQP P;  2Z4E A;  3H32 A;  1K9J A;  4PJ0 E;  1O7C T;  2FXO A;  2Q9I A;  1Y17 A;  2ZFC A;  2Q3E A;  1S2E A;  1YQ3 C;  5LGK E;  1SQP G;  1KN7 A;  3SWY A;  4AQR D;  1G1S A;  4YLI A;  3GPR A;  2B88 A;  5BU5 A;  1AQ5 A;  1GDT A;  1ZW0 A;  2FBW C;  1U0O B;  4H44 B;  4EOT A;  5J6G G;  1HGZ A;  1SFC D;  2FKW B;  4M17 A;  3RK3 B;  2B89 A;  1JTH B;  4L76 A;  3AE2 C;  3B71 A;  1H89 A;  1U57 A;  2O3J A;  1GU5 A;  1NKZ B;  3L35 A;  2B87 B;  3L72 D;  1E87 A;  1GL2 B;  1TDQ B;  1NHL A;  4AUW A;  1FZB A;  4GJ0 A;  4PDC A;  2M0B A;  2KLU A;  1S5L X;  1FS0 E;  1KYO D;  1KB9 H;  3NCX A;  4HH2 A;  3RGU A;  1JOC A;  5AVU B;  1Z56 A;  1DY1 A;  3PAK A;  4AYC A;  1NTM G;  3RK3 C;  4D6T D;  3N7N A;  3G9R A;  3HRN A;  1WRG A;  2WPQ A;  2ZVO B;  3VOP A;  1MV8 A;  1OZ7 B;  3L75 J;  1NAF A;  2IZ1 A;  3L36 A;  4LGD E;  3SFE C;  1KIL E;  1EDK A;  1G1I A;  3O6Q A;  3G4S P;  2PP6 A;  3MUD C;  1IFJ A;  1UV0 A;  2YKQ A;  1M1J A;  1ZXG A;  1NYH A;  1WT9 B;  1VQK P;  3WWK A;  5M62 A;  1Q2N A;  3AEB C;  3VYI A;  3L71 D;  1MZ9 A;  3A2A A;  4IOP B;  2KS1 B;  3T3A A;  3M91 A;  2IYP A;  1VDF A;  3IR9 A;  2W27 A;  1KZU B;  3GG2 A;  2OYO A;  2E76 C;  3BRV B;  3AEE C;  1BDC A;  1JWI B;  2XNX A;  1YI2 P;  1N7S C;  1SVF A;  5B5E H;  1SQV J;  4YTP C;  3B5N D;  2W83 C;  1Q86 Q;  1SQB D;  1T2K C;  3A3Y B;  1E5U I;  3OA7 A;  5AVQ B;  2GA1 A;  2IT5 A;  1JY3 O;  1SQQ G;  1SQP K;  4IFM A;  3H1I E;  4OVN F;  4GKO G;  4U3F G;  1KIL B;  4ASV A;  5CCG A;  1VQO P;  1SQV K;  1YTZ T;  4TLF A;  1G2C A;  4IL6 E;  3CC7 P;  2OS9 A;  1ZRT E;  2Q5U A;  2MTI A;  2KB7 P;  5APX A;  3HUS A;  1KCG A;  1BNL A;  4KZV A;  1DEE G;  3L73 E;  3I56 P;  1RDN 1;  2ZIB A;  1USE A;  5CBO A;  1RJH A;  2N1T C;  2P58 A;  4PD4 H;  3CXH H;  4OGQ D;  5B5E E;  4GIF A;  1YIT P;  3USS A;  3E7K A;  1SL5 A;  2GUV A;  3CCL P;  1GW3 A;  2FYU D;  4U7J A;  3VTP C;  3D6Z A;  5BVZ A;  3Q5R A;  2OYI B;  3H1I J;  1RY3 A;  3T97 B;  2E42 A;  1EDI A;  5F2Q A;  3H25 A;  2YO3 A;  2W8Z A;  3HUS B;  1CZQ A;  5FFR A;  3S1K A;  4GOE A;  3PAR A;  3MIW A;  4QKH A;  2A06 E;  1LT9 A;  3P5F A;  3H1K J;  4ZRW A;  1AFA 1;  2WPR A;  1SL6 A;  3VP8 A;  4IL6 H;  3MGN A;  1LTJ B;  1FZE A;  2KP8 A;  1SLQ A;  3P5D A;  2KSE A;  2N40 A;  2H89 C;  1Y8A A;  5AVR B;  2FYN C;  1G1Q A;  3CXH D;  2KYV A;  4H0L C;  1MKM A;  2E75 C;  2G8Y A;  2OYH B;  1X2W A;  2QJY C;  1J1E C;  2R5D A;  1M8O B;  5KJ7 C;  3CCV P;  1SQV E;  3Q2Y A;  1KFN A;  2CPB A;  4UWW A;  1LTJ A;  1LTJ C;  1AFD 1;  1URQ A;  4QKJ A;  1R14 A;  3NXS A;  1OW8 A;  4JYC A;  2AEJ A;  4OH8 B;  2YMK A;  1PPJ E;  3FWN A;  2VUZ A;  1M1J B;  1PGQ A;  1P84 I;  3RL0 g;  2GUS A;  3AEA C;  2R3S A;  2WQY C;  1JMB A;  4H13 B;  1X79 B;  3SWF A;  1WT6 A;  3Q1M A;  2QIW A;  4S0U A;  4R4L A;  4EI2 A;  3LIE A;  1F00 I;  4R4M A;  3V2Q A;  1B08 A;  3CDG F;  2OYI C;  1SQX J;  4KI1 E;  