3KQGA

Trimeric structure of langerin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
169
structure length
169
Chain Sequence
SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric structure of langerin.
pubmed doi rcsb
molecule keywords C-type lectin domain family 4 member K
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kqgA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3kqgA02
4LQFA 1HQ8A 2Q3IA 1WT9B 2E42A 1JA3A 3DBZA 4YMDA 1BNLA 1UEXA 3P5EA 1KZB1 1A02J 1SL4A 1HTNA 5AVYB 3P32A 3ALSA 1PW9A 4ZESA 1KZE1 5CMZA 1KWWA 2W27A 1E5UI 1SP4A 1JZNA 1CSBA 4G9AA 1J2JB 3P7KA 3WWKB 1H88A 3GPRB 4ZRWA 3IKQA 1NAFA 1KWTA 4KZVA 1Y17B 3PARA 4AQRD 5AW2B 1G1TA 4M18A 5FFRA 4S0UA 1EGIA 3ZHGD 1CI6A 1BYFA 2MSBA 1TN3A 1T8DA 3PAKA 2OS9A 1E87A 2RIAA 2PF5A 3G81A 4MTHA 1UV0A 4LU5A 1JNMA 4J6PA 3A3YB 4EOTA 4KMB1 1DV8A 4E52A 1U0NC 3VYKA 4LC1A 5B1XA 3WHDA 1J35B 2C9NY 4AYCA 1C3AA 1OZ7B 5F2QA 1IJKC 3HUPA 3L37A 4GJXA 1KMB1 2PY2A 2WPRA 1GZ2A 1UKMA 1SL6A 2YNYA 3M9BA 3A5TA 1KX0A 4J6JA 2IT5A 1BCJ1 5LGKE 1KWUA 1YYCA 3B8EB 2XZRA 3L35A 1A02F 1X2WA 4J6MA 2XR6A 4GKGA 2ORJA 3VYJA 1T8CA 1CZQA 2ORKA 2E3XB 4AUWA 1K9IA 4J6KA 2RIEA 1RDN1 3P7HA 3P5HA 1HYRA 1IXXA 4CSYA 3WBQA 1YXJA 4ZRVA 1SB2A 4ZETA 3WBRA 1ESLA 3CADA 3BDWB 2VUZA 4WUXA 3VLGA 2KV3A 3M9HA 3VMXA 1V4LB 5APYA 4GT1A 2LS8A 1XARA 4M17A 4N32A 1KZC1 3BX4A 1LITA 2XU6A 5B1RA 4C7NB 2H2RA 2WT7A 1FVUB 4G96A 1MUUA 2R5DA 3HE5A 3UBUB 1UMRA 4J6NA 3P7GA 3P5FA 2ZXEB 2C9LY 5J6GG 1MV8A 1RDO1 1UMRC 3C8JA 4GKOG 2XV5A 4AK8A 2JJLA 4WCOA 2W6AA 3O8ZA 1QO3C 3P5IA 1AFA1 3HE4B 1KOEA 3VTPC 3VYIA 1P1ZD 2H2TB 1OXZA 3FF7C 4IOPA 1KQLA 5APVA 1O7CT 1BJ3B 2GGUA 2VRPA 4J6QA 3RS1A 5AVTB 2GO0A 1F02I 2RIDA 1RDI1 1HJBA 5AVWB 4GJ0A 5AW9B 5APWA 3MGNA 1H8AA 1WT9A 2R32A 3FF8C 4KHXA 3C22A 1WK1A 5AVXB 3L36A 3LIDA 1B08A 2R5BA 2WPSA 3CDGE 1P4LD 3WBPA 3KQGA 1YTTA 1BUUA 3FF9A 3ZHGA 3UIAA 1GTWA 4WREA 1MFZA 3TYYA 2KMB1 1FAVA 2ZQKA 3WH2A 5AVRB 2RICA 1O7BT 3CFWA 2Q7CA 4QKHA 1R14A 5AVZB 3A7OA 3WWKA 3GPRA 1HBWA 1Y17A 3VMZA 1RDM1 3TNUB 3WWKC 3WH3A 3GPRC 1TLGA 2P67A 1G1QA 2WWWA 1JWIB 1GK6A 1RJHA 1RDJ1 5FFTA 4QKIA 3VPPA 5AW4B 1RTM1 4GK1A 1XPHA 3KMB1 4C46A 4I2LC 4DZOA 1J34B 4WUWA 1K9JA 1T2KD 1WMZA 3C8KD 3FD4A 4KZWA 1RDK1 1J35A 2P2UA 1MSBA 4QKJA 1OZ7A 2YO3A 1UOSB 1GK4A 1FIHA 2QM8A 3IKRA 3P8MC 1IODA 4N34A 3P5GA 4B86A 3NMDA 1U0OB 3V4QA 3CDGF 1V7PB 5AW5B 2VRSA 4N36A 4DN8A 1H8UA 2OX9A 2CL8A 3MD0A 1KZD1 1KWXA 5AW3B 4RESB 4YLIA 1GU4A 1BV4A 1GD2E 1DY1A 5AW0B 1R13A 3G8KA 1KWYA 3ALTA 2E3XC 1IO4A 2OX8A 1X2TB 1PWBA 3OAKA 3WSRA 3G83A 1KCGA 1F00I 2MTIA 1FOSE 4N37A 1YPQA 1DY2A 4C16A 2WTYA 1UEXB 1FIFA 4WRFA 2Z5IA 2IT6A 3BDWA 3NXSA 1SLQA 5B1WA 2H7HA 2GGXA 4N35A 4UXMA 3V5BA 1V4LA 1HUPA 3LIEA 4I6MC 1E8IA 1S9KD 2N9BA 2M94A 3NTNA 2YO2A 4C7NA 2XR5A 1FVUA 1S9KE 2N40A 2BPDA 3UBUA 3M91A 1YXKA 2P7JA 5AW6B 5APQA 2WPQA 3HE4A 3IKNA 2ZIBA 1SL5A 5AVSB 3T97A 1BJ3A 5M62A 2AFPA 1KZA1 1TDQB 1CI6B 1HUCA 2Z5HA 1MPUA 3V4WA 1H89A 1U0NB 2YHFA 5AW7B 1KWVA 3PBFA 4C9FA 4PDCA 3T3AA 1IJKB 1KX1A 1QDDA 1NWQA 2BPEA 1X8YA 1RDL1 2ZFCA 1B6EA 1C3AB 5KTIA 4XE5B 4UWWA 2BPHA 1FOSF 5AVUB 1UKMB 2ZWKA 4M3LA 3M0DA 2R3CA 5APUA 3HTKA 4JYCA 3TK1A 5AVVB 4N33A 5FFSA 1X2WB 1KWZA 1JUNA 1WMYA 1T2KC 3M9ZA 4PP8A 1G1SA 3K7BA 5APXA 4CAJA 1IXXB 1AFD1 1IODB 3GPRD 3TNUA 3IKPA 4HYTB 3G8LA 1SB2B 2QM7A 2BRSA 1MUQA 1JWIA 4N38A 3A2AA 1FM5A 3NCWA 3P5DA 1AFB1 1HWTC 2IPPA 3ALUA 1J34A 1G2CB 1G1RA 3BX4B 3VN0A 2WT7B 4KI1E 3VMYA 2BASA 3HE5B 3M06A 1KG0C 1YPUA 1UOSA 5K8YA 5AVQB 4WQQA 4GI0A 2C6UA 3IR9A 2Q5UA 4WRCA 3KDPB 4WR9A 3M0AA 3NCXA 4J6LA 1U0OA 3P7FA 2E43A 2KP8A 2I83A 1V7PA 1DH3A 1YPOA 4IOPB 5APTA 1GZLA 5KTHA 4QKGA 5AW1B 1BCH1 2RIBA 2VRPB 3I5CA 3L9JC 4JYBA 1CWVA 3G84A 1OWAA 3CCKA 5APSA 4M1GA 3SWFA 1GU5A 1DY0A 3NFQA 4EZMG 2VUVA 5AW8B 3PAQA 1X2TA 1EGGA
chains in the Genus database with same CATH superfamily
1JMMA 2N1TD 3TF5A 1HQ8A 2OTKE 1R5SA 2G8YA 3DBZA 2Y0EA 3P5EA 2WQYC 1KZB1 1A02J 1N7LA 1UIIA 2CK3H 3BRVB 3RK3D 2JDIH 4ZESA 3Q2YA 1QEXA 5CMZA 1NTKK 1SP4A 1JZNA 2KSJA 2QEXP 3MUDC 1NAYA 4G9AA 3P7KA 3BVHA 1LGHB 3IKQA 2YKOA 4KZVA 4I7ZB 3PARA 2B87B 3VP8A 1G1TA 4S0UA 2O01J 4WVZA 2OYOA 2RN0A 3ZHGD 1OZHA 5GTHE 2OS9A 2BEQD 2KYVA 4LC1A 2C9NY 1C3AA 1OZ7B 5CCGD 3AE9C 3HD7B 1LJ2A 2M5AA 3S9OA 2H88C 1NTKJ 1KX0A 1NTKE 1QVFO 1G1IA 4TLFA 1NVOA 1KWUA 1N2DC 1E5WA 2YKQA 1S72P 1KILE 2AEMA 1KFMA 1X9VA 2XR6A 2BEZF 2W8ZA 2E76B 1EDKA 1P84I 1CZQA 2IBZD 3H1ID 4R4LA 4ZMDA 3H1HJ 1DX7A 3H1HE 4J6KA 2RIEA 1HYRA 2AXCA 2Z4EA 2OGUA 4PD4E 4H0LB 3CADA 1DD3A 2FYUD 2ZYGA 4IL6H 1KV4A 2WITA 1EXIA 4WUXA 3VLGA 4Y99C 4RJTA 4JBZA 2L5GB 4N32A 3RK2B 2RH0A 2N1TA 2E76D 1FVUB 1MUUA 2R5DA 3UBUB 2ZYDA 3O6QA 2HR3A 1L0ND 2ZXEB 4H44D 1MV8A 2W6BA 3C8JA 1LT9A 4GKOG 4WCOA 1HVVA 4HB1A 2NRGA 1U57A 4H0LD 5APVA 1T8ZA 3CCEP 1O7CT 2VRPA 4OGQB 4J6QA 1L0LJ 2QRXA 1NTKG 2AXTH 1AQ5A 5AVTB 1AA0A 4U7JA 1FDMA 1F02I 1YBKA 3KHUA 1HJBA 2AEFA 5APWA 1JCCA 2PGDA 2IBZI 3LIDA 2WSFJ 2CPSA 2R5BA 3CDGE 1P4LD 3H1HG 4GIFA 3KQGA 3WBPA 3MHVA 1DIPA 3ZHGA 1VQKP 2I8DA 1LTGC 1GTWA 1G1JA 1JOCA 1MFZA 1IFPA 1VDFA 3A0BE 3CXHI 5AVRB 2RICA 2FYNC 1OIPA 4QKHA 5CCGA 2KZJA 4U3FJ 2JWDA 2B87A 1QVGO 3WWKC 3GPRC 1TLGA 3SFEC 1PGJA 5TJHA 1GK6A 2J58A 1RDJ1 3VPPA 3B4SA 3KMB1 4WUWA 1K9JA 1D7MA 1RDK1 2QIWA 2P2UA 4QKJA 1OZ7A 2YO3A 1UOSB 1FIHA 1FC2C 3HD7A 3IKRA 1U7MA 4IFFA 4N34A 2HG5D 2IZ0A 2B88A 4IFMA 3V2PA 1KC8Q 2Q3EA 3AEFC 2OX9A 1KB9H 3MD0A 5CHXA 5CCHA 1GU4A 3II6A 3G8KA 4YXWH 2QJPC 3ALTA 3L75D 3WU2H 1IO4A 2OX8A 1Q86Q 1EZVE 3OAKA 5C39A 3G83A 1RF1C 1FOSE 1KYOD 1NTZD 2A45I 3E1RA 2E5YA 2P1JA 4LLHA 2XKMA 2UWJE 1HUPA 3RK3C 4R4MA 1ZRTD 1VQ4P 1FVUA 1IFMA 1WMKA 5CBOA 3UBUA 1Y47A 3IN6A 2OARA 3IF4A 2OQQA 3L73J 1EDLA 3L73E 1YJWP 3CWBJ 5DJTB 1SL5A 3CWBE 1KQFB 1URQC 2V7QH 5BU8B 1KZA1 1CI6B 2Z5HA 2Q6QA 1XTGB 1HJ0A 2KIKA 4DCKA 1H89A 4DJGA 3AE4C 5AW7B 1PIXA 1KWVA 3BCCJ 1RE4C 1KX1A 3BCCE 3MP7B 1X8YA 1RDL1 3H1JD 2YMYA 2IFMA 4XE5B 5CCGC 4IL6E 1UKMB 1EZVG 1J1EC 3KYQA 2K3RA 1BDDA 2B9BA 2J59M 2WSCH 1X0TA 1KYOH 4JYCA 5FFSA 3M0DC 2BCCJ 4L76A 3FWNA 1PPJE 3FXEA 1G1SA 2ZJSE 1AFOA 4CAJA 1AFD1 1IODB 3G8LA 2JR8A 3B5NC 4Y99B 1DD4A 3A2AA 2WSSH 3L73G 4PV1C 1HWTC 3CWBG 1G1RA 3BX4B 2M8RA 3VN0A 3VMYA 2BASA 1UOSA 2W6JH 3CC4P 2GM4A 