3KQGA

Trimeric structure of langerin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
169
structure length
169
Chain Sequence
SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric structure of langerin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords C-type lectin domain family 4 member K
total genus 54
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kqgA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3kqgA02
3P7GA 3FD4A 2C9LY 1G1QA 1J35B 3CDGE 5APXA 1HWTC 2WTYA 3WBPA 1MUUA 4WUXA 3HE4B 4QKHA 4J6QA 4C7NA 1XPHA 3HE5B 4HYTB 1IO4A 1P4LD 4WUWA 1SL5A 2ZWKA 4AYCA 1YPQA 2H2RA 3HUPA 3A3YB 1K9IA 3BX4A 3P7FA 4ZRWA 2W27A 3MD0A 1T2KD 1X2TA 4N38A 1U0OA 3V4QA 5J6GG 4LU5A 3FF7C 1H88A 2IPPA 2R5DA 5AW6B 2RIAA 2R5BA 3LIEA 3PAQA 1B6EA 1J34B 1JNMA 1OZ7A 1MV8A 1XARA 1CI6B 3VMYA 3UBUA 4N34A 3G8KA 1FVUA 5AW0B 1KWXA 3CFWA 3M0AA 3VMXA 1KZE1 3HE4A 1SL4A 2AFPA 2ZIBA 5F2QA 2OS9A 5AW8B 3DBZA 2ZFCA 2N40A 1X2WA 1UKMA 4UXMA 2QM8A 4JYBA 1KX0A 1GTWA 1FOSE 4CSYA 2WT7B 5AVUB 4ZRVA 2P7JA 1OWAA 3I5CA 1S9KD 3IR9A 1AFA1 4WCOA 4EOTA 1DV8A 5M62A 3O8ZA 3VYIA 3A5TA 5APWA 1PW9A 1G1TA 4G9AA 4WRCA 2C9NY 1KWUA 5K8YA 1ESLA 3K7BA 3WWKB 2OX8A 1U0NC 4WREA 2YO3A 1SL6A 3RS1A 1OXZA 2VUZA 5AVRB 1HYRA 2JJLA 3NXSA 1GZ2A 4IOPB 3M0DA 1RDN1 4J6JA 1J34A 1WMZA 1NWQA 2YNYA 2BPHA 3BDWA 5AW5B 4GKOG 4MTHA 4N37A 4PP8A 1BJ3A 3WBRA 2XR5A 1CSBA 4WRFA 1U0OB 3VYKA 1E8IA 4B86A 4N32A 3NMDA 3BX4B 1MFZA 3VLGA 5AVVB 1H8AA 5AVZB 5B1XA 1RDI1 1BV4A 5AW9B 5AVYB 5AVWB 3ALUA 3P5IA 2VRSA 4GJXA 5KTIA 3GPRA 1PWBA 1KQLA 1KWZA 2MSBA 3G84A 1UEXA 3M9BA 1TN3A 5APYA 1C3AA 4M18A 1UOSA 1KCGA 4M1GA 2E43A 5APQA 2BPEA 2XZRA 2E3XB 1AFB1 3SWFA 2KMB1 1SLQA 2RIBA 2R32A 4AK8A 2E3XC 2Q3IA 1UKMB 3PAKA 3WWKA 1RDJ1 1YPUA 2GGUA 5LGKE 3L35A 3KMB1 2RIEA 1V7PA 3IKNA 3WHDA 1HUCA 3HTKA 1FM5A 3KQGA 3CCKA 2M94A 1G1SA 2OX9A 2VRPA 4QKGA 2WT7A 4GK1A 2PF5A 1C3AB 5APSA 2GO0A 4PDCA 1QO3C 3M9ZA 1H89A 1A02F 3P7HA 1JUNA 1E87A 1KMB1 1V4LB 4UWWA 3TYYA 2C6UA 3LIDA 2ORKA 2BPDA 2E42A 2BASA 1TLGA 3L37A 4GI0A 1KX1A 1GK4A 5AVSB 1UOSB 3WH2A 2PY2A 1IODB 4DZOA 2CL8A 3L9JC 3BDWB 2W6AA 4C46A 4JYCA 2MTIA 1X2TB 4WR9A 1E5UI 1HBWA 4ZETA 1FOSF 3P5DA 1R14A 3A2AA 1R13A 3P5FA 1CI6A 5FFRA 4J6PA 1CWVA 1GD2E 1IJKB 3C8JA 1V4LA 1KZD1 1BCJ1 1RTM1 4KZVA 5CMZA 3NTNA 1BUUA 2WWWA 2GGXA 1F00I 1RDK1 4YMDA 4E52A 1O7BT 3G8LA 1GU4A 5AW1B 1WT9A 4KMB1 4RESB 4G96A 1NAFA 3P5HA 3WSRA 1IXXA 1Y17B 1HUPA 3C22A 3IKQA 2XU6A 3UBUB 4C9FA 3OAKA 3GPRC 1BJ3B 1H8UA 5B1WA 4GKGA 1KWVA 1KWTA 1IODA 1DY0A 3GPRB 3M06A 3C8KD 3NCXA 1JZNA 1LITA 3NFQA 1YTTA 1FVUB 1F02I 4I6MC 1GU5A 4M17A 3ZHGD 5AW4B 1RDO1 1J2JB 1EGGA 1KZB1 2LS8A 1OZ7B 1EGIA 3G81A 4GT1A 2I83A 3PARA 4M3LA 5APVA 4QKJA 1YPOA 1FIHA 2YHFA 5AW3B 4ZESA 1JWIB 5KTHA 4J6KA 2XV5A 2Q5UA 4C16A 3NCWA 3VN0A 4N33A 4LC1A 2RIDA 3V4WA 1QDDA 1SB2B 3T97A 2WPQA 3CDGF 1X8YA 1Y17A 3HE5A 5AVQB 1GK6A 3B8EB 2ZXEB 1P1ZD 1T2KC 1RDL1 1T8CA 2Z5HA 1RDM1 1J35A 1YYCA 1HTNA 4YLIA 3IKPA 3KDPB 1S9KE 1RJHA 1BNLA 3WWKC 2R3CA 3T3AA 2Z5IA 3M91A 2WPSA 5AW7B 3VYJA 4J6MA 2KP8A 1DY1A 4XE5B 2WPRA 2Q7CA 4AQRD 1BYFA 3ALTA 4N35A 5B1RA 1TDQB 4J6LA 2RICA 5AVXB 1K9JA 1SP4A 2N9BA 1KOEA 3VMZA 1IJKC 4LQFA 4C7NB 1UEXB 1V7PB 2BRSA 3FF8C 1MSBA 1X2WB 2YO2A 2KV3A 4CAJA 3L36A 1AFD1 4GJ0A 1B08A 2IT6A 2XR6A 1KZC1 4KI1E 5AW2B 5APTA 2VRPB 4IOPA 1FIFA 1UMRC 1JA3A 3G83A 4N36A 5APUA 4KHXA 1DH3A 1WT9B 1WMYA 1FAVA 2QM7A 3M9HA 4I2LC 1G1RA 2VUVA 1MUQA 1UV0A 3P7KA 2P67A 1KZA1 3VTPC 1HJBA 5FFTA 1WK1A 3TK1A 1DY2A 5FFSA 3ALSA 3A7OA 1T8DA 1YXJA 2ORJA 4EZMG 1KG0C 3TNUA 3TNUB 1U0NB 1IXXB 4AUWA 2H7HA 1SB2A 3GPRD 3P5EA 1GZLA 3IKRA 3WBQA 1YXKA 2H2TB 3UIAA 3CADA 1KWYA 1UMRA 4KZWA 4WQQA 3P5GA 3MGNA 2P2UA 1BCH1 1JWIA 3V5BA 5AVTB 3P8MC 1A02J 4DN8A 3WH3A 3ZHGA 2IT5A 1O7CT 1KWWA 4S0UA 3PBFA 4J6NA 1CZQA 4QKIA 1HQ8A 1G2CB 2ZQKA 3VPPA 3FF9A 1MPUA 3P32A
chains in the Genus database with same CATH superfamily
2C9LY 5B5EH 1G1QA 1J35B 1RY3A 4EYYQ 1SQPG 3FWLA 1CW5A 4HYTB 1RF0A 4AYCA 5KLVD 4UB8H 3BX4A 3MD0A 3RL0C 4N38A 4LU5A 2QJKC 5B66H 1NJIQ 1OMIA 2IPPA 3L71D 3PAQA 2E76D 4UB8E 3L73J 2PGDA 1W2EA 3FWNA 3UBUA 1VF5C 1JTHA 2QJYC 1FZFA 2HG5D 3L74D 2AFPA 2ZYAA 1NU1J 2FYUK 3L4FA 3WMM0 1KC8Q 1NOHA 3G9RA 1KB9D 3C1LA 1P84E 3RK3E 2KS1A 3AEAC 4CSYA 1X9VA 3BRVB 1VQ5P 4BRYA 4K3AA 2IYPA 1L0LJ 1KV4A 3D6YA 2LXBA 1UIIA 2A45I 4ASWA 3AE1C 4EOTA 3GMAA 4O9BA 3LW5J 5M62A 3VYIA 3CMEP 2D2CB 1G1TA 1PW9A 3L75D 1ESLA 3II6A 3A0BE 5AVRB 2JJLA 3H32A 1JY2O 1PGQA 1RDN1 1LTJB 1OVRA 4JPZB 4NPEA 4GKOG 4MTHA 3AEDC 3GF7A 1VF5B 1SQVE 1IC2A 3CCUP 3HD7A 5TJHA 5AVZB 2W90A 3G3ZA 5AVWB 3ALUA 1S5LX 1KORA 4KJMA 1HJ0A 3GPRA 