3KQGA

Trimeric structure of langerin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
169
structure length
169
Chain Sequence
SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-type lectin domain family 4 member K
publication title Trimeric structure of langerin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kqgA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3kqgA02
5B1RA 5F2QA 4WUXA 3WH2A 3WH3A 3HE4B 3NXSA 1KOEA 1YTTA 2BRSA 3V4WA 1WMZA 3FF7C 4KMB1 2XZRA 1R13A 1SL6A 1UKMB 1KX0A 1KWXA 2BASA 3G83A 1SLQA 3VMYA 3NMDA 3TNUB 1HWTC 4GJXA 1CI6B 2ZXEB 5AVZB 3LIDA 3V4QA 1GTWA 1JZNA 4G96A 4EZMG 3DBZA 3KMB1 4ZRWA 1FIFA 3ALTA 3M9BA 1NWQA 3P7HA 4I6MC 4J6PA 1X8YA 1KQLA 4KZWA 4KHXA 4N33A 2QM8A 1GK4A 4WR9A 4WREA 2LS8A 4JYCA 5AW4B 1GK6A 3P8MC 1E8IA 3HE5A 1UOSA 5CMZA 4WUWA 1YXJA 1J35A 1V7PA 1FAVA 1KWYA 2KMB1 3M9ZA 2OS9A 4GJ0A 2WTYA 4WQQA 3VPPA 3A7OA 4G9AA 1WMYA 1RDM1 1JA3A 1HQ8A 3I5CA 1SB2B 4PDCA 2H7HA 3WHDA 4N36A 3LIEA 3L35A 1FVUA 4DZOA 1G1SA 5APYA 1H88A 1KMB1 1P4LD 1T2KC 1X2WB 1DV8A 2C9LY 3HE5B 1RDJ1 1UOSB 4XE5B 1V7PB 1ESLA 3FF9A 1K9IA 5APQA 2P2UA 1FOSF 1MV8A 2VUZA 2YO2A 3M9HA 2GGUA 3WWKA 5AW3B 3ZHGD 2W27A 1GU4A 2CL8A 4N34A 2R3CA 4PP8A 4JYBA 1KZD1 2PY2A 1WT9A 1FVUB 3CDGF 2IT5A 1MUQA 2WT7B 1E87A 1MUUA 4GKGA 1RDN1 3CDGE 1U0OA 3SWFA 3P7FA 2Z5HA 4E52A 1EGIA 2BPHA 1CSBA 3IKPA 3P5DA 1E5UI 1TDQB 1V4LA 2YO3A 1BJ3A 3C22A 2IT6A 3NCWA 4QKIA 1WT9B 3C8JA 1F02I 3WWKC 2OX9A 2YNYA 5AW8B 2KV3A 4AK8A 4C16A 3RS1A 4AQRD 3HTKA 3ALSA 1B6EA 2I83A 3IR9A 2Q7CA 4C46A 2ZWKA 1QDDA 1RDK1 1YPQA 4J6QA 2BPDA 2MTIA 4J6NA 2Z5IA 1JNMA 4M1GA 1BJ3B 3CFWA 3PBFA 2BPEA 3P5GA 4WCOA 4DN8A 3P5HA 1YYCA 1UMRA 4AUWA 3GPRD 2W6AA 2C6UA 1U0NB 3ZHGA 3M91A 3VMXA 3G8LA 4LQFA 1U0NC 1UV0A 3G8KA 4J6LA 3VYKA 4YLIA 1K9JA 2M94A 2E3XB 1BCJ1 5APSA 2MSBA 3L37A 4N35A 3KDPB 3FF8C 1AFD1 2XR5A 4J6MA 1GD2E 3C8KD 2E3XC 5AVQB 1OZ7A 4N37A 3G84A 5AW5B 1SL5A 3T3AA 2ZQKA 4GI0A 1EGGA 1O7CT 1JWIA 3BDWA 1MFZA 1G2CB 1YPOA 1UMRC 5APWA 3NTNA 2XR6A 5APTA 3P5EA 3M06A 1O7BT 1T8DA 1IJKB 1GU5A 1J35B 1C3AA 5AVSB 3IKRA 5B1XA 5AW0B 3FD4A 1IXXA 4IOPA 2R5DA 1G1QA 1IJKC 3ALUA 3KQGA 4J6KA 4KI1E 3PAQA 1OZ7B 2OX8A 1YXKA 2Q5UA 4UXMA 4AYCA 1AFA1 1OXZA 1JUNA 2AFPA 3P7KA 1JWIB 1S9KE 2N40A 3BDWB 4N38A 4ZESA 1KX1A 5B1WA 1KWUA 1H89A 1BUUA 1KWTA 2RIAA 4QKHA 5J6GG 2E43A 1R14A 4RESB 1G1TA 1IODA 1C3AB 4WRFA 1KZC1 1T8CA 3GPRA 3CCKA 1IXXB 4IOPB 5KTIA 1HUPA 3WWKB 3P32A 5K8YA 1A02J 4B86A 1MSBA 3A2AA 3HUPA 4HYTB 5AW1B 2RIEA 1KZE1 2GO0A 1RDI1 3UIAA 1X2TA 2WWWA 2YHFA 5LGKE 2N9BA 3BX4A 1U0OB 1RDL1 1XARA 1HBWA 3P5FA 5APXA 2P67A 3B8EB 4EOTA 2QM7A 1OWAA 2R32A 1IODB 1GZ2A 2E42A 3GPRB 1SL4A 2IPPA 4ZRVA 2ZFCA 1F00I 1TN3A 1V4LB 2H2TB 3M0AA 5M62A 3GPRC 5AW9B 3UBUA 1H8UA 1QO3C 2WPSA 3VTPC 2XV5A 1DY1A 1X2TB 4WRCA 4S0UA 1PW9A 5AVYB 3WSRA 4LC1A 3BX4B 3VLGA 3A3YB 3WBRA 1XPHA 3K7BA 1HUCA 5AW6B 1BV4A 1IO4A 1RJHA 1RDO1 1P1ZD 3VMZA 3MD0A 1SB2A 3UBUB 1BNLA 2VUVA 3G81A 1Y17A 1GZLA 1YPUA 3VYJA 2RICA 1S9KD 2RIDA 3IKQA 2VRPA 5AW7B 2R5BA 1PWBA 1X2WA 1UEXA 3O8ZA 5AVVB 1FM5A 1WK1A 3WBQA 4MTHA 2C9NY 2ZIBA 1RTM1 3CADA 3PARA 2GGXA 2KP8A 1KG0C 4UWWA 4I2LC 1BCH1 5AW2B 3P5IA 3L36A 3NFQA 4M3LA 1J2JB 3MGNA 1J34A 2WPRA 4M18A 1KCGA 1KZA1 2RIBA 3PAKA 5FFSA 1Y17B 1TLGA 1DY2A 1CZQA 3VN0A 2WT7A 1G1RA 1MPUA 2VRPB 4QKJA 1CWVA 1LITA 4CAJA 4QKGA 1UEXB 1DY0A 4C7NA 4GK1A 1KZB1 1B08A 2H2RA 1SP4A 4ZETA 3TK1A 1T2KD 1HYRA 3NCXA 5AVTB 5FFTA 1FOSE 4YMDA 5AVUB 2ORJA 3A5TA 3P7GA 2P7JA 2WPQA 1J34B 2XU6A 5AVWB 3VYIA 2VRSA 1HJBA 3T97A 4J6JA 4N32A 1FIHA 3OAKA 3TYYA 2PF5A 1NAFA 5AVXB 2ORKA 4LU5A 5APUA 1KWVA 3HE4A 1HTNA 1BYFA 4C7NB 1KWWA 2Q3IA 1DH3A 5AVRB 1A02F 3IKNA 1UKMA 4M17A 4GKOG 3M0DA 1KWZA 5APVA 3L9JC 5KTHA 1AFB1 2JJLA 3TNUA 3WBPA 5FFRA 4C9FA 1CI6A 1H8AA 4CSYA 4KZVA 4GT1A 3V5BA
chains in the Genus database with same CATH superfamily
3CCJP 3I55P 1URQA 3AE8C 4Y99B 2WSCJ 3WH3A 3H1JJ 1KQFB 5KLVE 3CWBD 3V4WA 2ZT9B 2W6JH 3AE5C 1IJDB 3G83A 1SLQA 5KLIB 3L73E 3NMDA 3E1RA 1HWTC 4GJXA 1CI6B 3H32A 1JZNA 4ZRWA 2H88C 2QE7H 5CCGC 3RK3E 3P7HA 4I6MC 1X8YA 4KHXA 1ZP0C 1NTMK 2IFMA 1NU1K 4IL6X 2OYIA 4WY4D 2Y9YA 1KILD 3HD7D 1SQBG 2NZ2A 1GK6A 1BCCD 1OIPA 1OMIA 1FAVA 1KWYA 2KMB1 2WZ7A 2E5YA 1VPCA 2MJZA 3L74E 1T3JA 4G9AA 1WMYA 2YMKA 1FJPA 1Y9BA 1GDTA 2OTJP 3SWYA 1HQ8A 3I5CA 3H1JG 1SB2B 2HR3A 4N36A 1EZVG 1FU1A 1OZHA 2MKVA 1KD1Q 1FDIA 1BCCJ 1JCCA 1KMB1 1P4LD 1X2WB 2AEJA 1P84D 2OYHC 3P8CD 1ESLA 1NTKD 1K9IA 2P2UA 4HJGH 2FFDC 4H0LD 4PD4E 2VUZA 3WWKA 3ZHGD 2W27A 1GU4A 2R3CA 4JYBA 2PY2A 2GA1A 3CDGF 3U1AA 1ZRTE 3BCCJ 1E87A 3G9RA 1HGZA 1N73B 2ZYAA 3P7FA 1EGIA 2A06D 5TJHA 1LTJC 2BPHA 4XA4A 5GTHH 3H1IE 1LT1A 1NTME 3NCWA 4JPZB 1BCCG 1WT9B 1F02I 4WBAA 2E5TA 1JEKA 1X9VA 1LT9C 2Y9ZA 3G3ZA 4C46A 1YI2P 1RDK1 2LR2A 1FZGA 4J6QA 2BPDA 3B5NB 1ZMEC 3HUSC 3A0HE 2E75B 4M1GA 1BJ3B 2KB7P 1T6AA 2Q6QA 1JTHA 1VQ7P 1EDLA 2PP6A 3BCCG 4WY4C 1LGHB 4DN8A 1SQXJ 2B88A 1G1IA 1ZN5A 1KILC 1YYCA 3HD7C 5H2FH 1OW8A 2W6AA 3CI9A 4H13B 1YJ9P 3G6EP 1FE6A 1HH0A 4D6TE 1VQ6P 1GW4A 3GHGC 2K3RA 3V2PA 4YLIA 2AXTE 2M94A 3L37A 1NTKK 3HRNA 2L91A 3FF8C 3CCEP 1VQ9P 5K5GB 3C8KD 5AVQB 1OZ7A 3O6QB 3T3AA 1DEBA 2Z4EA 1YQ3C 1SVFA 1JWIA 4UB8E 1YBKA 1R5LA 2IBZD 4PD4I 1IK9A 2LKMA 2WQYC 5CJ0A 2IYOA 3IKRA 5B1XA 4IOPA 1SQXG 3USSA 2OARA 4KI1E 3F89A 3PAQA 2WVRA 1YXKA 2Q5UA 1AFA1 1OXZA 1JM0A 2YKQA 1S9KE 2N40A 1KWUA 1KWTA 2HODA 2WMMA 2NPSA 1QVGO 1LP1A 1KZC1 1T8CA 3GPRA 4RKUJ 4Z1MH 1Q82Q 2GUVA 1BSHA 1IZNB 5KTIA 1HUPA 3WWKB 1L4AD 2E76B 5K8YA 3AEEC 2R44A 1EC5A 1NYHA 2GO0A 1SFCC 1PV3A 1HF9A 1RDL1 1HBWA 3P5FA 1FZCA 1OFCX 4YXWH 2QM7A 1OWAA 5CCHA 1F00I 1LTIC 4LLHA 1SQPD 5M62A 4PD4H 2K9JB 3SFDC 2IBZG 1H8UA 3CXHI 1LNQA 1X2TB 2B87B 4DT0A 3KHUA 2CPBA 1PW9A 4W7YA 4LC1A 4IOIH 4YXDC 3GF7A 3A3YB 3WBRA 1KB9E 1HTLC 4N78E 3K7BA 1SQPJ 1PZQA 1BV4A 1L0LD 3KYQA 1M1JC 3D6YA 3VMZA 2K37A 3AEDC 1R8EA 2YIUB 3UBUB 2JWDA 1NKZB 3CL3D 2HFED 1GZLA 1N7SD 1RY3A 5B66E 1BE3D 1HVVA 1SQVE 2R5BA 1NTZK 1PWBA 1NJIQ 1RQUA 1FM5A 2K1AA 2C9NY 1RTM1 2AEFA 4I2LC 1AQTA 2N9YB 3RK2D 2Y0CA 4M3LA 3L71E 1W2EA 1UIIA 2WSFH 2WPRA 4L75A 3L70J 3PAKA 1Y17B 1TLGA 3JC22 1DY2A 2RKLA 1VQNP 3VN0A 4BRYA 1MPUA 1LITA 4CAJA 5TISE 1M7LA 4WVZA 1BSNA 1MKMA 3A0BH 1SQPG 3MZWB 3CXHH 2HLOA 2A45G 