2Q5UA 4WRCA 4H44C 2ZAEB 3BCCG 2E43A 5APTA 4QKGA 2RIBA 5E79E 2YKPA 3I5CA 3RGUA 5APSA 3PP5A 3SWFA 1BCCD 2GA1A 1DY0A 4YTPC 1GW4A 2XDJA 2YXQB 1JA3A 1PPJG 3IAOA 1BNLA 2D2CB 1ZN5A 2N9YB 2I1KA 1S3JA 1L0LD 3AE2C 2OYHC 1SL4A 1HTNA 4GOFA 4KT0J 1N7SD 3ALSA 1NKNA 2FYNB 3PJSK 2FXPA 1KZE1 3U1AA 3MUDA 2LR2A 2W90A 2FBWC 1CSBA 2FKWB 1QGKB 3L72J 2KUBA 1J2JB 1S4XA 3WWKB 3GPRB 3CMEP 1NAFA 1Q2NA 3CMAP 1WT6A 1EXJA 5FFRA 2D2CD 1KB9E 3HUSB 1CI6A 4HH2A 2MSBA 1TN3A 1VQOP 1T8DA 3CX5E 1H0TB 2QSIA 5TISH 4MTHA 1L2PA 4E52A 1U0NC 3TGUJ 1PL5A 3TGUE 5KJ7D 4AYCA 1S2EA 1IJKC 3HUPA 3L37A 1ZMEC 2WPRA 3PH0A 1UKMA 3CD6P 1SL6A 1MZ9A 4J6JA 3H1LD 2PP6A 5LGKE 2Y9YA 4GKGA 5B5EH 3VYJA 4BRYB 2QJPB 2Y0CA 4IOIH 1NTMD 2KI7B 1RF1B 1K9IA 1BGYJ 1BGYE 1OMIA 3LW5H 4CSYA 3WBQA 4UB6H 4ZRVA 3WBRA 5KLVK 1FZEA 1VQ6P 2IFNA 1OW6A 2VUZA 3RK3B 1NU1K 1V4LB 4GT1A 5B66H 3BX4A 2H2RA 4J6NA 3P5FA 2C9LY 2QJYC 3G9RA 1KN7A 1SQXK 1UMRC 3WUUA 2W6AA 3O8ZA 1QO3C 1URQB 3TGUG 1AFA1 1P1ZD 1OXZA 3Q5RA 1P84D 1BJ3B 1FZGA 2G3AA 1RE3C 2C0WA 4ASWA 2RIDA 5KLVJ 5KLVE 5AW9B 3MGNA 1H8AA 3FF8C 2R32A 4KHXA 5AVXB 2ZVNB 1J1EB 1NU1J 1NU1E 2JKVA 1YTTA 1BGYG 2WPVB 1URQD 2QE7H 1YJNP 1PZQA 1PV3A 1VQ5P 3WH2A 1FU1A 1Y9BA 3GW6A 1SQXJ 1SQXE 1OVVA 3AE5C 1EZVI 3L74D 4HKZH 3WWKA 1K9MQ 3GPRA 2KNCB 3FX0A 3B5NB 3TNUB 3WMM0 1UIXA 3KZIH 4PJ0E 1JWIB 1RJHA 1SQVK 3L70D 3HUSA 1AVYA 1JEKA 1XTCC 4PV1B 3AEBC 4GK1A 3JC22 4LGDE 3V2NA 1H0TA 1LP1B 1NHLA 2FYZA 1P84H 4D6TJ 4D6TE 2YMKA 2KB7P 2O3JA 1GK4A 4H44B 5KLVG 1K8AQ 3B5ND 2QVAA 1R5LA 3CC2P 1U0OB 3V4QA 3CXHD 1KD1Q 1YQ3C 1NU1G 1PGQA 4PV1D 4BRYA 3P8CE 2NPSD 4ASVA 5AW0B 1RF1A 1AJYA 1KWYA 2K9JB 1T3UA 2E3XC 1SQVJ 2HODB 1SQVE 2MTIA 1VQLP 1SQXG 3HRNA 1YPQA 4C16A 1SFCD 2OYHB 1EDIA 2IT6A 1SS1A 2MJZA 5KTBA 3NXSA 1SLQA 1SQBD 4N35A 2K9YA 1N7SC 5TISE 3V5BA 1V4LA 4QMAA 4Z1MH 1SQPK 1S9KD 3A0HH 2M94A 2YO2A 2CPBA 3CC7P 2XR5A 1PP9D 3E1IA 4K3AA 3AE3C 2N40A 4RO0A 3GLMA 3Q5PA 1YXKA 4D6TG 1URQA 3H1KE 2ZIBA 2D2CC 1BJ3A 1RHZB 5M62A 4YPCA 1TDQB 1VL2A 3JCUH 2JEEA 3CXHH 4EIJA 2OYIC 4HJGH 1RE4A 1U0NB 1SQQK 3I55P 4C9FA 3LW5J 1JTHB 2ZT9D 3C8VA 1IJKB 1NWQA 1J1DC 2KZIA 2ZFCA 5KJ7C 3SWYA 5KAIH 1SQPJ 2BPHA 1SQPE 4A7PA 1JO5A 5AVUB 1ZW0A 4WWIA 1SQVG 4M3LA 3M0DA 3RBXA 3TK1A 1BE3J 5B66E 1BE3E 1WMYA 2E74D 3HUSC 4Y28J 1T2KC 1IK7A 2H8PD 1BSHA 4GOEA 1FJPA 1FE6A 3CLQA 1FZAA 4WBAA 2KNCA 1FZCC 1IXXB 1E79H 3B5NA 1Z56A 3TNUA 3IKPA 5K5GB 4HYTB 1HTLC 1SB2B 2MKVA 2BRSA 1MUQA 1JWIA 1SQQJ 3CCMP 1SQQE 1YJ9P 1AFB1 4N78E 4BXLA 3H1KG 1LP1A 3ALUA 1G2CB 1KQGB 1QL2A 3L71J 3L71E 4KI1E 4H13D 2QJYB 1KG0C 1VQ8P 5K8YA 4IFDK 4WQQA 2WZ7A 4WR9A 3AE8C 1U0OA 1W2BO 2A45H 2KP8A 1R8EA 1MFTA 5KAFH 1GZLA 1SQPG 2Q1KA 3CX5I 3RL0B 1OWAA 3CCKA 2YXRB 1S5LX 2HFED 3NFQA 2VUVA 5AW8B 3PAQA 2K9JA 1BE3G 2O1JA 2HODA 4GDOA 4LQFA 2Q3IA 2E42A 2P58A 1VF5C 4YMDA 2OYHA 4L73A 3VMAA 2L91A 1LTSC 1VPCA 3P32A 1PW9A 1P84E 2IX7C 2C0XA 1SQQG 3RL0D 4DT0A 2W27A 3RK3E 1E5UI 3BATA 1NGMB 1JB0J 1GL2D 3Q3DA 1H88A 1PGOA 4ZRWA 4NPDA 1BSNA 3L71G 1Y17B 4AQRD 3M9QA 4DOJA 4M18A 3V6IA 3PRJA 1EGIA 4JQ0D 3PAKA 1E87A 2RIAA 2ITAA 2PF5A 2H89C 3G81A 1UV0A 1JNMA 4J6PA 3A3YB 2WSEH 4EOTA 1JTHA 3VYKA 1KTMA 5B1XA 3WHDA 2FYUK 5F2QA 2GUSA 1NTKD 1FZFA 3CPWO 2PY2A 4NPEA 2YNYA 1KILD 3M9BA 3A5TA 3N7NA 4N3YB 1GW3A 3B8EB 2XZRA 3L35A 4MN4C 2XNXA 1A02F 4J6MA 1IFJA 2ORJA 2AXTE 3H1HD 3CCVP 1L0NK 1T8CA 1OVRA 2ORKA 2E3XB 4AUWA 1IFIA 1LWUC 2NPSC 1L4AC 3H1IJ 4PD4D 3P5HA 3H1IE 2IBZE 1IXXA 4WY4D 1AVOA 4O9BA 5CJ4A 2Y9ZA 1YXJA 1SB2A 4ZETA 2DW3A 1SFCC 2K1AA 1N7SB 5BU5A 3H6PA 3M9HA 2FYUJ 3VMXA 2FYUE 1FBMA 2LS8A 1XARA 4M17A 1G2CA 1KZC1 1LITA 2XU6A 5B1RA 2JP3A 3MTUE 3MIWA 4G96A 1UMRA 5KAIE 5J6GG 1KMIZ 1RF0A 1RDO1 1IK9A 2XV5A 1L0NJ 3R4YA 4TT3H 1L0NE 3OJAB 3HE4B 3FF7C 3VTPC 2M0BA 1KQLA 1K05A 1EDJA 3T97B 1LNQA 1RE3A 2OYIB 1IFNA 1GDTA 3D71A 1J1DB 3EFGA 1VQNP 1W5CE 5AVWB 3WUVA 1KQSO 5CBNA 3AEAC 2ZT9C 3F89A 3C22A 3AEGC 3L36A 1BUUA 3H1IG 2IBZG 4PD4I 3D6YA 1JM0A 1NH4A 2RMZA 3TYYA 3HTKB 2R3SA 2KMB1 3TDKA 1NKZB 3W67A 3FGAD 2WMMA 3AECC 1YHQP 1FAVA 4CPGA 1N73C 3MZWB 4U3FD 1LTJB 2E74C 2Q7CA 2K88A 1FZCB 3WU2E 1R14A 2FYUG 2HPCB 1NJIQ 1Y17A 3VMZA 1RDM1 4UB8H 2ZXXA 2PRRA 3WH3A 2M3EA 2P67A 1G1QA 4EYYQ 4I1LA 1S5LH 1YTZI 1W2EA 3AE7C 3BASA 4QKIA 1XPHA 2QA4P 1L0NG 1CW5A 3IFMA 4I2LC 1QX8A 3GMAA 1T2KD 1WMZA 1JMBA 1NTZK 3AEDC 3JSVC 1M1JB 4H13C 1FZBA 1IODA 3P5GA 4B86A 1DEBA 1LTAC 2WSFH 1U7JA 3CDGF 2V7QJ 5AW5B 2VRSA 4DN8A 1YQ4C 1H8UA 2CL8A 1OW8A 1KZD1 3A0BH 1EZVD 1GD2E 1DY1A 1R13A 1X2TB 1VF5B 1K04A 1VQ7P 5DJUB 4N37A 3L75J 4EDFA 2WTYA 3L75E 1ZXGA 1DEEG 1UEXB 3BRTB 4WRFA 2E75C 2WSCJ 1N7SA 1NTZJ 1KYOE 2FXOA 1RF0C 1NTZE 5BVZA 2A45G 5B1WA 2H7HA 2GGXA 1FDIA 3GHGC 3LIEA 4BWNA 2KLVA 3RL0C 3TSIA 1NO4A 1ZRTE 3L73D 2ZVOB 5CJ0A 3M91A 1GL2C 1VF5D 5AW6B 3CWBD 5APQA 3CCUP 1T3JA 3HE4A 3IKNA 1YI2P 3T97A 2AFPA 5EFWB 1YTZT 2OYIA 3G6EP 3BCCD 3V4WA 4JF7A 1X22A 3PBFA 4PDCA 5KJ7A 3CCJP 1QDDA 2BPEA 2KSEA 4UWWA 3SWKA 1FOSF 3H1JJ 1OVUA 3H1JE 2ZWKA 1LTBC 1KILC 2BCCD 5KKZC 5APUA 3L75G 3I56P 3HTKA 1PPJD 5AVVB 1X2WB 2NPSB 1LWUB 1JUNA 1L4AB 1NTZG 1LTJA 2J5UA 3M9ZA 1FZCA 4PP8A 2B89A 1LT1A 2LXCB 1ZR4A 3K7BA 2HPCA 1K73Q 2KS1B 1YITP 1SFCB 4WY4C 2A06D 2I1JA 2IYOA 4KJMA 4W7ZA 1BDCA 1KFNA 1FM5A 4XFJA 3S1KA 1L4AD 2WT7B 1M1JA 1JY3P 1L0LK 1ZP0C 5KLIC 3HE5B 3M06A 1YPUA 3GF3A 5AVQB 4YXDC 2C6UA 3HD7D 1KZUB 2I83A 1DH3A 1YPOA 4IOPB 1EC5A 5AW1B 4JYBA 4C7RA 3G84A 4XA4A 2WVRA 3H1JG 3RL0g 1HGVA 2FFDC 1GU5A 1HF9A 5CCHD 4M1GA 3VP9A 4EZMG 3EWKA 2ZT9B 1Q81Q 1BCCJ 1X2TA 3C9IA 1BCCE 4UB8E 1WT9B 2KXPB 4ZNCA 3ABVC 1YIJP 1VQMP 1UEXA 1S5LE 1JY2P 2Q9IA 2YIUC 3H1KJ 2IYPA 5AVYB 1M90Q 3CCLP 2GUVA 1N73B 1L0LE 5B5EE 2E74B 1WRGA 2HYNA 3L72D 1N8RQ 1KWWA 3RK2D 3KPEA 1JY3O 4UB6E 1KB9D 1KWTA 5AW2B 3D6ZA 5H2FH 3CX5D 2KOGA 4L75A 1BYFA 1NTMK 2K37A 5E79H 1QL1A 4OGQD 3N4XA 3TGUD 3EFFK 3PHLA 4LU5A 4KMB1 1DV8A 3H32B 4H13B 3USSA 4U3FE 1J35B 3F5HA 1LTJC 3PTZA 2SPZA 4GJXA 1KMB1 2LKMA 2QJKC 1GZ2A 1M1KQ 1BCCG 3PLNA 1JY2O 1OFCX 1BCJ1 2IT5A 1YYCA 1X2WA 1QLED 2NPSA 1LWUA 3H1LJ 1L4AA 3H1LE 2O01N 1BGYD 1HH0A 3G71P 1L0LG 1RDN1 3P7HA 5L8RJ 1Q82Q 1NTMJ 2KS1A 2E75B 1NTME 1SFCA 1M1JC 3R2PA 2JWAA 1ESLA 1AV1A 3BDWB 3GHGB 1Y8AA 3ITKA 4OH8B 1KB9I 2KV3A 1AQTA 4EI2A 5APYA 3CX5H 3SFDC 3WUTA 1PFIA 4C7NB 2WT7A 