3BX4 A;  2C0X A;  3TF5 A;  1OZH A;  3RK2 B;  3G6E P;  1KWY A;  5AW2 B;  4IOP A;  1LGH B;  2RIE A;  1KZC 1;  1SS1 A;  1VPC A;  1HQ8 A;  1JCD A;  1BCH 1;  3R2P A;  2WTY A;  3L72 G;  2N9B A;  3BDW B;  1NTM K;  1VQ6 P;  3A0H H;  1T2K D;  1P84 E;  1WK1 A;  3ALS A;  1LWU C;  1UMR A;  3FXE A;  2OTK E;  2Y9Z A;  5DJU B;  1WMY A;  3RL0 D;  2P2U A;  2WSC J;  5B66 H;  3CCJ P;  1RQU A;  4YXW H;  2Y0D A;  2K3R A;  2G3A A;  3RK2 C;  2HLO A;  2RMZ A;  1JM0 A;  2YIU B;  3E1R A;  1KZB 1;  4M1G A;  3H1L G;  2FYU K;  1DY0 A;  2NPS D;  1V7P A;  1UKM A;  2O01 H;  2VUV A;  4I6M C;  1KYO H;  1QGK B;  4KJM A;  3BX4 B;  2KIK A;  4BRY B;  3A0B H;  3P7G A;  3P5E A;  4OGQ C;  1X0T A;  1EZV D;  1WT9 A;  2OGU A;  3E1I A;  2WWW A;  2XR6 A;  4ZKU A;  1BGY J;  1IC2 A;  2M3E A;  2V4H A;  4GK1 A;  2HFE D;  4QKG A;  2O1J A;  2E74 B;  2GGU A;  4I1L A;  3L4F A;  3C1L A;  1RDK 1;  4DOJ A;  1NU1 D;  2JP3 A;  2HOD B;  1LTI C;  1L2P A;  4H44 D;  1N8R Q;  4WR9 A;  2LXC B;  2K9Y A;  3L73 D;  2QJP C;  2OYI A;  3F89 A;  3C8J A;  4N38 A;  1DY2 A;  2H2R A;  2ZYG A;  1K9I A;  2D2C D;  5H2F H;  3L71 J;  2GGX A;  4YXD C;  1L4A B;  5AW9 B;  1HUP A;  4JQ0 D;  2PGD A;  2FXM A;  1P4L D;  2KMB 1;  2KUB A;  3HD7 A;  3LW5 J;  3HD7 C;  2IPP A;  1SQB G;  5AW4 B;  4WUW A;  5B1R A;  1KIL A;  3P7F A;  3SSU A;  2E74 D;  3CC2 P;  1BGY E;  2KSJ A;  3UBU B;  1PP9 G;  1T8C A;  1YPQ A;  1IFP A;  1IXX B;  2AXT H;  3PJS K;  4WB4 A;  5KJ7 D;  2AXC A;  3AE6 C;  4RES B;  3H1L J;  1CI6 A;  5APT A;  1YJW P;  1BCC E;  2R44 A;  2RKL A;  2D2C B;  1WMK A;  1UII A;  4OWF A;  5TJH A;  2AFP A;  3KMB 1;  2O1K A;  5AW0 B;  4WVZ A;  5C39 A;  1W2E A;  4UB6 E;  2A06 G;  3G83 A;  5AVT B;  5CBN A;  1EC5 A;  2FFD B;  2WT7 A;  1LP1 B;  3QWO C;  3EFG A;  5CHX A;  3PH0 A;  5APU A;  4RJT A;  5KTB A;  3Q3D A;  2DW3 A;  4J6J A;  1W5C E;  2JKV A;  1V4L A;  3CXH I;  3H1J D;  4EIJ A;  2RIC A;  2JDI H;  5KLV E;  4G9A A;  1FJP A;  1YJ9 P;  2N1T B;  1IFD A;  1BSH A;  2HPC A;  1NTZ K;  3FF8 C;  1K04 A;  1FC2 C;  2YKP A;  1YIJ P;  2WSE J;  2P1J A;  3GPR D;  4W80 A;  2M3B A;  3II6 A;  1N73 B;  1Y9B A;  4HB1 A;  3F5H A;  5L8R J;  3O6Q B;  1OMI A;  3IN6 A;  3P7K A;  3LW5 H;  2QA4 P;  1KC8 Q;  1VF5 C;  1OZ7 A;  3VYK A;  2YXQ B;  2E43 A;  5KAI E;  4DN8 A;  2HG5 D;  2N1T A;  2LR2 A;  4U3F E;  5APW A;  4WY4 D;  4J6L A;  1Q90 D;  2IT6 A;  3P32 A;  2VRP A;  1YQ4 C;  3R4Y A;  2OTJ P;  1PGO A;  1M90 Q;  4YPC A;  1K05 A;  1KV4 A;  4WQQ A;  1N73 C;  1GK4 A;  1R5L A;  2ITA A;  1DD3 A;  3NTN A;  4N37 A;  2XU6 A;  2A45 I;  2WSF J;  2BCC G;  1A02 J;  2E76 D;  3MZW B;  1NTK K;  1YPU A;  4ZMD A;  4O9B A;  3RS1 A;  3W68 A;  3D71 A;  1JCC A;  1NWQ A;  1J35 B;  1RDO 1;  3KZI H;  2QJK C;  4RO0 A;  1IJK B;  5CCG D;  4H13 C;  1ZRT D;  1VQN P;  1UIX A;  1FE6 A;  1QL1 A;  1N7L A;  5CCH A;  1ZN5 A;  3JSV C;  2Q7C A;  4C7N B;  