3NCXA 4CPGA 2WSSH 2HG5D 1L4AC 1M56D 5AVUB 3D71A 3P7GA 2WPQA 2XU6A 1RF1B 2AXTH 1VF5D 3Q5PA 1MFTA 1HJBA 2FYUJ 4HKZH 3H25A 4I7ZC 1FIHA 5CJ4A 3TYYA 4EI2A 5AVXB 1JCDA 1HTNA 3ABVC 2QJPC 3Q2YA 1VL2A 1A02F 1VQLP 2HODB 2GUSA 4M17A 1K05A 4LGDE 2KZJA 3M0DA 2J5UA 5KTHA 1JMMA 3L70G 5FFRA 1CI6A 2KLVA 5KLVJ 4GT1A 1Q86Q 1L0LK 2KOGA 5B1RA 5F2QA 1NTZE 1S4XA 3L73J 1QVFO 3HE4B 2BRSA 1QEXA 4PV1D 1WMZA 3FF7C 4KMB1 3C8VA 3L74D 2BASA 3IFMA 2FYUG 4O9BA 1GTWA 4G96A 4EZMG 1PPJG 3EFGA 1RE4C 3KMB1 3WUUA 1FIFA 2RN0A 1N7SC 1NWQA 5CBOA 1KQLA 5KAFH 3CMEP 1GK4A 1L0ND 3MP7B 3BATA 4WR9A 4WREA 1FDOA 3L74J 5CHXA 3Q5RA 4W7ZA 5KJ7A 2D2CD 2QJYC 3WMM0 5AW4B 1E8IA 4PD4D 3RK2C 3L75D 2OS9A 1S5LH 3H1LE 3VPPA 4W80A 1XTCC 4A7PA 1YITP 3L73G 3WUVA 1ZRTD 4PDCA 2H7HA 3L35A 2FYZA 2OYHB 1DV8A 2KNCB 3L75J 2FFDB 2C9LY 4XFJA 3TGUE 2LXCB 3FF9A 1VF5C 5GTIH 1HJ0A 5AW3B 1ZOYC 3U1CA 4PP8A 3L74G 2G8YA 4TLFA 3ITKA 3G71P 1WT9A 4WB4A 1LTJB 2IT5A 4BRYB 3H1IJ 1RDN1 3RK3C 2J58A 2W6BA 2YKOA 1VQPP 4MN4C 1VQMP 1SQQE 1L0NG 3B5NA 1V4LA 5CBNA 5KKZC 1BJ3A 1JY3N 3CXHD 1K73Q 4D6TD 4N3YB 3L75G 2WSFJ 3KZIH 4PV1C 1KYOI 1NO4A 4AQRD 4JF7A 3D70A 1B6EA 1WT6A 3HUSB 2Q7CA 1J1EB 1YPQA 4WY4B 1JY3P 1KILB 3HD7B 3PBFA 4D6TJ 3P5HA 1IFIA 2D2CC 3O6QA 3Q3DA 4AUWA 2Q1KA 2A45I 3GHGB 5KAIE 3W68A 2IDBA 2FXMA 1OW7A 2V7QJ 1U7MA 3L72D 3M91A 1RH5B 2K9YA 1UV0A 2KK7A 2FBWC 3Q1MA 1NKNA 2IZ1A 5APSA 2KXPB 3AE1C 3KDPB 1AFD1 4NPEA 4J6MA 5E79E 3MHVA 1X0TA 5AW5B 3PRJA 1SQBK 3L72J 2ZQKA 4H0LB 1O7CT 3H1KE 1G2CB 1YPOA 2QG4A 1UMRC 1FZEA 2M3BA 1WRGA 5APWA 3P5EA 2KIKA 3BCCD 1AA0A 1LJ2A 4D6TG 1KYOH 3CCSP 4IL6E 2J59M 1TU3F 3KQGA 4J6KA 2YKPA 2AEMA 4AYCA 1IFNA 4C7RA 2AFPA 3FXDA 3P7KA 2Q9IA 2QVAA 3BDWB 5EFWB 5B1WA 3RBXA 1BUUA 5B5EH 2N1TD 5J6GG 4RESB 3E1IA 3W67A 1G1TA 2A45H 1C3AB 3MUDA 2FY8A 3L72G 2K9JA 4B86A 3I56P 1NU1E 3A2AA 4OGQD 3M9QA 2RIEA 1KZE1 1S2EA 3UIAA 3CPWO 2B87A 1RDI1 1X2TA 2YHFA 1YIJP 2N9BA 1SQXD 5APXA 1FDMA 3B8EB 1LWUC 1SFCD 1GZ2A 2E42A 1Z56A 1SL4A 2IX7C 2IPPA 4ZRVA 3IN6A 1TN3A 1V4LB 1N7LA 3M0AA 4YPCA 5AW9B 1SQVD 3AECC 3UBUA 1RE3A 2WPSA 1GL2D 4DOJA 4UB6H 4WRCA 4S0UA 3AE4C 3WSRA 4H44D 1M1JB 2Y0DA 3C9IA 1XPHA 4K3AA 3EFFK 3H1JE 3WU2E 1E5WA 4ZKUA 5AW6B 1SQVJ 1RJHA 1RDO1 1PL5A 1P1ZD 1PIXA 2JP3A 3JCUE 2M5AB 3G81A 1Y17A 3V2QA 3PLNA 2POHA 4WWIA 3L71J 3JSVC 5AVVB 3KPEA 3FGAD 3CWBE 3OA7A 1URQD 4GDOA 2GGXA 4UWWA 1NOHA 5C39A 1DIPA 1J1DC 1KTMA 1LTTC 3L36A 3PP5A 1H0TB 2QSIA 1J2JB 1RF1A 4M18A 1FBMA 5FFSA 1N8RQ 2N1TC 1UEXB 2M3EA 4GK1A 1KZB1 1B08A 1L4AB 1SP4A 2KS1B 1BDDA 1SQVG 4U7JA 1PGOA 1T2KD 1S5LX 1SQXK 1BCCE 4I7ZB 4OGQC 1J34B 3H1HE 3VYIA 2IYPA 1FC2C 2VRSA 3SFEC 2QJPB 1AJYA 3OAKA 3L71G 1NAFA 1KYOD 2M0BA 4LU5A 3HE4A 2DW3A 1BYFA 2Q3IA 1DH3A 1IK7A 3CCMP 2ZYGA 1N73C 3IKNA 1N86A 5CCGA 4GIFA 1X79B 5APVA 3B71A 2JJLA 3P8CE 3PTZA 3QWOC 3R4YA 1AFB1 3WBPA 3B4SA 3GLMA 1NTKE 1GL2C 3CCVP 1EXIA 1N2DC 4NPDA 4WUXA 3WH2A 4H44C 3AE3C 1KQSO 1KOEA 2XNDH 3H1LD 1KWXA 1IFDA 2A06E 1QL1A 1KORA 1N7SB 3TNUB 2ZXEB 3DBZA 2O01N 4DCKA 3M9BA 4J6PA 3AE6C 1PP9D 4N33A 1RF0C 2QJYB 2ZYDA 3RL0D 1GW3A 1CW5A 3H1LJ 2E74D 2OYHA 3RK2B 1U57A 1YTZT 3L70D 1URQC 4JYCA 2KNCA 3P8MC 2FFDA 4WUWA 1YXJA 2WSEH 4GJ0A 2WTYA 3AE2C 3BASA 4WQQA 2XNXA 4U3FE 1PP9J 1RDM1 1Q81Q 3CCRP 3A0HH 2ZVNB 3TGUJ 2W90A 3LIEA 1USEA 1IFPA 1LTJA 2FYNC 3Q5SA 1KV4A 1G1SA 2FYUD 1H88A 1T2KC 1MZ9A 1PPJD 1VF5B 1SQQD 2OYIC 2QIWA 3HE5B 3SSUA 1RDJ1 1UOSB 1OX3A 2P1JA 1V7PB 2JO1A 5APQA 4EDFA 1FOSF 1MV8A 3V2RA 2I1JA 2PFXA 2GGUA 3LW5H 5BU8B 4ASWA 2KSEA 3H1LG 4N34A 1RQVA 1LT9A 1FVUB 3JCUH 2V7QH 1SQQJ 1SQPK 5KLVD 1MUUA 2Q3EA 3BVHA 1U0OA 2BEQD 3HUSA 3L73D 2B89A 5KKZB 1PP9G 4UB8H 1FZFA 2LXBA 3P5DA 1E5UI 4WY4A 1W2BO 2YO3A 3RK3D 3TGUG 4GODA 3FWLA 1KILA 1PGPA 3HD7A 4PV1B 3CCUP 2ITAA 3C22A 3S4RA 1JOCA 2HPCB 3WWKC 2E76C 2ZXXA 3F5HA 2HYNA 1YTZI 2KLUA 1LTGC 3GHGA 2KV3A 4AK8A 4C16A 2PGDA 1KB9I 3HTKA 3VMAA 1QDDA 3U59A 1AFOA 4J6NA 2Z5IA 3ZDMA 2D2CB 3CFWA 1D7MA 1SQQG 4IFDK 3RL0C 2BPEA 3P5GA 4WCOA 3AE9C 2E74C 2NPSD 1DD4A 2ZAEB 2RH0A 3GPRD 4TT3H 1QL2A 4EIJA 3N7NA 3ZHGA 1G2CA 2FYUK 1JY3O 1U0NC 1NAYA 3D6ZA 2CPSA 4J6LA 3VYKA 1KZUB 1K9JA 5KLVG 1ZW0A 2MSBA 2WPVB 3H1KJ 3AEFC 4N35A 2JDIH 2XR5A 2E3XC 4IFFA 2JWAA 4N37A 3K5BA 3G84A 1SL5A 1EGGA 5CCHD 5GTHE 3BDWA 3AE7C 4BWNA 2KSJA 5APTA 1O7BT 3GMAA 1GU5A 3H1ID 1C3AA 5AVSB 1KQGB 3SWKA 1PFIA 1NTMD 1YQ4C 1KB9H 1NU1D 2R5DA 1EXJA 1G1QA 2OGUA 1ZR2A 1L0LE 1IJKC 3ALUA 3GG2A 4RJTA 1SFCA 2OX8A 2H8PD 4I1LA 2IFNA 2WITA 4ZKPA 4ZESA 1KX1A 1IFJA 1OVRA 1BE3E 3TDKA 2RIAA 1Q2NA 1NH4A 5B66H 1NTMJ 2BCCE 1NU1J 1R14A 1Q7YQ 1M90Q 4WRFA 3CCKA 1IXXB 1AVOA 2W8ZA 1S1CX 2H43A 5H2FE 2WSEJ 5DJTB 3P32A 2CK3H 4EYYQ 1QGKB 3HUPA 4HYTB 5AW1B 1LT9B 2WWWA 1LWUB 2C0XA 3EWKA 1DEEG 1U0OB 1L0NK 1XARA 1VQ5P 1VQKP 1M1JA 5TISH 4EOTA 4K35A 1IODB 1BGYE 3TF5A 1XTGB 1FS0E 2NPSC 4N6JA 2O1KA 2H2TB 3CD6P 4GOFA 3GPRC 1UIXA 3EQ2A 3WUTA 2M5AA 2QJKC 3R2PA 2XV5A 1DY1A 1L2PA 3H1IG 3LW5J 1NTMG 1NU1G 3BRTB 3BX4B 3HTKB 3VLGA 5M1BA 2XDJA 1FZCC 3CCLP 1H0TA 2FXOA 3MD0A 3GF3A 2ZT9D 2NRGA 1BNLA 3CWBJ 5CCHC 1YPUA 1ZXGA 1S9KD 2RIDA 3CX5E 3IKQA 2YXRB 5AW7B 1M8OB 1G1JA 3V2NA 2YXQB 1AQ5A 1UEXA 3O8ZA 4IFMA 1J1DB 2OTLP 1K9MQ 1L4AA 2KS1A 4JBZA 2B9BA 2ZIBA 3CADA 3OW2O 1KG0C 1RHZB 3H1HD 2OYOA 4ASVA 1W5CE 5AW2B 3P5IA 1OW6A 4ZMDA 3NFQA 1YJWP 1LTAC 3MGNA 1J34A 3OJAB 2N1TB 1KZA1 1JY2O 2RIBA 1IFMA 4GOEA 2WT7A 4QKJA 2VRPB 1OVVA 4QKGA 1L0NE 1DY0A 3H1HJ 2H2RA 2M8RA 3BRVB 3TK1A 4OGQB 1HYRA 5BU5A 2BEZF 3L75E 3CWBG 5KJ7D 2ORJA 3A5TA 2P7JA 3E7KA 1KFNA 2W83C 3T97A 1SFCB 4OH8B 2JR8A 2PF5A 1KWVA 1KWWA 4C7NB 1NTKJ 2FKWB 1KB9D 4N78D 1DD3A 2RMZA 3AEBC 1GL2B 1USDA 1RE4A 4GKOG 2OQQA 4YTPC 1KWZA 1N7SA 3G4SP 3TNUA 3IAOA 4CSYA 4KZVA 3CCQP 1U7JA 3V5BA 4H44B 2OTKE 1SQBE 1WMKA 3H1HG 2ZJSE 5DJUB 3NXSA 1GMJA 2QRXA 1YTTA 2I1KA 2XZRA 4Y99C 4U3FD 1JY2N 1FZAA 2Y0EA 1R13A 1SL6A 1KX0A 1IC2A 3PH0A 1UKMB 4NPFX 4OWFA 3VMYA 3L71D 5AVZB 4R4MA 2ZT9C 3LIDA 3V4QA 1J1EC 3AEAC 1YHQP 1BDCA 1EZVE 3ALTA 3CX5I 3M0DC 5KLIC 2ZVOB 4KZWA 1URQB 1HGVA 2YMYA 1NTKG 2QM8A 3A0BE 3V6IA 3CXHE 3B5ND 2LS8A 4U3FJ 2E75D 1JMBA 1M1KQ 1JY2P 5BVZA 1KC8Q 1EDJA 2P10A 3HE5A 1UOSA 5CMZA 1J35A 1V7PA 4PJ0E 3M9ZA 2K88A 3H32B 4H13D 3A7OA 3N4XA 2A06G 1JA3A 1ZV8A 2FYNB 1YJNP 3WHDA 4RO0A 2OYIB 1FVUA 4DZOA 