1M8OB 4GODA 1GL2B 3QH9A 3HE5A 4JPZB 3VOPA 2N1TC 3P7GA 4N6JA 3G4SP 2RKLA 2H43A 4OWFA 4AK8A 3KZIE 2JJLA 2E75D 3P5IA 4U3FG 1KOEA 2H2TB 3VYIA 1LT9C 4IOPA 5M1BA 2GGUA 3CL3D 5KLVD 3RS1A 2ZYAA 1FJKA 4NPFX 2GO0A 1ZOYC 1RDI1 5GTIH 1NU1D 4GJ0A 3H1LG 1WT9A 2FY8A 2XNDH 2W83C 1SVFA 3QWOC 1WK1A 1B08A 2WPSA 1TU3F 1X79B 3U59A 1KILB 5KKZB 3FF9A 3UIAA 1PGPA 1NTMG 3FWLA 1VQPP 1SQXD 1N73A 4WREA 4W7YA 2ZQKA 3S4RA 1USEA 1O7BT 3CFWA 3U1CA 5AVZB 2PFXA 1IJDB 4L74A 3A7OA 3GF7A 3C1LA 4WY4B 1HBWA 1RQUA 2PAJA 4K35A 3L74J 3ZDMA 3L74E 2WWWA 4I7ZC 3EQ2A 4ZKPA 1KYOI 2O1KA 4RKUJ 5FFTA 5AW4B 1RTM1 4D6TD 2BCCE 4C46A 4WB4A 3L70J 3A0HE 3L70E 4DZOA 1JY3N 1J34B 5KLIB 3C8KD 3FD4A 1RY3A 4KZWA 2NZ2A 3H32A 3H25A 2Y0DA 1MKMA 3OW2O 1J35A 1MSBA 3Q1MA 2QM8A 3B71A 1SQBK 1Q7YQ 3P8MC 3FXDA 1GMJA 3KXDA 3NMDA 3HD7C 2E5TA 3P8CD 1V7PB 2A06E 4N36A 2FFDB 3JCUE 2O01H 1KWXA 3CXHE 4RESB 5AW3B 4YLIA 1BV4A 1USDA 1SQVD 5GTHH 2E76C 5CCHC 1VQ9P 3AE6C 1HGZA 2R44A 1IFDA 3AE1C 1PWBA 3WSRA 1JY2N 1KCGA 1F00I 5H2FE 2YIUB 1DY2A 1FIFA 2Z5IA 3BDWA 1ZR2A 2AEJA 3GHGA 4PJ0H 3OA7A 4H0LC 2KLUA 3L74G 4UXMA 1LTIC 3CI9A 4I6MC 1E8IA 1FS0E 1SQBJ 2N9BA 1SQBE 3NTNA 2IZ1A 3CCQP 4C7NA 1GL2A 1IZNB 3RK2C 2BCCG 1S9KE 2BPDA 1M56D 3H1KD 3L70G 3D70A 1PP9J 1PP9E 1RH5B 2P7JA 3Q5SA 3G3ZA 2KK7A 2WPQA 1KORA 3V2QA 3L4FA 1NOHA 4PD4H 5AVSB 2M3BA 1HUCA 1M7LA 1MPUA 2FXMA 3RBZA 3W68A 2QG4A 4IL6X 2A06G 4OGQC 2YHFA 3L72E 3T3AA 1LTTC 1SQPD 1B6EA 1C3AB 2QJKB 5KTIA 4OVNF 2M5AB 1KILA 1OW7A 1BE3D 5KAFE 3CCRP 2R3CA 4N33A 2HLOA 1KWZA 1JCDA 1NYHA 3CCSP 2OTLP 1OX3A 4W80A 1RQVA 3AEEC 1Q90D 5APXA 1T6AA 4WY4A 1SQBG 3K5BA 3GPRD 1SQQD 2LXBA 2QM7A 4N78D 3E7KA 4N38A 3SSUA 1PP9G 1IC2A 3NCWA 3P5DA 3GG2A 3L71D 1S1CX 2IPPA 1J34A 5GTIE 1EQ7A 2IDBA 2N1TB 3V2RA 2POHA 3O6QB 2OTJP 4GI0A 2JO1A 3IR9A 3KDPB 3M0AA 1LT9B 3NCXA 3L72G 4J6LA 1ZV8A 3P7FA 1V7PA 1N86A 5KTHA 2FFDA 1BCH1 2VRPB 1ZLLA 3L9JC 1CWVA 2V4HA 4ZKUA 1FDOA 2WSEJ 2P10A 1M57D 1EGGA
chains in the Genus database with same CATH topology
1JMMA 2HODA 2N1TD 3C9IA 4LQFA 1HQ8A 2Q3IA 1WT9B 2E42A 1JA3A 3DBZA 4YMDA 1BNLA 1UEXA 1ZN5A 2OYHA 3P5EA 1JY2P 2I1KA 1KZB1 2Q9IA 1A02J 1N7LA 2OYHC 1LTSC 1HTNA 1SL4A 5AVYB 1VPCA 1N7SD 3P32A 3BRVB 3RK3D 2GUVA 3ALSA 1N73B 1NKNA 1PW9A 4ZESA 2IX7C 1WRGA 2HYNA 1KZE1 2C0XA 5CMZA 3MUDA 3U1AA 3RL0D 1NTKK 1KWWA 2W27A 1E5UI 3RK2D 1SP4A 3BATA 1JZNA 2FKWB 1CSBA 2KSJA 1GL2D 3KPEA 4G9AA 1JY3O 1J2JB 3P7KA 3BVHA 3WWKB 1H88A 1LGHB 3GPRB 4ZRWA 3IKQA 2YKOA 1NAFA 1KWTA 4KZVA 1Y17B 1WT6A 3PARA 4AQRD 5AW2B 3VP8A 1G1TA 3M9QA 4DOJA 4M18A 5FFRA 4S0UA 2KOGA 3HUSB 1EGIA 3ZHGD 1CI6A 1NTMK 4HH2A 1BYFA 2MSBA 1TN3A 1T8DA 3PAKA 1QL1A 2OS9A 1E87A 2RIAA 3N4XA 2PF5A 3G81A 4MTHA 1UV0A 4LU5A 1JNMA 4J6PA 3A3YB 2WSEH 4EOTA 4KMB1 1JTHA 1DV8A 4E52A 3H32B 1U0NC 3VYKA 2KYVA 4LC1A 5B1XA 5KJ7D 1J35B 3WHDA 2FYUK 2C9NY 4AYCA 1C3AA 1OZ7B 5F2QA 2GUSA 1FZFA 1IJKC 1LTJC 5CCGD 3HUPA 3HD7B 3L37A 4GJXA 1KMB1 2PY2A 2LKMA 2WPRA 1GZ2A 1UKMA 1SL6A 1MZ9A 2YNYA 1KILD 3M9BA 3A5TA 1JY2O 1KX0A 4J6JA 2IT5A 1BCJ1 3N7NA 2PP6A 5LGKE 1G1IA 4N3YB 1KWUA 1GW3A 1N2DC 3B8EB 1YYCA 1E5WA 2XZRA 2YKQA 3L35A 2XNXA 1A02F 1KFMA 1X2WA 4J6MA 1X9VA 4GKGA 1IFJA 2ORJA 2NPSA 1LWUA 2XR6A 3VYJA 1L4AA 1L0NK 1T8CA 1CZQA 1HH0A 2ORKA 2E3XB 4AUWA 1IFIA 1LWUC 2NPSC 1DX7A 1L4AC 1RF1B 1K9IA 4J6KA 2RIEA 1RDN1 3P7HA 3P5HA 1HYRA 1IXXA 2Z4EA 3LW5H 4WY4D 4O9BA 5CJ4A 1EGGA 4CSYA 3WBQA 1SFCA 1YXJA 4ZRVA 1M1JC 3R2PA 1SB2A 4ZETA 3WBRA 5KLVK 1ESLA 3CADA 1FZEA 1SFCC 2IFNA 3BDWB 3GHGB 1N7SB 4OH8B 2VUZA 2WITA 3RK3B 5BU5A 4WUXA 3H6PA 3VLGA 2KV3A 3M9HA 4Y99C 3VMXA 1NU1K 1V4LB 1FBMA 5APYA 4GT1A 2LS8A 1XARA 2L5GB 1G2CA 4M17A 4N32A 1KZC1 3BX4A 3RK2B 1PFIA 1LITA 2N1TA 2XU6A 5B1RA 4C7NB 2H2RA 2WT7A 3MTUE 3MIWA 1FVUB 1GL2B 4G96A 1MUUA 2R5DA 3HE5A 3VOPA 3UBUB 1UMRA 4J6NA 2N1TC 3P5FA 3P7GA 2ZXEB 4N6JA 2C9LY 5J6GG 1RF0A 1MV8A 2H43A 2W6BA 1RDO1 1SQXK 1IK9A 1LT9A 2XV5A 1UMRC 2JJLA 3C8JA 4GKOG 4WCOA 4AK8A 2W6AA 1HVVA 3O8ZA 1QO3C 1URQB 3P5IA 3OJAB 1AFA1 3HE4B 1KOEA 3VTPC 3VYIA 1P1ZD 1LT9C 1OXZA 2H2TB 3FF7C 4IOPA 1KQLA 5APVA 1T8ZA 1O7CT 1BJ3B 2GGUA 2VRPA 1RE3A 2OYIB 3CL3D 1IFNA 4J6QA 3RS1A 1FZGA 1GDTA 1FJKA 1AQ5A 5AVTB 1RE3C 2C0WA 2GO0A 1FDMA 1F02I 1J1DB 2RIDA 1RDI1 3EFGA 1HJBA 5AVWB 4GJ0A 5AW9B 5APWA 3MGNA 1JCCA 1H8AA 1WT9A 2R32A 3FF8C 4KHXA 3C22A 1SVFA 1WK1A 5AVXB 3L36A 3LIDA 1B08A 1J1EB 2CPSA 2R5BA 2WPSA 3CDGE 1X79B 1P4LD 3U59A 4GIFA 1KILB 3KQGA 1YTTA 3WBPA 1BUUA 3FF9A 3ZHGA 3UIAA 1LTGC 1URQD 1GTWA 1G1JA 1NH4A 1N73A 4WREA 1JOCA 1MFZA 1VDFA 3HTKB 3TYYA 2KMB1 4W7YA 1NKZB 1FAVA 1FU1A 1N73C 2ZQKA 3WH2A 5AVRB 2RICA 1O7BT 3CFWA 3U1CA 1LTJB 2Q7CA 4QKHA 1FZCB 1R14A 5AVZB 5CCGA 1IJDB 3A7OA 3WWKA 2HPCB 4WY4B 3GPRA 1HBWA 1Y17A 3VMZA 2PAJA 3B5NB 1RDM1 3TNUB 3WMM0 3WWKC 3WH3A 3GPRC 1TLGA 2P67A 1G1QA 2WWWA 3EQ2A 4I1LA 1YTZI 4ZKPA 1JWIB 1GK6A 1W2EA 2J58A 2O1KA 1RJHA 1RDJ1 1SQVK 3HUSA 5FFTA 1XTCC 3BASA 4QKIA 3VPPA 5AW4B 1RTM1 4GK1A 1XPHA 3KMB1 4LGDE 3V2NA 4C46A 4WB4A 1CW5A 3IFMA 1NHLA 4I2LC 4DZOA 1JY3N 1J34B 2FYZA 4WUWA 1K9JA 1T2KD 1WMZA 3C8KD 1RY3A 3FD4A 4KZWA 1NTZK 3H32A 2KB7P 1M1JB 1RDK1 1J35A 2P2UA 1MSBA 4QKJA 1OZ7A 2YO3A 1UOSB 1GK4A 1FIHA 2QM8A 3HD7A 1SQBK 3IKRA 1FZBA 3P8MC 4IFFA 1IODA 4N34A 3P5GA 4B86A 3NMDA 1DEBA 1LTAC 2HG5D 2WSFH 3B5ND 3HD7C 4IFMA 1U0OB 3V2PA 3V4QA 3CDGF 3P8CD 1V7PB 5AW5B 2VRSA 4N36A 4DN8A 1H8UA 2FFDB 2OX9A 2CL8A 2O01H 3MD0A 5CHXA 1KZD1 1KWXA 5CCHA 5AW3B 4RESB 3P8CE 4YLIA 1GU4A 1BV4A 2NPSD 1GD2E 3II6A 1DY1A 5AW0B 1R13A 3G8KA 5CCHC 1RF1A 1HGZA 1KWYA 3ALTA 1IFDA 1T3UA 1IO4A 2E3XC 2OX8A 1X2TB 1PWBA 3OAKA 2HODB 3WSRA 3G83A 1JY2N 1KCGA 1RF1C 1F00I 1FOSE 2MTIA 4N37A 3HRNA 1YPQA 1DY2A 4C16A 2WTYA 1SFCD 1UEXB 2OYHB 1FIFA 2A45I 3BRTB 4WRFA 2Z5IA 2IT6A 3BDWA 1ZR2A 3GHGA 2P1JA 1N7SA 2MJZA 3NXSA 1SLQA 3OA7A 5KTBA 1RF0C 4LLHA 2XKMA 5BVZA 2A45G 5B1WA 2H7HA 2GGXA 3GHGC 4N35A 4UXMA 1N7SC 1LTIC 3V5BA 3CI9A 1HUPA 3RK3C 3LIEA 4I6MC 1V4LA 1SQPK 1E8IA 1S9KD 2N9BA 2M94A 3NTNA 2YO2A 4C7NA 2CPBA 2XR5A 1FVUA 1IFMA 1GL2A 2KLVA 3E1IA 3RL0C 3TSIA 3RK2C 1NO4A 1S9KE 2N40A 2BPDA 3UBUA 5CJ0A 2OARA 3M91A 1YXKA 1GL2C 2P7JA 5AW6B 3G3ZA 5APQA 1URQA 1T3JA 2WPQA 3HE4A 3V2QA 3IKNA 3L4FA 2ZIBA 1NOHA 5AVSB 1SL5A 3T97A 1URQC 1BJ3A 5M62A 2AFPA 5BU8B 1KZA1 1YTZT 2M3BA 1TDQB 