3KQGA

Trimeric structure of langerin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
169
structure length
169
Chain Sequence
b'SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-type lectin domain family 4 member K
molecule tags Immune system
source organism Homo sapiens
publication title Trimeric structure of langerin.
pubmed doi rcsb
total genus 54
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kqgA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3kqgA02
1CSBA 1KX1A 1F02I 4KHXA 4M17A 1NAFA 2QM8A 1HWTC 1SL4A 1UV0A 1RDK1 1SL6A 3L36A 2ZQKA 3ALUA 1OZ7B 5AVSB 1RTM1 3FF8C 3WH2A 2QM7A 3O8ZA 4QKHA 4CSYA 4S0UA 1GK4A 5AVQB 5KTIA 5APXA 1KZA1 2RIEA 4J6LA 2ZXEB 1DH3A 1JWIB 5FFTA 5AVVB 1R13A 1KZD1 3V4QA 4M1GA 1IXXA 2ZFCA 1FVUB 1T8CA 1H88A 2VUZA 1FIFA 1YPUA 3BX4A 3NCXA 2YNYA 4C16A 3CDGE 1CI6B 2W27A 3V4WA 3PARA 2WPSA 4AQRD 1KCGA 3UIAA 1EGIA 2GO0A 1YXJA 2H2TB 1AFD1 3HE4B 3FF7C 1RDL1 2XZRA 1KWYA 3HTKA 1GTWA 4G9AA 1T8DA 4J6MA 4GJ0A 1IODB 4UXMA 3G83A 4GK1A 3HE5B 5APYA 3CCKA 2C9LY 3SWFA 2OX9A 1V7PB 1BUUA 1X8YA 5F2QA 2BPHA 1RDN1 5AW3B 2VRPA 1X2TA 3P5GA 1SP4A 5AW6B 1GZ2A 2RIAA 1DY0A 3C8KD 2N40A 1H8AA 1C3AA 3IKNA 4LC1A 4AK8A 2Q3IA 3WSRA 4KZVA 3ALSA 3WWKA 3VTPC 5AW9B 3IKPA 3L9JC 1S9KD 4PDCA 4YLIA 3P7GA 1E87A 1IJKC 3FD4A 1KZC1 5B1XA 5AVYB 2YO2A 1C3AB 4J6NA 3VN0A 3M0DA 1FIHA 1A02F 4YMDA 1JA3A 3VPPA 1JZNA 2KMB1 1G2CB 4N35A 1T2KD 4J6KA 3RS1A 4I6MC 5AW2B 3CADA 4KI1E 3WHDA 1KMB1 1YPQA 1TLGA 2BPEA 1FM5A 3I5CA 4J6PA 4C9FA 1F00I 1YTTA 3A5TA 1RDO1 5KTHA 1FAVA 3P5DA 3P32A 3GPRC 3L35A 1OWAA 1KWWA 1UOSB 2H2RA 4ZETA 3MD0A 5B1RA 5LGKE 3FF9A 1U0OA 1CZQA 1AFB1 1PW9A 1WMYA 1NWQA 3CFWA 3VYKA 2W6AA 3LIEA 1A02J 3KMB1 2MSBA 3G8KA 2KP8A 2MTIA 2WPRA 2BASA 3HUPA 1JNMA 3M91A 3NTNA 1HYRA 2N9BA 1J35B 1RDM1 4B86A 2KV3A 3NMDA 1IODA 1BV4A 3KDPB 4LQFA 2JJLA 5APSA 1UOSA 2R3CA 5AVWB 3HE4A 1MUUA 2WWWA 3A2AA 3NCWA 1PWBA 5AW4B 5AW7B 2C6UA 1HQ8A 4ZESA 1KG0C 1TDQB 1KWXA 1J35A 1H8UA 1BCH1 3G81A 3ZHGD 3OAKA 2E3XC 3GPRA 1BCJ1 1S9KE 5AW0B 1KZB1 5AVXB 2Q7CA 2PY2A 3M9BA 1IXXB 1MUQA 1LITA 1SB2A 2Z5HA 3P7HA 4WCOA 1JWIA 3VMZA 2Q5UA 1U0OB 3VLGA 4N32A 4QKGA 4QKJA 2P2UA 1U0NC 2ORJA 1SL5A 1GU4A 1Y17A 1BNLA 5M62A 3WWKB 4XE5B 2VRSA 3TYYA 1O7BT 4WUXA 4WREA 4GJXA 2C9NY 4JYBA 1WT9A 1G1QA 4N38A 1UMRA 5J6GG 1FOSF 3UBUA 1HJBA 1X2TB 3PAKA 1HTNA 1K9IA 4DN8A 1XPHA 3ALTA 3PAQA 4PP8A 4AUWA 1OXZA 4J6QA 3ZHGA 1V7PA 4WRFA 3P8MC 2E3XB 4WQQA 2WPQA 4M3LA 1WK1A 3P5HA 4J6JA 4N37A 4UWWA 3VYIA 3BDWA 3VMYA 5K8YA 3IKQA 2CL8A 2P7JA 3CDGF 2XV5A 1EGGA 4N34A 3C8JA 3M0AA 1QDDA 2BRSA 1HUPA 3MGNA 2P67A 1UEXB 2WT7B 2R5DA 2BPDA 3KQGA 5AW1B 3G84A 5AVZB 1CI6A 1UKMA 5AW8B 4DZOA 2WTYA 2VRPB 1KZE1 1XARA 3BX4B 3P7KA 4QKIA 4N36A 4EZMG 3PBFA 1X2WA 1MFZA 1MPUA 1V4LA 2VUVA 2YHFA 3HE5A 4KMB1 1GK6A 3VMXA 3L37A 1YYCA 3C22A 1GZLA 2IT5A 2IPPA 5APWA 2LS8A 4C7NB 2RICA 1P1ZD 2GGXA 3IKRA 3B8EB 1U0NB 2PF5A 4C7NA 3K7BA 4WRCA 4GI0A 5FFSA 1E8IA 3GPRD 4KZWA 2ORKA 2E42A 1QO3C 1KWTA 1J34A 1CWVA 1K9JA 1V4LB 4EOTA 4HYTB 3P5EA 3P5IA 5FFRA 1X2WB 5AVTB 1MV8A 1HUCA 1SLQA 1G1RA 4E52A 1E5UI 4GKOG 1RDI1 4ZRVA 2AFPA 4IOPB 1J2JB 3NXSA 4CAJA 3P7FA 1KWZA 3LIDA 1T2KC 1G1TA 1FVUA 2RIBA 4M18A 1JUNA 2OX8A 3M9ZA 1YPOA 2WT7A 1UEXA 5APTA 1J34B 4LU5A 3G8LA 3NFQA 5AVRB 3WBQA 3T97A 1IJKB 2YO3A 1KQLA 1RJHA 2RIDA 3T3AA 1RDJ1 3M06A 3V5BA 1OZ7A 3WWKC 1KOEA 2R32A 1B08A 2XR6A 1BYFA 2GGUA 3WH3A 2IT6A 1H89A 1KWVA 2M94A 3TNUA 3UBUB 4GT1A 1UKMB 5AVUB 1AFA1 2ZIBA 1KWUA 4RESB 2R5BA 1ESLA 4I2LC 1BJ3B 3A3YB 4GKGA 2XR5A 2I83A 5B1WA 1MSBA 1P4LD 1Y17B 5APVA 3IR9A 2ZWKA 4G96A 1GU5A 4AYCA 4ZRWA 3BDWB 1R14A 5AW5B 5APQA 1GD2E 1TN3A 3DBZA 2OS9A 1DY2A 2Z5IA 2XU6A 1IO4A 1B6EA 4MTHA 3TK1A 4WUWA 1DV8A 1G1SA 5APUA 3WBPA 4JYCA 1BJ3A 1DY1A 1SB2B 3A7OA 2E43A 4WR9A 1O7CT 1YXKA 1KX0A 3GPRB 3M9HA 3P5FA 1UMRC 3VYJA 5CMZA 4N33A 4C46A 1HBWA 1WMZA 1WT9B 4IOPA 2H7HA 3WBRA 1FOSE 3TNUB
chains in the Genus database with same CATH superfamily
1EZVE 1F02I 1LTJB 5CCGC 4R4LA 2J5UA 3LW5J 3M0DC 2QJYB 4OGQB 3H1IE 2GA1A 3HD7A 1N86A 1OZ7B 5AVSB 1RTM1 3FF8C 3L72D 3EFFK 3KXDA 1ZR4A 1Q90D 3IFMA 3V6IA 3JCUH 3H1HJ 5B66H 5AVQB 4R4MA 4EDFA 3EWKA 2RIEA 2ZXEB 2BCCG 4PD4H 1JWIB 3FXEA 1YI2P 5KLIC 1RE4C 1IXXA 1MFTA 1T8CA 1H88A 1FIFA 1YPUA 1LTTC 1J1EC 3TGUE 1L0LE 1K9MQ 2E75B 2W27A 3PARA 1LT9A 3GLMA 1KCGA 1SFCD 1EGIA 3Q5PA 1GL2D 1AFD1 3P8CE 2XZRA 2O3JA 3JCUE 3H1HD 2O01H 4H13C 1V7PB 1U7JA 3AE6C 2BPHA 4H13B 4BWNA 3PH0A 1NTMJ 3P5GA 5CJ0A 3WUTA 4U3FJ 1GZ2A 2ZT9B 2WSSH 1H8AA 2QVAA 1C3AA 4U3FE 1PGPA 2QJPB 1KFMA 2C0XA 4TLFA 3L9JC 4PDCA 1U57A 1K04A 3FD4A 2FYNC 1BDCA 1ZRTD 2KZJA 1S3JA 1LP1B 3VN0A 1LTIC 3A0BH 3WU2H 1L0NK 2OGUA 2Y9ZA 2CPSA 3VPPA 5DJTB 1BGYG 4N35A 2IBZG 1XTGB 3L70E 3RK2B 3CADA 2WMMA 4KI1E 5KLVK 1M57D 2I8DA 1YPQA 2BPEA 1JY3P 2IZ1A 2IYOA 3I5CA 1YTTA 3GF7A 2QG4A 1EQ7A 1L0LK 5TJHA 3L35A 3CCRP 3LW5H 1SQXD 1IFPA 1U0OA 1PW9A 2B89A 3L74E 3U59A 3MP7B 1JCCA 1VQ7P 2MSBA 4N6JA 1KYOE 1KILE 3HUPA 1R5LA 3NTNA 2B87A 1NU1E 5EFWB 3NMDA 1IODA 3JC22 1GMJA 1VF5D 3BCCG 3B71A 1E5WA 3HD7B 1BSNA 1KC8Q 2C6UA 1TDQB 1LTJA 1SQQD 1YIJP 2J58A 2FKWB 1BCH1 3G81A 3ZHGD 4PJ0E 2Q7CA 2Z5HA 3P7HA 1JO5A 4WCOA 1FC2C 1LT9C 1LTBC 1M8OB 1U0OB 5CCGD 2KOGA 1VQOP 3FWNA 5CCHC 1U0NC 3CCMP 3AEFC 1Y17A 1RQVA 3L72G 1HVVA 3KZIE 2LXBA 1OFCX 2K9YA 3AE4C 1GL2B 2E76B 3TYYA 1O7BT 1L4AB 2BEZF 4GJXA 1WT9A 1SQVG 1PP9J 4H0LB 4GOEA 3H6PA 1X2TB 3MUDC 2IZ0A 3KYQA 1PP9E 1AA0A 4PP8A 5E79E 3CC2P 2JWAA 4J6QA 1LP1A 3ZHGA 2E3XB 3AE3C 5KLVE 3WMM0 1IFDA 4D6TG 4M3LA 2I1JA 4N37A 1HGVA 2WQYC 1YJ9P 1KFNA 3H1LJ 1EGGA 3KHUA 3Q1MA 2MKVA 3C8JA 4NPDA 1Z56A 1S4XA 2KSJA 2WT7B 1PGJA 2R5DA 1JMMA 1BGYD 3KQGA 3G84A 1JB0J 1S2EA 2O01J 5AVZB 2NPSB 2ZVOB 3PTZA 4QKIA 1VF5C 1SQPE 2M3BA 4XFJA 4UB8E 2E5TA 3CCVP 2AXCA 1VQ9P 3HE5A 3GHGB 3W68A 2IT5A 3CX5D 1SQQJ 1P84I 2GGXA 3AEBC 1EXIA 1U0NB 1T3JA 3G3ZA 2KLVA 4GI0A 5FFSA 1OW7A 5KJ7D 4KZWA 2ORKA 2KK7A 1Y9BA 1DX7A 1J34A 1CWVA 1K9JA 1M1JC 1WRGA 1OX3A 1VQNP 1X2WB 5AVTB 3AE1C 1FZFA 1S1CX 1R8EA 1KB9D 3GMAA 1J2JB 4CAJA 2KYVA 1KWZA 3LIDA 2GUSA 1GW3A 3M9ZA 1SQVD 1YPOA 1N73A 1SQXJ 4GOFA 1M7LA 2KZIA 3G8LA 3BCCJ 2KNCB 3S9OA 4PJ0H 5AVRB 3T97A 2A06E 4NPFX 4HH2A 2YO3A 4IL6X 1BE3J 1RJHA 1OZ7A 2YMKA 1KB9H 3G71P 3WWKC 1N7SC 2YXRB 1KOEA 