5APYA 3QH9A 2GM4A 4H0LC 1E79H 4XE5B 5KAIH 3L72E 1KILE 5KJ7C 1KFMA 2P58A 3FWNA 4KJMA 2YO2A 3M9HA 1NTZD 2CL8A 4U3FG 1KZD1 2HPCA 3VP8A 1MUQA 2WT7B 4GKGA 1SQVK 2L5GB 5E79H 3CDGE 1DX7A 3CX5H 2O1JA 3SWFA 2Z5HA 4E52A 1CSBA 1EQ7A 2O01H 1OVUA 2JKVA 3CC4P 3IKPA 1P84E 1NTZJ 3BCCE 1TDQB 5KAFE 2JEEA 3IF4A 2IT6A 4QKIA 4R4LA 3C8JA 2OX9A 3T97B 1Y8AA 2PAJA 5L8RJ 2YNYA 4IL6H 5AW8B 1LTBC 4BXLA 3RS1A 2UWJE 3ALSA 1S5LE 2I83A 3IR9A 2E76D 2ZWKA 1LTSC 1EZVI 3II6A 3RL0B 2MTIA 2E74B 1JNMA 1QX8A 3B5NC 2R3SA 2E75C 1VDFA 1R5SA 1UMRA 1X22A 2C6UA 1U0NB 2FXPA 1ZR4A 3TGUD 3VMXA 5GTIE 1NTZG 3G8LA 2AXCA 4H13C 1SQXE 4LQFA 3G8KA 4QMAA 2E3XB 1BCJ1 1JTHB 2O3JA 1GD2E 1SS1A 3CC7P 4GI0A 2BCCD 1MFZA 2G3AA 1L0LJ 3H6PA 3NTNA 2XR6A 3M06A 1T8DA 1IJKB 1J35B 4KT0J 3RGUA 3RL0g 5AW0B 3FD4A 1IXXA 5KTBA 1BE3J 1S3JA 2WSCH 3KZIE 3C1LA 3WU2H 1Y47A 3FX0A 1OZ7B 2BCCJ 4UXMA 1NVOA 1JUNA 2H89C 1VQOP 1JWIB 4N38A 3RK3B 3CC2P 1LWUA 2KZIA 1H89A 1P84I 1BGYD 4QKHA 3RBZA 3S9OA 2E43A 1NHLA 1IODA 3PHLA 4DJGA 1FZBA 4IOPB 2IBZE 4PJ0H 1JO5A 1A02J 4Y28J 1MSBA 1T3UA 2C0WA 1L0LG 1BGYJ 3PJSK 5LGKE 3CLQA 4OVNF 3BX4A 2P67A 2NPSB 2KYVA 1BE3G 3CMAP 2R32A 1LP1B 3GPRB 2QJKB 1S72P 4HB1A 2ZFCA 2BCCG 2KUBA 3CX5D 1K8AQ 3L4FA 3MTUE 3MUDC 3KXDA 1QO3C 3VTPC 2V4HA 3H1KD 3FXEA 3S1KA 1K04A 5AVYB 1KYOE 1KN7A 1FZCB 3VP9A 2IZ0A 1PGQA 1SQQK 1HUCA 1IO4A 4HH2A 1NGMB 2SPZA 1P84H 2O01J 1SB2A 1BGYG 2N1TA 2VUVA 1M57D 1AVYA 5CCGD 5B5EE 2RICA 1SQPE 4ZNCA 3VYJA 2VRPA 1EDKA 2YIUC 1FJKA 1RE3C 1X2WA 1AV1A 1ZLLA 1WK1A 3WBQA 4MTHA 2PRRA 5KLVK 4L74A 3PARA 2KP8A 1VQ8P 4JQ0D 1BCH1 3MIWA 2KI7B 1L0NJ 1Q90D 4L73A 1KCGA 1CZQA 1G1RA 1PP9E 3GW6A 2QA4P 1CWVA 1N73A 4C7NA 3L70E 2IBZI 4ZETA 1KMIZ 1GL2A 5AVTB 3H1KG 5FFTA 2XKMA 1FOSE 4YMDA 4UB6E 1VQ4P 1SQBD 5AVWB 4L76A 1JB0J 1QLED 4J6JA 4N32A 1PGJA 1RF1C 2ORKA 5APUA 1EDIA 5AVRB 2FYUE 1PPJE 3H1JD 1UKMA 3TSIA 1EZVD 1SQBJ 3L9JC 3VOPA 4C9FA 2QEXP 1RF0A 2I8DA 1H8AA 1T8ZA 3AEGC
chains in the Genus database with same CATH topology
1N2DC 2KOGA 5B1RA 5F2QA 1URQA 4WUXA 4Y99B 3WH2A 3WH3A 3HE4B 3NXSA 1KOEA 1YTTA 2BRSA 2I1KA 3V4WA 1WMZA 3FF7C 4KMB1 2XZRA 4Y99C 1R13A 1JY2N 1IJDB 1FZAA 1SL6A 1UKMB 1KX0A 1IC2A 1KWXA 1IFDA 1QL1A 2BASA 3G83A 1SLQA 3IFMA 1N7SB 3VMYA 3NMDA 3TNUB 1HWTC 4GJXA 1CI6B 2ZXEB 3H32A 3LIDA 4O9BA 5AVZB 1J1EC 3V4QA 1GTWA 1JZNA 4G96A 4EZMG 3DBZA 3EFGA 1RE4C 3KMB1 4ZRWA 1FIFA 5CCGC 3ALTA 3M0DC 1N7SC 3M9BA 1NWQA 3P7HA 4I6MC 4J6PA 1X8YA 1KQLA 4KZWA 4KHXA 1URQB 4N33A 1NTMK 1RF0C 1HGVA 2IFMA 2YMYA 2QM8A 1NU1K 1GK4A 2OYIA 3RL0D 3B5ND 3BATA 1GW3A 4WY4D 1CW5A 4WREA 2LS8A 4WR9A 2OYHA 3RK2B 5CHXA 4W7ZA 1YTZT 5KJ7A 1KILD 1URQC 1JY2P 5BVZA 3HD7D 4JYCA 3WMM0 5AW4B 1GK6A 3P8MC 2FFDA 1E8IA 3HE5A 1UOSA 5CMZA 4WUWA 1YXJA 2WSEH 3RK2C 1J35A 1FAVA 1V7PA 1KWYA 2KMB1 3M9ZA 2WZ7A 2OS9A 4GJ0A 2WTYA 3BASA 1VPCA 3H32B 4WQQA 2MJZA 2XNXA 3VPPA 3A7OA 3N4XA 1XTCC 4W80A 1T3JA 4G9AA 1WMYA 1RDM1 1JA3A 1ZV8A 1FJPA 1GDTA 3SWYA 1HQ8A 3I5CA 1SB2B 4PDCA 2H7HA 3WHDA 4N36A 2OYIB 3LIEA 3L35A 2FYZA 1FVUA 1FU1A 1LTJA 4DZOA 2OYHB 1G1SA 5APYA 1JCCA 1H88A 1KMB1 1P4LD 1T2KC 1MZ9A 1X2WB 1DV8A 2GM4A 2FFDB 2OYIC 2C9LY 3HE5B 1RDJ1 1UOSB 4XE5B 2OYHC 2P1JA 1V7PB 3P8CD 5KJ7C 1ESLA 3FF9A 1KFMA 1K9IA 5APQA 2P2UA 1FOSF 2FFDC 1MV8A 3V2RA 2VUZA 2YO2A 3M9HA 2I1JA 2GGUA 3WWKA 3LW5H 5AW3B 5BU8B 3ZHGD 2W27A 1GU4A 3U1CA 2CL8A 4N34A 2R3CA 4PP8A 4JYBA 1KZD1 2PY2A 2HPCA 1LT9A 1WT9A 1FVUB 4WB4A 1LTJB 3VP8A 3CDGF 1SQPK 2IT5A 1MUQA 3U1AA 2WT7B 1E87A 1MUUA 4GKGA 1HGZA 1SQVK 2L5GB 1N73B 1RDN1 3CDGE 1DX7A 3BVHA 1U0OA 2O1JA 3SWFA 3P7FA 2Z5HA 4E52A 1EGIA 1LTJC 3HUSA 3RK3C 2J58A 2BPHA 1CSBA 2W6BA 1EQ7A 2YKOA 2O01H 4XA4A 3IKPA 1FZFA 3P5DA 3B5NA 1E5UI 1TDQB 4WY4A 1V4LA 2YO3A 3RK3D 1KILA 1BJ3A 3HD7A 2JEEA 3C22A 1JY3N 2IT6A 3NCWA 4QKIA 1JOCA 2HPCB 1WT9B 3C8JA 1F02I 3WWKC 2OX9A 2PAJA 4N3YB 2HYNA 1YTZI 2YNYA 1LTGC 1NO4A 3GHGA 4WBAA 5AW8B 2KV3A 4AK8A 1LTBC 4C16A 1X9VA 3RS1A 4AQRD 4JF7A 3HTKA 1LT9C 1B6EA 3ALSA 2I83A 1WT6A 3IR9A 3HUSB 3G3ZA 2Q7CA 4C46A 2ZWKA 1J1EB 1QDDA 1RDK1 3U59A 1AFOA 1LTSC 1YPQA 1FZGA 3II6A 3RL0B 4J6QA 2BPDA 3B5NB 2MTIA 4WY4B 4J6NA 2Z5IA 3HUSC 1JY3P 1JNMA 4M1GA 1KILB 2KB7P 1BJ3B 3CFWA 1JTHA 3HD7B 3PBFA 4IFDK 2BPEA 3RL0C 3B5NC 2PP6A 3P5GA 4WCOA 4WY4C 1LGHB 4DN8A 2NPSD 3P5HA 1G1IA 1ZN5A 1IFIA 1KILC 1VDFA 1YYCA 1UMRA 3HD7C 4AUWA 3GPRD 2W6AA 2A45I 3CI9A 3GHGB 1QL2A 2C6UA 1U0NB 4EIJA 2FXMA 1ZR4A 3N7NA 1HH0A 3ZHGA 1G2CA 1GW4A 3M91A 3VMXA 2FYUK 3G8LA 3GHGC 1JY3O 4LQFA 1U0NC 1UV0A 3G8KA 2CPSA 4J6LA 3V2PA 3VYKA 1NKNA 4YLIA 1KZUB 1K9JA 2M94A 2E3XB 1BCJ1 5APSA 2MSBA 1JTHB 3L37A 4N35A 3KDPB 1NTKK 3HRNA 3FF8C 1AFD1 2XR5A 4J6MA 1GD2E 3C8KD 2E3XC 5AVQB 4IFFA 1OZ7A 4N37A 3G84A 5AW5B 1SL5A 1SQBK 3T3AA 2ZQKA 4GI0A 1DEBA 2Z4EA 1EGGA 1SVFA 1O7CT 5CCHD 1JWIA 3BDWA 1MFZA 1G2CB 1YPOA 1UMRC 2M3BA 1FZEA 3H6PA 1WRGA 5APWA 3NTNA 2XR6A 2KSJA 5APTA 1IK9A 2LKMA 3M06A 1O7BT 3P5EA 1T8DA 1IJKB 1GU5A 5CJ0A 1J35B 1C3AA 5AVSB 3IKRA 5B1XA 5AW0B 1PFIA 1IXXA 3FD4A 4IOPA 5KTBA 2R5DA 1G1QA 2WSCH 1ZR2A 2OARA 2J59M 1IJKC 3ALUA 3KQGA 4J6KA 4KI1E 1SFCA 3PAQA 2YKPA 1OZ7B 2OX8A 1YXKA 2Q5UA 2H8PD 4UXMA 4AYCA 1AFA1 1OXZA 1IFNA 4I1LA 2IFNA 4C7RA 1JUNA 2AFPA 3P7KA 2Q9IA 2WITA 2YKQA 1S9KE 3RK3B 4ZKPA 1LWUA 1JWIB 1KX1A 1IFJA 2N40A 3BDWB 4N38A 1KWUA 5B1WA 1H89A 1BUUA 1KWTA 2RIAA 2HODA 4QKHA 1NH4A 2N1TD 5J6GG 2E43A 2NPSA 1R14A 4RESB 3E1IA 1NHLA 1G1TA 2A45H 1IODA 1C3AB 4WRFA 1KZC1 1T8CA 3GPRA 1FZBA 3MUDA 3CCKA 1IXXB 4IOPB 2GUVA 2H43A 5KTIA 1JO5A 1HUPA 3WWKB 1L4AD 3P32A 5K8YA 1A02J 4B86A 1MSBA 3A2AA 3M9QA 4HYTB 3HUPA 5AW1B 1T3UA 2C0WA 2RIEA 1LT9B 1KZE1 2GO0A 1RDI1 3UIAA 1X2TA 2WWWA 1SFCC 2YHFA 1LWUB 5LGKE 2C0XA 2N9BA 3CLQA 3BX4A 1U0OB 1L0NK 1RDL1 1XARA 1HBWA 3P5FA 5APXA 1FZCA 2P67A 1FDMA 3B8EB 1M1JA 2NPSB 1LWUC 4EOTA 1SFCD 2KYVA 1OWAA 2QM7A 2R32A 1IODB 1GZ2A 2E42A 3GPRB 1Z56A 1SL4A 2IX7C 1XTGB 2IPPA 4ZRVA 5CCHA 2ZFCA 1F00I 1TN3A 2NPSC 1LTIC 4N6JA 4LLHA 1V4LB 2O1KA 2H2TB 1N7LA 3L4FA 3M0AA 5M62A 3GPRC 5AW9B 3EQ2A 3MTUE 3UBUA 1RE3A 1H8UA 1QO3C 2WPSA 1GL2D 3R2PA 3VTPC 4DOJA 2XV5A 1DY1A 1X2TB 4WRCA 4S0UA 2CPBA 5AVYB 4W7YA 1PW9A 3WSRA 3BRTB 4LC1A 3BX4B 3HTKB 3VLGA 3A3YB 1FZCB 3WBRA 1HTLC 1M1JB 3C9IA 3VP9A 2XDJA 4N78E 1XPHA 3K7BA 1E5WA 1SQQK 1HUCA 4ZKUA 5AW6B 1BV4A 