5GTIH 1SQPE 1VQ7P 1SQXD 1C3AA 1UOSA 4M1GA 1LTGC 2E3XB 2KMB1 3ITKA 3IAOA 1SQQD 3P8CE 3HD7B 3TF5A 2Q3EA 4PD4I 5M1BA 3WWKA 2O1JA 5LGKE 2I8DA 1GL2B 4ZKUA 2AEMA 1FM5A 3KQGA 3CCKA 4DT0A 3KXDA 3CCMP 3S1KA 2VRPA 4QKGA 1XTGB 3JC22 3CC7P 1T3JA 3RGUA 1FJKA 4YPCA 2GO0A 3BRTB 3CCQP 4PDCA 1NU1K 3W68A 2WVRA 4YXDC 4H0LB 1KMB1 1V4LB 3BVHA 1LWUA 5E79H 1JY3O 2O1KA 1NTZJ 1SQBJ 1D7MA 1LTSC 1KYOI 2WSEH 2BASA 2WSSH 4GI0A 2IFMA 1JY3N 2PY2A 1IODB 1M1JA 4DZOA 1FZAA 2IDBA 3BDWB 2IBZI 4C46A 4JYCA 1X2TB 2KYVA 1FOSF 3M0DC 3A2AA 1L0LG 4N3YB 2KSEA 3HUSB 5FFRA 1PZQA 1IJKB 3C8JA 2IZ1A 1V4LA 1BCJ1 1OW8A 1DX7A 3H6PA 1UIXA 1HGZA 1SQXG 1PPJD 2WSFJ 1PP9G 1GL2C 3GLMA 4E52A 3G8LA 2GA1A 1J1DC 1RE4A 3Q2YA 1HUPA 2XU6A 4C9FA 3OAKA 3L75E 5KAFH 1HVVA 5B1WA 4GKGA 1L4AC 4OWFA 1DY0A 1L4AA 4WVZA 1LITA 3NFQA 1YTTA 4OVNF 1EZVD 4I6MC 2E74C 3AE8C 4M17A 1J2JB 1FZCB 4BXLA 1OZ7B 3MTUE 3E1RA 3PARA 3EQ2A 1KYOE 1FIHA 3L74J 1KYOD 3GF3A 2AEFA 2I1JA 3O6QB 4R4LA 1ZP0C 2Q5UA 4NPFX 3FGAD 2RIDA 3V4WA 1EC5A 2HPCB 1JMMA 3IN6A 2E76B 1PPJE 1X8YA 3SWKA 1GL2D 2QSIA 1LT9B 3L70J 4JQ0D 1RE3C 1KQSO 3B8EB 1P1ZD 1NAYA 1VQPP 2IFNA 2KNCB 1RDL1 1EDLA 3JCUH 3USSA 5CCHD 3IKPA 3KDPB 1RJHA 1NTMG 2R3CA 2WSCJ 1X79B 3P8CD 3QWOC 2WPSA 1KILC 3VOPA 1LTAC 1BYFA 3ALTA 1L4AD 1TDQB 4J6LA 4PV1B 1KOEA 1IJKC 1M1JC 1N7LA 1M8OB 3H1JD 2E74D 1X2WB 2KV3A 1G1JA 1OZHA 1AFD1 2IT6A 4LGDE 1BCCJ 1SQPJ 2OGUA 5H2FH 4IOPA 2V4HA 3G83A 2QG4A 5KAIE 5BU5A 4I7ZC 3A0BH 4KHXA 3E7KA 1DH3A 1WMYA 1G1RA 3P7KA 2A45H 1KZA1 3VTPC 1QL2A 3EFGA 3EFFK 2H88C 2Y9ZA 2ORJA 1JOCA 4EZMG 3I55P 1IZNB 3RL0B 3AE3C 5KLIB 1U0NB 1ZMEC 1YTZI 2R3SA 1GZLA 2WSEJ 3IKRA 3UIAA 1U57A 1NTZK 1SQBK 1KWYA 2QJPB 2UWJE 3L74G 3AE2C 2P2UA 1R5LA 5AVTB 4ZNCA 1KB9H 1KWWA 1FDIA 3B71A 3PLNA 5B5EE 3U1CA 1N86A 3CCJP 1SQVJ 4U3FG 3N4XA 2QIWA 3VPPA 2KZJA 3CI9A 1JMBA 3FD4A 1GDTA 4D6TD 3H1JJ 1NTKG 4WUXA 1AFOA 2Y9YA 4C7NA 2ZYGA 3HE5B 3LW5H 1S4XA 1IO4A 2ZWKA 4Y99B 3KZIH 1VQ4P 1OW6A 3HUPA 2QE7H 2CPSA 1K9IA 1NH4A 1T2KD 4HB1A 1U0OA 3ABVC 2NPSB 1HGVA 1SQQG 4GDOA 2OYHA 4PV1C 3PRJA 1JNMA 3MUDA 1MV8A 1QEXA 2HR3A 1LT9A 3H1KG 2YXRB 3CC4P 1KWXA 3M0AA 3VMXA 3HTKB 5E79E 1SL4A 2ZIBA 4WBAA 2PRRA 3W67A 2KSJA 4H0LC 5AW8B 3L70G 1NU1G 2ZFCA 2N40A 1EDIA 2QM8A 2JO1A 1GTWA 3GG2A 3V2QA 2P7JA 3CWBG 1IK9A 1VF5D 1Z56A 2AXTH 3PHLA 3KPEA 4WCOA 1DV8A 3A5TA 4G9AA 1PGPA 2HFED 4IOIH 5KLVE 3AEGC 4H13B 4WRCA 3K7BA 1ZW0A 2YMYA 4WY4B 5KAIH 3JSVC 4WREA 1BE3J 3TGUJ 1YHQP 1HYRA 3NXSA 3CCVP 1GZ2A 1LTBC 2BCCJ 5KLVG 3BCCD 1WMZA 1NWQA 2OYHB 2C0XA 3BDWA 5AW5B 2GM4A 1BJ3A 1FZGA 2XR5A 1CSBA 4WRFA 1U0OB 1OX3A 3VLGA 2OYIB 1LGHB 4PD4H 1RQUA 1PP9J 5AW9B 3MP7B 4UB6H 2AXCA 2RN0A 3CX5I 2JR8A 3L70D 3PJSK 4IFMA 5KTIA 2RH0A 4W7YA 1KWZA 1PGJA 3M9BA 1TN3A 2Q1KA 2E75C 4M18A 1KCGA 2W6BA 2E43A 3CX5D 2XZRA 2OYIA 3SWFA 1SLQA 3V2RA 4N6JA 2Q3IA 2WZ7A 3RL0D 5GTHE 1UKMB 3PAKA 1RDJ1 4BWNA 1KILA 4ZMDA 1HF9A 2KI7B 3L35A 1EXJA 1YBKA 3KMB1 2E76C 2CK3H 1QX8A 3WHDA 3JCUE 2M94A 3AE9C 3HUSA 2V7QJ 2OX9A 3GHGA 3H1LD 1DIPA 2PF5A 1C3AB 2ZJSE 1Y47A 2FYUG 3M9ZA 1H89A 1A02F 3P7HA 1JUNA 1Q82Q 2JWDA 4CPGA 1NTMK 1FDMA 3K5BA 4C7RA 2W6JH 4OH8B 2ORKA 2N1TC 1JY2N 1NU1E 4OGQB 1WT6A 2QRXA 1GL2A 1KX1A 1DD3A 1GK4A 3B5NC 4LLHA 3C8VA 4EDFA 3L71J 2CL8A 4IL6E 2WQYC 3CCSP 2YIUB 3MHVA 1QLED 1HBWA 2N9YB 1MFTA 1R13A 2HODB 1SQVD 1KZD1 2YKPA 1RF1B 4KZVA 2N1TD 2WWWA 1PP9E 4YTPC 1BGYE 3CXHD 1O7BT 1QVGO 1NAFA 3P5HA 1P84I 3L71G 3IKQA 4RJTA 3H1LJ 1ZRTE 3RK3B 1DEBA 3SFDC 4TT3H 3L75J 1IODA 1YQ3C 4Y28J 3G71P 1YJ9P 1JZNA 1JO5A 2O3JA 1RF1A 1Q90D 1RE3A 1NO4A 1FVUB 2Z4EA 1GU5A 3CWBD 1RDO1 2R44A 1EGGA 1KZB1 4Y99C 2LS8A 2I83A 4ZESA 2ZAEB 2QJPC 4DOJA 3MUDC 5EFWB 5KTBA 2Q9IA 4N33A 3CD6P 1LTJC 1L0NJ 2WPVB 1E79H 2WPQA 3CDGF 1WMKA 2KIKA 2PAJA 5AVQB 1KN7A 1PL5A 5CJ0A 2Z5HA 1IFMA 1J35A 3OW2O 2WSCH 2J58A 1VQNP 1BNLA 3WWKC 3AEFC 2Z5IA 5AW7B 2MJZA 2L5GB 1SQQK 3VYJA 1JTHB 2KP8A 3AEBC 4XE5B 1BGYJ 5B1RA 2ZXXA 3H1LE 1VL2A 3KYQA 1PV3A 4H13C 4HJGH 2Y0EA 1UEXB 2BRSA 3BCCG 2C0WA 2YO2A 4CAJA 3VP8A 2FFDB 3L36A 4HKZH 1ZLLA 1B08A 4KI1E 5APTA 2VRPB 1FIFA 1K04A 4WY4D 4N36A 1EZVG 5APUA 4ZKPA 3WU2E 1SQXK 1WT9B 1FZBA 3M9HA 1UV0A 1T3UA 2I1KA 3CLQA 1FZEA 1WK1A 3TK1A 1DY2A 5FFSA 3BASA 1LP1B 1XTCC 4GOEA 3V6IA 3H1HD 4DCKA 3ALSA 1Q2NA 3H32B 1USDA 1YQ4C 3F5HA 2K9YA 3KZIE 3TNUB 2H43A 1IXXB 2B88A 3GPRD 4U3FD 4WWIA 2LKMA 1YXKA 2H2TB 3CADA 5KLVK 4WQQA 1MZ9A 3P5GA 1N73B 5B66E 1BCH1 1JWIA 1VPCA 2OYIC 4DN8A 3WH3A 1NTME 4S0UA 1PFIA 4J6NA 4TLFA 1CZQA 1PGOA 3U59A 3PH0A 2L91A 1KMIZ 2KUBA 5CBNA 2QVAA 1LTIC 1L0NG 1SFCC 2HYNA 2OYHC 1MPUA 1L4AB 4PD4D 2FYUD 3CDGE 2SPZA 1AQ5A 3O6QA 3RBXA 2WTYA 3WBPA 1MUUA 1LTJA 4EIJA 2GUSA 