4W80A 2GGUA 4D6TE 1AVOA 1BE3E 4U3FG 1H89A 2YMYA 1OW6A 2KS1A 1KWVA 1FZBA 1ZN5A 4GT1A 1DEBA 3E1RA 3AECC 1SQVJ 4H44D 4EI2A 4I2LC 2KS1B 2JP3A 2QIWA 4GKGA 3IN6A 4WVZA 1SQVE 3CL3D 1P4LD 1L0NJ 3IR9A 5CCHA 1R14A 3L75J 4RKUJ 4LGDE 1NTKE 3HRNA 3DBZA 2OS9A 1DY2A 2Z5IA 3L75E 1KMIZ 1KORA 1NTMD 3EFGA 4MTHA 5E79H 3WBPA 2WZ7A 1SB2B 1CW5A 2LR2A 1L0NG 5L8RJ 1JY3O 1NTZE 1JY2O 3RBZA 5GTIH 4N33A 1N7SB 4C46A 4OH8B 5GTHH 1KX1A 1NAFA 2QM8A 1HWTC 1NTZJ 3OJAB 3D6YA 1U7MA 2O1JA 3L36A 2QM7A 1IFIA 4DT0A 5TISE 2R44A 3R4YA 1GK4A 2HLOA 5KTIA 1LT1A 1KZA1 1S5LE 1KZUB 1UIXA 1FS0E 1N73B 3V4QA 4M1GA 2QA4P 1NU1G 2ZT9C 3NCXA 4L73A 4PV1C 4TT3H 2RN0A 1KD1Q 1YTZI 1FDOA 4U7JA 3CDGE 2QSIA 1SQQG 1P84E 1IFNA 1VQMP 1RY3A 2QJKC 2D2CD 3HE4B 3FF7C 2Y9YA 1KWYA 4ZNCA 4EIJA 4J6MA 2PGDA 4GDOA 4UXMA 3HE5B 1PGQA 4K3AA 2YIUB 2NPSC 5APYA 2E74B 2OX9A 1BUUA 2LKMA 1RDN1 3B4SA 3GW6A 3SFEC 3VP9A 1SP4A 1DIPA 2AXTE 2YXQB 2RIAA 1VF5B 1SQVK 2M5AA 2OYIB 1NTMK 3JSVC 2IBZI 1LGHB 1X22A 2ITAA 2B88A 1PPJG 4YTPC 1YHQP 2IDBA 1NTZG 5AVYB 2OYIC 1AV1A 3M0DA 1JY2N 1FIHA 1A02F 3C1LA 4YMDA 4HB1A 1X0TA 4W7ZA 1PL5A 1JZNA 2KMB1 4O9BA 1BCCD 4J6KA 3H1JD 4DJGA 4C7RA 1ZP0C 3L74J 4Y99C 3RL0D 1TLGA 3SFDC 1NU1D 1FM5A 3A0BE 3WU2E 3TF5A 4C9FA 2N1TD 4WWIA 3A5TA 3CWBD 5KTHA 2RKLA 3SWKA 3GPRC 5KJ7C 1OWAA 3CCUP 4H0LD 3B5NB 3L74D 3MD0A 5LGKE 3H1KG 1OVUA 1YJNP 3FF9A 4RJTA 1AFB1 4CPGA 3CFWA 2FXMA 3IAOA 1LTAC 1QVFO 3E1IA 3KMB1 2KP8A 1N2DC 3FX0A 3CWBE 1JNMA 3TGUG 2N9BA 2A06G 2KV3A 5CBNA 3QWOC 4Y28J 1T6AA 3H1JE 2H43A 4JF7A 1N7SD 1SS1A 1FE6A 1MUUA 2WWWA 4UB6E 1HF9A 2WVRA 5AW4B 1FU1A 4ZESA 5BU8B 1KWXA 2MJZA 4UB8H 2E3XC 4H44C 1BCJ1 1NHLA 1YTZT 2PFXA 1KZB1 1LITA 2RMZA 3HD7D 2W8ZA 3VMZA 3U1CA 2Q5UA 3G9RA 3N7NA 3A0HE 1SFCC 2P2UA 1BDDA 1SL5A 5M1BA 1BNLA 5KLVJ 2VRSA 1W2EA 1VQKP 5C39A 4JYBA 3AE2C 1N7SA 3U1AA 2JEEA 2XNXA 1G1QA 4N38A 3KPEA 1UMRA 5J6GG 1FOSF 1OIPA 2FYNB 3L71G 1HTNA 1XPHA 3VMAA 1RF1B 3L73G 1VL2A 1KV4A 1P84D 1V7PA 5KLVG 2Q1KA 1WK1A 2D2CC 1L0LD 4UWWA 5BVZA 1PP9G 1YITP 1NTZD 3VMYA 3FXDA 3BVHA 1VQ5P 2OYOA 2XV5A 3BRVB 4N34A 2HODA 3TGUJ 1LTSC 2HPCA 1QDDA 1R5SA 2BRSA 1UEXB 3MGNA 4WY4A 5AW1B 3RBXA 3L72E 1SQBG 1XARA 3PBFA 4DCKA 1FZAA 3AEAC 4JQ0D 3CCEP 4HKZH 2OTKE 3CI9A 1MPUA 1V4LA 1EZVD 2YHFA 3AE5C 3VMXA 1YYCA 3V2NA 1YJWP 1GZLA 4IOIH 1ZXGA 2IPPA 1T8ZA 2XNDH 3AEGC 3H1KJ 5APWA 2LS8A 2JKVA 2RICA 1P1ZD 5KJ7A 1USDA 1DD3A 2NPSD 2PF5A 4WRCA 1E8IA 3H1KE 3TSIA 1NTME 3GG2A 3L75D 3O6QB 4EOTA 4D6TD 1MV8A 1SLQA 3HUSB 2AEFA 2FYUJ 2AFPA 2XDJA 3A0HH 3HUSA 3H1HG 3K5BA 3P7FA 1T2KC 2AEJA 4I1LA 1FVUA 2OX8A 1PZQA 1AVYA 5APTA 1J34B 2YIUC 3CLQA 3L70J 3RL0C 2L91A 2M3EA 3NFQA 3WBQA 1M56D 3M9QA 1EC5A 1IJKB 2OYHA 3BCCD 3MTUE 1NKZB 1P84H 1S5LX 1KQLA 2C0WA 2RIDA 3M06A 1PFIA 2Y0EA 4MN4C 3H25A 3D6ZA 2R32A 1PV3A 1BE3D 1NVOA 4EYYQ 3WH3A 3TNUA 2NPSA 3UBUB 5AVUB 2ZIBA 3II6A 1KWUA 1UIIA 2POHA 1ESLA 1L4AC 1JY2P 2HPCB 1RE3A 1SQPK 2XR5A 2I83A 5B1WA 2E74D 1EDIA 3N4XA 1IZNB 4G96A 1KB9E 5AW5B 5APQA 1QEXA 3L70G 3T97B 1BGYE 2N1TA 3FGAD 1N73C 1RF1A 2KNCA 1B6EA 1DV8A 1H0TA 1G1SA 1BJ3A 1NKNA 4ZKPA 4IL6H 1YXKA 2V7QJ 1KX0A 2IFNA 3Q5SA 3GPRB 3CX5E 3P5FA 1UMRC 3VYJA 1JOCA 3CXHH 1WT9B 1CSBA 1IFJA 1NYHA 1YQ3C 2P1JA 1SQPD 5CHXA 3HD7C 1SL4A 1UV0A 3G4SP 2ZYDA 4KT0J 1ZV8A 3ALUA 3RK3D 1W2BO 3WH2A 1URQA 3O8ZA 4QKHA 4S0UA 3I56P 1ZMEC 5APXA 4J6LA 5KAFE 2M0BA 1DH3A 4KJMA 1KILB 1LWUA 5KTBA 2GM4A 5DJUB 5CJ4A 2VUZA 2R3SA 3BX4A 2YNYA 3RK2C 3CMEP 4C16A 3H1LG 1VQ6P 1Q81Q 3GF3A 1CI6B 5KLVD 3V4WA 2WPSA 1AQ5A 2E75D 1KQGB 4AQRD 4IFDK 3BATA 1PP9D 1ZLLA 2HFED 3GHGC 5BU5A 4UB6H 3HTKA 1HGZA 3CXHD 4G9AA 4GJ0A 3G83A 3CCKA 3SWFA 1URQC 2KB7P 3PRJA 4XA4A 1X8YA 3CC7P 5F2QA 3H1LE 2FFDC 2VRPA 2BCCE 1X2TA 1EDJA 5AW6B 3V2RA 1VQ4P 1OVRA 2N40A 2CPBA 2AXTH 4IL6E 3IF4A 4HJGH 2K1AA 3IKNA 3ITKA 3VTPC 1KILD 2Y0DA 5H2FH 3P7GA 1E87A 1IJKC 2W90A 2QEXP 2YO2A 3CXHI 1MZ9A 2KXPB 2FBWC 2O01N 3MZWB 1JA3A 1NH4A 2H88C 2FXOA 1G2CB 3MIWA 4Z1MH 2WSCJ 3WHDA 1KMB1 3CX5I 2KIKA 1FDIA 4J6PA 4BXLA 2ZYGA 1RDO1 1L2PA 5GTIE 1FAVA 3CWBJ 1N7LA 3P5DA 3P32A 1Q7YQ 5KAIE 3C9IA 1BCCE 4ASVA 2M5AB 2OYIA 5B1RA 1KYOI 5KKZC 1KB9I 1CZQA 2FXPA 3AE9C 1WMYA 1KQSO 2B87B 3W67A 1SQXE 1VPCA 2W6AA 2PRRA 4W7YA 4D6TJ 3KZIH 3G8KA 2JDIH 2MTIA 2BASA 1LJ2A 1HYRA 1VDFA 1J35B 4B86A 4Y99B 3I55P 1FZCA 1BV4A 1G1IA 2JJLA 5APSA 1JCDA 3WUUA 1RF0C 2R3CA 3S4RA 3HE4A 3A2AA 3NCWA 1PWBA 1FZCB 1HJ0A 2HR3A 3CWBG 1HQ8A 1KG0C 2FYUK 1RH5B 1ZRTE 2WSEH 1H8UA 3H1HE 2XKMA 3GPRA 1QLED 2PY2A 3M9BA 3P8CD 4U3FD 1NTMG 1JWIA 5KAFH 1L0LJ 1NTKJ 2D2CB 1X9VA 1RQUA 3QH9A 3TGUD 5TISH 3L73J 1L4AD 5M62A 4RO0A 2L5GB 4YXDC 4WREA 2Y0CA 3Q5RA 1VQ8P 4L76A 4I7ZB 3UBUA 1HJBA 1BSHA 1EZVI 3PAKA 3ALTA 4AUWA 1OXZA 2A45H 3H1ID 3V2QA 4WRFA 3L72J 4BRYA 1ZOYC 4GODA 1SQBJ 4WBAA 2ZYAA 1JMBA 1Q82Q 1SFCA 3P5HA 4J6JA 1NAYA 3VYIA 1GW4A 3FWLA 3VOPA 2CL8A 1SQBE 1VQPP 3M0AA 4WB4A 1HUPA 2P67A 3HUSC 1URQD 3C8VA 2BPDA 3RK3C 2K3RA 1NTKD 2W83C 5KAIH 1DD4A 5AW8B 4DZOA 2WTYA 1KZE1 3P7KA 4N78D 1PPJD 1AJYA 1X2WA 3RL0B 2FYUE 3O6QA 1MFZA 1E79H 3SSUA 5CBOA 2VUVA 3CCLP 2H8PD 4KMB1 1GK6A 2FYZA 3Q2YA 1G1JA 1SVFA 3B8EB 3L74G 3K7BA 3GPRD 3S1KA 5CCGA 2E42A 1V4LB 1K05A 4HYTB 1GL2C 3P5EA 1IK9A 2M8RA 1HUCA 1G1RA 1WT6A 1Q2NA 1RDI1 5H2FE 2JO1A 4IOPB 2K88A 1RF0A 3CX5H 4I7ZC 3NXSA 1FJKA 4L74A 2A06D 1G1TA 2RIBA 3C22A 1JUNA 4H13D 1K73Q 1UEXA 2Q3EA 3WUVA 3L4FA 2ZT9D 3BRTB 2WSCH 3AEEC 2DW3A 1OW8A 5K5GB 1NU1J 2YKPA 1URQB 3T3AA 4ZKUA 1RDJ1 3V5BA 3GHGA 1N8RQ 1BYFA 2RH0A 2HG5D 5B5EE 3BASA 2N9YB 2ZXXA 3CCJP 2ZAEB 4PV1B 4DOJA 2K37A 4RESB 2R5BA 2IFMA 1RHZB 4K35A 3H1JG 3VP8A 3R2PA 2K9JB 1HTLC 1FZCC 5APVA 2W6JH 2ZWKA 1NTZK 4AYCA 4ZRWA 3PJSK 5GTHE 3AE8C 2XU6A 1JTHA 1IO4A 2HYNA 3TK1A 1RE4A 4JYCA 1DY1A 2E43A 1LNQA 3PP5A 1O7CT 2JWDA 1HBWA 2H7HA 1IJDB 2O1KA 1RE3C 1WMKA 1GL2A 4KHXA 4M17A 1PPJE 1RDK1 3MHVA 1SL6A 4N78E 1T3UA 2ZQKA 2WSEJ 1D7MA 4WY4D 2KSEA 1EDKA 4CSYA 1SQXK 2OYHB 2I1KA 1EXJA 5FFTA 5AVVB 1R13A 1KZD1 4OVNF 2ZFCA 1SQBD 1FVUB 1K8AQ 2A45G 3RK3B 1FZGA 3H1IJ 2OYHC 1JY3N 1W5CE 4YXWH 3B5NC 1FJPA 3G6EP 2BCCJ 1RF1C 5B66E 3UIAA 2GO0A 1YXJA 4L75A 2H2TB 1RDL1 3B5NA 3AE7C 2Q6QA 2QJKB 1J1EB 3F5HA 1GTWA 1QVGO 1T8DA 1IODB 2V7QH 3AEDC 3SWYA 2OTJP 1BCCG 4GK1A 3L73D 1NJIQ 2IYPA 3EQ2A 2KI7B 2E76C 2C9LY 1SQQE 4BRYB 1KN7A 1Y8AA 1ZW0A 1AQTA 