1IO4A 4HH2A 3KYQA 1FZCC 1M1JC 1RJHA 1RDO1 1P1ZD 4ZESA 3VMZA 3MD0A 1SB2A 3UBUB 1NKZB 3CL3D 2N1TA 1BNLA 2VUVA 3G81A 2HFED 5CCHC 1Y17A 1GZLA 1YPUA 3V2QA 5CCGD 3VYJA 2RICA 1S9KD 2RIDA 1N7SD 2POHA 3IKQA 1RY3A 2VRPA 5AW7B 1HVVA 2R5BA 1G1JA 1NTZK 3V2NA 1PWBA 1FJKA 1RE3C 1X2WA 1AQ5A 1UEXA 1ZLLA 3O8ZA 4IFMA 1J1DB 5AVVB 1FM5A 1WK1A 3KPEA 1L4AA 4MTHA 3WBQA 2C9NY 2ZIBA 5KLVK 3OA7A 1RTM1 1URQD 3CADA 3PARA 2GGXA 2KP8A 1KG0C 4UWWA 1NOHA 4I2LC 1J1DC 1BCH1 5AW2B 3MIWA 1LTTC 3P5IA 3L36A 3RK2D 3PP5A 3NFQA 4M3LA 1LTAC 1W2EA 1J2JB 2WSFH 3MGNA 1J34A 2WPRA 1RF1A 4M18A 3OJAB 2N1TB 1KCGA 1KZA1 1FBMA 1JY2O 2RIBA 3PAKA 5FFSA 1Y17B 1TLGA 1DY2A 1IFMA 1CZQA 3VN0A 2WT7A 1G1RA 1MPUA 2VRPB 4QKJA 1CWVA 1LITA 1N73A 4CAJA 4QKGA 2N1TC 1M7LA 1DY0A 1UEXB 4C7NA 4GK1A 1KZB1 1B08A 1L4AB 2H2RA 1SP4A 4ZETA 2M8RA 3BRVB 3TK1A 1GL2A 1T2KD 2HLOA 1HYRA 1SQXK 2A45G 5AVTB 3NCXA 2HG5D 1L4AC 5FFTA 5BU5A 2XKMA 1FOSE 5AVUB 4YMDA 5KJ7D 2ORJA 3A5TA 3P7GA 2P7JA 2WPQA 2XU6A 1J34B 5AVWB 3VYIA 1RF1B 2VRSA 1HJBA 1KFNA 3T97A 4J6JA 1SFCB 4N32A 1FIHA 5CJ4A 4OH8B 3OAKA 3TYYA 1RF1C 2PF5A 1NAFA 5AVXB 2ORKA 4LU5A 1JCDA 5APUA 3HE4A 1HTNA 1KWWA 1BYFA 4C7NB 1KWVA 2FKWB 2Q3IA 1DH3A 5AVRB 1A02F 4N78D 3IKNA 1N73C 1GL2B 2HODB 1UKMA 1RE4A 2GUSA 4M17A 3TSIA 1N86A 4LGDE 5CCGA 4GKOG 3M0DA 4GIFA 1N7SA 1X79B 5APVA 1KWZA 3L9JC 5KTHA 1AFB1 2JJLA 3P8CE 3TNUA 3VOPA 1JMMA 5FFRA 3WBPA 4C9FA 1CI6A 1RF0A 1H8AA 1GL2C 4CSYA 4KZVA 2KLVA 1T8ZA 4GT1A 3V5BA 1L0LK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1R A;  5F2Q A;  4WUX A;  3WH2 A;  3WH3 A;  3HE4 B;  3NXS A;  1KOE A;  1YTT A;  2BRS A;  3V4W A;  1WMZ A;  3FF7 C;  4KMB 1;  2XZR A;  1R13 A;  1SL6 A;  1UKM B;  1KX0 A;  1KWX A;  2BAS A;  3G83 A;  1SLQ A;  3VMY A;  3NMD A;  3TNU B;  1HWT C;  4GJX A;  1CI6 B;  2ZXE B;  5AVZ B;  3LID A;  3V4Q A;  1GTW A;  1JZN A;  4G96 A;  4EZM G;  3DBZ A;  3KMB 1;  4ZRW A;  1FIF A;  3ALT A;  3M9B A;  1NWQ A;  3P7H A;  4I6M C;  4J6P A;  1X8Y A;  1KQL A;  4KZW A;  4KHX A;  4N33 A;  2QM8 A;  1GK4 A;  4WR9 A;  4WRE A;  2LS8 A;  4JYC A;  5AW4 B;  1GK6 A;  3P8M C;  1E8I A;  3HE5 A;  1UOS A;  5CMZ A;  4WUW A;  1YXJ A;  1J35 A;  1V7P A;  1FAV A;  1KWY A;  2KMB 1;  3M9Z A;  2OS9 A;  4GJ0 A;  2WTY A;  4WQQ A;  3VPP A;  3A7O A;  4G9A A;  1WMY A;  1RDM 1;  1JA3 A;  1HQ8 A;  3I5C A;  1SB2 B;  4PDC A;  2H7H A;  3WHD A;  4N36 A;  3LIE A;  3L35 A;  1FVU A;  4DZO A;  1G1S A;  5APY A;  1H88 A;  1KMB 1;  1P4L D;  1T2K C;  1X2W B;  1DV8 A;  2C9L Y;  3HE5 B;  1RDJ 1;  1UOS B;  4XE5 B;  1V7P B;  1ESL A;  3FF9 A;  1K9I A;  5APQ A;  2P2U A;  1FOS F;  1MV8 A;  2VUZ A;  2YO2 A;  3M9H A;  2GGU A;  3WWK A;  5AW3 B;  3ZHG D;  2W27 A;  1GU4 A;  2CL8 A;  4N34 A;  2R3C A;  4PP8 A;  4JYB A;  1KZD 1;  2PY2 A;  1WT9 A;  1FVU B;  3CDG F;  2IT5 A;  1MUQ A;  2WT7 B;  1E87 A;  1MUU A;  4GKG A;  1RDN 1;  3CDG E;  1U0O A;  3SWF A;  3P7F A;  2Z5H A;  4E52 A;  1EGI A;  2BPH A;  1CSB A;  3IKP A;  3P5D A;  1E5U I;  1TDQ B;  1V4L A;  2YO3 A;  1BJ3 A;  3C22 A;  2IT6 A;  3NCW A;  4QKI A;  1WT9 B;  3C8J A;  1F02 I;  3WWK C;  2OX9 A;  2YNY A;  5AW8 B;  2KV3 A;  4AK8 A;  4C16 A;  3RS1 A;  4AQR D;  3HTK A;  3ALS A;  1B6E A;  2I83 A;  3IR9 A;  2Q7C A;  4C46 A;  2ZWK A;  1QDD A;  1RDK 1;  1YPQ A;  4J6Q A;  2BPD A;  2MTI A;  4J6N A;  2Z5I A;  1JNM A;  4M1G A;  1BJ3 B;  3CFW A;  3PBF A;  2BPE A;  3P5G A;  4WCO A;  4DN8 A;  3P5H A;  1YYC A;  1UMR A;  4AUW A;  3GPR D;  2W6A A;  2C6U A;  1U0N B;  3ZHG A;  3M91 A;  3VMX A;  3G8L A;  4LQF A;  1U0N C;  1UV0 A;  3G8K A;  4J6L A;  3VYK A;  4YLI A;  1K9J A;  2M94 A;  2E3X B;  1BCJ 1;  5APS A;  2MSB A;  3L37 A;  4N35 A;  3KDP B;  3FF8 C;  1AFD 1;  2XR5 A;  4J6M A;  1GD2 E;  3C8K D;  2E3X C;  5AVQ B;  1OZ7 A;  4N37 A;  3G84 A;  5AW5 B;  1SL5 A;  3T3A A;  2ZQK A;  4GI0 A;  1EGG A;  1O7C T;  1JWI A;  3BDW A;  1MFZ A;  1G2C B;  1YPO A;  1UMR C;  5APW A;  3NTN A;  2XR6 A;  5APT A;  3P5E A;  3M06 A;  1O7B T;  1T8D A;  1IJK B;  1GU5 A;  1J35 B;  1C3A A;  5AVS B;  3IKR A;  5B1X A;  5AW0 B;  3FD4 A;  1IXX A;  4IOP A;  2R5D A;  1G1Q A;  1IJK C;  3ALU A;  3KQG A;  4J6K A;  4KI1 E;  3PAQ A;  1OZ7 B;  2OX8 A;  1YXK A;  2Q5U A;  4UXM A;  4AYC A;  1AFA 1;  1OXZ A;  1JUN A;  2AFP A;  3P7K A;  1JWI B;  1S9K E;  2N40 A;  3BDW B;  4N38 A;  4ZES A;  1KX1 A;  5B1W A;  1KWU A;  1H89 A;  1BUU A;  1KWT A;  2RIA A;  4QKH A;  5J6G G;  2E43 A;  1R14 A;  4RES B;  1G1T A;  1IOD A;  1C3A B;  4WRF A;  1KZC 1;  1T8C A;  3GPR A;  3CCK A;  1IXX B;  4IOP B;  5KTI A;  1HUP A;  3WWK B;  3P32 A;  5K8Y A;  1A02 J;  4B86 A;  1MSB A;  3A2A A;  3HUP A;  4HYT B;  5AW1 B;  2RIE A;  1KZE 1;  2GO0 A;  1RDI 1;  3UIA A;  1X2T A;  2WWW A;  2YHF A;  5LGK E;  2N9B A;  3BX4 A;  1U0O B;  1RDL 1;  1XAR A;  1HBW A;  3P5F A;  5APX A;  2P67 A;  3B8E B;  4EOT A;  2QM7 A;  1OWA A;  2R32 A;  1IOD B;  1GZ2 A;  2E42 A;  3GPR B;  1SL4 A;  2IPP A;  4ZRV A;  2ZFC A;  1F00 I;  1TN3 A;  1V4L B;  2H2T B;  3M0A A;  5M62 A;  3GPR C;  5AW9 B;  3UBU A;  1H8U A;  1QO3 C;  2WPS A;  3VTP C;  2XV5 A;  1DY1 A;  1X2T B;  4WRC A;  4S0U A;  1PW9 A;  5AVY B;  3WSR A;  4LC1 A;  3BX4 B;  3VLG A;  3A3Y B;  3WBR A;  1XPH A;  3K7B A;  1HUC A;  5AW6 B;  1BV4 A;  1IO4 A;  1RJH A;  1RDO 1;  1P1Z D;  3VMZ A;  3MD0 A;  1SB2 A;  3UBU B;  1BNL A;  2VUV A;  3G81 A;  1Y17 A;  1GZL A;  1YPU A;  3VYJ A;  2RIC A;  1S9K D;  2RID A;  3IKQ A;  2VRP A;  5AW7 B;  2R5B A;  1PWB A;  1X2W A;  1UEX A;  3O8Z A;  5AVV B;  1FM5 A;  1WK1 A;  3WBQ A;  4MTH A;  2C9N Y;  2ZIB A;  1RTM 1;  3CAD A;  3PAR A;  2GGX A;  2KP8 A;  1KG0 C;  4UWW A;  4I2L C;  1BCH 1;  5AW2 B;  3P5I A;  3L36 A;  3NFQ A;  4M3L A;  1J2J B;  3MGN A;  1J34 A;  2WPR A;  4M18 A;  1KCG A;  1KZA 1;  2RIB A;  3PAK A;  5FFS A;  1Y17 B;  1TLG A;  1DY2 A;  1CZQ A;  3VN0 A;  2WT7 A;  1G1R A;  1MPU A;  2VRP B;  4QKJ A;  1CWV A;  1LIT A;  4CAJ A;  4QKG A;  1UEX B;  1DY0 A;  4C7N A;  4GK1 A;  1KZB 1;  1B08 A;  2H2R A;  1SP4 A;  4ZET A;  3TK1 A;  1T2K D;  1HYR A;  3NCX A;  5AVT B;  5FFT A;  1FOS E;  4YMD A;  5AVU B;  2ORJ A;  3A5T A;  3P7G A;  2P7J A;  2WPQ A;  1J34 B;  2XU6 A;  5AVW B;  3VYI A;  2VRS A;  1HJB A;  3T97 A;  4J6J A;  4N32 A;  1FIH A;  3OAK A;  3TYY A;  2PF5 A;  1NAF A;  5AVX B;  2ORK A;  4LU5 A;  5APU A;  1KWV A;  3HE4 A;  1HTN A;  1BYF A;  4C7N B;  1KWW A;  2Q3I A;  1DH3 A;  5AVR B;  1A02 F;  3IKN A;  1UKM A;  4M17 A;  4GKO G;  3M0D A;  1KWZ A;  5APV A;  3L9J C;  5KTH A;  1AFB 1;  2JJL A;  3TNU A;  3WBP A;  5FFR A;  4C9F A;  1CI6 A;  1H8A A;  4CSY A;  4KZV A;  4GT1 A;  3V5B A; 