3HE4B 1SQXE 3Q5RA 1M56D 1P4LD 3CXHI 1SL5A 3T97B 1YPQA 1L0LE 2H2RA 1OVUA 1KD1Q 2E75B 3AE4C 3CCEP 1N8RQ 2JKVA 2OARA 4ZRWA 3VP9A 5CCHC 5J6GG 1PIXA 4R4MA 1H88A 5AW6B 2R5DA 2RIAA 1IK7A 1K73Q 2FYZA 3H25A 1OVVA 1B6EA 1KILD 1ZOYC 3D6ZA 2OYOA 3CPWO 1CI6B 3GHGB 2OQQA 3H1LG 3H1HJ 3S9OA 3G8KA 1FVUA 1KFMA 2D2CD 5AW0B 3CFWA 1U7MA 1KZE1 3HE4A 1SQVG 4U3FJ 2OS9A 3CX5E 3SSUA 3HRNA 1G1IA 3DBZA 3RL0g 3RK3C 2IYOA 3H1IJ 3AECC 2KXPB 2E5YA 1UKMA 1L2PA 1KX0A 3WUVA 5CJ4A 3M9QA 4PD4E 5AVUB 1JY3P 1VQMP 3IR9A 4RKUJ 1AFA1 3B5ND 2OTLP 3H1KD 3L72D 2YKQA 3I56P 1M1JB 2FXMA 3FX0A 3F89A 1HTLC 2OX8A 1IFDA 1P84D 3RS1A 1ZV8A 3KHUA 1RHZB 2VUZA 4I7ZB 2K9JB 1Q81Q 4IOPB 3M0DA 2P10A 4XA4A 3CCRP 3N7NA 2V7QH 1GW3A 3WUUA 3U1AA 3WBRA 1JM0A 3VYKA 1E8IA 4B86A 4OGQC 1NTZD 1SQBD 3R2PA 3NMDA 3BX4B 1G2CA 5AVVB 3TSIA 5B1XA 1FU1A 3L73D 2ZT9B 1RDI1 2J5UA 1L0ND 5AVYB 1YJWP 2FFDC 1YI2P 4GJXA 2FFDA 1FJPA 5KJ7C 3L72G 4I1LA 4L73A 1PWBA 2MSBA 3HUSC 1UEXA 4XFJA 1FZCC 1IFIA 2H89C 1FZCA 3B5NB 2BPEA 3HD7D 3CC2P 2BEQD 1BGYD 3CXHE 4QMAA 2E3XC 5CCHA 2KLVA 2G3AA 1YPUA 2KK7A 1TU3F 2XNXA 2KOGA 1AJYA 3AE5C 4PV1D 2RIEA 3L72J 3GW6A 1V7PA 4HH2A 3HTKA 3RK2B 2OTKE 4DJGA 3FXDA 2WT7A 4GK1A 2IZ0A 5APSA 4D6TJ 1KB9I 4PJ0E 2QA4P 1J1EC 1QO3C 2QEXP 1KILB 2Q6QA 3BATA 2IBZE 3PTZA 1GW4A 2G8YA 1KZUB 4UWWA 1AQTA 4BRYB 3L75G 5BVZA 3TYYA 3LIDA 1JCCA 2E42A 1IFPA 2BPDA 1KQFB 1TLGA 1LT9C 2FKWB 3WH2A 2NPSA 2BCCE 3L9JC 3TGUE 4WR9A 1E5UI 1SFCD 1X22A 2Y0DA 4ZETA 3P5DA 1R14A 1K8AQ 4A7PA 1NGMB 2W83C 5CBOA 1CI6A 4L74A 5KLIC 1CWVA 4J6PA 2O01H 1GD2E 5CMZA 1AV1A 3NTNA 4PJ0H 1BUUA 2YMKA 2GGXA 1NKNA 1URQA 5GTIE 1R5SA 4KMB1 3C9IA 4RESB 4G96A 3RK3D 3WSRA 3H1KE 1SVFA 1KQGB 3C22A 2O01N 3UBUB 5KJ7A 3GPRC 1NYHA 3CXHH 4WY4A 1KILE 2WITA 1BJ3B 1H8UA 1U7JA 1LT1A 1BCCG 1KWVA 2K88A 1KWTA 3NCXA 2E75D 1KYOH 1OFCX 2FXOA 2N1TB 4YXWH 5KKZC 1OW7A 3G81A 1BSNA 4GT1A 4QKJA 5APVA 1YTZT 2XKMA 1L0NK 4RO0A 3VMAA 1JWIB 1VQ8P 1N7SB 2XV5A 2LXCB 3NCWA 3VN0A 4LC1A 1SQPK 5H2FE 2E74B 1Y17A 1M7LA 4IL6X 3HE5A 1GK6A 2NZ2A 4L75A 2A06E 2ZXEB 1T8CA 1YYCA 4YLIA 1S9KE 3T3AA 2ZT9D 2ZYDA 3M91A 5DJTB 3SWYA 2QJKB 2M5AA 4J6MA 2K9JA 4N35A 2WPRA 4AQRD 1M90Q 3L71E 2RICA 1K9JA 1SP4A 3L74E 4C7NB 3BCCE 1V7PB 1K05A 3FF8C 4H44C 2M0BA 3IF4A 3D71A 3TDKA 4N78E 2IBZD 1KZC1 5AW2B 3CL3D 1UMRC 1JA3A 4WB4A 1IJDB 2BCCG 2CPBA 3AE6C 3TGUG 1FC2C 1NTKE 1FDOA 2AEJA 1PPJG 3IFMA 2QM7A 2VUVA 3HD7C 1YITP 3S4RA 1N7SA 2P67A 1HJBA 3AEEC 1QGKB 1LNQA 1T8DA 1YXJA 1M57D 1SQXJ 1KG0C 1J1EB 3Q5PA 1AA0A 4AUWA 1GMJA 1WRGA 4WY4C 1SB2A 1RH5B 1ZR2A 1URQB 4KZWA 3MGNA 1H0TB 3V5BA 1A02J 2KLUA 3ZHGA 2IT5A 2WSFH 2DW3A 3PBFA 4QKIA 1HQ8A 4GODA 1Q7YQ 5DJUB 1KB9E 2JDIH 3FF9A 3P7GA 2P1JA 5KJ7D 5APXA 1HWTC 1S1CX 2PP6A 1Y9BA 4J6QA 4QKHA 1URQD 1XPHA 3L73E 4WUWA 4IFFA 1RF1C 2BCCD 1BCCD 4UB6E 1QVFO 3A3YB 2AXTE 3P7FA 3EWKA 2JEEA 2W27A 4MN4C 1X2TA 3V4QA 4Z1MH 3FF7C 1T8ZA 2R5BA 1FE6A 1BGYG 3LIEA 1J34B 3CWBJ 1VQOP 1OZ7A 1XARA 2M3EA 3R4YA 1USEA 3VMYA 2KZIA 1PP9D 4N34A 2HPCA 1JCDA 1FBMA 2A06D 3H1IG 3GHGC 5F2QA 2JWAA 2KNCA 1X2WA 4UXMA 4JYBA 1HH0A 3H1HG 3H1IE 1FOSE 2P58A 3CX5H 5CCGC 2WT7B 2XDJA 4U7JA 1JY2P 4ZRVA 5CCGA 1OWAA 3I5CA 1S9KD 2N1TA 2D2CC 1N7SC 3RBZA 1URQC 3RK2C 3O8ZA 5APWA 5K5GB 2C9NY 1KWUA 5K8YA 3WWKB 4EI2A 1U0NC 3G4SP 2YO3A 1SL6A 3A0HH 1OXZA 1L0LK 1RQVA 1K9MQ 3H1JG 4J6JA 1J34A 2YNYA 2O01J 2BPHA 1DEEG 1IFJA 4N37A 1LTTC 4PP8A 4N32A 2E5TA 1X0TA 3G6EP 1MFZA 2ITAA 1T6AA 2K3RA 3H1JE 1H8AA 1NHLA 1S5LH 3CMAP 2FYUE 1BV4A 2RKLA 2ZT9C 1LWUB 1AVOA 3P5IA 2VRSA 3MZWB 1LP1A 5CCGD 3MIWA 5CHXA 1NTMJ 1KQLA 4NPDA 3G84A 5APYA 2WMMA 1N7SD 1Q86Q 5APQA 3Q3DA 3AE7C 1AFB1 1NVOA 2RIBA 2QJYB 2R32A 4AK8A 1W5CE 1Y8AA 1EZVE 4N78D 1R8EA 2GGUA 3L73G 1EXIA 1EQ7A 3IKNA 5TISE 1HUCA 3PP5A 5GTHH 1J1DB 2K37A 1G1SA 1M1KQ 2H8PD 1SQPD 1KTMA 3TGUD 2HLOA 1SQVK 1YIJP 4L76A 1RF0C 4D6TG 3BCCJ 4H0LD 3V2PA 3E1IA 2IBZG 1L0NE 2YIUC 3OA7A 1E87A 3H1HE 1YJNP 5KLVJ 1SS1A 2B87A 4D6TE 2C6UA 3CCLP 3A0HE 3B5NA 3L37A 4H13D 5AVSB 1UOSB 1OIPA 2A45G 1FS0E 1BDDA 4H44D 1SFCB 3L72E 2W6AA 1JEKA 2FY8A 2MTIA 1NTMD 4H44B 5TISH 2HODA 4W80A 3P5FA 1LJ2A 1LWUC 2M5AB 1RTM1 2M8RA 1BSHA 1F00I 1RDK1 4YMDA 1SQQE 2M3BA 1GU4A 1MKMA 5AW1B 5KAFE 1WT9A 1KFNA 1NTZE 1SQBE 1VQKP 1IXXA 1Y17B 1ZXGA 4GIFA 3V2NA 3WU2H 1N2DC 2W8ZA 2OTJP 2POHA 3H1KJ 2B89A 3L70E 1NTZG 1SQBG 1S2EA 1EDKA 1E5WA 3GPRB 1S5LE 3M06A 3C8KD 1N73C 1BE3G 4JBZA 5C39A 3ZDMA 1NTKD 1VQLP 1F02I 1QL1A 2J59M 3ZHGD 5AW4B 3FXEA 1AVYA 3Q5SA 1EGIA 3B4SA 1ZN5A 4M3LA 1S72P 1YPOA 2YHFA 3D70A 1RE4C 5AW3B 1BDCA 1SFCA 5KTHA 4J6KA 4C16A 5L8RJ 2FXPA 1NTKK 1IFNA 2PFXA 1QDDA 1SB2B 2KB7P 3T97A 2LR2A 2B87B 4IFDK 4K35A 2ZVOB 3OJAB 1T2KC 2MKVA 1RDM1 1HTNA 2ZVNB 1H0TA 2XNDH 2NRGA 1ZR4A 2IX7C 2JP3A 1DY1A 2Q7CA 1SQQJ 1BE3D 5AVXB 1P84H 2N9BA 3VMZA 2KS1B 4LQFA 2FYUJ 1EDJA 1MSBA 4GOFA 1BCCE 4ASVA 4GJ0A 2XR6A 4W7ZA 1S3JA 2FYNC 2YKOA 1NTKJ 4IL6H 2BEZF 1FAVA 4I2LC 2YXQB 3RK2D 1MUQA 1VQ6P 5BU8B 5FFTA 2NPSC 3A7OA 2FYNB 3TNUA 2H7HA 1EZVI 1NU1D 3P5EA 3WBQA 3QH9A 1ZRTD 1DD4A 2GUVA 3Q1MA 1UMRA 2A06G 3H1ID 3WUTA 1N73A 3P8MC 2B9BA 4OGQD 1BE3E 4KT0J 1NKZB 1VQ9P 5KKZB 3SFEC 1VDFA 1O7CT 2Y0CA 3CWBE 2K1AA 1L0LD 2NPSD 1G2CB 1JB0J 1W2BO 2ZQKA 4U3FE 2RMZA 4JF7A 2FBWC 3P32A