1CI6B 1HUCA 1M7LA 2OYIA 2Z5HA 1MPUA 1XTGB 2FXMA 2JEEA 3V4WA 4EIJA 1H89A 2OYIC 1RE4A 1U0NB 2YHFA 1SQQK 5AW7B 4JF7A 1KWVA 3PBFA 4C9FA 1JTHB 5KJ7A 1IJKB 4PDCA 1RE4C 1LTTC 1KX1A 1QDDA 1NWQA 2BPEA 1J1DC 1X8YA 1RDL1 2ZFCA 1B6EA 1C3AB 2YMYA 5KTIA 2IFMA 5KJ7C 4XE5B 4UWWA 3SWYA 2BPHA 5CCGC 1KILA 1FOSF 1JO5A 5AVUB 1UKMB 1J1EC 3KYQA 2ZWKA 4M3LA 1LTBC 3M0DA 2J59M 2R3CA 2WSCH 1KILC 5APUA 3HTKA 4JYCA 3TK1A 5AVVB 4N33A 3M0DC 5FFSA 1X2WB 2HLOA 1KWZA 1JCDA 2NPSB 1LWUB 1JUNA 1WMYA 1L4AB 3HUSC 1LTJA 1T2KC 4W80A 3M9ZA 1FZCA 4PP8A 1G1SA 2H8PD 1ZR4A 3K7BA 1FJPA 3CLQA 5APXA 2HPCA 1AFOA 4CAJA 1FZAA 4WBAA 4WY4A 1FZCC 1IXXB 1AFD1 1IODB 3B5NA 3GPRD 1Z56A 3TNUA 3IKPA 1SFCB 4HYTB 4WY4C 3G8LA 1HTLC 1SB2B 2I1JA 2QM7A 3B5NC 4N78D 2BRSA 1MUQA 1JWIA 4N38A 4Y99B 4W7ZA 3A2AA 1IC2A 1KFNA 1FM5A 3NCWA 3P5DA 1AFB1 4N78E 1HWTC 2IPPA 3ALUA 1J34A 1G2CB 1QL2A 1G1RA 3BX4B 2M8RA 1EQ7A 2N1TB 3V2RA 1L4AD 3VN0A 2WT7B 4KI1E 1M1JA 1JY3P 3VMYA 1L0LK 2BASA 3HE5B 3M06A 1KG0C 1YPUA 1UOSA 2POHA 5K8YA 5AVQB 4IFDK 4WQQA 4GI0A 2WZ7A 2GM4A 2C6UA 3IR9A 2Q5UA 4WRCA 3HD7D 3KDPB 4WR9A 3M0AA 1LT9B 3NCXA 4J6LA 3T3AA 1KZUB 1ZV8A 1U0OA 2A45H 2E43A 2KP8A 3P7FA 2I83A 1V7PA 1DH3A 1YPOA 4IOPB 1N86A 5APTA 1GZLA 5KTHA 2FFDA 5AW1B 1BCH1 2RIBA 2VRPB 4QKGA 2YKPA 1ZLLA 3I5CA 4JYBA 3L9JC 4C7RA 1CWVA 3RL0B 3G84A 1OWAA 4XA4A 3CCKA 5APSA 1HGVA 3PP5A 4ZKUA 3SWFA 5CCHD 2HFED 1GU5A 2FFDC 4M1GA 1DY0A 3NFQA 3VP9A 4EZMG 2VUVA 5AW8B 3PAQA 1GW4A 2XDJA 1X2TA 2O1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQF A;  1HQ8 A;  2Q3I A;  1WT9 B;  2E42 A;  1JA3 A;  3DBZ A;  4YMD A;  1BNL A;  1UEX A;  3P5E A;  1KZB 1;  1A02 J;  1SL4 A;  1HTN A;  5AVY B;  3P32 A;  3ALS A;  1PW9 A;  4ZES A;  1KZE 1;  5CMZ A;  1KWW A;  2W27 A;  1E5U I;  1SP4 A;  1JZN A;  1CSB A;  4G9A A;  1J2J B;  3P7K A;  3WWK B;  1H88 A;  3GPR B;  4ZRW A;  3IKQ A;  1NAF A;  1KWT A;  4KZV A;  1Y17 B;  3PAR A;  4AQR D;  5AW2 B;  1G1T A;  4M18 A;  5FFR A;  4S0U A;  1EGI A;  3ZHG D;  1CI6 A;  1BYF A;  2MSB A;  1TN3 A;  1T8D A;  3PAK A;  2OS9 A;  1E87 A;  2RIA A;  2PF5 A;  3G81 A;  4MTH A;  1UV0 A;  4LU5 A;  1JNM A;  4J6P A;  3A3Y B;  4EOT A;  4KMB 1;  1DV8 A;  4E52 A;  1U0N C;  3VYK A;  4LC1 A;  5B1X A;  3WHD A;  1J35 B;  2C9N Y;  4AYC A;  1C3A A;  1OZ7 B;  5F2Q A;  1IJK C;  3HUP A;  3L37 A;  4GJX A;  1KMB 1;  2PY2 A;  2WPR A;  1GZ2 A;  1UKM A;  1SL6 A;  2YNY A;  3M9B A;  3A5T A;  1KX0 A;  4J6J A;  2IT5 A;  1BCJ 1;  5LGK E;  1KWU A;  1YYC A;  3B8E B;  2XZR A;  3L35 A;  1A02 F;  1X2W A;  4J6M A;  2XR6 A;  4GKG A;  2ORJ A;  3VYJ A;  1T8C A;  1CZQ A;  2ORK A;  2E3X B;  4AUW A;  1K9I A;  4J6K A;  2RIE A;  1RDN 1;  3P7H A;  3P5H A;  1HYR A;  1IXX A;  4CSY A;  3WBQ A;  1YXJ A;  4ZRV A;  1SB2 A;  4ZET A;  3WBR A;  1ESL A;  3CAD A;  3BDW B;  2VUZ A;  4WUX A;  3VLG A;  2KV3 A;  3M9H A;  3VMX A;  1V4L B;  5APY A;  4GT1 A;  2LS8 A;  1XAR A;  4M17 A;  4N32 A;  1KZC 1;  3BX4 A;  1LIT A;  2XU6 A;  5B1R A;  4C7N B;  2H2R A;  2WT7 A;  1FVU B;  4G96 A;  1MUU A;  2R5D A;  3HE5 A;  3UBU B;  1UMR A;  4J6N A;  3P7G A;  3P5F A;  2ZXE B;  2C9L Y;  5J6G G;  1MV8 A;  1RDO 1;  1UMR C;  3C8J A;  4GKO G;  2XV5 A;  4AK8 A;  2JJL A;  4WCO A;  2W6A A;  3O8Z A;  1QO3 C;  3P5I A;  1AFA 1;  3HE4 B;  1KOE A;  3VTP C;  3VYI A;  1P1Z D;  2H2T B;  1OXZ A;  3FF7 C;  4IOP A;  1KQL A;  5APV A;  1O7C T;  1BJ3 B;  2GGU A;  2VRP A;  4J6Q A;  3RS1 A;  5AVT B;  2GO0 A;  1F02 I;  2RID A;  1RDI 1;  1HJB A;  5AVW B;  4GJ0 A;  5AW9 B;  5APW A;  3MGN A;  1H8A A;  1WT9 A;  2R32 A;  3FF8 C;  4KHX A;  3C22 A;  1WK1 A;  5AVX B;  3L36 A;  3LID A;  1B08 A;  2R5B A;  2WPS A;  3CDG E;  1P4L D;  3WBP A;  3KQG A;  1YTT A;  1BUU A;  3FF9 A;  3ZHG A;  3UIA A;  1GTW A;  4WRE A;  1MFZ A;  3TYY A;  2KMB 1;  1FAV A;  2ZQK A;  3WH2 A;  5AVR B;  2RIC A;  1O7B T;  3CFW A;  2Q7C A;  4QKH A;  1R14 A;  5AVZ B;  3A7O A;  3WWK A;  3GPR A;  1HBW A;  1Y17 A;  3VMZ A;  1RDM 1;  3TNU B;  3WWK C;  3WH3 A;  3GPR C;  1TLG A;  2P67 A;  1G1Q A;  2WWW A;  1JWI B;  1GK6 A;  1RJH A;  1RDJ 1;  5FFT A;  4QKI A;  3VPP A;  5AW4 B;  1RTM 1;  4GK1 A;  1XPH A;  3KMB 1;  4C46 A;  4I2L C;  4DZO A;  1J34 B;  4WUW A;  1K9J A;  1T2K D;  1WMZ A;  3C8K D;  3FD4 A;  4KZW A;  1RDK 1;  1J35 A;  2P2U A;  1MSB A;  4QKJ A;  1OZ7 A;  2YO3 A;  1UOS B;  1GK4 A;  1FIH A;  2QM8 A;  3IKR A;  3P8M C;  1IOD A;  4N34 A;  3P5G A;  4B86 A;  3NMD A;  1U0O B;  3V4Q A;  3CDG F;  1V7P B;  5AW5 B;  2VRS A;  4N36 A;  4DN8 A;  1H8U A;  2OX9 A;  2CL8 A;  3MD0 A;  1KZD 1;  1KWX A;  5AW3 B;  4RES B;  4YLI A;  1GU4 A;  1BV4 A;  1GD2 E;  1DY1 A;  5AW0 B;  1R13 A;  3G8K A;  1KWY A;  3ALT A;  2E3X C;  1IO4 A;  2OX8 A;  1X2T B;  1PWB A;  3OAK A;  3WSR A;  3G83 A;  1KCG A;  1F00 I;  2MTI A;  1FOS E;  4N37 A;  1YPQ A;  1DY2 A;  4C16 A;  2WTY A;  1UEX B;  1FIF A;  4WRF A;  2Z5I A;  2IT6 A;  3BDW A;  3NXS A;  1SLQ A;  5B1W A;  2H7H A;  2GGX A;  4N35 A;  4UXM A;  3V5B A;  1V4L A;  1HUP A;  3LIE A;  4I6M C;  1E8I A;  1S9K D;  2N9B A;  2M94 A;  3NTN A;  2YO2 A;  4C7N A;  2XR5 A;  1FVU A;  1S9K E;  2N40 A;  2BPD A;  3UBU A;  3M91 A;  1YXK A;  2P7J A;  5AW6 B;  5APQ A;  2WPQ A;  3HE4 A;  3IKN A;  2ZIB A;  1SL5 A;  5AVS B;  3T97 A;  1BJ3 A;  5M62 A;  2AFP A;  1KZA 1;  1TDQ B;  1CI6 B;  1HUC A;  2Z5H A;  1MPU A;  3V4W A;  1H89 A;  1U0N B;  2YHF A;  5AW7 B;  1KWV A;  3PBF A;  4C9F A;  4PDC A;  3T3A A;  1IJK B;  1KX1 A;  1QDD A;  1NWQ A;  2BPE A;  1X8Y A;  1RDL 1;  2ZFC A;  1B6E A;  1C3A B;  5KTI A;  4XE5 B;  4UWW A;  2BPH A;  1FOS F;  5AVU B;  1UKM B;  2ZWK A;  4M3L A;  3M0D A;  2R3C A;  5APU A;  3HTK A;  4JYC A;  3TK1 A;  5AVV B;  4N33 A;  5FFS A;  1X2W B;  1KWZ A;  1JUN A;  1WMY A;  1T2K C;  3M9Z A;  4PP8 A;  1G1S A;  3K7B A;  5APX A;  4CAJ A;  1IXX B;  1AFD 1;  1IOD B;  3GPR D;  3TNU A;  3IKP A;  4HYT B;  3G8L A;  1SB2 B;  2QM7 A;  2BRS A;  1MUQ A;  1JWI A;  4N38 A;  3A2A A;  1FM5 A;  3NCW A;  3P5D A;  1AFB 1;  1HWT C;  2IPP A;  3ALU A;  1J34 A;  1G2C B;  1G1R A;  3BX4 B;  3VN0 A;  2WT7 B;  4KI1 E;  3VMY A;  2BAS A;  3HE5 B;  3M06 A;  1KG0 C;  1YPU A;  1UOS A;  5K8Y A;  5AVQ B;  4WQQ A;  4GI0 A;  2C6U A;  3IR9 A;  2Q5U A;  4WRC A;  3KDP B;  4WR9 A;  3M0A A;  3NCX A;  4J6L A;  1U0O A;  3P7F A;  2E43 A;  2KP8 A;  2I83 A;  1V7P A;  1DH3 A;  1YPO A;  4IOP B;  5APT A;  1GZL A;  5KTH A;  4QKG A;  5AW1 B;  1BCH 1;  2RIB A;  2VRP B;  3I5C A;  3L9J C;  4JYB A;  1CWV A;  3G84 A;  1OWA A;  3CCK A;  5APS A;  4M1G A;  3SWF A;  1GU5 A;  1DY0 A;  3NFQ A;  4EZM G;  2VUV A;  5AW8 B;  3PAQ A;  1X2T A;  1EGG A; 