2VRP B;  5KLI B;  3AE1 C;  1USD A;  1U0O A;  2RIB A;  4QMA A;  3CX5 H;  1M56 D;  2D2C C;  1VQL P;  4WRF A;  1S4X A;  3L74 J;  4KT0 J;  3V4W A;  2LXB A;  4MTH A;  1SP4 A;  3IAO A;  4E52 A;  1KMI Z;  1P84 H;  1G1R A;  2JWD A;  1FM5 A;  1JMM A;  1PWB A;  1G1T A;  4J6K A;  1M1K Q;  3KPE A;  4LU5 A;  1R13 A;  2LS8 A;  1BE3 G;  4I7Z C;  1R8E A;  4DT0 A;  4PP8 A;  1KIL D;  2YIU C;  1CW5 A;  3PHL A;  1S1C X;  4CAJ A;  2PF5 A;  3H1K G;  3C8V A;  3CPW O;  1GL2 C;  1FIH A;  3D70 A;  1GL2 A;  2ZXE B;  1N73 A;  3H1J J;  1HGV A;  3D6Y A;  3T97 A;  3WU2 H;  3H1I D;  3QH9 A;  4L73 A;  4H0L B;  1VQM P;  1NAY A;  1MPU A;  1URQ C;  4XA4 A;  2ZT9 D;  4U3F J;  1KWX A;  3TSI A;  1L4A C;  4JF7 A;  2HR3 A;  4UB6 H;  1FDO A;  2FYZ A;  3FD4 A;  2O01 N;  1P1Z D;  1NTZ D;  3H1K D;  3PBF A;  2QM7 A;  3VYJ A;  3H1H D;  1EQ7 A;  1XTG B;  3S4R A;  3CX5 E;  3CCU P;  1SQB K;  3EFF K;  3O8Z A;  5AVY B;  2I1K A;  1BJ3 A;  3TNU A;  1QVF O;  3AEC C;  4NPE A;  2ZT9 B;  1UMR C;  1NTK E;  2E5Y A;  1SQX G;  4TT3 H;  2IYO A;  1FJK A;  4N6J A;  3WUT A;  3PP5 A;  1C3A B;  1KWZ A;  3M0D C;  1TLG A;  1H88 A;  1QO3 C;  1RDM 1;  4ZET A;  2WPV B;  4KMB 1;  2IBZ E;  1R5S A;  1RDJ 1;  3VMX A;  1SQV G;  2L5G B;  3WMM 0;  1FZA A;  1KX0 A;  2W6A A;  1K73 Q;  3SWK A;  4WRC A;  3U1C A;  1E8I A;  1CSB A;  1NTK D;  2HOD A;  4C7N A;  2NZ2 A;  2QM8 A;  1F02 I;  3HTK B;  1EZV G;  3A0H E;  3GHG C;  4GJX A;  2FYU E;  4CSY A;  1LT9 B;  1KZD 1;  1HVV A;  1N7S B;  1WMZ A;  1AFO A;  1W2B O;  3TGU J;  1SB2 B;  1X2T A;  1NTZ E;  1VQ7 P;  3G8K A;  3H6P A;  3GF7 A;  1NTZ J;  4HYT B;  3IKR A;  1KQS O;  3ABV C;  1ZME C;  4BWN A;  1KWW A;  2GO0 A;  3ZHG A;  3BRT B;  4C46 A;  1P84 D;  3M9H A;  5APY A;  2QVA A;  1ZLL A;  3B5N A;  3B4S A;  1L0N G;  2FY8 A;  2V7Q J;  3NMD A;  2ZYA A;  1HBW A;  4OGQ B;  2WSE H;  1NTM J;  2NRG A;  3CCQ P;  1ZR2 A;  1IOD A;  2BPD A;  3VMZ A;  4ZES A;  2AEF A;  3CX5 D;  2N9Y B;  3H1J G;  1QLE D;  3GMA A;  2C0W A;  2J58 A;  3CX5 I;  3M0D A;  3ZHG D;  2KK7 A;  3TDK A;  3RK3 E;  2P67 A;  4U3F D;  1L0N E;  3CMA P;  2CPS A;  4EDF A;  1KB9 D;  1NTK J;  1RHZ B;  1GK6 A;  2WMM A;  4UB8 H;  1KIL C;  1RE4 C;  1TN3 A;  1HUC A;  3AEF C;  1NJI Q;  3AEG C;  3V6I A;  3ALU A;  3MD0 A;  3AE8 C;  5AW8 B;  1NTZ G;  1UOS B;  1KTM A;  2L91 A;  2OX9 A;  1XTC C;  2WSF H;  1JY2 N;  3AE7 C;  3FF7 C;  3M0A A;  3CWB D;  3A5T A;  3H1J E;  2BRS A;  3RK3 D;  2Q1K A;  4PV1 B;  4J6M A;  4GI0 A;  1AV1 A;  1K8A Q;  3BDW A;  2OTL P;  3HE5 A;  1J35 A;  5B1W A;  3FXD A;  1FOS E;  1KD1 Q;  1L0L K;  1KQL A;  1IFN A;  1DH3 A;  1H8A A;  2AEM A;  2KLV A;  1K9M Q;  4KZW A;  4Y28 J;  2ZJS E;  3WU2 E;  4N78 E;  1NTM D;  1IFM A;  1M7L A;  3IKN A;  4GDO A;  4IOI H;  1SQX K;  2FYU J;  1EXI A;  1MUU A;  2FXP A;  4CPG A;  2KV3 A;  4I2L C;  2BCC J;  4AK8 A;  4J6Q A;  5CCH C;  4C7R A;  3TNU B;  