2QJPC 5AW3B 3OA7A 1USEA 1SQPJ 1JEKA 1NGMB 1DY0A 2WSFH 3C8KD 2LXCB 4WY4B 3CD6P 2HODB 4LC1A 4AK8A 1TU3F 2Q3IA 3WSRA 4KZVA 3ALSA 3WWKA 5AW9B 3L71D 3IKPA 1S9KD 4YLIA 1KYOD 2OARA 1KZC1 3CPWO 5B1XA 1NU1K 1C3AB 4J6NA 2WSFJ 1J1DC 1YBKA 2NZ2A 1L0ND 2FFDA 3RL0g 1T2KD 2FFDB 3RS1A 1FDMA 4I6MC 5AW2B 1AFOA 2QJYC 4OGQC 1YQ4C 4NPEA 2WITA 1LWUC 1F00I 4ASWA 1KWWA 3L70D 1UOSB 2H2RA 4ZETA 1L0NE 2BEQD 3B5ND 1JM0A 2ZJSE 1NWQA 1NOHA 3D70A 3L75G 1XTCC 3VYKA 5KLIB 3LIEA 3RGUA 1NTKG 1A02J 2WPRA 2AEMA 2W6BA 1BE3G 1PGOA 3M91A 1RDM1 1OVVA 2E74C 2Z4EA 3KDPB 4LQFA 2PP6A 1UOSA 2A45I 2NRGA 2OQQA 5AVWB 2OTLP 2P10A 1LT9B 5AW7B 3L71J 1QGKB 1J35A 2JR8A 3L73E 1SQBK 3OAKA 1S9KE 2ZVNB 3L71E 5AW0B 2YKQA 3H32A 5AVXB 1G2CA 2G8YA 1IXXB 1MUQA 1SB2A 3RK2D 1QL2A 3TDKA 1MKMA 2FY8A 3VLGA 4N32A 2IX7C 4H44B 4QKGA 1BGYJ 4QKJA 2FYUG 4QMAA 4PD4I 2BCCD 2ORJA 1GU4A 3H1LD 4IFFA 3WWKB 4JPZB 1QL1A 4XE5B 4WUXA 2C9NY 4OGQD 1S72P 1X79B 4YPCA 3CXHE 4OWFA 2YKOA 1KILC 2GUVA 2E75C 1K9IA 2J59M 4DN8A 3PAQA 2G3AA 3P8MC 3V2PA 3CC4P 4WQQA 2WPQA 1SQPG 2B9BA 3OW2O 3BDWA 1ZR2A 5K8YA 3IKQA 2P7JA 3CDGF 2IBZD 4PD4D 2KUBA 1M1JA 4PV1D 1NTKK 4WY4C 2UWJE 1OZHA 1CI6A 1UKMA 3ABVC 3RK3E 2VRPB 3BX4B 4N36A 4EZMG 3Q3DA 1KQFB 2KLUA 1LTGC 3D71A 1KILA 4N3YB 3L37A 1KTMA 3F89A 4C7NB 3IKRA 1FBMA 2SPZA 4C7NA 3HTKB 1Y47A 1QO3C 3PLNA 1KWTA 3PHLA 2PAJA 3P5IA 5FFRA 1HH0A 1SQQK 1L0LG 4E52A 4LLHA 3E7KA 2CK3H 1E5UI 4GKOG 2QE7H 5B5EH 4ZRVA 1OMIA 4ZMDA 1M90Q 4IFMA 4M18A 2E76D 2WT7A 1GDTA 1H0TB 1M1JB 4LU5A 1LWUB 1JTHB 3MUDA 1EDLA 1M1KQ 4GIFA 2WPVB 1IC2A 1QX8A 4A7PA 1VQLP 1IK7A 3H1IG 1FZEA 3ZDMA 2P58A 2E5YA 1B08A 1EZVG 3H1JJ 2XR6A 3USSA 1SQXG 1J1DB 2K9JA 2IT6A 2M94A 1UKMB 1AFA1 2V4HA 1S5LH 3BCCE 3CCQP 1BJ3B 3CMAP 2H89C 1NO4A 1BCCJ 1L4AA 2Q9IA 1DEEG 3A3YB 2FYUD 2N1TB 5KKZB 1MSBA 1Y17B 1PIXA 1GU5A 3BDWB 1KYOH 1SFCB 5CCHD 1GD2E 1TN3A 2N1TC 4JBZA 3CCSP 1IFMA 1LTJC 2QRXA 3H1KD 1Q86Q 4WUWA 4PD4E 5APUA 2IBZE 3A7OA 4WR9A 3H32B 4H0LC 3M9HA 5CMZA 3WBRA 1WMZA 4IOPA 1FOSE 3TNUB
chains in the Genus database with same CATH topology
1CSBA 1IJDB 1KX1A 1F02I 1LTJB 2O1KA 1RE3C 4KHXA 1GL2A 1NAFA 1IFJA 2QM8A 5CCGC 2P1JA 3M0DC 5CHXA 1HWTC 3OJAB 3HD7C 1SL4A 1UV0A 1RDK1 1SL6A 3HD7A 2O1JA 1N86A 3L36A 4N78E 1T3UA 1ZV8A 2ZQKA 3ALUA 3RK3D 5AVSB 1OZ7B 1RTM1 1URQA 4WY4D 3FF8C 3WH2A 2QM7A 1IFIA 3O8ZA 1ZR4A 4QKHA 3IFMA 4CSYA 1SQXK 4S0UA 2OYHB 1GK4A 5AVQB 2HLOA 2I1KA 5KTIA 5APXA 1KZA1 2RIEA 4J6LA 1KZUB 2ZXEB 1DH3A 1JWIB 5FFTA 1KILB 1LWUA 5AVVB 5KTBA 2GM4A 1R13A 1RE4C 1KZD1 1N73B 3V4QA 4M1GA 1IXXA 2ZFCA 1FVUB 1T8CA 5CJ4A 1H88A 2VUZA 2A45G 3RK3B 1FZGA 1FIFA 1YPUA 3BX4A 1LTTC 1J1EC 2OYHC 3NCXA 2YNYA 3RK2C 4C16A 1JY3N 1YTZI 3CDGE 1CI6B 2W27A 3B5NC 3V4WA 1FJPA 3PARA 2WPSA 1LT9A 1AQ5A 1IFNA 4AQRD 1RF1C 1KCGA 1RY3A 1SFCD 4IFDK 3BATA 3UIAA 1EGIA 2GO0A 1YXJA 1GL2D 1ZLLA 2H2TB 1AFD1 3HE4B 3FF7C 1RDL1 3P8CE 2HFED 2XZRA 3GHGC 5BU5A 3B5NA 1KWYA 3HTKA 1HGZA 1J1EB 4EIJA 1GTWA 4G9AA 1T8DA 4J6MA 4GJ0A 1IODB 3SWYA 4UXMA 3G83A 4GK1A 3HE5B 3EQ2A 2NPSC 5APYA 3CCKA 2O01H 3SWFA 1URQC 2C9LY 2OX9A 2KB7P 1V7PB 1BUUA 4XA4A 1X8YA 2LKMA 2BPHA 1RDN1 5F2QA 5AW3B 3OA7A 2FFDC 2VRPA 3VP9A 1X2TA 3P5GA 1SP4A 5CJ0A 5AW6B 3V2RA 1GZ2A 2RIAA 1DY0A 2WSFH 3C8KD 2N40A 2CPBA 4WY4B 1SQVK 1H8AA 2OYIB 1C3AA 2HODB 3IKNA 1NTMK 4LC1A 4AK8A 2Q3IA 3WSRA 4KZVA 3ALSA 1LGHB 1KFMA 3WWKA 3VTPC 5AW9B 2C0XA 1KILD 3IKPA 1S9KD 3L9JC 4PDCA 4YLIA 3P7GA 1E87A 1IJKC 2OARA 3FD4A 1KZC1 4M17A 5B1XA 5AVYB 2OYIC 2YO2A 1MZ9A 1NU1K 1C3AB 3VN0A 4J6NA 1LTIC 1J1DC 3M0DA 1L0NK 1JY2N 1FIHA 1A02F 4YMDA 2FFDA 1JA3A 1NH4A 2CPSA 4W7ZA 3VPPA 1JZNA 2KMB1 1G2CB 4O9BA 4N35A 1T2KD 4J6KA 2FFDB 1XTGB 3MIWA 3RK2B 3RS1A 1FDMA 4I6MC 5AW2B 1AFOA 3CADA 5KLVK 4KI1E 4C7RA 3WHDA 1KMB1 1YPQA 4Y99C 3RL0D 1TLGA 2BPEA 1JY3P 1FM5A 3I5CA 2WITA 1LWUC 4J6PA 4C9FA 1F00I 2N1TD 1YTTA 3A5TA 1RDO1 5KTHA 1FAVA 3P5DA 1N7LA 1EQ7A 1L0LK 3P32A 3GPRC 3C9IA 3L35A 5KJ7C 1OWAA 1KWWA 1UOSB 3LW5H 2H2RA 4ZETA 3B5NB 3MD0A 2OYIA 5B1RA 5LGKE 3FF9A 1U0OA 1CZQA 3B5ND 1AFB1 1PW9A 1WMYA 1NWQA 3CFWA 3U59A 2FXMA 1NOHA 1XTCC 1LTAC 1VPCA 2W6AA 3VYKA 3E1IA 1JCCA 3LIEA 4W7YA 1A02J 3KMB1 2MSBA 3G8KA 2KP8A 4N6JA 2MTIA 1N2DC 2WPRA 2BASA 2W6BA 3HUPA 1JNMA 3M91A 3NTNA 1HYRA 2N9BA 1VDFA 1J35B 1RDM1 4B86A 2KV3A 3NMDA 4Y99B 2Z4EA 1FZCA 1IODA 1BV4A 3KDPB 1G1IA 4LQFA 2H43A 2JJLA 4JF7A 1JCDA 5APSA 1N7SD 1RF0C 2PP6A 1UOSA 2A45I 2R3CA 5AVWB 3HE4A 1MUUA 2WWWA 3A2AA 3NCWA 1PWBA 1E5WA 3HD7B 5AW4B 1FZCB 1FU1A 1LT9B 5AW7B 2C6UA 1HQ8A 4ZESA 5BU8B 1KG0C 1TDQB 1LTJA 2FYUK 1J35A 2J58A 2WSEH 1KWXA 2MJZA 1H8UA 2FKWB 1BCH1 3G81A 3ZHGD 3OAKA 1SQBK 2E3XC 2XKMA 3GPRA 1BCJ1 1NHLA 1YTZT 1S9KE 5AW0B 2YKQA 3H32A 1KZB1 5AVXB 2Q7CA 2PY2A 1G2CA 3M9BA 1IXXB 1MUQA 1LITA 2Z5HA 1SB2A 3P7HA 1JO5A 4WCOA 3RK2D 3P8CD 1QL2A 3HD7D 1JWIA 1LT9C 3VMZA 3U1CA 2Q5UA 1LTBC 1U0OB 3VLGA 4N32A 5CCGD 1X9VA 2KOGA 2IX7C 3N7NA 4QKGA 4QKJA 5CCHC 1SFCC 2P2UA 1U0NC 2ORJA 1SL5A 1GU4A 4IFFA 1L4AD 1Y17A 1BNLA 5M62A 3WWKB 1HVVA 1QL1A 4XE5B 1GL2B 2L5GB 2VRSA 3TYYA 1O7BT 1L4AB 4WUXA 1W2EA 4WREA 4GJXA 2C9NY 4JYBA 1WT9A 1N7SA 3U1AA 1X79B 2JEEA 2XNXA 1G1QA 2YKOA 4N38A 3KPEA 1UMRA 1KILC 5J6GG 1FOSF 3UBUA 2GUVA 3H6PA 1HJBA 1X2TB 3PAKA 1HTNA 1K9IA 2J59M 3KYQA 4DN8A 1XPHA 3ALTA 3PAQA 1RF1B 4AUWA 4PP8A 1OXZA 2A45H 4J6QA 3ZHGA 3V2QA 1V7PA 4WRFA 3P8MC 2E3XB 3V2PA 4WQQA 3WMM0 2WPQA 4WBAA 1IFDA 1SFCA 4M3LA 1WK1A 2I1JA 3P5HA 4J6JA 4N37A 1HGVA 4UWWA 3VYIA 5BVZA 3BDWA 1GW4A 3VMYA 1ZR2A 1KFNA 5K8YA 3VOPA 3BVHA 2CL8A 3IKQA 2P7JA 3CDGF 2XV5A 3BRVB 1EGGA 4N34A 2HODA 3C8JA 1LTSC 1Z56A 2HPCA 3M0AA 1QDDA 1M1JA 4WB4A 2BRSA 2KSJA 1HUPA 3MGNA 2P67A 1UEXB 3HUSC 2WT7B 1URQD 4WY4A 2R5DA 2BPDA 1JMMA 3RK3C 1NTKK 4WY4C 3KQGA 5AW1B 3G84A 5AVZB 1CI6A 1UKMA 2NPSB 5AW8B 4DZOA 2WTYA 2VRPB 1KZE1 1XARA 3BX4B 3P7KA 4N78D 4QKIA 4N36A 4EZMG 3PBFA 1FZAA 1X2WA 3RL0B 2M3BA 3CI9A 1MFZA 1MPUA 1V4LA 1LTGC 2VUVA 1KILA 2H8PD 3GHGB 3HE5A 1GK6A 2FYZA 4N3YB 3VMXA 2YHFA 3L37A 4KMB1 1YYCA 3V2NA 1GZLA 2IT5A 3C22A 2IPPA 1T8ZA 5APWA 2LS8A 4C7NB 1G1JA 2RICA 1P1ZD 2GGXA 1FOSE 5KJ7A 1SVFA 3IKRA 3B8EB 1FBMA 1U0NB 2NPSD 2PF5A 4C7NA 1T3JA 3HTKB 3G3ZA 3K7BA 2KLVA 4WRCA 4GI0A 5FFSA 1E8IA 3GPRD 5KJ7D 4KZWA 3TSIA 2ORKA 5CCGA 2E42A 1QO3C 1DX7A 1KWTA 1J34A 1CWVA 1K9JA 1V4LB 1M1JC 