#chains in the Genus database with same CATH topology
 3CCJ P;  3I55 P;  1URQ A;  3AE8 C;  4Y99 B;  2WSC J;  3WH3 A;  3H1J J;  1KQF B;  5KLV E;  3CWB D;  3V4W A;  2ZT9 B;  2W6J H;  3AE5 C;  1IJD B;  3G83 A;  1SLQ A;  5KLI B;  3L73 E;  3NMD A;  3E1R A;  1HWT C;  4GJX A;  1CI6 B;  3H32 A;  1JZN A;  4ZRW A;  2H88 C;  2QE7 H;  5CCG C;  3RK3 E;  3P7H A;  4I6M C;  1X8Y A;  4KHX A;  1ZP0 C;  1NTM K;  2IFM A;  1NU1 K;  4IL6 X;  2OYI A;  4WY4 D;  2Y9Y A;  1KIL D;  3HD7 D;  1SQB G;  2NZ2 A;  1GK6 A;  1BCC D;  1OIP A;  1OMI A;  1FAV A;  1KWY A;  2KMB 1;  2WZ7 A;  2E5Y A;  1VPC A;  2MJZ A;  3L74 E;  1T3J A;  4G9A A;  1WMY A;  2YMK A;  1FJP A;  1Y9B A;  1GDT A;  2OTJ P;  3SWY A;  1HQ8 A;  3I5C A;  3H1J G;  1SB2 B;  2HR3 A;  4N36 A;  1EZV G;  1FU1 A;  1OZH A;  2MKV A;  1KD1 Q;  1FDI A;  1BCC J;  1JCC A;  1KMB 1;  1P4L D;  1X2W B;  2AEJ A;  1P84 D;  2OYH C;  3P8C D;  1ESL A;  1NTK D;  1K9I A;  2P2U A;  4HJG H;  2FFD C;  4H0L D;  4PD4 E;  2VUZ A;  3WWK A;  3ZHG D;  2W27 A;  1GU4 A;  2R3C A;  4JYB A;  2PY2 A;  2GA1 A;  3CDG F;  3U1A A;  1ZRT E;  3BCC J;  1E87 A;  3G9R A;  1HGZ A;  1N73 B;  2ZYA A;  3P7F A;  1EGI A;  2A06 D;  5TJH A;  1LTJ C;  2BPH A;  4XA4 A;  5GTH H;  3H1I E;  1LT1 A;  1NTM E;  3NCW A;  4JPZ B;  1BCC G;  1WT9 B;  1F02 I;  4WBA A;  2E5T A;  1JEK A;  1X9V A;  1LT9 C;  2Y9Z A;  3G3Z A;  4C46 A;  1YI2 P;  1RDK 1;  2LR2 A;  1FZG A;  4J6Q A;  2BPD A;  3B5N B;  1ZME C;  3HUS C;  3A0H E;  2E75 B;  4M1G A;  1BJ3 B;  2KB7 P;  1T6A A;  2Q6Q A;  1JTH A;  1VQ7 P;  1EDL A;  2PP6 A;  3BCC G;  4WY4 C;  1LGH B;  4DN8 A;  1SQX J;  2B88 A;  1G1I A;  1ZN5 A;  1KIL C;  1YYC A;  3HD7 C;  5H2F H;  1OW8 A;  2W6A A;  3CI9 A;  4H13 B;  1YJ9 P;  3G6E P;  1FE6 A;  1HH0 A;  4D6T E;  1VQ6 P;  1GW4 A;  3GHG C;  2K3R A;  3V2P A;  4YLI A;  2AXT E;  2M94 A;  3L37 A;  1NTK K;  3HRN A;  2L91 A;  3FF8 C;  3CCE P;  1VQ9 P;  5K5G B;  3C8K D;  5AVQ B;  1OZ7 A;  3O6Q B;  3T3A A;  1DEB A;  2Z4E A;  1YQ3 C;  1SVF A;  1JWI A;  4UB8 E;  1YBK A;  1R5L A;  2IBZ D;  4PD4 I;  1IK9 A;  2LKM A;  2WQY C;  5CJ0 A;  2IYO A;  3IKR A;  5B1X A;  4IOP A;  1SQX G;  3USS A;  2OAR A;  4KI1 E;  3F89 A;  3PAQ A;  2WVR A;  1YXK A;  2Q5U A;  1AFA 1;  1OXZ A;  1JM0 A;  2YKQ A;  1S9K E;  2N40 A;  1KWU A;  1KWT A;  2HOD A;  2WMM A;  2NPS A;  1QVG O;  1LP1 A;  1KZC 1;  1T8C A;  3GPR A;  4RKU J;  4Z1M H;  1Q82 Q;  2GUV A;  1BSH A;  1IZN B;  5KTI A;  1HUP A;  3WWK B;  1L4A D;  2E76 B;  5K8Y A;  3AEE C;  2R44 A;  1EC5 A;  1NYH A;  2GO0 A;  1SFC C;  1PV3 A;  1HF9 A;  1RDL 1;  1HBW A;  3P5F A;  1FZC A;  1OFC X;  4YXW H;  2QM7 A;  1OWA A;  5CCH A;  1F00 I;  1LTI C;  4LLH A;  1SQP D;  5M62 A;  4PD4 H;  2K9J B;  3SFD C;  2IBZ G;  1H8U A;  3CXH I;  1LNQ A;  1X2T B;  2B87 B;  4DT0 A;  3KHU A;  2CPB A;  1PW9 A;  4W7Y A;  4LC1 A;  4IOI H;  4YXD C;  3GF7 A;  3A3Y B;  3WBR A;  1KB9 E;  1HTL C;  4N78 E;  3K7B A;  1SQP J;  1PZQ A;  1BV4 A;  1L0L D;  3KYQ A;  1M1J C;  3D6Y A;  3VMZ A;  2K37 A;  3AED C;  1R8E A;  2YIU B;  3UBU B;  2JWD A;  1NKZ B;  3CL3 D;  2HFE D;  1GZL A;  1N7S D;  1RY3 A;  5B66 E;  1BE3 D;  1HVV A;  1SQV E;  2R5B A;  1NTZ K;  1PWB A;  1NJI Q;  1RQU A;  1FM5 A;  2K1A A;  2C9N Y;  1RTM 1;  2AEF A;  4I2L C;  1AQT A;  2N9Y B;  3RK2 D;  2Y0C A;  4M3L A;  3L71 E;  1W2E A;  1UII A;  2WSF H;  2WPR A;  4L75 A;  3L70 J;  3PAK A;  1Y17 B;  1TLG A;  3JC2 2;  1DY2 A;  2RKL A;  1VQN P;  3VN0 A;  4BRY A;  1MPU A;  1LIT A;  4CAJ A;  5TIS E;  1M7L A;  4WVZ A;  1BSN A;  1MKM A;  3A0B H;  1SQP G;  3MZW B;  3CXH H;  2HLO A;  2A45 G;  3NCX A;  4CPG A;  2WSS H;  2HG5 D;  1L4A C;  1M56 D;  5AVU B;  3D71 A;  3P7G A;  2WPQ A;  2XU6 A;  1RF1 B;  2AXT H;  1VF5 D;  3Q5P A;  1MFT A;  1HJB A;  2FYU J;  4HKZ H;  3H25 A;  4I7Z C;  1FIH A;  5CJ4 A;  3TYY A;  4EI2 A;  5AVX B;  1JCD A;  1HTN A;  3ABV C;  2QJP C;  3Q2Y A;  1VL2 A;  1A02 F;  1VQL P;  2HOD B;  2GUS A;  4M17 A;  1K05 A;  4LGD E;  2KZJ A;  3M0D A;  2J5U A;  5KTH A;  1JMM A;  3L70 G;  5FFR A;  1CI6 A;  2KLV A;  5KLV J;  4GT1 A;  1Q86 Q;  1L0L K;  2KOG A;  5B1R A;  5F2Q A;  1NTZ E;  1S4X A;  3L73 J;  1QVF O;  3HE4 B;  2BRS A;  1QEX A;  4PV1 D;  1WMZ A;  3FF7 C;  4KMB 1;  3C8V A;  3L74 D;  2BAS A;  3IFM A;  2FYU G;  4O9B A;  1GTW A;  4G96 A;  4EZM G;  1PPJ G;  3EFG A;  1RE4 C;  3KMB 1;  3WUU A;  1FIF A;  2RN0 A;  1N7S C;  1NWQ A;  5CBO A;  1KQL A;  5KAF H;  3CME P;  1GK4 A;  1L0N D;  3MP7 B;  3BAT A;  4WR9 A;  4WRE A;  1FDO A;  3L74 J;  5CHX A;  3Q5R A;  4W7Z A;  5KJ7 A;  2D2C D;  2QJY C;  3WMM 0;  5AW4 B;  1E8I A;  4PD4 D;  3RK2 C;  3L75 D;  2OS9 A;  1S5L H;  3H1L E;  3VPP A;  4W80 A;  1XTC C;  4A7P A;  1YIT P;  3L73 G;  3WUV A;  1ZRT D;  4PDC A;  2H7H A;  3L35 A;  2FYZ A;  2OYH B;  1DV8 A;  2KNC B;  3L75 J;  2FFD B;  2C9L Y;  4XFJ A;  3TGU E;  2LXC B;  3FF9 A;  1VF5 C;  5GTI H;  1HJ0 A;  5AW3 B;  1ZOY C;  3U1C A;  4PP8 A;  3L74 G;  2G8Y A;  4TLF A;  3ITK A;  3G71 P;  1WT9 A;  4WB4 A;  1LTJ B;  2IT5 A;  4BRY B;  3H1I J;  1RDN 1;  3RK3 C;  2J58 A;  2W6B A;  2YKO A;  1VQP P;  4MN4 C;  1VQM P;  1SQQ E;  1L0N G;  3B5N A;  1V4L A;  5CBN A;  5KKZ C;  1BJ3 A;  1JY3 N;  3CXH D;  1K73 Q;  4D6T D;  4N3Y B;  3L75 G;  2WSF J;  3KZI H;  4PV1 C;  1KYO I;  1NO4 A;  4AQR D;  4JF7 A;  3D70 A;  1B6E A;  1WT6 A;  3HUS B;  2Q7C A;  1J1E B;  1YPQ A;  4WY4 B;  1JY3 P;  1KIL B;  3HD7 B;  3PBF A;  4D6T J;  3P5H A;  1IFI A;  2D2C C;  3O6Q A;  3Q3D A;  4AUW A;  2Q1K A;  2A45 I;  3GHG B;  5KAI E;  3W68 A;  2IDB A;  2FXM A;  1OW7 A;  2V7Q J;  1U7M A;  3L72 D;  3M91 A;  1RH5 B;  2K9Y A;  1UV0 A;  2KK7 A;  2FBW C;  3Q1M A;  1NKN A;  2IZ1 A;  5APS A;  2KXP B;  3AE1 C;  3KDP B;  1AFD 1;  4NPE A;  4J6M A;  5E79 E;  3MHV A;  1X0T A;  5AW5 B;  3PRJ A;  1SQB K;  3L72 J;  2ZQK A;  4H0L B;  1O7C