chains in the Genus database with same CATH topology
3P7GA 2P1JA 3FD4A 2C9LY 1G1QA 1J35B 1GDTA 3CDGE 1AQ5A 5KJ7D 5APXA 1RY3A 1HWTC 2WTYA 3WBPA 1MUUA 1LTJA 4EIJA 1AFOA 2GUSA 4WUXA 2PP6A 3HE4B 4QKHA 4J6QA 4C7NA 1URQD 3HE5B 1XPHA 3LW5H 1CW5A 4HYTB 1IO4A 1P4LD 4WUWA 1SL5A 2ZWKA 1RF0A 4IFFA 4Y99B 4AYCA 1RF1C 1YPQA 2H2RA 3HUPA 2CPSA 3A3YB 1K9IA 3BX4A 2OARA 3P7FA 1NH4A 2JEEA 4ZRWA 2W27A 3MD0A 1T2KD 3RL0C 1X2TA 4N38A 1U0OA 3VP9A 3V4QA 5CCHC 5J6GG 4LU5A 3FF7C 1T8ZA 1H88A 2IPPA 2R5DA 2NPSB 5AW6B 2RIAA 2R5BA 1HGVA 2FYZA 3LIEA 2OYHA 3PAQA 1B6EA 1KILD 1J34B 1JNMA 1W2EA 3MUDA 1MV8A 1OZ7A 1XARA 1LT9A 1CI6B 3GHGB 3VMYA 3UBUA 4N34A 3G8KA 1JTHA 1FVUA 1KFMA 5AW0B 1FZFA 1KWXA 2HG5D 3M0AA 2HPCA 3VMXA 3HTKB 1JCDA 1FBMA 3CFWA 1KZE1 3HE4A 1SL4A 2AFPA 2ZIBA 3GHGC 5F2QA 4WBAA 2OS9A 2KSJA 5AW8B 2FYUK 3HRNA 1G1IA 3DBZA 3RK3C 2ZFCA 3L4FA 3WMM0 2N40A 1X2WA 1NOHA 1UKMA 4UXMA 2QM8A 4JYBA 1HH0A 1KX0A 1GTWA 5CJ4A 1FOSE 4CSYA 3M9QA 5CCGC 5AVUB 3V2QA 2WT7B 2XDJA 1X9VA 3BRVB 1JY2P 2P7JA 4ZRVA 5CCGA 1IK9A 1OWAA 3I5CA 1S9KD 1Z56A 2N1TA 1JY3P 3KPEA 3IR9A 1AFA1 1N7SC 4WCOA 1URQC 3RK2C 2A45I 3B5ND 4EOTA 1DV8A 4O9BA 5M62A 3O8ZA 3VYIA 3A5TA 5APWA 2YKQA 1PW9A 1G1TA 2HFED 4G9AA 1M1JB 2FXMA 4WRCA 2C9NY 1KWUA 5K8YA 1ESLA 3K7BA 3WWKB 2YMYA 4WY4B 1HTLC 2OX8A 1IFDA 1U0NC 4WREA 3II6A 2YO3A 1SL6A 3RS1A 1OXZA 1ZV8A 1UV0A 5AVRB 2VUZA 1HYRA 2JJLA 3NXSA 1L0LK 3H32A 1GZ2A 4IOPB 1JY2O 3M0DA 1LTBC 1RDN1 4J6JA 1LTJB 1J34A 1WMZA 1NWQA 2OYHB 4XA4A 2YNYA 2C0XA 3N7NA 2BPHA 3BDWA 1GW3A 1IFJA 5AW5B 4GKOG 4MTHA 3U1AA 4N37A 1LTTC 4PP8A 2GM4A 1BJ3A 3WBRA 1FZGA 2XR5A 1CSBA 4WRFA 1U0OB 3VYKA 1E8IA 4B86A 4N32A 1IC2A 3HD7A 3R2PA 3NMDA 3BX4B 1MFZA 1G2CA 3VLGA 5AVVB 1H8AA 3TSIA 5AVZB 1NHLA 2OYIB 1FU1A 1LGHB 5B1XA 1RDI1 1BV4A 3G3ZA 5AW9B 5AVYB 5AVWB 1LWUB 3ALUA 3P5IA 2FFDC 2VRSA 4GJXA 2FFDA 1FJPA 5KJ7C 5KTIA 4IFMA 3GPRA 5CCGD 4I1LA 1PWBA 3MIWA 5CHXA 4W7YA 1KQLA 3HUSC 1KWZA 2MSBA 3G84A 1UEXA 3M9BA 1TN3A 5APYA 1C3AA 4M18A 1UOSA 1FZCC 1N7SD 1KCGA 4M1GA 2W6BA 1IFIA 1LTGC 1FZCA 2E43A 3B5NB 5APQA 2XZRA 2BPEA 3HD7D 2OYIA 2E3XB 1AFB1 3SWFA 2KMB1 1SLQA 2RIBA 3V2RA 4N6JA 2R32A 4AK8A 2E3XC 3P8CE 3HD7B 2Q3IA 2WZ7A 5CCHA 3RL0D 1UKMB 4N78D 3PAKA 2KLVA 3WWKA 1RDJ1 1YPUA 2GGUA 2O1JA 1KILA 5LGKE 2XNXA 3L35A 2KOGA 3KMB1 2RIEA 1EQ7A 1V7PA 1GL2B 4ZKUA 4HH2A 3IKNA 3WHDA 1HUCA 3HTKA 3PP5A 3RK2B 1FM5A 3KQGA 3CCKA 2M94A 1J1DB 1G1SA 3HUSA 2OX9A 2VRPA 4QKGA 2H8PD 3GHGA 2WT7A 4GK1A 1XTGB 2PF5A 1T3JA 2HLOA 1C3AB 1FJKA 1SQVK 5APSA 2GO0A 1RF0C 1J1EC 3BRTB 4PDCA 1NU1K 1QO3C 3M9ZA 1H89A 1A02F 3P7HA 3V2PA 1KILB 3BATA 3E1IA 1JUNA 3OA7A 1GW4A 1NTMK 1E87A 1FDMA 1KZUB 3BVHA 1LWUA 1KMB1 4C7RA 1V4LB 4UWWA 5BVZA 4OH8B 1JY3O 2O1KA 3TYYA 2C6UA 1LTSC 3LIDA 2WSEH 1JCCA 2ORKA 2N1TC 2E42A 2BPDA 2BASA 1TLGA 1JY2N 3B5NA 3L37A 1LT9C 1WT6A 4GI0A 1GL2A 1KX1A 1GK4A 3B5NC 5AVSB 2IFMA 4LLHA 1UOSB 1JY3N 2FKWB 3WH2A 2PY2A 2A45G 1M1JA 1IODB 4DZOA 1FZAA 2CL8A 2NPSA 3L9JC 3BDWB 1SFCB 2W6AA 4C46A 4JYCA 2MTIA 1X2TB 4WR9A 1E5UI 2KYVA 1SFCD 1HBWA 2HODA 4ZETA 1FOSF 4W80A 3P5DA 1R14A 3M0DC 3A2AA 1R13A 4N3YB 3HUSB 3P5FA 1CI6A 5FFRA 4J6PA 1CWVA 2O01H 1LWUC 1GD2E 1IJKB 1V4LA 3C8JA 2HODB 1KZD1 1BCJ1 1RTM1 2YKPA 1RF1B 3H6PA 1DX7A 2N1TD 5CMZA 3NTNA 4KZVA 2M8RA 1BUUA 2WWWA 1HGZA 2GGXA 1F00I 1RDK1 1GL2C 1NKNA 4YMDA 2M3BA 1URQA 4E52A 1O7BT 3G8LA 1GU4A 5AW1B 1WT9A 4KMB1 3C9IA 1J1DC 1KFNA 4RESB 4G96A 1NAFA 3RK3D 3P5HA 1IXXA 3WSRA 1RE4A 1Y17B 1HUPA 1SVFA 4GIFA 3C22A 3V2NA 3IKQA 2XU6A 1N2DC 3UBUB 5KJ7A 4C9FA 3OAKA 3GPRC 2POHA 3RK3B 4WY4A 1HVVA 2WITA 1BJ3B 1DEBA 1H8UA 5B1WA 4GKGA 1L4AC 1KWVA 1KWTA 1IODA 1L4AA 1DY0A 1E5WA 3GPRB 3M06A 3C8KD 3NCXA 1N73C 1JO5A 1JZNA 1LITA 3NFQA 1RF1A 1YTTA 1RE3A 1NO4A 2N1TB 1FVUB 1F02I 2Z4EA 4I6MC 1GU5A 4M17A 1QL1A 2J59M 3ZHGD 5AW4B 1RDO1 1J2JB 1FZCB 1EGGA 1KZB1 4Y99C 1MPUA 1OZ7B 2LS8A 3MTUE 1EGIA 3G81A 4GT1A 2I83A 3PARA 1ZN5A 3EQ2A 4M3LA 1YTZT 2XKMA 5APVA 1YPOA 4QKJA 1FIHA 2YHFA 1L0NK 1RE4C 5AW3B 4ZESA 1JWIB 4DOJA 2I1JA 1SFCA 5KTHA 1N7SB 2XV5A 2Q5UA 4J6KA 4C16A 3NCWA 3VN0A 5KTBA 2Q9IA 4N33A 1NTKK 4LC1A 