#chains in the Genus database with same CATH topology
 1JMM A;  2N1T D;  3TF5 A;  1HQ8 A;  2OTK E;  1R5S A;  2G8Y A;  3DBZ A;  2Y0E A;  3P5E A;  2WQY C;  1KZB 1;  1A02 J;  1N7L A;  1UII A;  2CK3 H;  3BRV B;  3RK3 D;  2JDI H;  4ZES A;  3Q2Y A;  1QEX A;  5CMZ A;  1NTK K;  1SP4 A;  1JZN A;  2KSJ A;  2QEX P;  3MUD C;  1NAY A;  4G9A A;  3P7K A;  3BVH A;  1LGH B;  3IKQ A;  2YKO A;  4KZV A;  4I7Z B;  3PAR A;  2B87 B;  3VP8 A;  1G1T A;  4S0U A;  2O01 J;  4WVZ A;  2OYO A;  2RN0 A;  3ZHG D;  1OZH A;  5GTH E;  2OS9 A;  2BEQ D;  2KYV A;  4LC1 A;  2C9N Y;  1C3A A;  1OZ7 B;  5CCG D;  3AE9 C;  3HD7 B;  1LJ2 A;  2M5A A;  3S9O A;  2H88 C;  1NTK J;  1KX0 A;  1NTK E;  1QVF O;  1G1I A;  4TLF A;  1NVO A;  1KWU A;  1N2D C;  1E5W A;  2YKQ A;  1S72 P;  1KIL E;  2AEM A;  1KFM A;  1X9V A;  2XR6 A;  2BEZ F;  2W8Z A;  2E76 B;  1EDK A;  1P84 I;  1CZQ A;  2IBZ D;  3H1I D;  4R4L A;  4ZMD A;  3H1H J;  1DX7 A;  3H1H E;  4J6K A;  2RIE A;  1HYR A;  2AXC A;  2Z4E A;  2OGU A;  4PD4 E;  4H0L B;  3CAD A;  1DD3 A;  2FYU D;  2ZYG A;  4IL6 H;  1KV4 A;  2WIT A;  1EXI A;  4WUX A;  3VLG A;  4Y99 C;  4RJT A;  4JBZ A;  2L5G B;  4N32 A;  3RK2 B;  2RH0 A;  2N1T A;  2E76 D;  1FVU B;  1MUU A;  2R5D A;  3UBU B;  2ZYD A;  3O6Q A;  2HR3 A;  1L0N D;  2ZXE B;  4H44 D;  1MV8 A;  2W6B A;  3C8J A;  1LT9 A;  4GKO G;  4WCO A;  1HVV A;  4HB1 A;  2NRG A;  1U57 A;  4H0L D;  5APV A;  1T8Z A;  3CCE P;  1O7C T;  2VRP A;  4OGQ B;  4J6Q A;  1L0L J;  2QRX A;  1NTK G;  2AXT H;  1AQ5 A;  5AVT B;  1AA0 A;  4U7J A;  1FDM A;  1F02 I;  1YBK A;  3KHU A;  1HJB A;  2AEF A;  5APW A;  1JCC A;  2PGD A;  2IBZ I;  3LID A;  2WSF J;  2CPS A;  2R5B A;  3CDG E;  1P4L D;  3H1H G;  4GIF A;  3KQG A;  3WBP A;  3MHV A;  1DIP A;  3ZHG A;  1VQK P;  2I8D A;  1LTG C;  1GTW A;  1G1J A;  1JOC A;  1MFZ A;  1IFP A;  1VDF A;  3A0B E;  3CXH I;  5AVR B;  2RIC A;  2FYN C;  1OIP A;  4QKH A;  5CCG A;  2KZJ A;  4U3F J;  2JWD A;  2B87 A;  1QVG O;  3WWK C;  3GPR C;  1TLG A;  3SFE C;  1PGJ A;  5TJH A;  1GK6 A;  2J58 A;  1RDJ 1;  3VPP A;  3B4S A;  3KMB 1;  4WUW A;  1K9J A;  1D7M A;  1RDK 1;  2QIW A;  2P2U A;  4QKJ A;  1OZ7 A;  2YO3 A;  1UOS B;  1FIH A;  1FC2 C;  3HD7 A;  3IKR A;  1U7M A;  4IFF A;  4N34 A;  2HG5 D;  2IZ0 A;  2B88 A;  4IFM A;  3V2P A;  1KC8 Q;  2Q3E A;  3AEF C;  2OX9 A;  1KB9 H;  3MD0 A;  5CHX A;  5CCH A;  1GU4 A;  3II6 A;  3G8K A;  4YXW H;  2QJP C;  3ALT A;  3L75 D;  3WU2 H;  1IO4 A;  2OX8 A;  1Q86 Q;  1EZV E;  3OAK A;  5C39 A;  3G83 A;  1RF1 C;  1FOS E;  1KYO D;  1NTZ D;  2A45 I;  3E1R A;  2E5Y A;  2P1J A;  4LLH A;  2XKM A;  2UWJ E;  1HUP A;  3RK3 C;  4R4M A;  1ZRT D;  1VQ4 P;  1FVU A;  1IFM A;  1WMK A;  5CBO A;  3UBU A;  1Y47 A;  3IN6 A;  2OAR A;  3IF4 A;  2OQQ A;  3L73 J;  1EDL A;  3L73 E;  1YJW P;  3CWB J;  5DJT B;  1SL5 A;  3CWB E;  1KQF B;  1URQ C;  2V7Q H;  5BU8 B;  1KZA 1;  1CI6 B;  2Z5H A;  2Q6Q A;  1XTG B;  1HJ0 A;  2KIK A;  4DCK A;  1H89 A;  4DJG A;  3AE4 C;  5AW7 B;  1PIX A;  1KWV A;  3BCC J;  1RE4 C;  1KX1 A;  3BCC E;  3MP7 B;  1X8Y A;  1RDL 1;  3H1J D;  2YMY A;  2IFM A;  4XE5 B;  5CCG C;  4IL6 E;  1UKM B;  1EZV G;  1J1E C;  3KYQ A;  2K3R A;  1BDD A;  2B9B A;  2J59 M;  2WSC H;  1X0T A;  1KYO H;  4JYC A;  5FFS A;  3M0D C;  2BCC J;  4L76 A;  3FWN A;  1PPJ E;  3FXE A;  1G1S A;  2ZJS E;  1AFO A;  4CAJ A;  1AFD 1;  1IOD B;  3G8L A;  2JR8 A;  3B5N C;  4Y99 B;  1DD4 A;  3A2A A;  2WSS H;  3L73 G;  4PV1 C;  1HWT C;  3CWB G;  1G1R A;  3BX4 B;  2M8R A;  3VN0 A;  3VMY A;  2BAS A;  1UOS A;  2W6J H;  3CC4 P;  2GM4 A;  2Q5U A;  4WRC A;  4H44 C;  2ZAE B;  3BCC G;  2E43 A;  5APT A;  4QKG A;  2RIB A;  5E79 E;  2YKP A;  3I5C A;  3RGU A;  5APS A;  3PP5 A;  3SWF A;  1BCC D;  2GA1 A;  1DY0 A;  4YTP C;  1GW4 A;  2XDJ A;  2YXQ B;  1JA3 A;  1PPJ G;  3IAO A;  1BNL A;  2D2C B;  1ZN5 A;  2N9Y B;  2I1K A;  1S3J A;  1L0L D;  3AE2 C;  2OYH C;  1SL4 A;  1HTN A;  4GOF A;  4KT0 J;  1N7S D;  3ALS A;  1NKN A;  2FYN B;  3PJS K;  2FXP A;  1KZE 1;  3U1A A;  3MUD A;  2LR2 A;  2W90 A;  2FBW C;  1CSB A;  2FKW B;  1QGK B;  3L72 J;  2KUB A;  1J2J B;  1S4X A;  3WWK B;  3GPR B;  3CME P;  1NAF A;  1Q2N A;  3CMA P;  1WT6 A;  1EXJ A;  5FFR A;  2D2C D;  1KB9 E;  3HUS B;  1CI6 A;  4HH2 A;  2MSB A;  1TN3 A;  1VQO P;  1T8D A;  3CX5 E;  1H0T B;  2QSI A;  5TIS H;  4MTH A;  1L2P A;  4E52 A;  1U0N C;  3TGU J;  1PL5 A;  3TGU E;  5KJ7 D;  4AYC A;  1S2E A;  1IJK C;  3HUP A;  3L37 A;  1ZME C;  2WPR A;  3PH0 A;  1UKM A;  3CD6 P;  1SL6 A;  1MZ9 A;  4J6J A;  3H1L D;  2PP6 A;  5LGK E;  2Y9Y A;  4GKG A;  5B5E H;  3VYJ A;  4BRY B;  2QJP B;  2Y0C A;  4IOI H;  1NTM D;  2KI7 B;  1RF1 B;  1K9I A;  1BGY J;  1BGY E;  1OMI A;  3LW5 H;  4CSY A;  3WBQ A;  4UB6 H;  4ZRV A;  3WBR A;  5KLV K;  1FZE A;  1VQ6 P;  2IFN A;  1OW6 A;  2VUZ A;  3RK3 B;  1NU1 K;  1V4L B;  4GT1 A;  5B66 H;  3BX4 A;  2H2R A;  4J6N A;  3P5F A;  2C9L Y;  2QJY C;  3G9R A;  1KN7 A;  1SQX K;  1UMR C;  3WUU A;  2W6A A;  3O8Z A;  1QO3 C;  1URQ B;  3TGU G;  1AFA 1;  1P1Z D;  1OXZ A;  3Q5R A;  1P84 D;  1BJ3 B;  1FZG A;  2G3A A;  1RE3 C;  2C0W A;  4ASW A;  2RID A;  5KLV J;  5KLV E;  5AW9 B;  3MGN A;  1H8A A;  3FF8 C;  2R32 A;  4KHX A;  5AVX B;  2ZVN B;  1J1E B;  1NU1 J;  1NU1 E;  2JKV A;  1YTT A;  1BGY G;  2WPV B;  1URQ D;  2QE7 H;  1YJN P;  1PZQ A;  1PV3 A;  1VQ5 P;  3WH2 A;  1FU1 A;  1Y9B A;  3GW6 A;  1SQX J;  1SQX E;  1OVV A;  3AE5 C;  1EZV I;  3L74 D;  4HKZ H;  3WWK A;  1K9M Q;  3GPR A;  2KNC B;  3FX0 A;  3B5N B;  3TNU B;  3WMM 0;  1UIX A;  3KZI H;  4PJ0 E;  1JWI B;  1RJH A;  1SQV K;  3L70 D;  3HUS A;  1AVY A;  1JEK A;  1XTC C;  4PV1 B;  3AEB C;  4GK1 A;  3JC2 2;  4LGD E;  3V2N A;  1H0T A;  1LP1 B;  1NHL A;  2FYZ A;  1P84 H;  4D6T J;  4D6T E;  2YMK A;  2KB7 P;  2O3J A;  1GK4 A;  4H44 B;  5KLV G;  1K8A