2E3X B;  1OW7 A;  1NKN A;  4ZNC A;  4WCO A;  1JB0 J;  3UIA A;  2FYU G;  1GZ2 A;  3JCU H;  2POH A;  1JO5 A;  3GF3 A;  2PY2 A;  1H0T A;  5KAF H;  1AVO A;  1LTG C;  1JY2 O;  1S5L E;  1NTM E;  3L74 D;  2E75 B;  1KYO I;  1KYO E;  3AE5 C;  4QKI A;  3WWK C;  2PRR A;  2CL8 A;  2JO1 A;  3CME P;  3L70 G;  1NOH A;  1QVG O;  1ZV8 A;  1FDM A;  3CC4 P;  2IBZ G;  2WSS H;  2XKM A;  1OVV A;  3PLN A;  3K7B A;  1MUQ A;  5KTI A;  4GOF A;  1VF5 B;  1KOE A;  2Z5I A;  5AVS B;  3C8K D;  1T8Z A;  1RTM 1;  2P7J A;  2Y0C A;  1OVU A;  1OVR A;  3DBZ A;  1U7J A;  2BCC D;  3V2N A;  1SQX E;  3CD6 P;  3H1K E;  3FGA D;  3B5N B;  2KOG A;  3RBZ A;  1YJN P;  1KX1 A;  2KZJ A;  4PV1 D;  3W67 A;  2XV5 A;  5AVV B;  1SQP E;  3U59 A;  4Z1M H;  2YMY A;  1SQQ K;  2QEX P;  2BPE A;  2YKO A;  1HJB A;  5KLV D;  2XZR A;  1T3J A;  1GU4 A;  2C6U A;  1PFI A;  1HYR A;  1IOD B;  1HH0 A;  3G81 A;  1DV8 A;  3JCU E;  4N36 A;  3WH2 A;  3L74 G;  1VL2 A;  2QSI A;  1J1D B;  2RIA A;  5AW1 B;  1FZF A;  4B86 A;  1C3A A;  1JY3 N;  2M94 A;  3WH3 A;  3GPR B;  1IZN B;  3GW6 A;  3HE4 A;  3CWB J;  5TIS H;  3H32 B;  4IFF A;  1GTW A;  4DJG A;  1Y17 B;  2KNC B;  1J2J B;  3AED C;  3ITK A;  1HTL C;  2JR8 A;  3N4X A;  1UEX B;  3AE9 C;  2WZ7 A;  5M1B A;  1KWT A;  2BAS A;  1BE3 E;  1SQB J;  1YYC A;  4J6N A;  3MP7 B;  2E75 D;  3PAQ A;  3C9I A;  3OAK A;  5KAI H;  1HTN A;  3VMY A;  1XPH A;  1JTH A;  5GTI H;  2BCC E;  4H0L D;  4WY4 A;  4N34 A;  1BV4 A;  4N35 A;  3A0B E;  1AQT A;  3IF4 A;  1EGI A;  3P5G A;  3TGU G;  1LT9 C;  4Y99 B;  4HKZ H;  4WRE A;  4D6T G;  1DEB A;  1QL2 A;  1LTS C;  5K8Y A;  4G96 A;  1N86 A;  1SFC C;  3VPP A;  1ZR4 A;  1KB9 I;  4WWI A;  1LWU B;  3CCS P;  3P5I A;  2OYH A;  4M3L A;  1HF9 A;  1RE3 A;  3WSR A;  2K1A A;  3G8L A;  4XE5 B;  2OQQ A;  2KS1 A;  1E79 H;  1BYF A;  2KXP B;  2HPC B;  2I1J A;  3V2P A;  3RL0 B;  4WUX A;  2A06 D;  1KWU A;  2W6B A;  3P8M C;  4N33 A;  5AW3 B;  1RF0 A;  1OWA A;  1BCJ 1;  1NU1 J;  1L4A D;  1PPJ D;  2LKM A;  3L73 J;  1BE3 D;  3KYQ A;  5E79 H;  1FZC A;  4ASW A;  1L0L G;  3HE4 B;  1UKM B;  1T6A A;  3TYY A;  2K9J B;  3WUV A;  2IZ0 A;  2YXR B;  5AVZ B;  2KNC A;  1QX8 A;  1T8D A;  4LC1 A;  1OIP A;  1M57 D;  1YPO A;  3BCC G;  3ALT A;  3CCM P;  1KWV A;  1FDI A;  3GLM A;  1VQ5 P;  4PJ0 H;  1YHQ P;  1BCC D;  3L9J C;  4UB8 E;  1Q81 Q;  2KZI A;  3GHG A;  3BCC E;  1MFZ A;  2K88 A;  1KZE 1;  2PAJ A;  1JEK A;  3RK2 D;  5KLV K;  1LT1 A;  3M06 A;  4ZKP A;  3BVH A;  3WBP A;  1EZV I;  4A7P A;  1U7M A;  5AVX B;  2M5A A;  5KLV G;  5E79 E;  2Z5H A;  4HJG H;  2PFX A;  4L74 A;  3CCR P;  1N7S D;  1FU1 A;  1FZC B;  1VQ9 P;  1BE3 J;  1SQB E;  2V7Q H;  3HTK A;  3G71 P;  1AVY A;  1X22 A;  4WBA A;  1KB9 E;  2BPH A;  1T3U A;  2NPS B;  2XDJ A;  2YO2 A;  3FF9 A;  3KXD A;  5KLI C;  3TK1 A;  3L75 E;  3CAD A;  3V5B A;  1VQ4 P;  1U0N C;  1KFM A;  1NGM B;  1BCC J;  