1IFNA 2RIDA 3V4WA 1SQPK 1QDDA 1SB2B 1LTJC 2KB7P 2HPCB 1JMMA 3T97A 2WPQA 3CDGF 1X8YA 1Y17A 1M7LA 1GL2D 4IFDK 3HE5A 2PAJA 5AVQB 1GK6A 1LT9B 1RE3C 3B8EB 5CJ0A 2ZXEB 1P1ZD 3OJAB 2IFNA 1T2KC 1RDL1 1T8CA 2Z5HA 1IFMA 1J35A 1RDM1 1YYCA 5CCHD 1HTNA 2WSCH 4YLIA 3IKPA 2J58A 3KDPB 1S9KE 1RJHA 1BNLA 3WWKC 2R3CA 3T3AA 1ZR4A 1X79B 2Z5IA 2IX7C 3M91A 3P8CD 2WPSA 5AW7B 2MJZA 2L5GB 3SWYA 1SQQK 3VYJA 1KILC 3VOPA 1LTAC 4J6MA 1JTHB 2KP8A 4XE5B 2WPRA 2Q7CA 4AQRD 1BYFA 1L4AD 1DY1A 3ALTA 4N35A 1TDQB 4J6LA 2RICA 5AVXB 1K9JA 1SP4A 2N9BA 1KOEA 3KYQA 3VMZA 1IJKC 1M1JC 4LQFA 4C7NB 1UEXB 1V7PB 1N7LA 2BRSA 3FF8C 1MSBA 2C0WA 1X2WB 2YO2A 2KV3A 4CAJA 1G1JA 3VP8A 2FFDB 3L36A 1ZLLA 1AFD1 4GJ0A 4N78E 1B08A 2IT6A 2XR6A 4LGDE 1KZC1 4W7ZA 4KI1E 5AW2B 5APTA 2VRPB 3CL3D 2YKOA 4IOPA 1FIFA 4WY4D 1JA3A 1UMRC 3G83A 4WB4A 5BU5A 1IJDB 4N36A 2CPBA 5APUA 4ZKPA 4KHXA 1DH3A 1SQXK 1WT9B 1WMYA 1FAVA 1FZBA 3IFMA 2QM7A 3M9HA 3HD7C 4I2LC 1G1RA 3RK2D 1MUQA 1N7SA 2VUVA 5BU8B 1T3UA 2I1KA 3CLQA 2P67A 2A45H 3P7KA 1KZA1 3VTPC 1FZEA 1HJBA 5FFTA 1WK1A 3TK1A 1DY2A 5FFSA 1QL2A 3BASA 1XTCC 2NPSC 3EFGA 3ALSA 3A7OA 1T8DA 1YXJA 2ORJA 3H32B 1JOCA 4EZMG 1KG0C 1J1EB 3TNUA 3RL0B 3TNUB 2H43A 1IXXB 1U0NB 4AUWA 1WRGA 4WY4C 2H7HA 1SB2A 3GPRD 1YTZI 3P5EA 2LKMA 1GZLA 3IKRA 3WBQA 1YXKA 2H2TB 3UIAA 1ZR2A 1URQB 1NTZK 1SQBK 2GUVA 1KWYA 5KLVK 1UMRA 3CADA 4KZWA 4WQQA 1MZ9A 3P5GA 1N73B 3MGNA 1N73A 2P2UA 1BCH1 1JWIA 3V5BA 5AVTB 3P8MC 1VPCA 2OYIC 1A02J 4DN8A 1NKZB 3WH3A 3ZHGA 2IT5A 1VDFA 2WSFH 1KWWA 1O7CT 4S0UA 5B1RA 3PBFA 1PFIA 4J6NA 1CZQA 3U1CA 1N86A 4QKIA 3U59A 2NPSD 1HQ8A 1G2CB 2ZQKA 3N4XA 3VPPA 1LTIC 3FF9A 1SFCC 2HYNA 4JF7A 2OYHC 3CI9A 1L4AB 3P32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7G A;  3FD4 A;  2C9L Y;  1G1Q A;  1J35 B;  3CDG E;  5APX A;  1HWT C;  2WTY A;  3WBP A;  1MUU A;  4WUX A;  3HE4 B;  4QKH A;  4J6Q A;  4C7N A;  1XPH A;  3HE5 B;  4HYT B;  1IO4 A;  1P4L D;  4WUW A;  1SL5 A;  2ZWK A;  4AYC A;  1YPQ A;  2H2R A;  3HUP A;  3A3Y B;  1K9I A;  3BX4 A;  3P7F A;  4ZRW A;  2W27 A;  3MD0 A;  1T2K D;  1X2T A;  4N38 A;  1U0O A;  3V4Q A;  5J6G G;  4LU5 A;  3FF7 C;  1H88 A;  2IPP A;  2R5D A;  5AW6 B;  2RIA A;  2R5B A;  3LIE A;  3PAQ A;  1B6E A;  1J34 B;  1JNM A;  1OZ7 A;  1MV8 A;  1XAR A;  1CI6 B;  3VMY A;  3UBU A;  4N34 A;  3G8K A;  1FVU A;  5AW0 B;  1KWX A;  3CFW A;  3M0A A;  3VMX A;  1KZE 1;  3HE4 A;  1SL4 A;  2AFP A;  2ZIB A;  5F2Q A;  2OS9 A;  5AW8 B;  3DBZ A;  2ZFC A;  2N40 A;  1X2W A;  1UKM A;  4UXM A;  2QM8 A;  4JYB A;  1KX0 A;  1GTW A;  1FOS E;  4CSY A;  2WT7 B;  5AVU B;  4ZRV A;  2P7J A;  1OWA A;  3I5C A;  1S9K D;  3IR9 A;  1AFA 1;  4WCO A;  4EOT A;  1DV8 A;  5M62 A;  3O8Z A;  3VYI A;  3A5T A;  5APW A;  1PW9 A;  1G1T A;  4G9A A;  4WRC A;  2C9N Y;  1KWU A;  5K8Y A;  1ESL A;  3K7B A;  3WWK B;  2OX8 A;  1U0N C;  4WRE A;  2YO3 A;  1SL6 A;  3RS1 A;  1OXZ A;  2VUZ A;  5AVR B;  1HYR A;  2JJL A;  3NXS A;  1GZ2 A;  4IOP B;  3M0D A;  1RDN 1;  4J6J A;  1J34 A;  1WMZ A;  1NWQ A;  2YNY A;  2BPH A;  3BDW A;  5AW5 B;  4GKO G;  4MTH A;  4N37 A;  4PP8 A;  1BJ3 A;  3WBR A;  2XR5 A;  1CSB A;  4WRF A;  1U0O B;  3VYK A;  1E8I A;  4B86 A;  4N32 A;  3NMD A;  3BX4 B;  1MFZ A;  3VLG A;  5AVV B;  1H8A A;  5AVZ B;  5B1X A;  1RDI 1;  1BV4 A;  5AW9 B;  5AVY B;  5AVW B;  3ALU A;  3P5I A;  2VRS A;  4GJX A;  5KTI A;  3GPR A;  1PWB A;  1KQL A;  1KWZ A;  2MSB A;  3G84 A;  1UEX A;  3M9B A;  1TN3 A;  5APY A;  1C3A A;  4M18 A;  1UOS A;  1KCG A;  4M1G A;  2E43 A;  5APQ A;  2BPE A;  2XZR A;  2E3X B;  1AFB 1;  3SWF A;  2KMB 1;  1SLQ A;  2RIB A;  2R32 A;  4AK8 A;  2E3X C;  2Q3I A;  1UKM B;  3PAK A;  3WWK A;  1RDJ 1;  1YPU A;  2GGU A;  5LGK E;  3L35 A;  3KMB 1;  2RIE A;  1V7P A;  3IKN A;  3WHD A;  1HUC A;  3HTK A;  1FM5 A;  3KQG A;  3CCK A;  2M94 A;  1G1S A;  2OX9 A;  2VRP A;  4QKG A;  2WT7 A;  4GK1 A;  2PF5 A;  1C3A B;  5APS A;  2GO0 A;  4PDC A;  1QO3 C;  3M9Z A;  1H89 A;  1A02 F;  3P7H A;  1JUN A;  1E87 A;  1KMB 1;  1V4L B;  4UWW A;  3TYY A;  2C6U A;  3LID A;  2ORK A;  2BPD A;  2E42 A;  2BAS A;  1TLG A;  3L37 A;  4GI0 A;  1KX1 A;  1GK4 A;  5AVS B;  1UOS B;  3WH2 A;  2PY2 A;  1IOD B;  4DZO A;  2CL8 A;  3L9J C;  3BDW B;  2W6A A;  4C46 A;  4JYC A;  2MTI A;  1X2T B;  4WR9 A;  1E5U I;  1HBW A;  4ZET A;  1FOS F;  3P5D A;  1R14 A;  3A2A A;  1R13 A;  3P5F A;  1CI6 A;  5FFR A;  4J6P A;  1CWV A;  1GD2 E;  1IJK B;  3C8J A;  1V4L A;  1KZD 1;  1BCJ 1;  1RTM 1;  4KZV A;  5CMZ A;  3NTN A;  1BUU A;  2WWW A;  2GGX A;  1F00 I;  1RDK 1;  4YMD A;  4E52 A;  1O7B T;  3G8L A;  1GU4 A;  5AW1 B;  1WT9 A;  4KMB 1;  4RES