T;  3H1K E;  1G2C B;  1YPO A;  2QG4 A;  1UMR C;  1FZE A;  2M3B A;  1WRG A;  5APW A;  3P5E A;  2KIK A;  3BCC D;  1AA0 A;  1LJ2 A;  4D6T G;  1KYO H;  3CCS P;  4IL6 E;  2J59 M;  1TU3 F;  3KQG A;  4J6K A;  2YKP A;  2AEM A;  4AYC A;  1IFN A;  4C7R A;  2AFP A;  3FXD A;  3P7K A;  2Q9I A;  2QVA A;  3BDW B;  5EFW B;  5B1W A;  3RBX A;  1BUU A;  5B5E H;  2N1T D;  5J6G G;  4RES B;  3E1I A;  3W67 A;  1G1T A;  2A45 H;  1C3A B;  3MUD A;  2FY8 A;  3L72 G;  2K9J A;  4B86 A;  3I56 P;  1NU1 E;  3A2A A;  4OGQ D;  3M9Q A;  2RIE A;  1KZE 1;  1S2E A;  3UIA A;  3CPW O;  2B87 A;  1RDI 1;  1X2T A;  2YHF A;  1YIJ P;  2N9B A;  1SQX D;  5APX A;  1FDM A;  3B8E B;  1LWU C;  1SFC D;  1GZ2 A;  2E42 A;  1Z56 A;  1SL4 A;  2IX7 C;  2IPP A;  4ZRV A;  3IN6 A;  1TN3 A;  1V4L B;  1N7L A;  3M0A A;  4YPC A;  5AW9 B;  1SQV D;  3AEC C;  3UBU A;  1RE3 A;  2WPS A;  1GL2 D;  4DOJ A;  4UB6 H;  4WRC A;  4S0U A;  3AE4 C;  3WSR A;  4H44 D;  1M1J B;  2Y0D A;  3C9I A;  1XPH A;  4K3A A;  3EFF K;  3H1J E;  3WU2 E;  1E5W A;  4ZKU A;  5AW6 B;  1SQV J;  1RJH A;  1RDO 1;  1PL5 A;  1P1Z D;  1PIX A;  2JP3 A;  3JCU E;  2M5A B;  3G81 A;  1Y17 A;  3V2Q A;  3PLN A;  2POH A;  4WWI A;  3L71 J;  3JSV C;  5AVV B;  3KPE A;  3FGA D;  3CWB E;  3OA7 A;  1URQ D;  4GDO A;  2GGX A;  4UWW A;  1NOH A;  5C39 A;  1DIP A;  1J1D C;  1KTM A;  1LTT C;  3L36 A;  3PP5 A;  1H0T B;  2QSI A;  1J2J B;  1RF1 A;  4M18 A;  1FBM A;  5FFS A;  1N8R Q;  2N1T C;  1UEX B;  2M3E A;  4GK1 A;  1KZB 1;  1B08 A;  1L4A B;  1SP4 A;  2KS1 B;  1BDD A;  1SQV G;  4U7J A;  1PGO A;  1T2K D;  1S5L X;  1SQX K;  1BCC E;  4I7Z B;  4OGQ C;  1J34 B;  3H1H E;  3VYI A;  2IYP A;  1FC2 C;  2VRS A;  3SFE C;  2QJP B;  1AJY A;  3OAK A;  3L71 G;  1NAF A;  1KYO D;  2M0B A;  4LU5 A;  3HE4 A;  2DW3 A;  1BYF A;  2Q3I A;  1DH3 A;  1IK7 A;  3CCM P;  2ZYG A;  1N73 C;  3IKN A;  1N86 A;  5CCG A;  4GIF A;  1X79 B;  5APV A;  3B71 A;  2JJL A;  3P8C E;  3PTZ A;  3QWO C;  3R4Y A;  1AFB 1;  3WBP A;  3B4S A;  3GLM A;  1NTK E;  1GL2 C;  3CCV P;  1EXI A;  1N2D C;  4NPD A;  4WUX A;  3WH2 A;  4H44 C;  3AE3 C;  1KQS O;  1KOE A;  2XND H;  3H1L D;  1KWX A;  1IFD A;  2A06 E;  1QL1 A;  1KOR A;  1N7S B;  3TNU B;  2ZXE B;  3DBZ A;  2O01 N;  4DCK A;  3M9B A;  4J6P A;  3AE6 C;  1PP9 D;  4N33 A;  1RF0 C;  2QJY B;  2ZYD A;  3RL0 D;  1GW3 A;  1CW5 A;  3H1L J;  2E74 D;  2OYH A;  3RK2 B;  1U57 A;  1YTZ T;  3L70 D;  1URQ C;  4JYC A;  2KNC A;  3P8M C;  2FFD A;  4WUW A;  1YXJ A;  2WSE H;  4GJ0 A;  2WTY A;  3AE2 C;  3BAS A;  4WQQ A;  2XNX A;  4U3F E;  1PP9 J;  1RDM 1;  1Q81 Q;  3CCR P;  3A0H H;  2ZVN B;  3TGU J;  2W90 A;  3LIE A;  1USE A;  1IFP A;  1LTJ A;  2FYN C;  3Q5S A;  1KV4 A;  1G1S A;  2FYU D;  1H88 A;  1T2K C;  1MZ9 A;  1PPJ D;  1VF5 B;  1SQQ D;  2OYI C;  2QIW A;  3HE5 B;  3SSU A;  1RDJ 1;  1UOS B;  1OX3 A;  2P1J A;  1V7P B;  2JO1 A;  5APQ A;  4EDF A;  1FOS F;  1MV8 A;  3V2R A;  2I1J A;  2PFX A;  2GGU A;  3LW5 H;  5BU8 B;  4ASW A;  2KSE A;  3H1L G;  4N34 A;  1RQV A;  1LT9 A;  1FVU B;  3JCU H;  2V7Q H;  1SQQ J;  1SQP K;  5KLV D;  1MUU A;  2Q3E A;  3BVH A;  1U0O A;  2BEQ D;  3HUS A;  3L73 D;  2B89 A;  5KKZ B;  1PP9 G;  4UB8 H;  1FZF A;  2LXB A;  3P5D A;  1E5U I;  4WY4 A;  1W2B O;  2YO3 A;  3RK3 D;  3TGU G;  4GOD A;  3FWL A;  1KIL A;  1PGP A;  3HD7 A;  4PV1 B;  3CCU P;  2ITA A;  3C22 A;  3S4R A;  1JOC A;  2HPC B;  3WWK C;  2E76 C;  2ZXX A;  3F5H A;  2HYN A;  1YTZ I;  2KLU A;  1LTG C;  3GHG A;  2KV3 A;  4AK8 A;  4C16 A;  2PGD A;  1KB9 I;  3HTK A;  3VMA A;  1QDD A;  3U59 A;  1AFO A;  4J6N A;  2Z5I A;  3ZDM A;  2D2C B;  3CFW A;  1D7M A;  1SQQ G;  4IFD K;  3RL0 C;  2BPE A;  3P5G A;  4WCO A;  3AE9 C;  2E74 C;  2NPS D;  1DD4 A;  2ZAE B;  2RH0 A;  3GPR D;  4TT3 H;  1QL2 A;  4EIJ A;  3N7N A;  3ZHG A;  1G2C A;  2FYU K;  1JY3 O;  1U0N C;  1NAY A;  3D6Z A;  2CPS A;  4J6L A;  3VYK A;  1KZU B;  1K9J A;  5KLV G;  1ZW0 A;  2MSB A;  2WPV B;  3H1K J;  3AEF C;  4N35 A;  2JDI H;  2XR5 A;  2E3X C;  4IFF A;  2JWA A;  4N37 A;  3K5B A;  3G84 A;  1SL5 A;  1EGG A;  5CCH D;  5GTH E;  3BDW A;  3AE7 C;  4BWN A;  2KSJ A;  5APT A;  1O7B T;  3GMA A;  1GU5 A;  3H1I D;  1C3A A;  5AVS B;  1KQG B;  3SWK A;  1PFI A;  1NTM D;  1YQ4 C;  1KB9 H;  1NU1 D;  2R5D A;  1EXJ A;  1G1Q A;  2OGU A;  1ZR2 A;  1L0L E;  1IJK C;  3ALU A;  3GG2 A;  4RJT A;  1SFC A;  2OX8 A;  2H8P D;  4I1L A;  2IFN A;  2WIT A;  4ZKP A;  4ZES A;  1KX1 A;  1IFJ A;  1OVR A;  1BE3 E;  3TDK A;  2RIA A;  1Q2N A;  1NH4 A;  5B66 H;  1NTM J;  2BCC E;  1NU1 J;  1R14 A;  1Q7Y Q;  1M90 Q;  4WRF A;  3CCK A;  1IXX B;  1AVO A;  2W8Z A;  1S1C X;  2H43 A;  5H2F E;  2WSE J;  5DJT B;  3P32 A;  2CK3 H;  4EYY Q;  1QGK B;  3HUP A;  4HYT B;  5AW1 B;  1LT9 B;  2WWW A;  1LWU B;  2C0X A;  3EWK A;  1DEE G;  1U0O B;  1L0N K;  1XAR A;  1VQ5 P;  1VQK P;  1M1J A;  5TIS H;  4EOT A;  4K35 A;  1IOD B;  1BGY E;  3TF5 A;  1XTG B;  1FS0 E;  2NPS C;  4N6J A;  2O1K A;  2H2T B;  3CD6 P;  4GOF A;  3GPR C;  1UIX A;  3EQ2 A;  3WUT A;  2M5A A;  2QJK C;  3R2P A;  2XV5 A;  1DY1 A;  1L2P A;  3H1I G;  3LW5 J;  1NTM G;  1NU1 G;  3BRT B;  3BX4 B;  3HTK B;  3VLG A;  5M1B A;  2XDJ A;  1FZC C;  3CCL P;  1H0T A;  2FXO A;  3MD0 A;  3GF3 A;  2ZT9 D;  2NRG A;  1BNL A;  3CWB J;  5CCH C;  1YPU A;  1ZXG A;  1S9K D;  2RID A;  3CX5 E;  3IKQ A;  2YXR B;  5AW7 B;  1M8O B;  1G1J A;  3V2N A;  2YXQ B;  1AQ5 A;  1UEX A;  3O8Z A;  4IFM A;  1J1D B;  2OTL P;  1K9M Q;  1L4A A;  2KS1 A;  4JBZ A;  2B9B A;  2ZIB A;  3CAD A;  3OW2 O;  1KG0 C;  1RHZ B;  3H1H D;  2OYO A;  4ASV A;  1W5C E;  5AW2 B;  3P5I A;  1OW6 A;  4ZMD A;  3NFQ A;  1YJW P;  1LTA C;  3MGN A;  1J34 A;  3OJA B;  2N1T B;  1KZA 1;  1JY2 O;  2RIB A;  1IFM A;  4GOE A;  2WT7 A;  4QKJ A;  2VRP B;  1OVV A;  4QKG A;  1L0N E;  1DY0 A;  3H1H J;  2H2R A;  2M8R A;  3BRV B;  3TK1 A;  4OGQ B;  1HYR A;  5BU5 A;  2BEZ F;  3L75 E;  3CWB G;  5KJ7 D;  2ORJ A;  3A5T A;  2P7J A;  3E7K A;  1KFN A;  2W83 C;  3T97 A;  1SFC B;  4OH8 B;  2JR8 A;  2PF5 A;  1KWV A;  1KWW A;  4C7N B;  1NTK J;  2FKW B;  1KB9 D;  4N78 D;  1DD3 A;  2RMZ A;  3AEB C;  1GL2 B;  1USD A;  1RE4 A;  4GKO G;  2OQQ A;  4YTP C;  1KWZ A;  1N7S A;  3G4S P;  3TNU