2PAJA 4EOTA 4HYTB 1GL2C 1WRGA 3P5EA 3P5IA 5FFRA 1HH0A 1X2WB 1IK9A 1SQQK 2M8RA 5AVTB 1MV8A 1HUCA 1SLQA 1G1RA 1WT6A 4E52A 4LLHA 1E5UI 3HUSB 1FZFA 4GKOG 1RDI1 4ZRVA 2AFPA 4IOPB 1RF0A 2XDJA 3HUSA 1J2JB 3NXSA 1FJKA 4CAJA 2KYVA 3P7FA 1KWZA 3LIDA 4IFMA 1T2KC 2GUSA 1G1TA 4I1LA 1GW3A 1FVUA 1JUNA 2RIBA 2OX8A 3M9ZA 4M18A 1YPOA 2WT7A 1N73A 1GDTA 1UEXA 5APTA 1J34B 1M1JB 4LU5A 1LWUB 1M7LA 3CLQA 3G8LA 3RL0C 1JTHB 3L4FA 3BRTB 2WSCH 3MUDA 3NFQA 5AVRB 3WBQA 3T97A 3M9QA 4GIFA 1IC2A 3MTUE 2OYHA 1IJKB 1NKZB 4HH2A 2YO3A 1KQLA 2YKPA 2C0WA 1RJHA 1URQB 2RIDA 3T3AA 4ZKUA 3M06A 3V5BA 3GHGA 1PFIA 1OZ7A 1RDJ1 1FZEA 3WWKC 1N7SC 1KOEA 2R32A 1B08A 2XR6A 1BYFA 4W80A 2HG5D 2GGUA 1J1DB 3BASA 3WH3A 2IT6A 1H89A 2YMYA 1KWVA 2M94A 3TNUA 1FZBA 1ZN5A 2NPSA 3UBUB 4GT1A 1DEBA 1UKMB 4DOJA 5AVUB 1AFA1 2ZIBA 3II6A 1KWUA 4RESB 2POHA 2R5BA 1ESLA 2IFMA 4I2LC 1BJ3B 1NO4A 1L4AC 1JY2P 2HPCB 1RE3A 1L4AA 3VP8A 2Q9IA 3R2PA 1SQPK 3A3YB 4GKGA 2N1TB 2XR5A 2I83A 5B1WA 1HTLC 1MSBA 3CL3D 1FZCC 1P4LD 1Y17B 5APVA 3IR9A 3N4XA 5CCHA 2ZWKA 4G96A 1GU5A 1NTZK 4AYCA 4ZRWA 3BDWB 1R14A 5AW5B 5APQA 1SFCB 5CCHD 1GD2E 4LGDE 1TN3A 3HRNA 3DBZA 2OS9A 2N1TA 1DY2A 2Z5IA 1N73C 1RF1A 2XU6A 1JTHA 2N1TC 1IFMA 1IO4A 1LTJC 1B6EA 3EFGA 2HYNA 4MTHA 3TK1A 1RE4A 4WUWA 1DV8A 1G1SA 5APUA 3WBPA 2WZ7A 4JYCA 1BJ3A 1CW5A 1DY1A 1NKNA 1SB2B 3A7OA 4ZKPA 2E43A 4WR9A 3PP5A 1O7CT 1YXKA 3H32B 1KX0A 1JY3O 2IFNA 3GPRB 1JY2O 3M9HA 3P5FA 1UMRC 3VYJA 5CMZA 1N7SB 4C46A 1JOCA 1HBWA 1WMZA 1WT9B 2H7HA 4IOPA 4N33A 3WBRA 4OH8B 3TNUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSB A;  1KX1 A;  1F02 I;  4KHX A;  4M17 A;  1NAF A;  2QM8 A;  1HWT C;  1SL4 A;  1UV0 A;  1RDK 1;  1SL6 A;  3L36 A;  2ZQK A;  3ALU A;  1OZ7 B;  5AVS B;  1RTM 1;  3FF8 C;  3WH2 A;  2QM7 A;  3O8Z A;  4QKH A;  4CSY A;  4S0U A;  1GK4 A;  5AVQ B;  5KTI A;  5APX A;  1KZA 1;  2RIE A;  4J6L A;  2ZXE B;  1DH3 A;  1JWI B;  5FFT A;  5AVV B;  1R13 A;  1KZD 1;  3V4Q A;  4M1G A;  1IXX A;  2ZFC A;  1FVU B;  1T8C A;  1H88 A;  2VUZ A;  1FIF A;  1YPU A;  3BX4 A;  3NCX A;  2YNY A;  4C16 A;  3CDG E;  1CI6 B;  2W27 A;  3V4W A;  3PAR A;  2WPS A;  4AQR D;  1KCG A;  3UIA A;  1EGI A;  2GO0 A;  1YXJ A;  2H2T B;  1AFD 1;  3HE4 B;  3FF7 C;  1RDL 1;  2XZR A;  1KWY A;  3HTK A;  1GTW A;  4G9A A;  1T8D A;  4J6M A;  4GJ0 A;  1IOD B;  4UXM A;  3G83 A;  4GK1 A;  3HE5 B;  5APY A;  3CCK A;  2C9L Y;  3SWF A;  2OX9 A;  1V7P B;  1BUU A;  1X8Y A;  5F2Q A;  2BPH A;  1RDN 1;  5AW3 B;  2VRP A;  1X2T A;  3P5G A;  1SP4 A;  5AW6 B;  1GZ2 A;  2RIA A;  1DY0 A;  3C8K D;  2N40 A;  1H8A A;  1C3A A;  3IKN A;  4LC1 A;  4AK8 A;  2Q3I A;  3WSR A;  4KZV A;  3ALS A;  3WWK A;  3VTP C;  5AW9 B;  3IKP A;  3L9J C;  1S9K D;  4PDC A;  4YLI A;  3P7G A;  1E87 A;  1IJK C;  3FD4 A;  1KZC 1;  5B1X A;  5AVY B;  2YO2 A;  1C3A B;  4J6N A;  3VN0 A;  3M0D A;  1FIH A;  1A02 F;  4YMD A;  1JA3 A;  3VPP A;  1JZN A;  2KMB 1;  1G2C B;  4N35 A;  1T2K D;  4J6K A;  3RS1 A;  4I6M C;  5AW2 B;  3CAD A;  4KI1 E;  3WHD A;  1KMB 1;  1YPQ A;  1TLG A;  2BPE A;  1FM5 A;  3I5C A;  4J6P A;  4C9F A;  1F00 I;  1YTT A;  3A5T A;  1RDO 1;  5KTH A;  1FAV A;  3P5D A;  3P32 A;  3GPR C;  3L35 A;  1OWA A;  1KWW A;  1UOS B;  2H2R A;  4ZET A;  3MD0 A;  5B1R A;  5LGK E;  3FF9 A;  1U0O A;  1CZQ A;  1AFB 1;  1PW9 A;  1WMY A;  1NWQ A;  3CFW A;  3VYK A;  2W6A A;  3LIE A;  1A02 J;  3KMB 1;  2MSB A;  3G8K A;  2KP8 A;  2MTI A;  2WPR A;  2BAS A;  3HUP A;  1JNM A;  3M91 A;  3NTN A;  1HYR A;  2N9B A;  1J35 B;  1RDM 1;  4B86 A;  2KV3 A;  3NMD A;  1IOD A;  1BV4 A;  3KDP B;  4LQF A;  2JJL A;  5APS A;  1UOS A;  2R3C A;  5AVW B;  3HE4 A;  1MUU A;  2WWW A;  3A2A A;  3NCW A;  1PWB A;  5AW4 B;  5AW7 B;  2C6U A;  1HQ8 A;  4ZES A;  1KG0 C;  1TDQ B;  1KWX A;  1J35 A;  1H8U A;  1BCH 1;  3G81 A;  3ZHG D;  3OAK A;  2E3X C;  3GPR A;  1BCJ 1;  1S9K E;  5AW0 B;  1KZB 1;  5AVX B;  2Q7C A;  2PY2 A;  3M9B A;  1IXX B;  1MUQ A;  1LIT A;  1SB2 A;  2Z5H A;  3P7H A;  4WCO A;  1JWI A;  3VMZ A;  2Q5U A;  1U0O B;  3VLG A;  4N32 A;  4QKG A;  4QKJ A;  2P2U A;  1U0N C;  2ORJ A;  1SL5 A;  1GU4 A;  1Y17 A;  1BNL A;  5M62 A;  3WWK B;  4XE5 B;  2VRS A;  3TYY A;  1O7B T;  4WUX A;  4WRE A;  4GJX A;  2C9N Y;  4JYB A;  1WT9 A;  1G1Q A;  4N38 A;  1UMR A;  5J6G G;  1FOS F;  3UBU A;  1HJB A;  1X2T B;  3PAK A;  1HTN A;  1K9I A;  4DN8 A;  1XPH A;  3ALT A;  3PAQ A;  4PP8 A;  4AUW A;  1OXZ A;  4J6Q A;  3ZHG A;  1V7P A;  4WRF A;  3P8M C;  2E3X B;  4WQQ A;  2WPQ A;  4M3L A;  1WK1 A;  3P5H A;  4J6J A;  4N37 A;  4UWW A;  3VYI A;  3BDW A;  3VMY A;  5K8Y A;  3IKQ A;  2CL8 A;  2P7J A;  3CDG F;  2XV5 A;  1EGG A;  4N34 A;  3C8J A;  3M0A A;  1QDD A;  2BRS A;  1HUP A;  3MGN A;  2P67 A;  1UEX B;  2WT7 B;  2R5D A;  2BPD A;  3KQG A;  5AW1 B;  3G84 A;  5AVZ B;  1CI6 A;  1UKM A;  5AW8 B;  4DZO A;  2WTY A;  2VRP B;  1KZE 1;  1XAR A;  3BX4 B;  3P7K A;  4QKI A;  4N36 A;  4EZM G;  3PBF A;  1X2W A;  1MFZ A;  1MPU A;  1V4L A;  2VUV A;  2YHF A;  3HE5 A;  4KMB 1;  1GK6 A;  3VMX A;  3L37 A;  1YYC A;  3C22 A;  1GZL A;  2IT5 A;  2IPP A;  5APW A;  2LS8 A;  4C7N B;  2RIC A;  1P1Z D;  2GGX A;  3IKR A;  3B8E B;  1U0N B;  2PF5 A;  4C7N A;  3K7B A;  4WRC A;  4GI0 A;  5FFS A;  1E8I A;  3GPR D;  4KZW A;  2ORK A;  2E42 A;  1QO3 C;  1KWT A;  1J34 A;  1CWV A;  1K9J A;  1V4L B;  4EOT A;  4HYT B;  3P5E A;  3P5I A;  5FFR A;  1X2W B;  5AVT B;  1MV8 A;  1HUC A;  1SLQ A;  1G1R A;  4E52 A;  1E5U I;  4GKO G;  1RDI 1;  4ZRV A;  2AFP A;  4IOP B;  1J2J B;  3NXS A;  4CAJ A;  3P7F A;  1KWZ A;  3LID A;  1T2K C;  1G1T A;  1FVU A;  2RIB A;  4M18 A;  1JUN A;  2OX8 A;  3M9Z A;  1YPO A;  2WT7 A;  1UEX A;  5APT A;  1J34 B;  4LU5 A;  3G8L A;  3NFQ A;  5AVR B;  3WBQ A;  3T97 A;  1IJK B;  2YO3 A;  1KQL A;  1RJH A;  2RID A;  3T3A A;  1RDJ 1;  3M06 A;  3V5B A;  1OZ7 A;  3WWK C;  1KOE A;  2R32 A;  1B08 A;  2XR6 A;  1BYF A;  2GGU A;  3WH3 A;  2IT6 A;  1H89 A;  1KWV A;  2M94 A;  3TNU A;  3UBU B;  4GT1 A;  1UKM B;  5AVU B;  1AFA 1;  2ZIB A;  1KWU A;  4RES B;  2R5B A;  1ESL A;  4I2L C;  1BJ3 B;  3A3Y B;  4GKG A;  2XR5 A;  2I83 A;  5B1W A;  1MSB A;  1P4L D;  1Y17 B;  5APV A;  3IR9 A;  2ZWK A;  4G96 A;  1GU5 A;  4AYC A;  4ZRW A;  3BDW B;  1R14 A;  5AW5 B;  5APQ A;  1GD2 E;  1TN3 A;  3DBZ A;  2OS9 A;  1DY2 A;  2Z5I A;  2XU6 A;  1IO4 A;  1B6E A;  4MTH A;  3TK1 A;  4WUW A;  1DV8 A;  1G1S A;  5APU A;  3WBP A;  4JYC A;  1BJ3 A;  1DY1 A;  1SB2 B;  3A7O A;  2E43 A;  4WR9 A;  1O7C T;  1YXK A;  1KX0 A;  3GPR B;  3M9H A;  3P5F A;  1UMR C;  3VYJ A;  5CMZ A;  4N33 A;  4C46 A;  1HBW A;  1WMZ A;  1WT9 B;  4IOP A;  2H7H A;  3WBR A;  1FOS E;  3TNU B; 