B;  4G96 A;  1NAF A;  3P5H A;  3WSR A;  1IXX A;  1Y17 B;  1HUP A;  3C22 A;  3IKQ A;  2XU6 A;  3UBU B;  4C9F A;  3OAK A;  3GPR C;  1BJ3 B;  1H8U A;  5B1W A;  4GKG A;  1KWV A;  1KWT A;  1IOD A;  1DY0 A;  3GPR B;  3M06 A;  3C8K D;  3NCX A;  1JZN A;  1LIT A;  3NFQ A;  1YTT A;  1FVU B;  1F02 I;  4I6M C;  1GU5 A;  4M17 A;  3ZHG D;  5AW4 B;  1RDO 1;  1J2J B;  1EGG A;  1KZB 1;  2LS8 A;  1OZ7 B;  1EGI A;  3G81 A;  4GT1 A;  2I83 A;  3PAR A;  4M3L A;  5APV A;  4QKJ A;  1YPO A;  1FIH A;  2YHF A;  5AW3 B;  4ZES A;  1JWI B;  5KTH A;  4J6K A;  2XV5 A;  2Q5U A;  4C16 A;  3NCW A;  3VN0 A;  4N33 A;  4LC1 A;  2RID A;  3V4W A;  1QDD A;  1SB2 B;  3T97 A;  2WPQ A;  3CDG F;  1X8Y A;  1Y17 A;  3HE5 A;  5AVQ B;  1GK6 A;  3B8E B;  2ZXE B;  1P1Z D;  1T2K C;  1RDL 1;  1T8C A;  2Z5H A;  1RDM 1;  1J35 A;  1YYC A;  1HTN A;  4YLI A;  3IKP A;  3KDP B;  1S9K E;  1RJH A;  1BNL A;  3WWK C;  2R3C A;  3T3A A;  2Z5I A;  3M91 A;  2WPS A;  5AW7 B;  3VYJ A;  4J6M A;  2KP8 A;  1DY1 A;  4XE5 B;  2WPR A;  2Q7C A;  4AQR D;  1BYF A;  3ALT A;  4N35 A;  5B1R A;  1TDQ B;  4J6L A;  2RIC A;  5AVX B;  1K9J A;  1SP4 A;  2N9B A;  1KOE A;  3VMZ A;  1IJK C;  4LQF A;  4C7N B;  1UEX B;  1V7P B;  2BRS A;  3FF8 C;  1MSB A;  1X2W B;  2YO2 A;  2KV3 A;  4CAJ A;  3L36 A;  1AFD 1;  4GJ0 A;  1B08 A;  2IT6 A;  2XR6 A;  1KZC 1;  4KI1 E;  5AW2 B;  5APT A;  2VRP B;  4IOP A;  1FIF A;  1UMR C;  1JA3 A;  3G83 A;  4N36 A;  5APU A;  4KHX A;  1DH3 A;  1WT9 B;  1WMY A;  1FAV A;  2QM7 A;  3M9H A;  4I2L C;  1G1R A;  2VUV A;  1MUQ A;  1UV0 A;  3P7K A;  2P67 A;  1KZA 1;  3VTP C;  1HJB A;  5FFT A;  1WK1 A;  3TK1 A;  1DY2 A;  5FFS A;  3ALS A;  3A7O A;  1T8D A;  1YXJ A;  2ORJ A;  4EZM G;  1KG0 C;  3TNU A;  3TNU B;  1U0N B;  1IXX B;  4AUW A;  2H7H A;  1SB2 A;  3GPR D;  3P5E A;  1GZL A;  3IKR A;  3WBQ A;  1YXK A;  2H2T B;  3UIA A;  3CAD A;  1KWY A;  1UMR A;  4KZW A;  4WQQ A;  3P5G A;  3MGN A;  2P2U A;  1BCH 1;  1JWI A;  3V5B A;  5AVT B;  3P8M C;  1A02 J;  4DN8 A;  3WH3 A;  3ZHG A;  2IT5 A;  1O7C T;  1KWW A;  4S0U A;  3PBF A;  4J6N A;  1CZQ A;  4QKI A;  1HQ8 A;  1G2C B;  2ZQK A;  3VPP A;  3FF9 A;  1MPU A;  3P32 A; 
#chains in the Genus database with same CATH topology
 2C9L Y;  5B5E H;  1G1Q A;  1J35 B;  1RY3 A;  4EYY Q;  1SQP G;  3FWL A;  1CW5 A;  4HYT B;  1RF0 A;  4AYC A;  5KLV D;  4UB8 H;  3BX4 A;  3MD0 A;  3RL0 C;  4N38 A;  4LU5 A;  2QJK C;  5B66 H;  1NJI Q;  1OMI A;  2IPP A;  3L71 D;  3PAQ A;  2E76 D;  4UB8 E;  3L73 J;  2PGD A;  1W2E A;  3FWN A;  3UBU A;  1VF5 C;  1JTH A;  2QJY C;  1FZF A;  2HG5 D;  3L74 D;  2AFP A;  2ZYA A;  1NU1 J;  2FYU K;  3L4F A;  3WMM 0;  1KC8 Q;  1NOH A;  3G9R A;  1KB9 D;  3C1L A;  1P84 E;  3RK3 E;  2KS1 A;  3AEA C;  4CSY A;  1X9V A;  3BRV B;  1VQ5 P;  4BRY A;  4K3A A;  2IYP A;  1L0L J;  1KV4 A;  3D6Y A;  2LXB A;  1UII A;  2A45 I;  4ASW A;  3AE1 C;  4EOT A;  3GMA A;  4O9B A;  3LW5 J;  5M62 A;  3VYI A;  3CME P;  2D2C B;  1G1T A;  1PW9 A;  3L75 D;  1ESL A;  3II6 A;  3A0B E;  5AVR B;  2JJL A;  3H32 A;  1JY2 O;  1PGQ A;  1RDN 1;  1LTJ B;  1OVR A;  4JPZ B;  4NPE A;  4GKO G;  4MTH A;  3AED C;  3GF7 A;  1VF5 B;  1SQV E;  1IC2 A;  3CCU P;  3HD7 A;  5TJH A;  5AVZ B;  2W90 A;  3G3Z A;  5AVW B;  3ALU A;  1S5L X;  1KOR A;  4KJM A;  1HJ0 A;  3GPR A;  5GTI H;  1SQP E;  1VQ7 P;  1SQX D;  1C3A A;  1UOS A;  4M1G A;  1LTG C;  2E3X B;  2KMB 1;  3ITK A;  3IAO A;  1SQQ D;  3P8C E;  3HD7 B;  3TF5 A;  2Q3E A;  4PD4 I;  5M1B A;  3WWK A;  2O1J A;  5LGK E;  2I8D A;  1GL2 B;  4ZKU A;  2AEM A;  1FM5 A;  3KQG A;  3CCK A;  4DT0 A;  3KXD A;  3CCM P;  3S1K A;  2VRP A;  4QKG A;  1XTG B;  3JC2 2;  3CC7 P;  1T3J A;  3RGU A;  1FJK A;  4YPC A;  2GO0 A;  3BRT B;  3CCQ P;  4PDC A;  1NU1 K;  3W68 A;  2WVR A;  4YXD C;  4H0L B;  1KMB 1;  1V4L B;  3BVH A;  1LWU A;  5E79 H;  1JY3 O;  2O1K A;  1NTZ J;  1SQB J;  1D7M A;  1LTS C;  1KYO I;  2WSE H;  2BAS A;  2WSS H;  4GI0 A;  2IFM A;  1JY3 N;  2PY2 A;  1IOD B;  1M1J A;  4DZO A;  1FZA A;  2IDB A;  3BDW B;  2IBZ I;  4C46 A;  4JYC A;  1X2T B;  2KYV A;  1FOS F;  3M0D C;  3A2A A;  1L0L G;  4N3Y B;  2KSE A;  3HUS B;  5FFR A;  1PZQ A;  1IJK B;  3C8J A;  2IZ1 A;  1V4L A;  1BCJ 1;  1OW8 A;  1DX7 A;  3H6P A;  1UIX A;  1HGZ A;  1SQX G;  1PPJ D;  2WSF J;  1PP9 G;  1GL2 C;  3GLM A;  4E52 A;  3G8L A;  2GA1 A;  1J1D C;  1RE4 A;  3Q2Y A;  1HUP A;  2XU6 A;  4C9F A;  3OAK A;  3L75 E;  5KAF H;  1HVV A;  5B1W A;  4GKG A;  1L4A C;  4OWF A;  1DY0 A;  1L4A A;  4WVZ A;  1LIT A;  3NFQ A;  1YTT A;  4OVN F;  1EZV D;  4I6M C;  2E74 C;  3AE8 C;  4M17 A;  1J2J B;  1FZC B;  