A;  3IAO A;  4CSY A;  4KZV A;  3CCQ P;  1U7J A;  3V5B A;  4H44 B;  2OTK E;  1SQB E;  1WMK A;  3H1H G;  2ZJS E;  5DJU B;  3NXS A;  1GMJ A;  2QRX A;  1YTT A;  2I1K A;  2XZR A;  4Y99 C;  4U3F D;  1JY2 N;  1FZA A;  2Y0E A;  1R13 A;  1SL6 A;  1KX0 A;  1IC2 A;  3PH0 A;  1UKM B;  4NPF X;  4OWF A;  3VMY A;  3L71 D;  5AVZ B;  4R4M A;  2ZT9 C;  3LID A;  3V4Q A;  1J1E C;  3AEA C;  1YHQ P;  1BDC A;  1EZV E;  3ALT A;  3CX5 I;  3M0D C;  5KLI C;  2ZVO B;  4KZW A;  1URQ B;  1HGV A;  2YMY A;  1NTK G;  2QM8 A;  3A0B E;  3V6I A;  3CXH E;  3B5N D;  2LS8 A;  4U3F J;  2E75 D;  1JMB A;  1M1K Q;  1JY2 P;  5BVZ A;  1KC8 Q;  1EDJ A;  2P10 A;  3HE5 A;  1UOS A;  5CMZ A;  1J35 A;  1V7P A;  4PJ0 E;  3M9Z A;  2K88 A;  3H32 B;  4H13 D;  3A7O A;  3N4X A;  2A06 G;  1JA3 A;  1ZV8 A;  2FYN B;  1YJN P;  3WHD A;  4RO0 A;  2OYI B;  1FVU A;  4DZO A;  5APY A;  3QH9 A;  2GM4 A;  4H0L C;  1E79 H;  4XE5 B;  5KAI H;  3L72 E;  1KIL E;  5KJ7 C;  1KFM A;  2P58 A;  3FWN A;  4KJM A;  2YO2 A;  3M9H A;  1NTZ D;  2CL8 A;  4U3F G;  1KZD 1;  2HPC A;  3VP8 A;  1MUQ A;  2WT7 B;  4GKG A;  1SQV K;  2L5G B;  5E79 H;  3CDG E;  1DX7 A;  3CX5 H;  2O1J A;  3SWF A;  2Z5H A;  4E52 A;  1CSB A;  1EQ7 A;  2O01 H;  1OVU A;  2JKV A;  3CC4 P;  3IKP A;  1P84 E;  1NTZ J;  3BCC E;  1TDQ B;  5KAF E;  2JEE A;  3IF4 A;  2IT6 A;  4QKI A;  4R4L A;  3C8J A;  2OX9 A;  3T97 B;  1Y8A A;  2PAJ A;  5L8R J;  2YNY A;  4IL6 H;  5AW8 B;  1LTB C;  4BXL A;  3RS1 A;  2UWJ E;  3ALS A;  1S5L E;  2I83 A;  3IR9 A;  2E76 D;  2ZWK A;  1LTS C;  1EZV I;  3II6 A;  3RL0 B;  2MTI A;  2E74 B;  1JNM A;  1QX8 A;  3B5N C;  2R3S A;  2E75 C;  1VDF A;  1R5S A;  1UMR A;  1X22 A;  2C6U A;  1U0N B;  2FXP A;  1ZR4 A;  3TGU D;  3VMX A;  5GTI E;  1NTZ G;  3G8L A;  2AXC A;  4H13 C;  1SQX E;  4LQF A;  3G8K A;  4QMA A;  2E3X B;  1BCJ 1;  1JTH B;  2O3J A;  1GD2 E;  1SS1 A;  3CC7 P;  4GI0 A;  2BCC D;  1MFZ A;  2G3A A;  1L0L J;  3H6P A;  3NTN A;  2XR6 A;  3M06 A;  1T8D A;  1IJK B;  1J35 B;  4KT0 J;  3RGU A;  3RL0 g;  5AW0 B;  3FD4 A;  1IXX A;  5KTB A;  1BE3 J;  1S3J A;  2WSC H;  3KZI E;  3C1L A;  3WU2 H;  1Y47 A;  3FX0 A;  1OZ7 B;  2BCC J;  4UXM A;  1NVO A;  1JUN A;  2H89 C;  1VQO P;  1JWI B;  4N38 A;  3RK3 B;  3CC2 P;  1LWU A;  2KZI A;  1H89 A;  1P84 I;  1BGY D;  4QKH A;  3RBZ A;  3S9O A;  2E43 A;  1NHL A;  1IOD A;  3PHL A;  4DJG A;  1FZB A;  4IOP B;  2IBZ E;  4PJ0 H;  1JO5 A;  1A02 J;  4Y28 J;  1MSB A;  1T3U A;  2C0W A;  1L0L G;  1BGY J;  3PJS K;  5LGK E;  3CLQ A;  4OVN F;  3BX4 A;  2P67 A;  2NPS B;  2KYV A;  1BE3 G;  3CMA P;  2R32 A;  1LP1 B;  3GPR B;  2QJK B;  1S72 P;  4HB1 A;  2ZFC A;  2BCC G;  2KUB A;  3CX5 D;  1K8A Q;  3L4F A;  3MTU E;  3MUD C;  3KXD A;  1QO3 C;  3VTP C;  2V4H A;  3H1K D;  3FXE A;  3S1K A;  1K04 A;  5AVY B;  1KYO E;  1KN7 A;  1FZC B;  3VP9 A;  2IZ0 A;  1PGQ A;  1SQQ K;  1HUC A;  1IO4 A;  4HH2 A;  1NGM B;  2SPZ A;  1P84 H;  2O01 J;  1SB2 A;  1BGY G;  2N1T A;  2VUV A;  1M57 D;  1AVY A;  5CCG D;  5B5E E;  2RIC A;  1SQP E;  4ZNC A;  3VYJ A;  2VRP A;  1EDK A;  2YIU C;  1FJK A;  1RE3 C;  1X2W A;  1AV1 A;  1ZLL A;  1WK1 A;  3WBQ A;  4MTH A;  2PRR A;  5KLV K;  4L74 A;  3PAR A;  2KP8 A;  1VQ8 P;  4JQ0 D;  1BCH 1;  3MIW A;  2KI7 B;  1L0N J;  1Q90 D;  4L73 A;  1KCG A;  1CZQ A;  1G1R A;  1PP9 E;  3GW6 A;  2QA4 P;  1CWV A;  1N73 A;  4C7N A;  3L70 E;  2IBZ I;  4ZET A;  1KMI Z;  1GL2 A;  5AVT B;  3H1K G;  5FFT A;  2XKM A;  1FOS E;  4YMD A;  4UB6 E;  1VQ4 P;  1SQB D;  5AVW B;  4L76 A;  1JB0 J;  1QLE D;  4J6J A;  4N32 A;  1PGJ A;  1RF1 C;  2ORK A;  5APU A;  1EDI A;  5AVR B;  2FYU E;  1PPJ E;  3H1J D;  1UKM A;  3TSI A;  1EZV D;  1SQB J;  3L9J C;  3VOP A;  4C9F A;  2QEX P;  1RF0 A;  2I8D A;  1H8A A;  1T8Z A;  3AEG C; 
#chains in the Genus database with same CATH homology
 1N2D C;  2KOG A;  5B1R A;  5F2Q A;  1URQ A;  4WUX A;  4Y99 B;  3WH2 A;  3WH3 A;  3HE4 B;  3NXS A;  1KOE A;  1YTT A;  2BRS A;  2I1K A;  3V4W A;  1WMZ A;  3FF7 C;  4KMB 1;  2XZR A;  4Y99 C;  1R13 A;  1JY2 N;  1IJD B;  1FZA A;  1SL6 A;  1UKM B;  1KX0 A;  1IC2 A;  1KWX A;  1IFD A;  1QL1 A;  2BAS A;  3G83 A;  1SLQ A;  3IFM A;  1N7S B;  3VMY A;  3NMD A;  3TNU B;  1HWT C;  4GJX A;  1CI6 B;  2ZXE B;  3H32 A;  3LID A;  4O9B A;  5AVZ B;  1J1E C;  3V4Q A;  1GTW A;  1JZN A;  4G96 A;  4EZM G;  3DBZ A;  3EFG A;  1RE4 C;  3KMB 1;  4ZRW A;  1FIF A;  5CCG C;  3ALT A;  3M0D C;  1N7S C;  3M9B A;  1NWQ A;  3P7H A;  4I6M C;  4J6P A;  1X8Y A;  1KQL A;  4KZW A;  4KHX A;  1URQ B;  4N33 A;  1NTM K;  1RF0 C;  1HGV A;  2IFM A;  2YMY A;  2QM8 A;  1NU1 K;  1GK4 A;  2OYI A;  3RL0 D;  3B5N D;  3BAT A;  1GW3 A;  4WY4 D;  1CW5 A;  4WRE A;  2LS8 A;  4WR9 A;  2OYH A;  3RK2 B;  5CHX A;  4W7Z A;  1YTZ T;  5KJ7 A;  1KIL D;  1URQ C;  1JY2 P;  5BVZ A;  3HD7 D;  4JYC A;  3WMM 0;  5AW4 B;  1GK6 A;  3P8M C;  2FFD A;  1E8I A;  3HE5 A;  1UOS A;  5CMZ A;  4WUW A;  1YXJ A;  2WSE H;  3RK2 C;  1J35 A;  1FAV A;  1V7P A;  1KWY A;  2KMB 1;  3M9Z A;  2WZ7 A;  2OS9 A;  4GJ0 A;  2WTY A;  3BAS A;  1VPC A;  3H32 B;  4WQQ A;  2MJZ A;  2XNX A;  3VPP A;  3A7O A;  3N4X A;  1XTC C;  4W80 A;  1T3J A;  4G9A A;  1WMY A;  1RDM 1;  1JA3 A;  1ZV8 A;  1FJP A;  1GDT A;  3SWY A;  1HQ8 A;  3I5C A;  1SB2 B;  4PDC A;  2H7H A;  3WHD A;  4N36 A;  2OYI B;  3LIE A;  3L35 A;  2FYZ A;  1FVU A;  1FU1 A;  1LTJ A;  4DZO A;  2OYH B;  1G1S A;  5APY A;  1JCC A;  1H88 A;  1KMB 1;  1P4L D;  1T2K C;  1MZ9 A;  1X2W B;  1DV8 A;  2GM4 A;  2FFD B;  2OYI C;  2C9L Y;  3HE5 B;  1RDJ 1;  1UOS B;  4XE5 B;  2OYH C;  2P1J A;  1V7P B;  3P8C D;  5KJ7 C;  1ESL A;  3FF9 A;  1KFM A;  1K9I A;  5APQ A;  2P2U A;  1FOS F;  2FFD C;  1MV8 A;  3V2R A;  2VUZ A;  2YO2 A;  3M9H A;  2I1J A;  2GGU A;  3WWK A;  3LW5 H;  5AW3 B;  5BU8 B;  3ZHG D;  2W27 A;  1GU4 A;  3U1C A;  2CL8 A;  4N34 A;  2R3C A;  4PP8 A;  4JYB A;  1KZD 1;  2PY2 A;  2HPC A;  1LT9 A;  1WT9 A;  1FVU B;  4WB4 A;  1LTJ B;  3VP8 A;  3CDG F;  1SQP K;  2IT5 A;  1MUQ A;  3U1A A;  2WT7 B;  1E87 A;  1MUU A;  4GKG A;  1HGZ A;  1SQV K;  2L5G B;  1N73 B;  1RDN 1;  3CDG E;  1DX7 A;  3BVH A;  1U0O A;  2O1J A;  3SWF A;  3P7F A;  2Z5H A;  4E52 A;  1EGI A;  1LTJ C;  3HUS A;  3RK3 