#chains in the Genus database with same CATH topology
 1EZV E;  1F02 I;  1LTJ B;  5CCG C;  4R4L A;  2J5U A;  3LW5 J;  3M0D C;  2QJY B;  4OGQ B;  3H1I E;  2GA1 A;  3HD7 A;  1N86 A;  1OZ7 B;  5AVS B;  1RTM 1;  3FF8 C;  3L72 D;  3EFF K;  3KXD A;  1ZR4 A;  1Q90 D;  3IFM A;  3V6I A;  3JCU H;  3H1H J;  5B66 H;  5AVQ B;  4R4M A;  4EDF A;  3EWK A;  2RIE A;  2ZXE B;  2BCC G;  4PD4 H;  1JWI B;  3FXE A;  1YI2 P;  5KLI C;  1RE4 C;  1IXX A;  1MFT A;  1T8C A;  1H88 A;  1FIF A;  1YPU A;  1LTT C;  1J1E C;  3TGU E;  1L0L E;  1K9M Q;  2E75 B;  2W27 A;  3PAR A;  1LT9 A;  3GLM A;  1KCG A;  1SFC D;  1EGI A;  3Q5P A;  1GL2 D;  1AFD 1;  3P8C E;  2XZR A;  2O3J A;  3JCU E;  3H1H D;  2O01 H;  4H13 C;  1V7P B;  1U7J A;  3AE6 C;  2BPH A;  4H13 B;  4BWN A;  3PH0 A;  1NTM J;  3P5G A;  5CJ0 A;  3WUT A;  4U3F J;  1GZ2 A;  2ZT9 B;  2WSS H;  1H8A A;  2QVA A;  1C3A A;  4U3F E;  1PGP A;  2QJP B;  1KFM A;  2C0X A;  4TLF A;  3L9J C;  4PDC A;  1U57 A;  1K04 A;  3FD4 A;  2FYN C;  1BDC A;  1ZRT D;  2KZJ A;  1S3J A;  1LP1 B;  3VN0 A;  1LTI C;  3A0B H;  3WU2 H;  1L0N K;  2OGU A;  2Y9Z A;  2CPS A;  3VPP A;  5DJT B;  1BGY G;  4N35 A;  2IBZ G;  1XTG B;  3L70 E;  3RK2 B;  3CAD A;  2WMM A;  4KI1 E;  5KLV K;  1M57 D;  2I8D A;  1YPQ A;  2BPE A;  1JY3 P;  2IZ1 A;  2IYO A;  3I5C A;  1YTT A;  3GF7 A;  2QG4 A;  1EQ7 A;  1L0L K;  5TJH A;  3L35 A;  3CCR P;  3LW5 H;  1SQX D;  1IFP A;  1U0O A;  1PW9 A;  2B89 A;  3L74 E;  3U59 A;  3MP7 B;  1JCC A;  1VQ7 P;  2MSB A;  4N6J A;  1KYO E;  1KIL E;  3HUP A;  1R5L A;  3NTN A;  2B87 A;  1NU1 E;  5EFW B;  3NMD A;  1IOD A;  3JC2 2;  1GMJ A;  1VF5 D;  3BCC G;  3B71 A;  1E5W A;  3HD7 B;  1BSN A;  1KC8 Q;  2C6U A;  1TDQ B;  1LTJ A;  1SQQ D;  1YIJ P;  2J58 A;  2FKW B;  1BCH 1;  3G81 A;  3ZHG D;  4PJ0 E;  2Q7C A;  2Z5H A;  3P7H A;  1JO5 A;  4WCO A;  1FC2 C;  1LT9 C;  1LTB C;  1M8O B;  1U0O B;  5CCG D;  2KOG A;  1VQO P;  3FWN A;  5CCH C;  1U0N C;  3CCM P;  3AEF C;  1Y17 A;  1RQV A;  3L72 G;  1HVV A;  3KZI E;  2LXB A;  1OFC X;  2K9Y A;  3AE4 C;  1GL2 B;  2E76 B;  3TYY A;  1O7B T;  1L4A B;  2BEZ F;  4GJX A;  1WT9 A;  1SQV G;  1PP9 J;  4H0L B;  4GOE A;  3H6P A;  1X2T B;  3MUD C;  2IZ0 A;  3KYQ A;  1PP9 E;  1AA0 A;  4PP8 A;  5E79 E;  3CC2 P;  2JWA A;  4J6Q A;  1LP1 A;  3ZHG A;  2E3X B;  3AE3 C;  5KLV E;  3WMM 0;  1IFD A;  4D6T G;  4M3L A;  2I1J A;  4N37 A;  1HGV A;  2WQY C;  1YJ9 P;  1KFN A;  3H1L J;  1EGG A;  3KHU A;  3Q1M A;  2MKV A;  3C8J A;  4NPD A;  1Z56 A;  1S4X A;  2KSJ A;  2WT7 B;  1PGJ A;  2R5D A;  1JMM A;  1BGY D;  3KQG A;  3G84 A;  1JB0 J;  1S2E A;  2O01 J;  5AVZ B;  2NPS B;  2ZVO B;  3PTZ A;  4QKI A;  1VF5 C;  1SQP E;  2M3B A;  4XFJ A;  4UB8 E;  2E5T A;  3CCV P;  2AXC A;  1VQ9 P;  3HE5 A;  3GHG B;  3W68 A;  2IT5 A;  3CX5 D;  1SQQ J;  1P84 I;  2GGX A;  3AEB C;  1EXI A;  1U0N B;  1T3J A;  3G3Z A;  2KLV A;  4GI0 A;  5FFS A;  1OW7 A;  5KJ7 D;  4KZW A;  2ORK A;  2KK7 A;  1Y9B A;  1DX7 A;  1J34 A;  1CWV A;  1K9J A;  1M1J C;  1WRG A;  1OX3 A;  1VQN P;  1X2W B;  5AVT B;  3AE1 C;  1FZF A;  1S1C X;  1R8E A;  1KB9 D;  3GMA A;  1J2J B;  4CAJ A;  2KYV A;  1KWZ A;  3LID A;  2GUS A;  1GW3 A;  3M9Z A;  1SQV D;  1YPO A;  1N73 A;  1SQX J;  4GOF A;  1M7L A;  2KZI A;  3G8L A;  3BCC J;  2KNC B;  3S9O A;  4PJ0 H;  5AVR B;  3T97 A;  2A06 E;  4NPF X;  4HH2 A;  2YO3 A;  4IL6 X;  1BE3 J;  1RJH A;  1OZ7 A;  2YMK A;  1KB9 H;  3G71 P;  3WWK C;  1N7S C;  2YXR B;  1KOE A;  4W80 A;  2GGU A;  4D6T E;  1AVO A;  1BE3 E;  4U3F G;  1H89 A;  2YMY A;  1OW6 A;  2KS1 A;  1KWV A;  1FZB A;  1ZN5 A;  4GT1 A;  1DEB A;  3E1R A;  3AEC C;  1SQV J;  4H44 D;  4EI2 A;  4I2L C;  2KS1 B;  2JP3 A;  2QIW A;  4GKG A;  3IN6 A;  4WVZ A;  1SQV E;  3CL3 D;  1P4L D;  1L0N J;  3IR9 A;  5CCH A;  1R14 A;  3L75 J;  4RKU J;  4LGD E;  1NTK E;  3HRN A;  3DBZ A;  2OS9 A;  1DY2 A;  2Z5I A;  3L75 E;  1KMI Z;  1KOR A;  1NTM D;  3EFG A;  4MTH A;  5E79 H;  3WBP A;  2WZ7 A;  1SB2 B;  1CW5 A;  2LR2 A;  1L0N G;  5L8R J;  1JY3 O;  1NTZ E;  1JY2 O;  3RBZ A;  5GTI H;  4N33 A;  1N7S B;  4C46 A;  4OH8 B;  5GTH H;  1KX1 A;  1NAF A;  2QM8 A;  1HWT C;  1NTZ J;  3OJA B;  3D6Y A;  1U7M A;  2O1J A;  3L36 A;  2QM7 A;  1IFI A;  4DT0 A;  5TIS E;  2R44 A;  3R4Y A;  1GK4 A;  2HLO A;  5KTI A;  1LT1 A;  1KZA 1;  1S5L E;  1KZU B;  1UIX A;  1FS0 E;  1N73 B;  3V4Q A;  4M1G A;  2QA4 P;  1NU1 G;  2ZT9 C;  3NCX A;  4L73 A;  4PV1 C;  4TT3 H;  2RN0 A;  1KD1 Q;  1YTZ I;  1FDO A;  4U7J A;  3CDG E;  2QSI A;  1SQQ G;  1P84 E;  1IFN A;  1VQM P;  1RY3 A;  2QJK C;  2D2C D;  3HE4 B;  3FF7 C;  2Y9Y A;  1KWY A;  4ZNC A;  4EIJ A;  4J6M A;  2PGD A;  4GDO A;  4UXM A;  3HE5 B;  1PGQ A;  4K3A A;  2YIU B;  2NPS C;  5APY A;  2E74 B;  2OX9 A;  1BUU A;  2LKM A;  1RDN 1;  3B4S A;  3GW6 A;  3SFE C;  3VP9 A;  1SP4 A;  1DIP A;  2AXT E;  2YXQ B;  2RIA A;  1VF5 B;  1SQV K;  2M5A A;  2OYI B;  1NTM K;  3JSV C;  2IBZ I;  1LGH B;  1X22 A;  2ITA A;  2B88 A;  1PPJ G;  4YTP C;  1YHQ P;  2IDB A;  1NTZ G;  5AVY B;  2OYI C;  1AV1 A;  3M0D A;  1JY2 N;  1FIH A;  1A02 F;  3C1L A;  4YMD A;  4HB1 A;  1X0T A;  4W7Z A;  1PL5 A;  1JZN A;  2KMB 1;  4O9B A;  1BCC D;  4J6K A;  3H1J D;  4DJG A;  4C7R A;  1ZP0 C;  3L74 J;  4Y99 C;  3RL0 D;  1TLG A;  3SFD C;  1NU1 D;  1FM5 A;  3A0B E;  3WU2 E;  3TF5 A;  4C9F A;  2N1T D;  4WWI A;  3A5T A;  3CWB D;  5KTH A;  2RKL A;  3SWK A;  3GPR C;  5KJ7 C;  1OWA A;  3CCU P;  4H0L D;  3B5N B;  3L74 D;  3MD0 A;  5LGK E;  3H1K G;  1OVU A;  1YJN P;  3FF9 A;  4RJT A;  1AFB 1;  4CPG A;  3CFW A;  2FXM A;  3IAO A;  1LTA C;  1QVF O;  3E1I A;  3KMB 1;  2KP8 A;  1N2D C;  3FX0 A;  3CWB E;  1JNM A;  3TGU G;  2N9B A;  2A06 G;  2KV3 A;  5CBN A;  3QWO C;  4Y28 J;  1T6A A;  3H1J E;  2H43 A;  4JF7 A;  1N7S D;  1SS1 A;  1FE6 A;  1MUU