4BXL A;  1OZ7 B;  3MTU E;  3E1R A;  3PAR A;  3EQ2 A;  1KYO E;  1FIH A;  3L74 J;  1KYO D;  3GF3 A;  2AEF A;  2I1J A;  3O6Q B;  4R4L A;  1ZP0 C;  2Q5U A;  4NPF X;  3FGA D;  2RID A;  3V4W A;  1EC5 A;  2HPC B;  1JMM A;  3IN6 A;  2E76 B;  1PPJ E;  1X8Y A;  3SWK A;  1GL2 D;  2QSI A;  1LT9 B;  3L70 J;  4JQ0 D;  1RE3 C;  1KQS O;  3B8E B;  1P1Z D;  1NAY A;  1VQP P;  2IFN A;  2KNC B;  1RDL 1;  1EDL A;  3JCU H;  3USS A;  5CCH D;  3IKP A;  3KDP B;  1RJH A;  1NTM G;  2R3C A;  2WSC J;  1X79 B;  3P8C D;  3QWO C;  2WPS A;  1KIL C;  3VOP A;  1LTA C;  1BYF A;  3ALT A;  1L4A D;  1TDQ B;  4J6L A;  4PV1 B;  1KOE A;  1IJK C;  1M1J C;  1N7L A;  1M8O B;  3H1J D;  2E74 D;  1X2W B;  2KV3 A;  1G1J A;  1OZH A;  1AFD 1;  2IT6 A;  4LGD E;  1BCC J;  1SQP J;  2OGU A;  5H2F H;  4IOP A;  2V4H A;  3G83 A;  2QG4 A;  5KAI E;  5BU5 A;  4I7Z C;  3A0B H;  4KHX A;  3E7K A;  1DH3 A;  1WMY A;  1G1R A;  3P7K A;  2A45 H;  1KZA 1;  3VTP C;  1QL2 A;  3EFG A;  3EFF K;  2H88 C;  2Y9Z A;  2ORJ A;  1JOC A;  4EZM G;  3I55 P;  1IZN B;  3RL0 B;  3AE3 C;  5KLI B;  1U0N B;  1ZME C;  1YTZ I;  2R3S A;  1GZL A;  2WSE J;  3IKR A;  3UIA A;  1U57 A;  1NTZ K;  1SQB K;  1KWY A;  2QJP B;  2UWJ E;  3L74 G;  3AE2 C;  2P2U A;  1R5L A;  5AVT B;  4ZNC A;  1KB9 H;  1KWW A;  1FDI A;  3B71 A;  3PLN A;  5B5E E;  3U1C A;  1N86 A;  3CCJ P;  1SQV J;  4U3F G;  3N4X A;  2QIW A;  3VPP A;  2KZJ A;  3CI9 A;  1JMB A;  3FD4 A;  1GDT A;  4D6T D;  3H1J J;  1NTK G;  4WUX A;  1AFO A;  2Y9Y A;  4C7N A;  2ZYG A;  3HE5 B;  3LW5 H;  1S4X A;  1IO4 A;  2ZWK A;  4Y99 B;  3KZI H;  1VQ4 P;  1OW6 A;  3HUP A;  2QE7 H;  2CPS A;  1K9I A;  1NH4 A;  1T2K D;  4HB1 A;  1U0O A;  3ABV C;  2NPS B;  1HGV A;  1SQQ G;  4GDO A;  2OYH A;  4PV1 C;  3PRJ A;  1JNM A;  3MUD A;  1MV8 A;  1QEX A;  2HR3 A;  1LT9 A;  3H1K G;  2YXR B;  3CC4 P;  1KWX A;  3M0A A;  3VMX A;  3HTK B;  5E79 E;  1SL4 A;  2ZIB A;  4WBA A;  2PRR A;  3W67 A;  2KSJ A;  4H0L C;  5AW8 B;  3L70 G;  1NU1 G;  2ZFC A;  2N40 A;  1EDI A;  2QM8 A;  2JO1 A;  1GTW A;  3GG2 A;  3V2Q A;  2P7J A;  3CWB G;  1IK9 A;  1VF5 D;  1Z56 A;  2AXT H;  3PHL A;  3KPE A;  4WCO A;  1DV8 A;  3A5T A;  4G9A A;  1PGP A;  2HFE D;  4IOI H;  5KLV E;  3AEG C;  4H13 B;  4WRC A;  3K7B A;  1ZW0 A;  2YMY A;  4WY4 B;  5KAI H;  3JSV C;  4WRE A;  1BE3 J;  3TGU J;  1YHQ P;  1HYR A;  3NXS A;  3CCV P;  1GZ2 A;  1LTB C;  2BCC J;  5KLV G;  3BCC D;  1WMZ A;  1NWQ A;  2OYH B;  2C0X A;  3BDW A;  5AW5 B;  2GM4 A;  1BJ3 A;  1FZG A;  2XR5 A;  1CSB A;  4WRF A;  1U0O B;  1OX3 A;  3VLG A;  2OYI B;  1LGH B;  4PD4 H;  1RQU A;  1PP9 J;  5AW9 B;  3MP7 B;  4UB6 H;  2AXC A;  2RN0 A;  3CX5 I;  2JR8 A;  3L70 D;  3PJS K;  4IFM A;  5KTI A;  2RH0 A;  4W7Y A;  1KWZ A;  1PGJ A;  3M9B A;  1TN3 A;  2Q1K A;  2E75 C;  4M18 A;  1KCG A;  2W6B A;  2E43 A;  3CX5 D;  2XZR A;  2OYI A;  3SWF A;  1SLQ A;  3V2R A;  4N6J A;  2Q3I A;  2WZ7 A;  3RL0 D;  5GTH E;  1UKM B;  3PAK A;  1RDJ 1;  4BWN A;  1KIL A;  4ZMD A;  1HF9 A;  2KI7 B;  3L35 A;  1EXJ A;  1YBK A;  3KMB 1;  2E76 C;  2CK3 H;  1QX8 A;  3WHD A;  3JCU E;  2M94 A;  3AE9 C;  3HUS A;  2V7Q J;  2OX9 A;  3GHG A;  3H1L D;  1DIP A;  2PF5 A;  1C3A B;  2ZJS E;  1Y47 A;  2FYU G;  3M9Z A;  1H89 A;  1A02 F;  3P7H A;  1JUN A;  1Q82 Q;  2JWD A;  4CPG A;  1NTM K;  1FDM A;  3K5B A;  4C7R A;  2W6J H;  4OH8 B;  2ORK A;  2N1T C;  1JY2 N;  1NU1 E;  4OGQ B;  1WT6 A;  2QRX A;  1GL2 A;  1KX1 A;  1DD3 A;  1GK4 A;  3B5N C;  4LLH A;  3C8V A;  4EDF A;  3L71 J;  2CL8 A;  4IL6 E;  2WQY C;  3CCS P;  2YIU B;  3MHV A;  1QLE D;  1HBW A;  2N9Y B;  1MFT A;  1R13 A;  2HOD B;  1SQV D;  1KZD 1;  2YKP A;  1RF1 B;  4KZV A;  2N1T D;  2WWW A;  1PP9 E;  4YTP C;  1BGY E;  3CXH D;  1O7B T;  1QVG O;  1NAF A;  3P5H A;  1P84 I;  3L71 G;  3IKQ A;  4RJT A;  3H1L J;  1ZRT E;  3RK3 B;  1DEB A;  3SFD C;  4TT3 H;  3L75 J;  1IOD A;  1YQ3 C;  4Y28 J;  3G71 P;  1YJ9 P;  1JZN A;  1JO5 A;  2O3J A;  1RF1 A;  1Q90 D;  1RE3 A;  1NO4 A;  1FVU B;  2Z4E A;  1GU5 A;  3CWB D;  1RDO 1;  2R44 A;  1EGG A;  1KZB 1;  4Y99 C;  2LS8 A;  2I83 A;  4ZES A;  2ZAE B;  2QJP C;  4DOJ A;  3MUD C;  5EFW B;  5KTB A;  2Q9I A;  4N33 A;  3CD6 P;  1LTJ C;  1L0N J;  2WPV B;  1E79 H;  2WPQ A;  3CDG F;  1WMK A;  2KIK A;  2PAJ A;  5AVQ B;  1KN7 A;  1PL5 A;  5CJ0 A;  2Z5H A;  1IFM A;  1J35 A;  3OW2 O;  2WSC H;  2J58 A;  1VQN P;  1BNL A;  3WWK C;  3AEF C;  2Z5I A;  5AW7 B;  2MJZ A;  2L5G B;  1SQQ K;  3VYJ A;  1JTH B;  2KP8 A;  3AEB C;  4XE5 B;  1BGY J;  5B1R A;  2ZXX A;  3H1L E;  1VL2 A;  3KYQ A;  1PV3 A;  4H13 C;  4HJG H;  2Y0E A;  1UEX B;  2BRS A;  3BCC