4D6T J;  2Y9Y A;  2RH0 A;  5CMZ A;  2IBZ D;  3IFM A;  1BCC G;  5GTH H;  5KAF E;  4EZM G;  2UWJ E;  4BRY A;  1IXX A;  2MKV A;  3VN0 A;  5BU8 B;  1FZC C;  3RBX A;  3MTU E;  1BSN A;  3MUD A;  1XAR A;  5KTH A;  1URQ D;  3H1H G;  2RN0 A;  1PP9 E;  4D6T E;  5APV A;  1BGY G;  1M1J C;  2W90 A;  3IKQ A;  3I5C A;  2ZWK A;  1KQF B;  3TGU E;  2Y0E A;  5KKZ B;  1RE4 A;  4WY4 B;  3KZI E;  4K35 A;  1X2W B;  4PD4 D;  5AW6 B;  2WPS A;  2K37 A;  1RF1 B;  2H88 C;  3L71 G;  4DZO A;  2J5U A;  2E5T A;  1S9K E;  3CWB G;  1GD2 E;  2JJL A;  1DX7 A;  3SFD C;  2H7H A;  1Q82 Q;  2XND H;  2ZAE B;  1H0T B;  2IFN A;  1NH4 A;  1D7M A;  3IKP A;  3KHU A;  4K3A A;  1IK9 A;  5EFW B;  3OW2 O;  1PV3 A;  2ZQK A;  4LQF A;  1OFC X;  5APS A;  3BCC J;  1PL5 A;  3L72 E;  1MSB A;  3CXH E;  2C9N Y;  3I55 P;  2CK3 H;  3WUU A;  3CI9 A;  1EDJ A;  1J1D C;  3S9O A;  1NU1 E;  3P8C E;  2ORK A;  1Y47 A;  1OW6 A;  3L74 E;  4JYB A;  1SQP D;  5KLV J;  2B9B A;  5TIS E;  2W6J H;  3NCW A;  4M18 A;  3CDG E;  1NU1 G;  2KI7 B;  2HYN A;  3H1L E;  1QEX A;  1ZOY C;  1YXK A;  1PP9 D;  3HE5 B;  1YTT A;  3M9B A;  2FFD A;  2AXT E;  2FFD C;  1TU3 F;  3B8E B;  1ESL A;  1ZP0 C;  3TGU D;  3OJA B;  1EDL A;  1IJD B;  3EWK A;  2I8D A;  1QDD A;  1SFC B;  2BEZ F;  1YTZ I;  1A02 F;  3ZDM A;  3L70 J;  3EQ2 A;  4I7Z B;  2OX8 A;  1FOS F;  2IX7 C;  3L72 J;  4L75 A;  1S9K D;  1J1E B;  3WHD A;  1VF5 D;  4DCK A;  2N1T D;  2XR5 A;  4GT1 A;  1X9V A;  3NFQ A;  4C9F A;  4Y99 C;  2WT7 B;  2OAR A;  3CWB E;  4MN4 C;  5H2F E;  5CCH D;  1YBK A;  1VQ8 P;  3L71 E;  1RH5 B;  1PW9 A;  3L70 E;  4WY4 C;  1KG0 C;  1LTB C;  5GTH E;  2WIT A;  1V7P B;  4IL6 X;  1LTT C;  3CCE P;  1GMJ A;  1UOS A;  2I83 A;  3WWK B;  2IDB A;  1RDL 1;  3K5B A;  3L75 D;  3AE3 C;  3HD7 B;  1CI6 B;  1UEX A;  3H1H E;  2WSC H;  5CJ4 A;  2YNY A;  1FVU A;  1N7S A;  1L0N K;  1PIX A;  1PP9 J;  1KOR A;  3RL0 C;  2H2T B;  5K5G B;  2QJP B;  5CCG C;  4IFD K;  3L70 D;  1NO4 A;  3H1H J;  1O7B T;  1EXJ A;  2GM4 A;  2RID A;  1YXJ A;  1FAV A;  3L75 G;  4JPZ B;  1JNM A;  1PPJ G;  1JUN A;  3BAS A;  4H13 D;  3Q5S A;  2QRX A;  1GZL A;  3VMA A;  4EYY Q;  3HUS C;  2IFM A;  2Q3I A;  2NPS C;  3C22 A;  2NPS A;  1FVU B;  1AFB 1;  1PZQ A;  1URQ B;  1HJ0 A;  1SQQ D;  1U0N B;  2A45 H;  3AE4 C;  3M9Z A;  1J34 B;  1RDI 1;  1DD4 A;  3WBQ A;  1MFT A;  3P5H A;  1KQG B;  2QJK B;  1OXZ A;  1RF1 C;  5AW7 B;  1L0L D;  2R3C A;  1KMB 1;  1SFC A;  2M8R A;  3KQG A;  3BCC D;  4C16 A;  3GHG B;  1JY3 P;  3PRJ A;  1KZA 1;  3VP9 A;  3P8C D;  2OYH C;  1SQX D;  2QJY B;  4NPD A;  4GKG A;  3M9Q A;  2IBZ I;  3BAT A;  4RKU J;  4NPF X;  3CLQ A;  1SQP J;  2P10 A;  2O01 J;  1B6E A;  2H43 A;  5GTI E;  1GL2 D;  2FYN B;  5DJT B;  1N2D C;  3CCK A;  3KDP B;  1G2C B;  5B1X A;  1EGG A;  2ZT9 C;  3H1I G;  1SL4 A;  1JA3 A;  1CWV A;  1L0L E;  1H8U A;  3HD7 D;  3MHV A;  1G1J A;  1SQQ J;  2WVR A;  3VLG A;  1S72 P;  1L0N J;  1JZN A; 