Q;  3B5N D;  2QVA A;  1R5L A;  3CC2 P;  1U0O B;  3V4Q A;  3CXH D;  1KD1 Q;  1YQ3 C;  1NU1 G;  1PGQ A;  4PV1 D;  4BRY A;  3P8C E;  2NPS D;  4ASV A;  5AW0 B;  1RF1 A;  1AJY A;  1KWY A;  2K9J B;  1T3U A;  2E3X C;  1SQV J;  2HOD B;  1SQV E;  2MTI A;  1VQL P;  1SQX G;  3HRN A;  1YPQ A;  4C16 A;  1SFC D;  2OYH B;  1EDI A;  2IT6 A;  1SS1 A;  2MJZ A;  5KTB A;  3NXS A;  1SLQ A;  1SQB D;  4N35 A;  2K9Y A;  1N7S C;  5TIS E;  3V5B A;  1V4L A;  4QMA A;  4Z1M H;  1SQP K;  1S9K D;  3A0H H;  2M94 A;  2YO2 A;  2CPB A;  3CC7 P;  2XR5 A;  1PP9 D;  3E1I A;  4K3A A;  3AE3 C;  2N40 A;  4RO0 A;  3GLM A;  3Q5P A;  1YXK A;  4D6T G;  1URQ A;  3H1K E;  2ZIB A;  2D2C C;  1BJ3 A;  1RHZ B;  5M62 A;  4YPC A;  1TDQ B;  1VL2 A;  3JCU H;  2JEE A;  3CXH H;  4EIJ A;  2OYI C;  4HJG H;  1RE4 A;  1U0N B;  1SQQ K;  3I55 P;  4C9F A;  3LW5 J;  1JTH B;  2ZT9 D;  3C8V A;  1IJK B;  1NWQ A;  1J1D C;  2KZI A;  2ZFC A;  5KJ7 C;  3SWY A;  5KAI H;  1SQP J;  2BPH A;  1SQP E;  4A7P A;  1JO5 A;  5AVU B;  1ZW0 A;  4WWI A;  1SQV G;  4M3L A;  3M0D A;  3RBX A;  3TK1 A;  1BE3 J;  5B66 E;  1BE3 E;  1WMY A;  2E74 D;  3HUS C;  4Y28 J;  1T2K C;  1IK7 A;  2H8P D;  1BSH A;  4GOE A;  1FJP A;  1FE6 A;  3CLQ A;  1FZA A;  4WBA A;  2KNC A;  1FZC C;  1IXX B;  1E79 H;  3B5N A;  1Z56 A;  3TNU A;  3IKP A;  5K5G B;  4HYT B;  1HTL C;  1SB2 B;  2MKV A;  2BRS A;  1MUQ A;  1JWI A;  1SQQ J;  3CCM P;  1SQQ E;  1YJ9 P;  1AFB 1;  4N78 E;  4BXL A;  3H1K G;  1LP1 A;  3ALU A;  1G2C B;  1KQG B;  1QL2 A;  3L71 J;  3L71 E;  4KI1 E;  4H13 D;  2QJY B;  1KG0 C;  1VQ8 P;  5K8Y A;  4IFD K;  4WQQ A;  2WZ7 A;  4WR9 A;  3AE8 C;  1U0O A;  1W2B O;  2A45 H;  2KP8 A;  1R8E A;  1MFT A;  5KAF H;  1GZL A;  1SQP G;  2Q1K A;  3CX5 I;  3RL0 B;  1OWA A;  3CCK A;  2YXR B;  1S5L X;  2HFE D;  3NFQ A;  2VUV A;  5AW8 B;  3PAQ A;  2K9J A;  1BE3 G;  2O1J A;  2HOD A;  4GDO A;  4LQF A;  2Q3I A;  2E42 A;  2P58 A;  1VF5 C;  4YMD A;  2OYH A;  4L73 A;  3VMA A;  2L91 A;  1LTS C;  1VPC A;  3P32 A;  1PW9 A;  1P84 E;  2IX7 C;  2C0X A;  1SQQ G;  3RL0 D;  4DT0 A;  2W27 A;  3RK3 E;  1E5U I;  3BAT A;  1NGM B;  1JB0 J;  1GL2 D;  3Q3D A;  1H88 A;  1PGO A;  4ZRW A;  4NPD A;  1BSN A;  3L71 G;  1Y17 B;  4AQR D;  3M9Q A;  4DOJ A;  4M18 A;  3V6I A;  3PRJ A;  1EGI A;  4JQ0 D;  3PAK A;  1E87 A;  2RIA A;  2ITA A;  2PF5 A;  2H89 C;  3G81 A;  1UV0 A;  1JNM A;  4J6P A;  3A3Y B;  2WSE H;  4EOT A;  1JTH A;  3VYK A;  1KTM A;  5B1X A;  3WHD A;  2FYU K;  5F2Q A;  2GUS A;  1NTK D;  1FZF A;  3CPW O;  2PY2 A;  4NPE A;  2YNY A;  1KIL D;  3M9B A;  3A5T A;  3N7N A;  4N3Y B;  1GW3 A;  3B8E B;  2XZR A;  3L35 A;  4MN4 C;  2XNX A;  1A02 F;  4J6M A;  1IFJ A;  2ORJ A;  2AXT E;  3H1H D;  3CCV P;  1L0N K;  1T8C A;  1OVR A;  2ORK A;  2E3X B;  4AUW A;  1IFI A;  1LWU C;  2NPS C;  1L4A C;  3H1I J;  4PD4 D;  3P5H A;  3H1I E;  2IBZ E;  1IXX A;  4WY4 D;  1AVO A;  4O9B A;  5CJ4 A;  2Y9Z A;  1YXJ A;  1SB2 A;  4ZET A;  2DW3 A;  1SFC C;  2K1A A;  1N7S B;  5BU5 A;  3H6P A;  3M9H A;  2FYU J;  3VMX A;  2FYU E;  1FBM A;  2LS8 A;  1XAR A;  4M17 A;  1G2C A;  1KZC 1;  1LIT A;  2XU6 A;  5B1R A;  2JP3 A;  3MTU E;  3MIW A;  4G96 A;  1UMR A;  5KAI E;  5J6G G;  1KMI Z;  1RF0 A;  1RDO 1;  1IK9 A;  2XV5 A;  1L0N J;  3R4Y A;  4TT3 H;  1L0N E;  3OJA B;  3HE4 B;  3FF7 C;  3VTP C;  2M0B A;  1KQL A;  1K05 A;  1EDJ A;  3T97 B;  1LNQ A;  1RE3 A;  2OYI B;  1IFN A;  1GDT A;  3D71 A;  1J1D B;  3EFG A;  1VQN P;  1W5C E;  5AVW B;  3WUV A;  1KQS O;  5CBN A;  3AEA C;  2ZT9 C;  3F89 A;  3C22 A;  3AEG C;  3L36 A;  1BUU A;  3H1I G;  2IBZ G;  4PD4 I;  3D6Y A;  1JM0 A;  1NH4 A;  2RMZ A;  3TYY A;  3HTK B;  2R3S A;  2KMB 1;  3TDK A;  1NKZ B;  3W67 A;  3FGA D;  2WMM A;  3AEC C;  1YHQ P;  1FAV A;  4CPG A;  1N73 C;  3MZW B;  4U3F D;  1LTJ B;  2E74 C;  2Q7C A;  2K88 A;  1FZC B;  3WU2 E;  1R14 A;  2FYU G;  2HPC B;  1NJI Q;  1Y17 A;  3VMZ A;  1RDM 1;  4UB8 H;  2ZXX A;  2PRR A;  3WH3 A;  2M3E A;  2P67 A;  1G1Q A;  4EYY Q;  4I1L A;  1S5L H;  1YTZ I;  1W2E A;  3AE7 C;  3BAS A;  4QKI A;  1XPH A;  2QA4 P;  1L0N G;  1CW5 A;  3IFM A;  4I2L C;  1QX8 A;  3GMA A;  1T2K D;  1WMZ A;  1JMB A;  1NTZ K;  3AED C;  3JSV C;  1M1J B;  4H13 C;  1FZB A;  1IOD A;  3P5G A;  4B86 A;  1DEB A;  1LTA C;  2WSF H;  1U7J A;  3CDG F;  2V7Q J;  5AW5 B;  2VRS A;  4DN8 A;  1YQ4 C;  1H8U A;  2CL8 A;  1OW8 A;  1KZD 1;  3A0B H;  1EZV D;  1GD2 E;  1DY1 A;  1R13 A;  1X2T B;  1VF5 B;  1K04 A;  1VQ7 P;  5DJU B;  4N37 A;  3L75 J;  4EDF A;  2WTY A;  3L75 E;  1ZXG A;  1DEE G;  1UEX B;  3BRT B;  4WRF A;  2E75 C;  2WSC J;  1N7S A;  1NTZ J;  1KYO E;  2FXO A;  1RF0 C;  1NTZ E;  5BVZ A;  2A45 G;  5B1W A;  2H7H A;  2GGX A;  1FDI A;  3GHG C;  3LIE A;  4BWN A;  2KLV A;  3RL0 C;  3TSI A;  1NO4 A;  1ZRT E;  3L73 D;  2ZVO B;  5CJ0 A;  3M91 A;  1GL2 C;  1VF5 D;  5AW6 B;  3CWB D;  5APQ A;  3CCU P;  1T3J A;  3HE4 A;  3IKN A;  1YI2 P;  3T97 A;  2AFP A;  5EFW B;  1YTZ T;  2OYI A;  3G6E P;  3BCC D;  3V4W A;  4JF7 A;  1X22 A;  3PBF A;  4PDC A;  5KJ7 A;  3CCJ P;  1QDD A;  2BPE A;  2KSE A;  4UWW A;  3SWK A;  1FOS F;  3H1J J;  1OVU A;  3H1J E;  2ZWK A;  1LTB C;  1KIL C;  2BCC D;  5KKZ C;  5APU A;  3L75 G;  3I56 P;  3HTK A;  1PPJ D;  5AVV B;  1X2W B;  2NPS B;  1LWU B;  1JUN A;  1L4A B;  1NTZ G;  1LTJ A;  2J5U A;  3M9Z A;  1FZC A;  4PP8 A;  2B89 A;  1LT1 A;  2LXC B;  1ZR4 A;  3K7B A;  2HPC A;  1K73 Q;  2KS1 B;  1YIT P;  1SFC B;  4WY4 C;  2A06 D;  2I1J A;  2IYO A;  4KJM A;  4W7Z A;  1BDC A;  1KFN A;  1FM5 A;  4XFJ A;  3S1K A;  1L4A D;  2WT7 B;  1M1J A;  1JY3 P;  1L0L K;  1ZP0 C;  5KLI C;  3HE5 B;  3M06 A;  1YPU A;  3GF3 A;  5AVQ B;  4YXD C;  2C6U A;  3HD7 D;  1KZU B;  2I83 A;  1DH3 A;  1YPO A;  4IOP B;  1EC5 A;  5AW1 B;  4JYB A;  4C7R A;  3G84 A;  4XA4 A;  2WVR A;  3H1J G;  3RL0 g;  1HGV A;  2FFD C;  1GU5 A;  1HF9 A;  5CCH D;  4M1G A;  3VP9 A;  4EZM G;  3EWK A;  2ZT9 B;  1Q81 Q;  1BCC J;  1X2T A;  3C9I A;  1BCC E;  4UB8 E;  1WT9 B;  2KXP B;  4ZNC A;  3ABV C;  1YIJ P;  1VQM P;  1UEX A;  1S5L E;  1JY2 P;  2Q9I A;  2YIU C;  3H1K J;  2IYP A;  5AVY B;  1M90 Q;  3CCL P;  2GUV A;  1N73 B;  1L0L E;  5B5E E;  2E74 B;  1WRG A;  2HYN A;  3L72 D;  1N8R Q;  