A;  2WWW A;  4UB6 E;  1HF9 A;  2WVR A;  5AW4 B;  1FU1 A;  4ZES A;  5BU8 B;  1KWX A;  2MJZ A;  4UB8 H;  2E3X C;  4H44 C;  1BCJ 1;  1NHL A;  1YTZ T;  2PFX A;  1KZB 1;  1LIT A;  2RMZ A;  3HD7 D;  2W8Z A;  3VMZ A;  3U1C A;  2Q5U A;  3G9R A;  3N7N A;  3A0H E;  1SFC C;  2P2U A;  1BDD A;  1SL5 A;  5M1B A;  1BNL A;  5KLV J;  2VRS A;  1W2E A;  1VQK P;  5C39 A;  4JYB A;  3AE2 C;  1N7S A;  3U1A A;  2JEE A;  2XNX A;  1G1Q A;  4N38 A;  3KPE A;  1UMR A;  5J6G G;  1FOS F;  1OIP A;  2FYN B;  3L71 G;  1HTN A;  1XPH A;  3VMA A;  1RF1 B;  3L73 G;  1VL2 A;  1KV4 A;  1P84 D;  1V7P A;  5KLV G;  2Q1K A;  1WK1 A;  2D2C C;  1L0L D;  4UWW A;  5BVZ A;  1PP9 G;  1YIT P;  1NTZ D;  3VMY A;  3FXD A;  3BVH A;  1VQ5 P;  2OYO A;  2XV5 A;  3BRV B;  4N34 A;  2HOD A;  3TGU J;  1LTS C;  2HPC A;  1QDD A;  1R5S A;  2BRS A;  1UEX B;  3MGN A;  4WY4 A;  5AW1 B;  3RBX A;  3L72 E;  1SQB G;  1XAR A;  3PBF A;  4DCK A;  1FZA A;  3AEA C;  4JQ0 D;  3CCE P;  4HKZ H;  2OTK E;  3CI9 A;  1MPU A;  1V4L A;  1EZV D;  2YHF A;  3AE5 C;  3VMX A;  1YYC A;  3V2N A;  1YJW P;  1GZL A;  4IOI H;  1ZXG A;  2IPP A;  1T8Z A;  2XND H;  3AEG C;  3H1K J;  5APW A;  2LS8 A;  2JKV A;  2RIC A;  1P1Z D;  5KJ7 A;  1USD A;  1DD3 A;  2NPS D;  2PF5 A;  4WRC A;  1E8I A;  3H1K E;  3TSI A;  1NTM E;  3GG2 A;  3L75 D;  3O6Q B;  4EOT A;  4D6T D;  1MV8 A;  1SLQ A;  3HUS B;  2AEF A;  2FYU J;  2AFP A;  2XDJ A;  3A0H H;  3HUS A;  3H1H G;  3K5B A;  3P7F A;  1T2K C;  2AEJ A;  4I1L A;  1FVU A;  2OX8 A;  1PZQ A;  1AVY A;  5APT A;  1J34 B;  2YIU C;  3CLQ A;  3L70 J;  3RL0 C;  2L91 A;  2M3E A;  3NFQ A;  3WBQ A;  1M56 D;  3M9Q A;  1EC5 A;  1IJK B;  2OYH A;  3BCC D;  3MTU E;  1NKZ B;  1P84 H;  1S5L X;  1KQL A;  2C0W A;  2RID A;  3M06 A;  1PFI A;  2Y0E A;  4MN4 C;  3H25 A;  3D6Z A;  2R32 A;  1PV3 A;  1BE3 D;  1NVO A;  4EYY Q;  3WH3 A;  3TNU A;  2NPS A;  3UBU B;  5AVU B;  2ZIB A;  3II6 A;  1KWU A;  1UII A;  2POH A;  1ESL A;  1L4A C;  1JY2 P;  2HPC B;  1RE3 A;  1SQP K;  2XR5 A;  2I83 A;  5B1W A;  2E74 D;  1EDI A;  3N4X A;  1IZN B;  4G96 A;  1KB9 E;  5AW5 B;  5APQ A;  1QEX A;  3L70 G;  3T97 B;  1BGY E;  2N1T A;  3FGA D;  1N73 C;  1RF1 A;  2KNC A;  1B6E A;  1DV8 A;  1H0T A;  1G1S A;  1BJ3 A;  1NKN A;  4ZKP A;  4IL6 H;  1YXK A;  2V7Q J;  1KX0 A;  2IFN A;  3Q5S A;  3GPR B;  3CX5 E;  3P5F A;  1UMR C;  3VYJ A;  1JOC A;  3CXH H;  1WT9 B;  1CSB A;  1IFJ A;  1NYH A;  1YQ3 C;  2P1J A;  1SQP D;  5CHX A;  3HD7 C;  1SL4 A;  1UV0 A;  3G4S P;  2ZYD A;  4KT0 J;  1ZV8 A;  3ALU A;  3RK3 D;  1W2B O;  3WH2 A;  1URQ A;  3O8Z A;  4QKH A;  4S0U A;  3I56 P;  1ZME C;  5APX A;  4J6L A;  5KAF E;  2M0B A;  1DH3 A;  4KJM A;  1KIL B;  1LWU A;  5KTB A;  2GM4 A;  5DJU B;  5CJ4 A;  2VUZ A;  2R3S A;  3BX4 A;  2YNY A;  3RK2 C;  3CME P;  4C16 A;  3H1L G;  1VQ6 P;  1Q81 Q;  3GF3 A;  1CI6 B;  5KLV D;  3V4W A;  2WPS A;  1AQ5 A;  2E75 D;  1KQG B;  4AQR D;  4IFD K;  3BAT A;  1PP9 D;  1ZLL A;  2HFE D;  3GHG C;  5BU5 A;  4UB6 H;  3HTK A;  1HGZ A;  3CXH D;  4G9A A;  4GJ0 A;  3G83 A;  3CCK A;  3SWF A;  1URQ C;  2KB7 P;  3PRJ A;  4XA4 A;  1X8Y A;  3CC7 P;  5F2Q A;  3H1L E;  2FFD C;  2VRP A;  2BCC E;  1X2T A;  1EDJ A;  5AW6 B;  3V2R A;  1VQ4 P;  1OVR A;  2N40 A;  2CPB A;  2AXT H;  4IL6 E;  3IF4 A;  4HJG H;  2K1A A;  3IKN A;  3ITK A;  3VTP C;  1KIL D;  2Y0D A;  5H2F H;  3P7G A;  1E87 A;  1IJK C;  2W90 A;  2QEX P;  2YO2 A;  3CXH I;  1MZ9 A;  2KXP B;  2FBW C;  2O01 N;  3MZW B;  1JA3 A;  1NH4 A;  2H88 C;  2FXO A;  1G2C B;  3MIW A;  4Z1M H;  2WSC J;  3WHD A;  1KMB 1;  3CX5 I;  2KIK A;  1FDI A;  4J6P A;  4BXL A;  2ZYG A;  1RDO 1;  1L2P A;  5GTI E;  1FAV A;  3CWB J;  1N7L A;  3P5D A;  3P32 A;  1Q7Y Q;  5KAI E;  3C9I A;  1BCC E;  4ASV A;  2M5A B;  2OYI A;  5B1R A;  1KYO I;  5KKZ C;  1KB9 I;  1CZQ A;  2FXP A;  3AE9 C;  1WMY A;  1KQS O;  2B87 B;  3W67 A;  1SQX E;  1VPC A;  2W6A A;  2PRR A;  4W7Y A;  4D6T J;  3KZI H;  3G8K A;  2JDI H;  2MTI A;  2BAS A;  1LJ2 A;  1HYR A;  1VDF A;  1J35 B;  4B86 A;  4Y99 B;  3I55 P;  1FZC A;  1BV4 A;  1G1I A;  2JJL A;  5APS A;  1JCD A;  3WUU A;  1RF0 C;  2R3C A;  3S4R A;  3HE4 A;  3A2A A;  3NCW A;  1PWB A;  1FZC B;  1HJ0 A;  2HR3 A;  3CWB G;  1HQ8 A;  1KG0 C;  2FYU K;  1RH5 B;  1ZRT E;  2WSE H;  1H8U A;  3H1H E;  2XKM A;  3GPR A;  1QLE D;  2PY2 A;  3M9B A;  3P8C D;  4U3F D;  1NTM G;  1JWI A;  5KAF H;  1L0L J;  1NTK J;  2D2C B;  1X9V A;  1RQU A;  3QH9 A;  3TGU D;  5TIS H;  3L73 J;  1L4A D;  5M62 A;  4RO0 A;  2L5G B;  4YXD C;  4WRE A;  2Y0C A;  3Q5R A;  1VQ8 P;  4L76 A;  4I7Z B;  3UBU A;  1HJB A;  1BSH A;  1EZV I;  3PAK A;  3ALT A;  4AUW A;  1OXZ A;  2A45 H;  3H1I D;  3V2Q A;  4WRF A;  3L72 J;  4BRY A;  1ZOY C;  4GOD A;  1SQB J;  4WBA A;  2ZYA A;  1JMB A;  1Q82 Q;  1SFC A;  3P5H A;  4J6J A;  1NAY A;  3VYI A;  1GW4 A;  3FWL A;  3VOP A;  2CL8 A;  1SQB E;  1VQP P;  3M0A A;  4WB4 A;  1HUP A;  2P67 A;  3HUS C;  1URQ D;  3C8V A;  2BPD A;  3RK3 C;  2K3R A;  1NTK D;  2W83 C;  5KAI H;  1DD4 A;  5AW8 B;  4DZO A;  2WTY A;  1KZE 1;  3P7K A;  4N78 D;  1PPJ D;  1AJY A;  1X2W A;  3RL0 B;  2FYU E;  3O6Q A;  1MFZ A;  1E79 H;  3SSU A;  5CBO A;  2VUV A;  3CCL P;  2H8P D;  4KMB 1;  1GK6 A;  2FYZ A;  3Q2Y A;  1G1J A;  1SVF A;  3B8E B;  3L74 G;  3K7B A;  3GPR D;  3S1K A;  5CCG A;  2E42 A;  1V4L B;  1K05 A;  4HYT B;  1GL2 C;  3P5E A;  1IK9 A;  2M8R A;  1HUC A;  1G1R A;  1WT6 A;  1Q2N A;  1RDI 1;  5H2F E;  2JO1 A;  4IOP B;  2K88 A;  1RF0 A;  3CX5 H;  4I7Z C;  3NXS A;  1FJK A;  4L74 A;  2A06 D;  1G1T A;  2RIB A;  3C22 A;  1JUN A;  4H13 D;  1K73 Q;  1UEX A;  2Q3E A;  3WUV A;  3L4F A;  2ZT9 D;  3BRT B;  2WSC H;  3AEE C;  2DW3 A;  1OW8 A;  5K5G B;  1NU1 J;  2YKP A;  1URQ B;  3T3A A;  4ZKU A;  1RDJ 1;  3V5B A;  3GHG A;  1N8R Q;  1BYF A;  2RH0 A;  2HG5 D;  5B5E E;  3BAS A;  2N9Y B;  2ZXX A;  3CCJ P;  2ZAE B;  4PV1 B;  4DOJ A;  2K37 A;  4RES B;  2R5B A;  2IFM A;  1RHZ B;  4K35 A;  3H1J G;  3VP8 A;  3R2P A;  2K9J B;  1HTL C;  1FZC C;  5APV A;  2W6J H;  2ZWK A;  1NTZ K;  4AYC A;  4ZRW A;  3PJS K;  5GTH E;  3AE8 C;  2XU6 A;  1JTH A;  1IO4 A;  2HYN A;  3TK1 A;  1RE4 A;  4JYC A;  1DY1 A;  2E43 A;  1LNQ A;  3PP5 A;  1O7C T;  2JWD A;  1HBW A;  