#chains in the Genus database with same CATH homology
 4M3L A;  4W7Z A;  1RE3 C;  1RE3 A;  3WSR A;  4YMD A;  2ORJ A;  4XE5 B;  1X79 B;  3G8L A;  1SQB K;  3SWF A;  3G84 A;  1WT6 A;  5KJ7 A;  3CFW A;  1BYF A;  3O8Z A;  5AVY B;  2I1K A;  1BJ3 A;  3TNU A;  2HPC B;  4S0U A;  2I1J A;  3V2P A;  3RL0 B;  4WUX A;  1KWU A;  1UMR C;  2W6B A;  4W7Y A;  3LIE A;  1SB2 A;  1X2T B;  3P8M C;  1F00 I;  4N33 A;  5AW3 B;  1V4L B;  2YHF A;  4LLH A;  3U1A A;  1RF0 A;  1IO4 A;  5AVW B;  1OWA A;  1BCJ 1;  3V2Q A;  1B08 A;  3CDG F;  2OYI C;  3P7H A;  1FJK A;  4N6J A;  1GW4 A;  1L4A A;  2MJZ A;  3PP5 A;  3BX4 A;  4KI1 E;  2C0X A;  1C3A B;  3RK2 B;  1KWY A;  1L4A D;  2LKM A;  1LTA C;  1KWZ A;  3M0D C;  1JWI A;  4UXM A;  3KYQ A;  1TLG A;  5AW2 B;  1FZC A;  1H88 A;  1QO3 C;  4IOP A;  1RDM 1;  2R5B A;  1LGH B;  2RIE A;  4ZET A;  1KZC 1;  3HE4 B;  1UKM B;  2JEE A;  4N78 D;  4KMB 1;  3TYY A;  3V4Q A;  3UBU A;  1VPC A;  1HQ8 A;  1JCD A;  1RF1 A;  1BCH 1;  1RDJ 1;  3R2P A;  3VMX A;  5AVZ B;  2L5G B;  3WMM 0;  2WTY A;  1J34 A;  1FZA A;  2N9B A;  1KX0 A;  3BDW B;  1NTM K;  1T8D A;  4LC1 A;  1T2K D;  2W6A A;  4J6P A;  4N32 A;  1WK1 A;  3ALS A;  1BJ3 B;  1LWU C;  4ZRV A;  1LIT A;  1LWU A;  1YPO A;  1UMR A;  3B5N C;  2R32 A;  3U1C A;  3ALT A;  1KWV A;  4WRC A;  1E8I A;  1CSB A;  1FBM A;  1E5W A;  2HOD A;  4C7N A;  1WMY A;  2H8P D;  3RL0 D;  3L9J C;  2P2U A;  5APQ A;  2QM8 A;  1F02 I;  3HTK B;  4KHX A;  3V2R A;  3GHG A;  3GHG C;  4GJX A;  4CSY A;  2MSB A;  1BUU A;  1LT9 B;  1MFZ A;  5CJ0 A;  3RK2 C;  1HWT C;  2HLO A;  1KZD 1;  1KZE 1;  1HVV A;  3WBR A;  2PAJ A;  1N7S B;  3RK2 D;  1WMZ A;  1AFO A;  3GPR C;  1KZB 1;  5AW5 B;  5KLV K;  4M1G A;  3M06 A;  4ZKP A;  2FYU K;  3CL3 D;  3BVH A;  1DY0 A;  3WBP A;  2NPS D;  1SB2 B;  1X2T A;  1V7P A;  1UKM A;  2O01 H;  3G8K A;  3H6P A;  2VUV A;  3G3Z A;  2A45 G;  5AVX B;  1RF0 C;  2Z5H A;  1X8Y A;  4I6M C;  4HYT B;  3IKR A;  3BX4 B;  1KWW A;  1NU1 K;  5FFS A;  1N7S D;  2GO0 A;  3ZHG A;  1FU1 A;  3BRT B;  4C46 A;  2E3X C;  3P7G A;  3P5E A;  3M9H A;  5APY A;  1FZC B;  3B5N A;  1ZLL A;  2VRS A;  3HUP A;  1JY2 P;  1WT9 A;  3E1I A;  2WWW A;  2XR6 A;  4ZKU A;  3HTK A;  1IC2 A;  3NMD A;  1FZG A;  2C9L Y;  3A7O A;  4WBA A;  1IFI A;  4GK1 A;  3LID A;  5FFT A;  2BPH A;  2HFE D;  1T3U A;  2NPS B;  2XDJ A;  2YO2 A;  3L37 A;  1HBW A;  3FF9 A;  4QKG A;  2O1J A;  4N3Y B;  1FIF A;  2GGU A;  4I1L A;  3L4F A;  2WSE H;  2J59 M;  1IJK C;  3TK1 A;  1RDK 1;  2Z4E A;  3H32 A;  4DOJ A;  1ZR2 A;  1IOD A;  2HOD B;  2BPD A;  3V5B A;  3VMZ A;  1K9J A;  1U0N C;  3CAD A;  1KFM A;  1LTI C;  1O7C T;  4ZES A;  4WR9 A;  2Q9I A;  1Y17 A;  2ZFC A;  2OYI A;  3C8J A;  5CMZ A;  3IFM A;  4N38 A;  1DY2 A;  2H2R A;  4EZM G;  5LGK E;  3SWY A;  2C0W A;  2J58 A;  3M0D A;  3VN0 A;  4AQR D;  5BU8 