1KWW A;  3RK2 D;  3KPE A;  1JY3 O;  4UB6 E;  1KB9 D;  1KWT A;  5AW2 B;  3D6Z A;  5H2F H;  3CX5 D;  2KOG A;  4L75 A;  1BYF A;  1NTM K;  2K37 A;  5E79 H;  1QL1 A;  4OGQ D;  3N4X A;  3TGU D;  3EFF K;  3PHL A;  4LU5 A;  4KMB 1;  1DV8 A;  3H32 B;  4H13 B;  3USS A;  4U3F E;  1J35 B;  3F5H A;  1LTJ C;  3PTZ A;  2SPZ A;  4GJX A;  1KMB 1;  2LKM A;  2QJK C;  1GZ2 A;  1M1K Q;  1BCC G;  3PLN A;  1JY2 O;  1OFC X;  1BCJ 1;  2IT5 A;  1YYC A;  1X2W A;  1QLE D;  2NPS A;  1LWU A;  3H1L J;  1L4A A;  3H1L E;  2O01 N;  1BGY D;  1HH0 A;  3G71 P;  1L0L G;  1RDN 1;  3P7H A;  5L8R J;  1Q82 Q;  1NTM J;  2KS1 A;  2E75 B;  1NTM E;  1SFC A;  1M1J C;  3R2P A;  2JWA A;  1ESL A;  1AV1 A;  3BDW B;  3GHG B;  1Y8A A;  3ITK A;  4OH8 B;  1KB9 I;  2KV3 A;  1AQT A;  4EI2 A;  5APY A;  3CX5 H;  3SFD C;  3WUT A;  1PFI A;  4C7N B;  2WT7 A;  1M8O B;  4GOD A;  1GL2 B;  3QH9 A;  3HE5 A;  4JPZ B;  3VOP A;  2N1T C;  3P7G A;  4N6J A;  3G4S P;  2RKL A;  2H43 A;  4OWF A;  4AK8 A;  3KZI E;  2JJL A;  2E75 D;  3P5I A;  4U3F G;  1KOE A;  2H2T B;  3VYI A;  1LT9 C;  4IOP A;  5M1B A;  2GGU A;  3CL3 D;  5KLV D;  3RS1 A;  2ZYA A;  1FJK A;  4NPF X;  2GO0 A;  1ZOY C;  1RDI 1;  5GTI H;  1NU1 D;  4GJ0 A;  3H1L G;  1WT9 A;  2FY8 A;  2XND H;  2W83 C;  1SVF A;  3QWO C;  1WK1 A;  1B08 A;  2WPS A;  1TU3 F;  1X79 B;  3U59 A;  1KIL B;  5KKZ B;  3FF9 A;  3UIA A;  1PGP A;  1NTM G;  3FWL A;  1VQP P;  1SQX D;  1N73 A;  4WRE A;  4W7Y A;  2ZQK A;  3S4R A;  1USE A;  1O7B T;  3CFW A;  3U1C A;  5AVZ B;  2PFX A;  1IJD B;  4L74 A;  3A7O A;  3GF7 A;  3C1L A;  4WY4 B;  1HBW A;  1RQU A;  2PAJ A;  4K35 A;  3L74 J;  3ZDM A;  3L74 E;  2WWW A;  4I7Z C;  3EQ2 A;  4ZKP A;  1KYO I;  2O1K A;  4RKU J;  5FFT A;  5AW4 B;  1RTM 1;  4D6T D;  2BCC E;  4C46 A;  4WB4 A;  3L70 J;  3A0H E;  3L70 E;  4DZO A;  1JY3 N;  1J34 B;  5KLI B;  3C8K D;  3FD4 A;  1RY3 A;  4KZW A;  2NZ2 A;  3H32 A;  3H25 A;  2Y0D A;  1MKM A;  3OW2 O;  1J35 A;  1MSB A;  3Q1M A;  2QM8 A;  3B71 A;  1SQB K;  1Q7Y Q;  3P8M C;  3FXD A;  1GMJ A;  3KXD A;  3NMD A;  3HD7 C;  2E5T A;  3P8C D;  1V7P B;  2A06 E;  4N36 A;  2FFD B;  3JCU E;  2O01 H;  1KWX A;  3CXH E;  4RES B;  5AW3 B;  4YLI A;  1BV4 A;  1USD A;  1SQV D;  5GTH H;  2E76 C;  5CCH C;  1VQ9 P;  3AE6 C;  1HGZ A;  2R44 A;  1IFD A;  3AE1 C;  1PWB A;  3WSR A;  1JY2 N;  1KCG A;  1F00 I;  5H2F E;  2YIU B;  1DY2 A;  1FIF A;  2Z5I A;  3BDW A;  1ZR2 A;  2AEJ A;  3GHG A;  4PJ0 H;  3OA7 A;  4H0L C;  2KLU A;  3L74 G;  4UXM A;  1LTI C;  3CI9 A;  4I6M C;  1E8I A;  1FS0 E;  1SQB J;  2N9B A;  1SQB E;  3NTN A;  2IZ1 A;  3CCQ P;  4C7N A;  1GL2 A;  1IZN B;  3RK2 C;  2BCC G;  1S9K E;  2BPD A;  1M56 D;  3H1K D;  3L70 G;  3D70 A;  1PP9 J;  1PP9 E;  1RH5 B;  2P7J A;  3Q5S A;  3G3Z A;  2KK7 A;  2WPQ A;  1KOR A;  3V2Q A;  3L4F A;  1NOH A;  4PD4 H;  5AVS B;  2M3B A;  1HUC A;  1M7L A;  1MPU A;  2FXM A;  3RBZ A;  3W68 A;  2QG4 A;  4IL6 X;  2A06 G;  4OGQ C;  2YHF A;  3L72 E;  3T3A A;  1LTT C;  1SQP D;  1B6E A;  1C3A B;  2QJK B;  5KTI A;  4OVN F;  2M5A B;  1KIL A;  1OW7 A;  1BE3 D;  5KAF E;  3CCR P;  2R3C A;  4N33 A;  2HLO A;  1KWZ A;  1JCD A;  1NYH A;  3CCS P;  2OTL P;  1OX3 A;  4W80 A;  1RQV A;  3AEE C;  1Q90 D;  5APX A;  1T6A A;  4WY4 A;  1SQB G;  3K5B A;  3GPR D;  1SQQ D;  2LXB A;  2QM7 A;  4N78 D;  3E7K A;  4N38 A;  3SSU A;  1PP9 G;  1IC2 A;  3NCW A;  3P5D A;  3GG2 A;  3L71 D;  1S1C X;  2IPP A;  1J34 A;  5GTI E;  1EQ7 A;  2IDB A;  2N1T B;  3V2R A;  2POH A;  3O6Q B;  2OTJ P;  4GI0 A;  2JO1 A;  3IR9 A;  3KDP B;  3M0A A;  1LT9 B;  3NCX A;  3L72 G;  4J6L A;  1ZV8 A;  3P7F A;  1V7P A;  1N86 A;  5KTH A;  2FFD A;  1BCH 1;  2VRP B;  1ZLL A;  3L9J C;  1CWV A;  2V4H A;  4ZKU A;  1FDO A;  2WSE J;  2P10 A;  1M57 D;  1EGG A; 
#chains in the Genus database with same CATH homology
 1JMM A;  2HOD A;  2N1T D;  3C9I A;  4LQF A;  1HQ8 A;  2Q3I A;  1WT9 B;  2E42 A;  1JA3 A;  3DBZ A;  4YMD A;  1BNL A;  1UEX A;  1ZN5 A;  2OYH A;  3P5E A;  1JY2 P;  2I1K A;  1KZB 1;  2Q9I A;  1A02 J;  1N7L A;  2OYH C;  1LTS C;  1HTN A;  1SL4 A;  5AVY B;  1VPC A;  1N7S D;  3P32 A;  3BRV B;  3RK3 D;  2GUV A;  3ALS A;  1N73 B;  1NKN A;  1PW9 A;  4ZES A;  2IX7 C;  1WRG A;  2HYN A;  1KZE 1;  2C0X A;  5CMZ A;  3MUD A;  3U1A A;  3RL0 D;  1NTK K;  1KWW A;  2W27 A;  1E5U I;  3RK2 D;  1SP4 A;  3BAT A;  1JZN A;  2FKW B;  1CSB A;  2KSJ A;  1GL2 D;  3KPE A;  4G9A A;  1JY3 O;  1J2J B;  3P7K A;  3BVH A;  3WWK B;  1H88 A;  1LGH B;  3GPR B;  4ZRW A;  3IKQ A;  2YKO A;  1NAF A;  1KWT A;  4KZV A;  1Y17 B;  1WT6 A;  3PAR A;  4AQR D;  5AW2 B;  3VP8 A;  1G1T A;  3M9Q A;  4DOJ A;  4M18 A;  5FFR A;  4S0U A;  2KOG A;  3HUS B;  1EGI A;  3ZHG D;  1CI6 A;  1NTM K;  4HH2 A;  1BYF A;  2MSB A;  1TN3 A;  1T8D A;  3PAK A;  1QL1 A;  2OS9 A;  1E87 A;  2RIA A;  3N4X A;  2PF5 A;  3G81 A;  4MTH A;  1UV0 A;  4LU5 A;  1JNM A;  4J6P A;  3A3Y B;  2WSE H;  4EOT A;  4KMB 1;  1JTH A;  1DV8 A;  4E52 A;  3H32 B;  1U0N C;  3VYK A;  2KYV A;  4LC1 A;  5B1X A;  5KJ7 D;  1J35 B;  3WHD A;  2FYU K;  2C9N Y;  4AYC A;  1C3A A;  1OZ7 B;  5F2Q A;  2GUS A;  1FZF A;  1IJK C;  1LTJ C;  5CCG D;  3HUP A;  3HD7 B;  3L37 A;  4GJX A;  1KMB 1;  2PY2 A;  2LKM A;  2WPR A;  1GZ2 A;  1UKM A;  1SL6 A;  1MZ9 A;  2YNY A;  1KIL D;  3M9B A;  3A5T A;  1JY2 O;  1KX0 A;  4J6J A;  2IT5 A;  1BCJ 1;  3N7N A;  2PP6 A;  5LGK E;  1G1I A;  4N3Y B;  1KWU A;  1GW3 A;  1N2D C;  3B8E B;  1YYC A;  1E5W A;  2XZR A;  2YKQ A;  3L35 A;  2XNX A;  1A02 F;  1KFM A;  1X2W A;  4J6M A;  1X9V A;  4GKG A;  1IFJ A;  2ORJ A;  2NPS A;  1LWU A;  2XR6 A;  3VYJ A;  1L4A A;  1L0N K;  1T8C A;  1CZQ A;  1HH0 A;  2ORK A;  2E3X B;  4AUW A;  1IFI A;  1LWU C;  2NPS C;  1DX7 A;  1L4A C;  1RF1 B;  1K9I A;  4J6K A;  2RIE A;  1RDN 1;  3P7H A;  3P5H A;  1HYR A;  1IXX A;  2Z4E A;  3LW5 H;  4WY4 D;  4O9B A;  5CJ4 A;  1EGG A;  4CSY A;  3WBQ A;  1SFC A;  1YXJ A;  4ZRV A;  1M1J C;  3R2P A;  1SB2 A;  4ZET A;  3WBR A;  5KLV K;  1ESL A;  3CAD A;  1FZE A;  1SFC C;  2IFN A;  3BDW B;  3GHG B;  1N7S B;  4OH8 B;  2VUZ A;  2WIT A;  3RK3 B;  5BU5 A;  4WUX A;  3H6P A;  3VLG A;  2KV3 A;  3M9H A;  4Y99 C;  3VMX A;  1NU1 K;  1V4L B;  1FBM A;  5APY A;  