2H7H A;  1IJD B;  2O1K A;  1RE3 C;  1WMK A;  1GL2 A;  4KHX A;  4M17 A;  1PPJ E;  1RDK 1;  3MHV A;  1SL6 A;  4N78 E;  1T3U A;  2ZQK A;  2WSE J;  1D7M A;  4WY4 D;  2KSE A;  1EDK A;  4CSY A;  1SQX K;  2OYH B;  2I1K A;  1EXJ A;  5FFT A;  5AVV B;  1R13 A;  1KZD 1;  4OVN F;  2ZFC A;  1SQB D;  1FVU B;  1K8A Q;  2A45 G;  3RK3 B;  1FZG A;  3H1I J;  2OYH C;  1JY3 N;  1W5C E;  4YXW H;  3B5N C;  1FJP A;  3G6E P;  2BCC J;  1RF1 C;  5B66 E;  3UIA A;  2GO0 A;  1YXJ A;  4L75 A;  2H2T B;  1RDL 1;  3B5N A;  3AE7 C;  2Q6Q A;  2QJK B;  1J1E B;  3F5H A;  1GTW A;  1QVG O;  1T8D A;  1IOD B;  2V7Q H;  3AED C;  3SWY A;  2OTJ P;  1BCC G;  4GK1 A;  3L73 D;  1NJI Q;  2IYP A;  3EQ2 A;  2KI7 B;  2E76 C;  2C9L Y;  1SQQ E;  4BRY B;  1KN7 A;  1Y8A A;  1ZW0 A;  1AQT A;  2QJP C;  5AW3 B;  3OA7 A;  1USE A;  1SQP J;  1JEK A;  1NGM B;  1DY0 A;  2WSF H;  3C8K D;  2LXC B;  4WY4 B;  3CD6 P;  2HOD B;  4LC1 A;  4AK8 A;  1TU3 F;  2Q3I A;  3WSR A;  4KZV A;  3ALS A;  3WWK A;  5AW9 B;  3L71 D;  3IKP A;  1S9K D;  4YLI A;  1KYO D;  2OAR A;  1KZC 1;  3CPW O;  5B1X A;  1NU1 K;  1C3A B;  4J6N A;  2WSF J;  1J1D C;  1YBK A;  2NZ2 A;  1L0N D;  2FFD A;  3RL0 g;  1T2K D;  2FFD B;  3RS1 A;  1FDM A;  4I6M C;  5AW2 B;  1AFO A;  2QJY C;  4OGQ C;  1YQ4 C;  4NPE A;  2WIT A;  1LWU C;  1F00 I;  4ASW A;  1KWW A;  3L70 D;  1UOS B;  2H2R A;  4ZET A;  1L0N E;  2BEQ D;  3B5N D;  1JM0 A;  2ZJS E;  1NWQ A;  1NOH A;  3D70 A;  3L75 G;  1XTC C;  3VYK A;  5KLI B;  3LIE A;  3RGU A;  1NTK G;  1A02 J;  2WPR A;  2AEM A;  2W6B A;  1BE3 G;  1PGO A;  3M91 A;  1RDM 1;  1OVV A;  2E74 C;  2Z4E A;  3KDP B;  4LQF A;  2PP6 A;  1UOS A;  2A45 I;  2NRG A;  2OQQ A;  5AVW B;  2OTL P;  2P10 A;  1LT9 B;  5AW7 B;  3L71 J;  1QGK B;  1J35 A;  2JR8 A;  3L73 E;  1SQB K;  3OAK A;  1S9K E;  2ZVN B;  3L71 E;  5AW0 B;  2YKQ A;  3H32 A;  5AVX B;  1G2C A;  2G8Y A;  1IXX B;  1MUQ A;  1SB2 A;  3RK2 D;  1QL2 A;  3TDK A;  1MKM A;  2FY8 A;  3VLG A;  4N32 A;  2IX7 C;  4H44 B;  4QKG A;  1BGY J;  4QKJ A;  2FYU G;  4QMA A;  4PD4 I;  2BCC D;  2ORJ A;  1GU4 A;  3H1L D;  4IFF A;  3WWK B;  4JPZ B;  1QL1 A;  4XE5 B;  4WUX A;  2C9N Y;  4OGQ D;  1S72 P;  1X79 B;  4YPC A;  3CXH E;  4OWF A;  2YKO A;  1KIL C;  2GUV A;  2E75 C;  1K9I A;  2J59 M;  4DN8 A;  3PAQ A;  2G3A A;  3P8M C;  3V2P A;  3CC4 P;  4WQQ A;  2WPQ A;  1SQP G;  2B9B A;  3OW2 O;  3BDW A;  1ZR2 A;  5K8Y A;  3IKQ A;  2P7J A;  3CDG F;  2IBZ D;  4PD4 D;  2KUB A;  1M1J A;  4PV1 D;  1NTK K;  4WY4 C;  2UWJ E;  1OZH A;  1CI6 A;  1UKM A;  3ABV C;  3RK3 E;  2VRP B;  3BX4 B;  4N36 A;  4EZM G;  3Q3D A;  1KQF B;  2KLU A;  1LTG C;  3D71 A;  1KIL A;  4N3Y B;  3L37 A;  1KTM A;  3F89 A;  4C7N B;  3IKR A;  1FBM A;  2SPZ A;  4C7N A;  3HTK B;  1Y47 A;  1QO3 C;  3PLN A;  1KWT A;  3PHL A;  2PAJ A;  3P5I A;  5FFR A;  1HH0 A;  1SQQ K;  1L0L G;  4E52 A;  4LLH A;  3E7K A;  2CK3 H;  1E5U I;  4GKO G;  2QE7 H;  5B5E H;  4ZRV A;  1OMI A;  4ZMD A;  1M90 Q;  4IFM A;  4M18 A;  2E76 D;  2WT7 A;  1GDT A;  1H0T B;  1M1J B;  4LU5 A;  1LWU B;  1JTH B;  3MUD A;  1EDL A;  1M1K Q;  4GIF A;  2WPV B;  1IC2 A;  1QX8 A;  4A7P A;  1VQL P;  1IK7 A;  3H1I G;  1FZE A;  3ZDM A;  2P58 A;  2E5Y A;  1B08 A;  1EZV G;  3H1J J;  2XR6 A;  3USS A;  1SQX G;  1J1D B;  2K9J A;  2IT6 A;  2M94 A;  1UKM B;  1AFA 1;  2V4H A;  1S5L H;  3BCC E;  3CCQ P;  1BJ3 B;  3CMA P;  2H89 C;  1NO4 A;  1BCC J;  1L4A A;  2Q9I A;  1DEE G;  3A3Y B;  2FYU D;  2N1T B;  5KKZ B;  1MSB A;  1Y17 B;  1PIX A;  1GU5 A;  3BDW B;  1KYO H;  1SFC B;  5CCH D;  1GD2 E;  1TN3 A;  2N1T C;  4JBZ A;  3CCS P;  1IFM A;  1LTJ C;  2QRX A;  3H1K D;  1Q86 Q;  4WUW A;  4PD4 E;  5APU A;  2IBZ E;  3A7O A;  4WR9 A;  3H32 B;  4H0L C;  3M9H A;  5CMZ A;  3WBR A;  1WMZ A;  4IOP A;  1FOS E;  3TNU B; 
#chains in the Genus database with same CATH homology
 1CSB A;  1IJD B;  1KX1 A;  1F02 I;  1LTJ B;  2O1K A;  1RE3 C;  4KHX A;  1GL2 A;  1NAF A;  1IFJ A;  2QM8 A;  5CCG C;  2P1J A;  3M0D C;  5CHX A;  1HWT C;  3OJA B;  3HD7 C;  1SL4 A;  1UV0 A;  1RDK 1;  1SL6 A;  3HD7 A;  2O1J A;  1N86 A;  3L36 A;  4N78 E;  1T3U A;  1ZV8 A;  2ZQK A;  3ALU A;  3RK3 D;  5AVS B;  1OZ7 B;  1RTM 1;  1URQ A;  4WY4 D;  3FF8 C;  3WH2 A;  2QM7 A;  1IFI A;  3O8Z A;  1ZR4 A;  4QKH A;  3IFM A;  4CSY A;  1SQX K;  4S0U A;  2OYH B;  1GK4 A;  5AVQ B;  2HLO A;  2I1K A;  5KTI A;  5APX A;  1KZA 1;  2RIE A;  4J6L A;  1KZU B;  2ZXE B;  1DH3 A;  1JWI B;  5FFT A;  1KIL B;  1LWU A;  5AVV B;  5KTB A;  2GM4 A;  1R13 A;  1RE4 C;  1KZD 1;  1N73 B;  3V4Q A;  4M1G A;  1IXX A;  2ZFC A;  1FVU B;  1T8C A;  5CJ4 A;  1H88 A;  2VUZ A;  2A45 G;  3RK3 B;  1FZG A;  1FIF A;  1YPU A;  3BX4 A;  1LTT C;  1J1E C;  2OYH C;  3NCX A;  2YNY A;  3RK2 C;  4C16 A;  1JY3 N;  1YTZ I;  3CDG E;  1CI6 B;  2W27 A;  3B5N C;  3V4W A;  1FJP A;  3PAR A;  2WPS A;  1LT9 A;  1AQ5 A;  1IFN A;  4AQR D;  1RF1 C;  1KCG A;  1RY3 A;  1SFC D;  4IFD K;  3BAT A;  3UIA A;  1EGI A;  2GO0 A;  1YXJ A;  1GL2 D;  1ZLL A;  2H2T B;  1AFD 1;  3HE4 B;  3FF7 C;  1RDL 1;  3P8C E;  2HFE D;  2XZR A;  3GHG C;  5BU5 A;  3B5N A;  1KWY A;  3HTK A;  1HGZ A;  1J1E B;  4EIJ A;  1GTW A;  4G9A A;  1T8D A;  4J6M A;  4GJ0 A;  1IOD B;  3SWY A;  4UXM A;  3G83 A;  4GK1 A;  3HE5 B;  3EQ2 A;  2NPS C;  5APY A;  3CCK A;  2O01 H;  3SWF A;  1URQ C;  2C9L Y;  2OX9 A;  2KB7 P;  1V7P B;  1BUU A;  4XA4 A;  1X8Y A;  2LKM A;  2BPH A;  1RDN 1;  5F2Q A;  5AW3 B;  3OA7 A;  2FFD C;  2VRP A;  3VP9 A;  1X2T A;  3P5G A;  1SP4 A;  5CJ0 A;  5AW6 B;  3V2R A;  1GZ2 A;  2RIA A;  1DY0 A;  2WSF H;  3C8K D;  2N40 A;  2CPB A;  4WY4 B;  1SQV K;  1H8A A;  2OYI B;  1C3A A;  2HOD B;  3IKN A;  1NTM K;  4LC1 A;  4AK8 A;  2Q3I A;  3WSR A;  4KZV A;  3ALS A;  1LGH B;  1KFM A;  3WWK A;  3VTP C;  5AW9 B;  2C0X A;  1KIL D;  3IKP A;  1S9K D;  3L9J C;  4PDC A;  4YLI A;  3P7G A;  1E87 A;  1IJK C;  2OAR A;  3FD4 A;  1KZC 1;  4M17 A;  5B1X A;  5AVY B;  2OYI C;  2YO2 A;  1MZ9 A;  1NU1 K;  1C3A B;  3VN0 A;  4J6N A;  1LTI C;  1J1D C;  3M0D A;  1L0N K;  1JY2 N;  1FIH A;  1A02 F;  4YMD A;  2FFD A;  1JA3 A;  1NH4 A;  2CPS A;  4W7Z A;  3VPP A;  1JZN A;  2KMB 1;  1G2C B;  4O9B A;  4N35 A;  1T2K D;  4J6K A;  2FFD B;  1XTG B;  