B;  1IXX A;  1G1S A;  1K9I A;  1FZC C;  3ZHG D;  4YLI A;  3GPR A;  2GGX A;  3MTU E;  5BU5 A;  1AQ5 A;  1L4A B;  1GDT A;  5AW9 B;  1HUP A;  3MUD A;  1U0O B;  1XAR A;  5KTH A;  4EOT A;  2FXM A;  2P67 A;  1URQ D;  1P4L D;  2KMB 1;  5J6G G;  1HGZ A;  2CPS A;  3HD7 A;  5APV A;  1SFC D;  2FKW B;  1M1J C;  3HD7 C;  4M17 A;  3RK3 B;  3IKQ A;  3I5C A;  1GK6 A;  2IPP A;  2ZWK A;  1JTH B;  5AW4 B;  1H89 A;  4WUW A;  5B1R A;  1KIL C;  1RE4 A;  4WY4 B;  1KIL A;  1RE4 C;  1NKZ B;  1GU5 A;  3P7F A;  3L35 A;  1TN3 A;  1X2W B;  1E87 A;  1GL2 B;  1HUC A;  5AW6 B;  2KSJ A;  1TDQ B;  1NHL A;  4AUW A;  3UBU B;  1FZB A;  2WPS A;  1T8C A;  4GJ0 A;  3ALU A;  3MD0 A;  1RF1 B;  1YPQ A;  4PDC A;  5AW8 B;  1UOS B;  4DZO A;  1S9K E;  1IXX B;  3NCX A;  4HH2 A;  4WB4 A;  5KJ7 D;  2OX9 A;  1GD2 E;  1XTC C;  2JJL A;  4RES B;  2WSF H;  1DX7 A;  1JOC A;  1JY2 N;  5AVU B;  1CI6 A;  2H7H A;  3FF7 C;  3M0A A;  3A5T A;  5APT A;  1Z56 A;  1DY1 A;  2BRS A;  3RK3 D;  2IFN A;  2AFP A;  3KMB 1;  3PAK A;  4AYC A;  1NH4 A;  3RK3 C;  3IKP A;  2O1K A;  4J6M A;  3N7N A;  1IK9 A;  4GI0 A;  3HRN A;  1WRG A;  3BDW A;  2ZQK A;  2WPQ A;  5AW0 B;  4LQF A;  3VOP A;  1W2E A;  3HE5 A;  1MV8 A;  1OZ7 B;  1NAF A;  3G83 A;  1J35 A;  5B1W A;  3L36 A;  5AVT B;  5APS A;  1FOS E;  4LGD E;  1MSB A;  1L0L K;  2FFD B;  1KQL A;  2C9N Y;  1IFN A;  2WT7 A;  1G1I A;  1H8A A;  3CI9 A;  1DH3 A;  3EFG A;  2KLV A;  5CHX A;  1J1D C;  2PP6 A;  4KZW A;  1IFJ A;  5APU A;  3P8C E;  4N78 E;  2ORK A;  1UV0 A;  2YKQ A;  5KTB A;  4J6J A;  1IFM A;  1M7L A;  3IKN A;  1M1J A;  4JYB A;  1V4L A;  1SQX K;  1WT9 B;  1MUU A;  3WWK A;  2KV3 A;  4I2L C;  4EIJ A;  2RIC A;  4C9F A;  4AK8 A;  4J6Q A;  5CCH C;  4G9A A;  1FJP A;  3NCW A;  5M62 A;  2N1T B;  1IFD A;  4M18 A;  4C7R A;  3CDG E;  3VYI A;  1MZ9 A;  2HYN A;  3A2A A;  3TNU B;  1NTZ K;  2HPC A;  4IOP B;  2E3X B;  3FF8 C;  1NKN A;  3M91 A;  3T3A A;  4WCO A;  1YXK A;  3HE5 B;  2YKP A;  1YTT A;  3M9B A;  2FFD A;  2P1J A;  2FFD C;  1VDF A;  3IR9 A;  3GPR D;  3B8E B;  1ESL A;  2W27 A;  4W80 A;  1KZU B;  2M3B A;  3II6 A;  3UIA A;  1N73 B;  3OJA B;  1GZ2 A;  2POH A;  1JO5 A;  1IJD B;  2PY2 A;  1QDD A;  1SFC B;  1YTZ I;  1A02 F;  3EQ2 A;  1LTG C;  1JY2 O;  3BRV B;  3P7K A;  2OX8 A;  3LW5 H;  1FOS F;  1JWI B;  2IX7 C;  2XNX A;  1N7S C;  1SVF A;  1OZ7 A;  1S9K D;  1J1E B;  3VYK A;  3B5N D;  3WHD A;  2E43 A;  2N1T D;  4QKI A;  3WWK C;  4DN8 A;  2HG5 D;  1T2K C;  2CL8 A;  4GT1 A;  3A3Y B;  3NFQ A;  1X9V A;  2N1T A;  2XR5 A;  4Y99 C;  2WT7 B;  2OAR A;  3OA7 A;  5AVQ B;  1E5U I;  1NOH A;  5APW A;  2IT5 A;  1JY3 O;  1SQP K;  4IFM A;  1ZV8 A;  4WY4 D;  1FDM A;  4J6L A;  2XKM A;  5CCH D;  2IT6 A;  3P32 A;  1PW9 A;  4GKO G;  1KIL B;  4WY4 C;  5CCG A;  1KG0 C;  1SQV K;  2VRP A;  3K7B A;  1MUQ A;  1LTB C;  5KTI A;  2WIT A;  1YTZ T;  1V7P B;  1G2C A;  2OS9 