4GT1 A;  2LS8 A;  1XAR A;  2L5G B;  1G2C A;  4M17 A;  4N32 A;  1KZC 1;  3BX4 A;  3RK2 B;  1PFI A;  1LIT A;  2N1T A;  2XU6 A;  5B1R A;  4C7N B;  2H2R A;  2WT7 A;  3MTU E;  3MIW A;  1FVU B;  1GL2 B;  4G96 A;  1MUU A;  2R5D A;  3HE5 A;  3VOP A;  3UBU B;  1UMR A;  4J6N A;  2N1T C;  3P5F A;  3P7G A;  2ZXE B;  4N6J A;  2C9L Y;  5J6G G;  1RF0 A;  1MV8 A;  2H43 A;  2W6B A;  1RDO 1;  1SQX K;  1IK9 A;  1LT9 A;  2XV5 A;  1UMR C;  2JJL A;  3C8J A;  4GKO G;  4WCO A;  4AK8 A;  2W6A A;  1HVV A;  3O8Z A;  1QO3 C;  1URQ B;  3P5I A;  3OJA B;  1AFA 1;  3HE4 B;  1KOE A;  3VTP C;  3VYI A;  1P1Z D;  1LT9 C;  1OXZ A;  2H2T B;  3FF7 C;  4IOP A;  1KQL A;  5APV A;  1T8Z A;  1O7C T;  1BJ3 B;  2GGU A;  2VRP A;  1RE3 A;  2OYI B;  3CL3 D;  1IFN A;  4J6Q A;  3RS1 A;  1FZG A;  1GDT A;  1FJK A;  1AQ5 A;  5AVT B;  1RE3 C;  2C0W A;  2GO0 A;  1FDM A;  1F02 I;  1J1D B;  2RID A;  1RDI 1;  3EFG A;  1HJB A;  5AVW B;  4GJ0 A;  5AW9 B;  5APW A;  3MGN A;  1JCC A;  1H8A A;  1WT9 A;  2R32 A;  3FF8 C;  4KHX A;  3C22 A;  1SVF A;  1WK1 A;  5AVX B;  3L36 A;  3LID A;  1B08 A;  1J1E B;  2CPS A;  2R5B A;  2WPS A;  3CDG E;  1X79 B;  1P4L D;  3U59 A;  4GIF A;  1KIL B;  3KQG A;  1YTT A;  3WBP A;  1BUU A;  3FF9 A;  3ZHG A;  3UIA A;  1LTG C;  1URQ D;  1GTW A;  1G1J A;  1NH4 A;  1N73 A;  4WRE A;  1JOC A;  1MFZ A;  1VDF A;  3HTK B;  3TYY A;  2KMB 1;  4W7Y A;  1NKZ B;  1FAV A;  1FU1 A;  1N73 C;  2ZQK A;  3WH2 A;  5AVR B;  2RIC A;  1O7B T;  3CFW A;  3U1C A;  1LTJ B;  2Q7C A;  4QKH A;  1FZC B;  1R14 A;  5AVZ B;  5CCG A;  1IJD B;  3A7O A;  3WWK A;  2HPC B;  4WY4 B;  3GPR A;  1HBW A;  1Y17 A;  3VMZ A;  2PAJ A;  3B5N B;  1RDM 1;  3TNU B;  3WMM 0;  3WWK C;  3WH3 A;  3GPR C;  1TLG A;  2P67 A;  1G1Q A;  2WWW A;  3EQ2 A;  4I1L A;  1YTZ I;  4ZKP A;  1JWI B;  1GK6 A;  1W2E A;  2J58 A;  2O1K A;  1RJH A;  1RDJ 1;  1SQV K;  3HUS A;  5FFT A;  1XTC C;  3BAS A;  4QKI A;  3VPP A;  5AW4 B;  1RTM 1;  4GK1 A;  1XPH A;  3KMB 1;  4LGD E;  3V2N A;  4C46 A;  4WB4 A;  1CW5 A;  3IFM A;  1NHL A;  4I2L C;  4DZO A;  1JY3 N;  1J34 B;  2FYZ A;  4WUW A;  1K9J A;  1T2K D;  1WMZ A;  3C8K D;  1RY3 A;  3FD4 A;  4KZW A;  1NTZ K;  3H32 A;  2KB7 P;  1M1J B;  1RDK 1;  1J35 A;  2P2U A;  1MSB A;  4QKJ A;  1OZ7 A;  2YO3 A;  1UOS B;  1GK4 A;  1FIH A;  2QM8 A;  3HD7 A;  1SQB K;  3IKR A;  1FZB A;  3P8M C;  4IFF A;  1IOD A;  4N34 A;  3P5G A;  4B86 A;  3NMD A;  1DEB A;  1LTA C;  2HG5 D;  2WSF H;  3B5N D;  3HD7 C;  4IFM A;  1U0O B;  3V2P A;  3V4Q A;  3CDG F;  3P8C D;  1V7P B;  5AW5 B;  2VRS A;  4N36 A;  4DN8 A;  1H8U A;  2FFD B;  2OX9 A;  2CL8 A;  2O01 H;  3MD0 A;  5CHX A;  1KZD 1;  1KWX A;  5CCH A;  5AW3 B;  4RES B;  3P8C E;  4YLI A;  1GU4 A;  1BV4 A;  2NPS D;  1GD2 E;  3II6 A;  1DY1 A;  5AW0 B;  1R13 A;  3G8K A;  5CCH C;  1RF1 A;  1HGZ A;  1KWY A;  3ALT A;  1IFD A;  1T3U A;  1IO4 A;  2E3X C;  2OX8 A;  1X2T B;  1PWB A;  3OAK A;  2HOD B;  3WSR A;  3G83 A;  1JY2 N;  1KCG A;  1RF1 C;  1F00 I;  1FOS E;  2MTI A;  4N37 A;  3HRN A;  1YPQ A;  1DY2 A;  4C16 A;  2WTY A;  1SFC D;  1UEX B;  2OYH B;  1FIF A;  2A45 I;  3BRT B;  4WRF A;  2Z5I A;  2IT6 A;  3BDW A;  1ZR2 A;  3GHG A;  2P1J A;  1N7S A;  2MJZ A;  3NXS A;  1SLQ A;  3OA7 A;  5KTB A;  1RF0 C;  4LLH A;  2XKM A;  5BVZ A;  2A45 G;  5B1W A;  2H7H A;  2GGX A;  3GHG C;  4N35 A;  4UXM A;  1N7S C;  1LTI C;  3V5B A;  3CI9 A;  1HUP A;  3RK3 C;  3LIE A;  4I6M C;  1V4L A;  1SQP K;  1E8I A;  1S9K D;  2N9B A;  2M94 A;  3NTN A;  2YO2 A;  4C7N A;  2CPB A;  2XR5 A;  1FVU A;  1IFM A;  1GL2 A;  2KLV A;  3E1I A;  3RL0 C;  3TSI A;  3RK2 C;  1NO4 A;  1S9K E;  2N40 A;  2BPD A;  3UBU A;  5CJ0 A;  2OAR A;  3M91 A;  1YXK A;  1GL2 C;  2P7J A;  5AW6 B;  3G3Z A;  5APQ A;  1URQ A;  1T3J A;  2WPQ A;  3HE4 A;  3V2Q A;  3IKN A;  3L4F A;  2ZIB A;  1NOH A;  5AVS B;  1SL5 A;  3T97 A;  1URQ C;  1BJ3 A;  5M62 A;  2AFP A;  5BU8 B;  1KZA 1;  1YTZ T;  2M3B A;  1TDQ B;  1CI6 B;  1HUC A;  1M7L A;  2OYI A;  2Z5H A;  1MPU A;  1XTG B;  2FXM A;  2JEE A;  3V4W A;  4EIJ A;  1H89 A;  2OYI C;  1RE4 A;  1U0N B;  2YHF A;  1SQQ K;  5AW7 B;  4JF7 A;  1KWV A;  3PBF A;  4C9F A;  1JTH B;  5KJ7 A;  1IJK B;  4PDC A;  1RE4 C;  1LTT C;  1KX1 A;  1QDD A;  1NWQ A;  2BPE A;  1J1D C;  1X8Y A;  1RDL 1;  2ZFC A;  1B6E A;  1C3A B;  2YMY A;  5KTI A;  2IFM A;  5KJ7 C;  4XE5 B;  4UWW A;  3SWY A;  2BPH A;  5CCG C;  1KIL A;  1FOS F;  1JO5 A;  5AVU B;  1UKM B;  1J1E C;  3KYQ A;  2ZWK A;  4M3L A;  1LTB C;  3M0D A;  2J59 M;  2R3C A;  2WSC H;  1KIL C;  5APU A;  3HTK A;  4JYC A;  3TK1 A;  5AVV B;  4N33 A;  3M0D C;  5FFS A;  1X2W B;  2HLO A;  1KWZ A;  1JCD A;  2NPS B;  1LWU B;  1JUN A;  1WMY A;  1L4A B;  3HUS C;  1LTJ A;  1T2K C;  4W80 A;  3M9Z A;  1FZC A;  4PP8 A;  1G1S A;  2H8P D;  1ZR4 A;  3K7B A;  1FJP A;  3CLQ A;  5APX A;  2HPC A;  1AFO A;  4CAJ A;  1FZA A;  4WBA A;  4WY4 A;  1FZC C;  1IXX B;  1AFD 1;  1IOD B;  3B5N A;  3GPR D;  1Z56 A;  3TNU A;  3IKP A;  1SFC B;  4HYT B;  4WY4 C;  3G8L A;  1HTL C;  1SB2 B;  2I1J A;  2QM7 A;  3B5N C;  4N78 D;  2BRS A;  1MUQ A;  1JWI A;  4N38 A;  4Y99 B;  4W7Z A;  3A2A A;  1IC2 A;  1KFN A;  1FM5 A;  3NCW A;  3P5D A;  1AFB 1;  4N78 E;  1HWT C;  2IPP A;  3ALU A;  1J34 A;  1G2C B;  1QL2 A;  1G1R A;  3BX4 B;  2M8R A;  1EQ7 A;  2N1T B;  3V2R A;  1L4A D;  3VN0 A;  2WT7 B;  4KI1 E;  1M1J A;  1JY3 P;  3VMY A;  1L0L K;  2BAS A;  3HE5 B;  3M06 A;  1KG0 C;  1YPU A;  1UOS A;  2POH A;  5K8Y A;  5AVQ B;  4IFD K;  4WQQ A;  4GI0 A;  2WZ7 A;  2GM4 A;  2C6U A;  3IR9 A;  2Q5U A;  4WRC A;  3HD7 D;  3KDP B;  4WR9 A;  3M0A A;  1LT9 B;  3NCX A;  4J6L A;  3T3A A;  1KZU B;  1ZV8 A;  1U0O A;  2A45 H;  2E43 A;  2KP8 A;  3P7F A;  2I83 A;  1V7P A;  1DH3 A;  1YPO A;  4IOP B;  1N86 A;  5APT A;  1GZL A;  5KTH A;  2FFD A;  5AW1 B;  1BCH 1;  2RIB A;  2VRP B;  4QKG A;  2YKP A;  1ZLL A;  3I5C A;  4JYB A;  3L9J C;  4C7R A;  1CWV A;  3RL0 B;  3G84 A;  1OWA A;  4XA4 A;  3CCK A;  5APS A;  1HGV A;  3PP5 A;  4ZKU A;  3SWF A;  5CCH D;  2HFE D;  1GU5 A;  2FFD C;  4M1G A;  1DY0 A;  3NFQ A;  3VP9 A;  4EZM G;  2VUV A;  5AW8 B;  3PAQ A;  1GW4 A;  2XDJ A;  1X2T A;  2O1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...