C;  2J58 A;  2BPH A;  1CSB A;  2W6B A;  1EQ7 A;  2YKO A;  2O01 H;  4XA4 A;  3IKP A;  1FZF A;  3P5D A;  3B5N A;  1E5U I;  1TDQ B;  4WY4 A;  1V4L A;  2YO3 A;  3RK3 D;  1KIL A;  1BJ3 A;  3HD7 A;  2JEE A;  3C22 A;  1JY3 N;  2IT6 A;  3NCW A;  4QKI A;  1JOC A;  2HPC B;  1WT9 B;  3C8J A;  1F02 I;  3WWK C;  2OX9 A;  2PAJ A;  4N3Y B;  2HYN A;  1YTZ I;  2YNY A;  1LTG C;  1NO4 A;  3GHG A;  4WBA A;  5AW8 B;  2KV3 A;  4AK8 A;  1LTB C;  4C16 A;  1X9V A;  3RS1 A;  4AQR D;  4JF7 A;  3HTK A;  1LT9 C;  1B6E A;  3ALS A;  2I83 A;  1WT6 A;  3IR9 A;  3HUS B;  3G3Z A;  2Q7C A;  4C46 A;  2ZWK A;  1J1E B;  1QDD A;  1RDK 1;  3U59 A;  1AFO A;  1LTS C;  1YPQ A;  1FZG A;  3II6 A;  3RL0 B;  4J6Q A;  2BPD A;  3B5N B;  2MTI A;  4WY4 B;  4J6N A;  2Z5I A;  3HUS C;  1JY3 P;  1JNM A;  4M1G A;  1KIL B;  2KB7 P;  1BJ3 B;  3CFW A;  1JTH A;  3HD7 B;  3PBF A;  4IFD K;  2BPE A;  3RL0 C;  3B5N C;  2PP6 A;  3P5G A;  4WCO A;  4WY4 C;  1LGH B;  4DN8 A;  2NPS D;  3P5H A;  1G1I A;  1ZN5 A;  1IFI A;  1KIL C;  1VDF A;  1YYC A;  1UMR A;  3HD7 C;  4AUW A;  3GPR D;  2W6A A;  2A45 I;  3CI9 A;  3GHG B;  1QL2 A;  2C6U A;  1U0N B;  4EIJ A;  2FXM A;  1ZR4 A;  3N7N A;  1HH0 A;  3ZHG A;  1G2C A;  1GW4 A;  3M91 A;  3VMX A;  2FYU K;  3G8L A;  3GHG C;  1JY3 O;  4LQF A;  1U0N C;  1UV0 A;  3G8K A;  2CPS A;  4J6L A;  3V2P A;  3VYK A;  1NKN A;  4YLI A;  1KZU B;  1K9J A;  2M94 A;  2E3X B;  1BCJ 1;  5APS A;  2MSB A;  1JTH B;  3L37 A;  4N35 A;  3KDP B;  1NTK K;  3HRN A;  3FF8 C;  1AFD 1;  2XR5 A;  4J6M A;  1GD2 E;  3C8K D;  2E3X C;  5AVQ B;  4IFF A;  1OZ7 A;  4N37 A;  3G84 A;  5AW5 B;  1SL5 A;  1SQB K;  3T3A A;  2ZQK A;  4GI0 A;  1DEB A;  2Z4E A;  1EGG A;  1SVF A;  1O7C T;  5CCH D;  1JWI A;  3BDW A;  1MFZ A;  1G2C B;  1YPO A;  1UMR C;  2M3B A;  1FZE A;  3H6P A;  1WRG A;  5APW A;  3NTN A;  2XR6 A;  2KSJ A;  5APT A;  1IK9 A;  2LKM A;  3M06 A;  1O7B T;  3P5E A;  1T8D A;  1IJK B;  1GU5 A;  5CJ0 A;  1J35 B;  1C3A A;  5AVS B;  3IKR A;  5B1X A;  5AW0 B;  1PFI A;  1IXX A;  3FD4 A;  4IOP A;  5KTB A;  2R5D A;  1G1Q A;  2WSC H;  1ZR2 A;  2OAR A;  2J59 M;  1IJK C;  3ALU A;  3KQG A;  4J6K A;  4KI1 E;  1SFC A;  3PAQ A;  2YKP A;  1OZ7 B;  2OX8 A;  1YXK A;  2Q5U A;  2H8P D;  4UXM A;  4AYC A;  1AFA 1;  1OXZ A;  1IFN A;  4I1L A;  2IFN A;  4C7R A;  1JUN A;  2AFP A;  3P7K A;  2Q9I A;  2WIT A;  2YKQ A;  1S9K E;  3RK3 B;  4ZKP A;  1LWU A;  1JWI B;  1KX1 A;  1IFJ A;  2N40 A;  3BDW B;  4N38 A;  1KWU A;  5B1W A;  1H89 A;  1BUU A;  1KWT A;  2RIA A;  2HOD A;  4QKH A;  1NH4 A;  2N1T D;  5J6G G;  2E43 A;  2NPS A;  1R14 A;  4RES B;  3E1I A;  1NHL A;  1G1T A;  2A45 H;  1IOD A;  1C3A B;  4WRF A;  1KZC 1;  1T8C A;  3GPR A;  1FZB A;  3MUD A;  3CCK A;  1IXX B;  4IOP B;  2GUV A;  2H43 A;  5KTI A;  1JO5 A;  1HUP A;  3WWK B;  1L4A D;  3P32 A;  5K8Y A;  1A02 J;  4B86 A;  1MSB A;  3A2A A;  3M9Q A;  4HYT B;  3HUP A;  5AW1 B;  1T3U A;  2C0W A;  2RIE A;  1LT9 B;  1KZE 1;  2GO0 A;  1RDI 1;  3UIA A;  1X2T A;  2WWW A;  1SFC C;  2YHF A;  1LWU B;  5LGK E;  2C0X A;  2N9B A;  3CLQ A;  3BX4 A;  1U0O B;  1L0N K;  1RDL 1;  1XAR A;  1HBW A;  3P5F A;  5APX A;  1FZC A;  2P67 A;  1FDM A;  3B8E B;  1M1J A;  2NPS B;  1LWU C;  4EOT A;  1SFC D;  2KYV A;  1OWA A;  2QM7 A;  2R32 A;  1IOD B;  1GZ2 A;  2E42 A;  3GPR B;  1Z56 A;  1SL4 A;  2IX7 C;  1XTG B;  2IPP A;  4ZRV A;  5CCH A;  2ZFC A;  1F00 I;  1TN3 A;  2NPS C;  1LTI C;  4N6J A;  4LLH A;  1V4L B;  2O1K A;  2H2T B;  1N7L A;  3L4F A;  3M0A A;  5M62 A;  3GPR C;  5AW9 B;  3EQ2 A;  3MTU E;  3UBU A;  1RE3 A;  1H8U A;  1QO3 C;  2WPS A;  1GL2 D;  3R2P A;  3VTP C;  4DOJ A;  2XV5 A;  1DY1 A;  1X2T B;  4WRC A;  4S0U A;  2CPB A;  5AVY B;  4W7Y A;  1PW9 A;  3WSR A;  3BRT B;  4LC1 A;  3BX4 B;  3HTK B;  3VLG A;  3A3Y B;  1FZC B;  3WBR A;  1HTL C;  1M1J B;  3C9I A;  3VP9 A;  2XDJ A;  4N78 E;  1XPH A;  3K7B A;  1E5W A;  1SQQ K;  1HUC A;  4ZKU A;  5AW6 B;  1BV4 A;  1IO4 A;  4HH2 A;  3KYQ A;  1FZC C;  1M1J C;  1RJH A;  1RDO 1;  1P1Z D;  4ZES A;  3VMZ A;  3MD0 A;  1SB2 A;  3UBU B;  1NKZ B;  3CL3 D;  2N1T A;  1BNL A;  2VUV A;  3G81 A;  2HFE D;  5CCH C;  1Y17 A;  1GZL A;  1YPU A;  3V2Q A;  5CCG D;  3VYJ A;  2RIC A;  1S9K D;  2RID A;  1N7S D;  2POH A;  3IKQ A;  1RY3 A;  2VRP A;  5AW7 B;  1HVV A;  2R5B A;  1G1J A;  1NTZ K;  3V2N A;  1PWB A;  1FJK A;  1RE3 C;  1X2W A;  1AQ5 A;  1UEX A;  1ZLL A;  3O8Z A;  4IFM A;  1J1D B;  5AVV B;  1FM5 A;  1WK1 A;  3KPE A;  1L4A A;  4MTH A;  3WBQ A;  2C9N Y;  2ZIB A;  5KLV K;  3OA7 A;  1RTM 1;  1URQ D;  3CAD A;  3PAR A;  2GGX A;  2KP8 A;  1KG0 C;  4UWW A;  1NOH A;  4I2L C;  1J1D C;  1BCH 1;  5AW2 B;  3MIW A;  1LTT C;  3P5I A;  3L36 A;  3RK2 D;  3PP5 A;  3NFQ A;  4M3L A;  1LTA C;  1W2E A;  1J2J B;  2WSF H;  3MGN A;  1J34 A;  2WPR A;  1RF1 A;  4M18 A;  3OJA B;  2N1T B;  1KCG A;  1KZA 1;  1FBM A;  1JY2 O;  2RIB A;  3PAK A;  5FFS A;  1Y17 B;  1TLG A;  1DY2 A;  1IFM A;  1CZQ A;  3VN0 A;  2WT7 A;  1G1R A;  1MPU A;  2VRP B;  4QKJ A;  1CWV A;  1LIT A;  1N73 A;  4CAJ A;  4QKG A;  2N1T C;  1M7L A;  1DY0 A;  1UEX B;  4C7N A;  4GK1 A;  1KZB 1;  1B08 A;  1L4A B;  2H2R A;  1SP4 A;  4ZET A;  2M8R A;  3BRV B;  3TK1 A;  1GL2 A;  1T2K D;  2HLO A;  1HYR A;  1SQX K;  2A45 G;  5AVT B;  3NCX A;  2HG5 D;  1L4A C;  5FFT A;  5BU5 A;  2XKM A;  1FOS E;  5AVU B;  4YMD A;  5KJ7 D;  2ORJ A;  3A5T A;  3P7G A;  2P7J A;  2WPQ A;  2XU6 A;  1J34 B;  5AVW B;  3VYI A;  1RF1 B;  2VRS A;  1HJB A;  1KFN A;  3T97 A;  4J6J A;  1SFC B;  4N32 A;  1FIH A;  5CJ4 A;  4OH8 B;  3OAK A;  3TYY A;  1RF1 C;  2PF5 A;  1NAF A;  5AVX B;  2ORK A;  4LU5 A;  1JCD A;  5APU A;  3HE4 A;  1HTN A;  1KWW A;  1BYF A;  4C7N B;  1KWV A;  2FKW B;  2Q3I A;  1DH3 A;  5AVR B;  1A02 F;  4N78 D;  3IKN A;  1N73 C;  1GL2 B;  2HOD B;  1UKM A;  1RE4 A;  2GUS A;  4M17 A;  3TSI A;  1N86 A;  4LGD E;  5CCG A;  4GKO G;  3M0D A;  4GIF A;  1N7S A;  1X79 B;  5APV A;  1KWZ A;  3L9J C;  5KTH A;  1AFB 1;  2JJL A;  3P8C E;  3TNU A;  3VOP A;  1JMM A;  5FFR A;  3WBP A;  4C9F A;  1CI6 A;  1RF0 A;  1H8A A;  1GL2 C;  4CSY A;  4KZV A;  2KLV A;  1T8Z A;  4GT1 A;  3V5B A;  1L0L K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...