3MIW A;  3RK2 B;  3RS1 A;  1FDM A;  4I6M C;  5AW2 B;  1AFO A;  3CAD A;  5KLV K;  4KI1 E;  4C7R A;  3WHD A;  1KMB 1;  1YPQ A;  4Y99 C;  3RL0 D;  1TLG A;  2BPE A;  1JY3 P;  1FM5 A;  3I5C A;  2WIT A;  1LWU C;  4J6P A;  4C9F A;  1F00 I;  2N1T D;  1YTT A;  3A5T A;  1RDO 1;  5KTH A;  1FAV A;  3P5D A;  1N7L A;  1EQ7 A;  1L0L K;  3P32 A;  3GPR C;  3C9I A;  3L35 A;  5KJ7 C;  1OWA A;  1KWW A;  1UOS B;  3LW5 H;  2H2R A;  4ZET A;  3B5N B;  3MD0 A;  2OYI A;  5B1R A;  5LGK E;  3FF9 A;  1U0O A;  1CZQ A;  3B5N D;  1AFB 1;  1PW9 A;  1WMY A;  1NWQ A;  3CFW A;  3U59 A;  2FXM A;  1NOH A;  1XTC C;  1LTA C;  1VPC A;  2W6A A;  3VYK A;  3E1I A;  1JCC A;  3LIE A;  4W7Y A;  1A02 J;  3KMB 1;  2MSB A;  3G8K A;  2KP8 A;  4N6J A;  2MTI A;  1N2D C;  2WPR A;  2BAS A;  2W6B A;  3HUP A;  1JNM A;  3M91 A;  3NTN A;  1HYR A;  2N9B A;  1VDF A;  1J35 B;  1RDM 1;  4B86 A;  2KV3 A;  3NMD A;  4Y99 B;  2Z4E A;  1FZC A;  1IOD A;  1BV4 A;  3KDP B;  1G1I A;  4LQF A;  2H43 A;  2JJL A;  4JF7 A;  1JCD A;  5APS A;  1N7S D;  1RF0 C;  2PP6 A;  1UOS A;  2A45 I;  2R3C A;  5AVW B;  3HE4 A;  1MUU A;  2WWW A;  3A2A A;  3NCW A;  1PWB A;  1E5W A;  3HD7 B;  5AW4 B;  1FZC B;  1FU1 A;  1LT9 B;  5AW7 B;  2C6U A;  1HQ8 A;  4ZES A;  5BU8 B;  1KG0 C;  1TDQ B;  1LTJ A;  2FYU K;  1J35 A;  2J58 A;  2WSE H;  1KWX A;  2MJZ A;  1H8U A;  2FKW B;  1BCH 1;  3G81 A;  3ZHG D;  3OAK A;  1SQB K;  2E3X C;  2XKM A;  3GPR A;  1BCJ 1;  1NHL A;  1YTZ T;  1S9K E;  5AW0 B;  2YKQ A;  3H32 A;  1KZB 1;  5AVX B;  2Q7C A;  2PY2 A;  1G2C A;  3M9B A;  1IXX B;  1MUQ A;  1LIT A;  2Z5H A;  1SB2 A;  3P7H A;  1JO5 A;  4WCO A;  3RK2 D;  3P8C D;  1QL2 A;  3HD7 D;  1JWI A;  1LT9 C;  3VMZ A;  3U1C A;  2Q5U A;  1LTB C;  1U0O B;  3VLG A;  4N32 A;  5CCG D;  1X9V A;  2KOG A;  2IX7 C;  3N7N A;  4QKG A;  4QKJ A;  5CCH C;  1SFC C;  2P2U A;  1U0N C;  2ORJ A;  1SL5 A;  1GU4 A;  4IFF A;  1L4A D;  1Y17 A;  1BNL A;  5M62 A;  3WWK B;  1HVV A;  1QL1 A;  4XE5 B;  1GL2 B;  2L5G B;  2VRS A;  3TYY A;  1O7B T;  1L4A B;  4WUX A;  1W2E A;  4WRE A;  4GJX A;  2C9N Y;  4JYB A;  1WT9 A;  1N7S A;  3U1A A;  1X79 B;  2JEE A;  2XNX A;  1G1Q A;  2YKO A;  4N38 A;  3KPE A;  1UMR A;  1KIL C;  5J6G G;  1FOS F;  3UBU A;  2GUV A;  3H6P A;  1HJB A;  1X2T B;  3PAK A;  1HTN A;  1K9I A;  2J59 M;  3KYQ A;  4DN8 A;  1XPH A;  3ALT A;  3PAQ A;  1RF1 B;  4AUW A;  4PP8 A;  1OXZ A;  2A45 H;  4J6Q A;  3ZHG A;  3V2Q A;  1V7P A;  4WRF A;  3P8M C;  2E3X B;  3V2P A;  4WQQ A;  3WMM 0;  2WPQ A;  4WBA A;  1IFD A;  1SFC A;  4M3L A;  1WK1 A;  2I1J A;  3P5H A;  4J6J A;  4N37 A;  1HGV A;  4UWW A;  3VYI A;  5BVZ A;  3BDW A;  1GW4 A;  3VMY A;  1ZR2 A;  1KFN A;  5K8Y A;  3VOP A;  3BVH A;  2CL8 A;  3IKQ A;  2P7J A;  3CDG F;  2XV5 A;  3BRV B;  1EGG A;  4N34 A;  2HOD A;  3C8J A;  1LTS C;  1Z56 A;  2HPC A;  3M0A A;  1QDD A;  1M1J A;  4WB4 A;  2BRS A;  2KSJ A;  1HUP A;  3MGN A;  2P67 A;  1UEX B;  3HUS C;  2WT7 B;  1URQ D;  4WY4 A;  2R5D A;  2BPD A;  1JMM A;  3RK3 C;  1NTK K;  4WY4 C;  3KQG A;  5AW1 B;  3G84 A;  5AVZ B;  1CI6 A;  1UKM A;  2NPS B;  5AW8 B;  4DZO A;  2WTY A;  2VRP B;  1KZE 1;  1XAR A;  3BX4 B;  3P7K A;  4N78 D;  4QKI A;  4N36 A;  4EZM G;  3PBF A;  1FZA A;  1X2W A;  3RL0 B;  2M3B A;  3CI9 A;  1MFZ A;  1MPU A;  1V4L A;  1LTG C;  2VUV A;  1KIL A;  2H8P D;  3GHG B;  3HE5 A;  1GK6 A;  2FYZ A;  4N3Y B;  3VMX A;  2YHF A;  3L37 A;  4KMB 1;  1YYC A;  3V2N A;  1GZL A;  2IT5 A;  3C22 A;  2IPP A;  1T8Z A;  5APW A;  2LS8 A;  4C7N B;  1G1J A;  2RIC A;  1P1Z D;  2GGX A;  1FOS E;  5KJ7 A;  1SVF A;  3IKR A;  3B8E B;  1FBM A;  1U0N B;  2NPS D;  2PF5 A;  4C7N A;  1T3J A;  3HTK B;  3G3Z A;  3K7B A;  2KLV A;  4WRC A;  4GI0 A;  5FFS A;  1E8I A;  3GPR D;  5KJ7 D;  4KZW A;  3TSI A;  2ORK A;  5CCG A;  2E42 A;  1QO3 C;  1DX7 A;  1KWT A;  1J34 A;  1CWV A;  1K9J A;  1V4L B;  1M1J C;  2PAJ A;  4EOT A;  4HYT B;  1GL2 C;  1WRG A;  3P5E A;  3P5I A;  5FFR A;  1HH0 A;  1X2W B;  1IK9 A;  1SQQ K;  2M8R A;  5AVT B;  1MV8 A;  1HUC A;  1SLQ A;  1G1R A;  1WT6 A;  4E52 A;  4LLH A;  1E5U I;  3HUS B;  1FZF A;  4GKO G;  1RDI 1;  4ZRV A;  2AFP A;  4IOP B;  1RF0 A;  2XDJ A;  3HUS A;  1J2J B;  3NXS A;  1FJK A;  4CAJ A;  2KYV A;  3P7F A;  1KWZ A;  3LID A;  4IFM A;  1T2K C;  2GUS A;  1G1T A;  4I1L A;  1GW3 A;  1FVU A;  1JUN A;  2RIB A;  2OX8 A;  3M9Z A;  4M18 A;  1YPO A;  2WT7 A;  1N73 A;  1GDT A;  1UEX A;  5APT A;  1J34 B;  1M1J B;  4LU5 A;  1LWU B;  1M7L A;  3CLQ A;  3G8L A;  3RL0 C;  1JTH B;  3L4F A;  3BRT B;  2WSC H;  3MUD A;  3NFQ A;  5AVR B;  3WBQ A;  3T97 A;  3M9Q A;  4GIF A;  1IC2 A;  3MTU E;  2OYH A;  1IJK B;  1NKZ B;  4HH2 A;  2YO3 A;  1KQL A;  2YKP A;  2C0W A;  1RJH A;  1URQ B;  2RID A;  3T3A A;  4ZKU A;  3M06 A;  3V5B A;  3GHG A;  1PFI A;  1OZ7 A;  1RDJ 1;  1FZE A;  3WWK C;  1N7S C;  1KOE A;  2R32 A;  1B08 A;  2XR6 A;  1BYF A;  4W80 A;  2HG5 D;  2GGU A;  1J1D B;  3BAS A;  3WH3 A;  2IT6 A;  1H89 A;  2YMY A;  1KWV A;  2M94 A;  3TNU A;  1FZB A;  1ZN5 A;  2NPS A;  3UBU B;  4GT1 A;  1DEB A;  1UKM B;  4DOJ A;  5AVU B;  1AFA 1;  2ZIB A;  3II6 A;  1KWU A;  4RES B;  2POH A;  2R5B A;  1ESL A;  2IFM A;  4I2L C;  1BJ3 B;  1NO4 A;  1L4A C;  1JY2 P;  2HPC B;  1RE3 A;  1L4A A;  3VP8 A;  2Q9I A;  3R2P A;  1SQP K;  3A3Y B;  4GKG A;  2N1T B;  2XR5 A;  2I83 A;  5B1W A;  1HTL C;  1MSB A;  3CL3 D;  1FZC C;  1P4L D;  1Y17 B;  5APV A;  3IR9 A;  3N4X A;  5CCH A;  2ZWK A;  4G96 A;  1GU5 A;  1NTZ K;  4AYC A;  4ZRW A;  3BDW B;  1R14 A;  5AW5 B;  5APQ A;  1SFC B;  5CCH D;  1GD2 E;  4LGD E;  1TN3 A;  3HRN A;  3DBZ A;  2OS9 A;  2N1T A;  1DY2 A;  2Z5I A;  1N73 C;  1RF1 A;  2XU6 A;  1JTH A;  2N1T C;  1IFM A;  1IO4 A;  1LTJ C;  1B6E A;  3EFG A;  2HYN A;  4MTH A;  3TK1 A;  1RE4 A;  4WUW A;  1DV8 A;  1G1S A;  5APU A;  3WBP A;  2WZ7 A;  4JYC A;  1BJ3 A;  1CW5 A;  1DY1 A;  1NKN A;  1SB2 B;  3A7O A;  4ZKP A;  2E43 A;  4WR9 A;  3PP5 A;  1O7C T;  1YXK A;  3H32 B;  1KX0 A;  1JY3 O;  2IFN A;  3GPR B;  1JY2 O;  3M9H A;  3P5F A;  1UMR C;  3VYJ A;  5CMZ A;  1N7S B;  4C46 A;  1JOC A;  1HBW A;  1WMZ A;  1WT9 B;  2H7H A;  4IOP A;  4N33 A;  3WBR A;  4OH8 B;  3TNU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...