A;  4WQQ A;  1N73 C;  2Q5U A;  2Z5I A;  1KOE A;  1LTT C;  1GK4 A;  2MTI A;  5AVS B;  1UOS A;  3C8K D;  2I83 A;  1T8Z A;  1RTM 1;  3WWK B;  2P7J A;  1RDL 1;  2KB7 P;  3NTN A;  4N37 A;  3DBZ A;  3V2N A;  5APX A;  2XU6 A;  3HD7 B;  2A45 I;  3HUS A;  1KCG A;  1CI6 B;  1UEX A;  1A02 J;  1BNL A;  2WSC H;  3B5N B;  4KZV A;  5CJ4 A;  2KOG A;  2YNY A;  2ZIB A;  1FVU A;  1RDN 1;  1NTK K;  1YPU A;  1N7S A;  4O9B A;  1L0N K;  1KX1 A;  3RS1 A;  2XV5 A;  5AVV B;  1RJH A;  2N1T C;  1JCC A;  3U59 A;  1NWQ A;  2YMY A;  1SQQ K;  2BPE A;  4GIF A;  3RL0 C;  1J35 B;  2H2T B;  2YKO A;  5CCG C;  1HJB A;  4IFD K;  1RDO 1;  2XZR A;  1SL5 A;  1T3J A;  1NO4 A;  2GUV A;  1GU4 A;  1GW3 A;  1IJK B;  2C6U A;  5CCG D;  1O7B T;  1PFI A;  1HYR A;  2GM4 A;  1IOD B;  2RID A;  3VTP C;  1YXJ A;  1FAV A;  1HH0 A;  3G81 A;  1JNM A;  1JUN A;  1DV8 A;  4N36 A;  3BAS A;  5BVZ A;  3WH2 A;  2OYI B;  1QL1 A;  1N7L A;  1GZL A;  1RY3 A;  1J1D B;  2E42 A;  2RIA A;  5AW1 B;  5F2Q A;  1FZF A;  2YO3 A;  4B86 A;  3HUS C;  2IFM A;  2Q3I A;  1JY3 N;  5CCH A;  2NPS C;  1C3A A;  2M94 A;  2NPS A;  3HUS B;  1ZN5 A;  1FVU B;  1CZQ A;  3C22 A;  1AFB 1;  5FFR A;  3WH3 A;  2Q7C A;  4C7N B;  1URQ B;  2VRP B;  3GPR B;  1U0O A;  1U0N B;  2RIB A;  3HE4 A;  3PAR A;  3MIW A;  2A45 H;  4QKH A;  4WRF A;  3M9Z A;  3H32 B;  1LT9 A;  3P5F A;  1J34 B;  4IFF A;  3V4W A;  1GTW A;  1RDI 1;  1Y17 B;  4MTH A;  3WBQ A;  4ZRW A;  1AFA 1;  2WPR A;  1J2J B;  1SP4 A;  1SL6 A;  3P5H A;  4E52 A;  1HTL C;  3N4X A;  1G1R A;  1UEX B;  3VP8 A;  1FM5 A;  1JMM A;  1PWB A;  2WZ7 A;  1OXZ A;  3MGN A;  1RF1 C;  1KWT A;  1LTJ B;  2BAS A;  5AW7 B;  1G1T A;  4J6K A;  2R3C A;  1YYC A;  1SFC A;  1FZE A;  2M8R A;  2KP8 A;  3KQG A;  1KMB 1;  1SLQ A;  3KPE A;  3P5D A;  4LU5 A;  1R13 A;  2N40 A;  2LS8 A;  5AVR B;  4C16 A;  1G1Q A;  4J6N A;  3GHG B;  3PAQ A;  3C9I A;  3OAK A;  2KYV A;  1HTN A;  1KIL D;  4PP8 A;  3VMY A;  1JY3 P;  1CW5 A;  1XPH A;  1JTH A;  4CAJ A;  2OYH B;  2PF5 A;  1KZA 1;  4WY4 A;  3VP9 A;  4N34 A;  3P8C D;  2OYH C;  1BV4 A;  4N35 A;  1X2W A;  1J1E C;  4GKG A;  3M9Q A;  3BAT A;  2R5D A;  1EGI A;  3P5G A;  3CLQ A;  1GL2 C;  1FIH A;  2ZXE B;  1GL2 A;  1LT9 C;  1N73 A;  1B6E A;  4Y99 B;  5KJ7 C;  2H43 A;  1HGV A;  1GL2 D;  3T97 A;  4WRE A;  1DEB A;  1N2D C;  1KFN A;  3CCK A;  1QL2 A;  2CPB A;  3KDP B;  1G2C B;  5B1X A;  1LTS C;  1EGG A;  4UWW A;  1MPU A;  1LTJ A;  1LTJ C;  5K8Y A;  1URQ C;  1AFD 1;  1URQ A;  1SL4 A;  4QKJ A;  4XA4 A;  1R14 A;  3NXS A;  4JYC A;  1CWV A;  1JA3 A;  1KWX A;  4G96 A;  1H8U A;  1N86 A;  1SFC C;  3HD7 D;  3TSI A;  1G1J A;  1L4A C;  4JF7 A;  4OH8 B;  1ZR4 A;  3VPP A;  2FYZ A;  2VUZ A;  1M1J B;  3VLG A;  3FD4 A;  1LWU B;  2GUS A;  1P1Z D;  3PBF A;  2QM7 A;  3VYJ A;  1EQ7 A;  1XTG B;  1JZN A;  3P5I A;  2OYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...