G;  2C0W A;  2YO2 A;  4CAJ A;  3VP8 A;  2FFD B;  3L36 A;  4HKZ H;  1ZLL A;  1B08 A;  4KI1 E;  5APT A;  2VRP B;  1FIF A;  1K04 A;  4WY4 D;  4N36 A;  1EZV G;  5APU A;  4ZKP A;  3WU2 E;  1SQX K;  1WT9 B;  1FZB A;  3M9H A;  1UV0 A;  1T3U A;  2I1K A;  3CLQ A;  1FZE A;  1WK1 A;  3TK1 A;  1DY2 A;  5FFS A;  3BAS A;  1LP1 B;  1XTC C;  4GOE A;  3V6I A;  3H1H D;  4DCK A;  3ALS A;  1Q2N A;  3H32 B;  1USD A;  1YQ4 C;  3F5H A;  2K9Y A;  3KZI E;  3TNU B;  2H43 A;  1IXX B;  2B88 A;  3GPR D;  4U3F D;  4WWI A;  2LKM A;  1YXK A;  2H2T B;  3CAD A;  5KLV K;  4WQQ A;  1MZ9 A;  3P5G A;  1N73 B;  5B66 E;  1BCH 1;  1JWI A;  1VPC A;  2OYI C;  4DN8 A;  3WH3 A;  1NTM E;  4S0U A;  1PFI A;  4J6N A;  4TLF A;  1CZQ A;  1PGO A;  3U59 A;  3PH0 A;  2L91 A;  1KMI Z;  2KUB A;  5CBN A;  2QVA A;  1LTI C;  1L0N G;  1SFC C;  2HYN A;  2OYH C;  1MPU A;  1L4A B;  4PD4 D;  2FYU D;  3CDG E;  2SPZ A;  1AQ5 A;  3O6Q A;  3RBX A;  2WTY A;  3WBP A;  1MUU A;  1LTJ A;  4EIJ A;  2GUS A;  3HE4 B;  1SQX E;  3Q5R A;  1M56 D;  1P4L D;  3CXH I;  1SL5 A;  3T97 B;  1YPQ A;  1L0L E;  2H2R A;  1OVU A;  1KD1 Q;  2E75 B;  3AE4 C;  3CCE P;  1N8R Q;  2JKV A;  2OAR A;  4ZRW A;  3VP9 A;  5CCH C;  5J6G G;  1PIX A;  4R4M A;  1H88 A;  5AW6 B;  2R5D A;  2RIA A;  1IK7 A;  1K73 Q;  2FYZ A;  3H25 A;  1OVV A;  1B6E A;  1KIL D;  1ZOY C;  3D6Z A;  2OYO A;  3CPW O;  1CI6 B;  3GHG B;  2OQQ A;  3H1L G;  3H1H J;  3S9O A;  3G8K A;  1FVU A;  1KFM A;  2D2C D;  5AW0 B;  3CFW A;  1U7M A;  1KZE 1;  3HE4 A;  1SQV G;  4U3F J;  2OS9 A;  3CX5 E;  3SSU A;  3HRN A;  1G1I A;  3DBZ A;  3RL0 g;  3RK3 C;  2IYO A;  3H1I J;  3AEC C;  2KXP B;  2E5Y A;  1UKM A;  1L2P A;  1KX0 A;  3WUV A;  5CJ4 A;  3M9Q A;  4PD4 E;  5AVU B;  1JY3 P;  1VQM P;  3IR9 A;  4RKU J;  1AFA 1;  3B5N D;  2OTL P;  3H1K D;  3L72 D;  2YKQ A;  3I56 P;  1M1J B;  2FXM A;  3FX0 A;  3F89 A;  1HTL C;  2OX8 A;  1IFD A;  1P84 D;  3RS1 A;  1ZV8 A;  3KHU A;  1RHZ B;  2VUZ A;  4I7Z B;  2K9J B;  1Q81 Q;  4IOP B;  3M0D A;  2P10 A;  4XA4 A;  3CCR P;  3N7N A;  2V7Q H;  1GW3 A;  3WUU A;  3U1A A;  3WBR A;  1JM0 A;  3VYK A;  1E8I A;  4B86 A;  4OGQ C;  1NTZ D;  1SQB D;  3R2P A;  3NMD A;  3BX4 B;  1G2C A;  5AVV B;  3TSI A;  5B1X A;  1FU1 A;  3L73 D;  2ZT9 B;  1RDI 1;  2J5U A;  1L0N D;  5AVY B;  1YJW P;  2FFD C;  1YI2 P;  4GJX A;  2FFD A;  1FJP A;  5KJ7 C;  3L72 G;  4I1L A;  4L73 A;  1PWB A;  2MSB A;  3HUS C;  1UEX A;  4XFJ A;  1FZC C;  1IFI A;  2H89 C;  1FZC A;  3B5N B;  2BPE A;  3HD7 D;  3CC2 P;  2BEQ D;  1BGY D;  3CXH E;  4QMA A;  2E3X C;  5CCH A;  2KLV A;  2G3A A;  1YPU A;  2KK7 A;  1TU3 F;  2XNX A;  2KOG A;  1AJY A;  3AE5 C;  4PV1 D;  2RIE A;  3L72 J;  3GW6 A;  1V7P A;  4HH2 A;  3HTK A;  3RK2 B;  2OTK E;  4DJG A;  3FXD A;  2WT7 A;  4GK1 A;  2IZ0 A;  5APS A;  4D6T J;  1KB9 I;  4PJ0 E;  2QA4 P;  1J1E C;  1QO3 C;  2QEX P;  1KIL B;  2Q6Q A;  3BAT A;  2IBZ E;  3PTZ A;  1GW4 A;  2G8Y A;  1KZU B;  4UWW A;  1AQT A;  4BRY B;  3L75 G;  5BVZ A;  3TYY A;  3LID A;  1JCC A;  2E42 A;  1IFP A;  2BPD A;  1KQF B;  1TLG A;  1LT9 C;  2FKW B;  3WH2 A;  2NPS A;  2BCC E;  3L9J C;  3TGU E;  4WR9 A;  1E5U I;  1SFC D;  1X22 A;  2Y0D A;  4ZET A;  3P5D A;  1R14 A;  1K8A Q;  4A7P A;  1NGM B;  2W83 C;  5CBO A;  1CI6 A;  4L74 A;  5KLI C;  1CWV A;  4J6P A;  2O01 H;  1GD2 E;  5CMZ A;  1AV1 A;  3NTN A;  4PJ0 H;  1BUU A;  2YMK A;  2GGX A;  1NKN A;  1URQ A;  5GTI E;  1R5S A;  4KMB 1;  3C9I A;  4RES B;  4G96 A;  3RK3 D;  3WSR A;  3H1K E;  1SVF A;  1KQG B;  3C22 A;  2O01 N;  3UBU B;  5KJ7 A;  3GPR C;  1NYH A;  3CXH H;  4WY4 A;  1KIL E;  2WIT A;  1BJ3 B;  1H8U A;  1U7J A;  1LT1 A;  1BCC G;  1KWV A;  2K88 A;  1KWT A;  3NCX A;  2E75 D;  1KYO H;  1OFC X;  2FXO A;  2N1T B;  4YXW H;  5KKZ C;  1OW7 A;  3G81 A;  1BSN A;  4GT1 A;  4QKJ A;  5APV A;  1YTZ T;  2XKM A;  1L0N K;  4RO0 A;  3VMA A;  1JWI B;  1VQ8 P;  1N7S B;  2XV5 A;  2LXC B;  3NCW A;  3VN0 A;  4LC1 A;  1SQP K;  5H2F E;  2E74 B;  1Y17 A;  1M7L A;  4IL6 X;  3HE5 A;  1GK6 A;  2NZ2 A;  4L75 A;  2A06 E;  2ZXE B;  1T8C A;  1YYC A;  4YLI A;  1S9K E;  3T3A A;  2ZT9 D;  2ZYD A;  3M91 A;  5DJT B;  3SWY A;  2QJK B;  2M5A A;  4J6M A;  2K9J A;  4N35 A;  2WPR A;  4AQR D;  1M90 Q;  3L71 E;  2RIC A;  1K9J A;  1SP4 A;  3L74 E;  4C7N B;  3BCC E;  1V7P B;  1K05 A;  3FF8 C;  4H44 C;  2M0B A;  3IF4 A;  3D71 A;  3TDK A;  4N78 E;  2IBZ D;  1KZC 1;  5AW2 B;  3CL3 D;  1UMR C;  1JA3 A;  4WB4 A;  1IJD B;  2BCC G;  2CPB A;  3AE6 C;  3TGU G;  1FC2 C;  1NTK E;  1FDO A;  2AEJ A;  1PPJ G;  3IFM A;  2QM7 A;  2VUV A;  3HD7 C;  1YIT P;  3S4R A;  1N7S A;  2P67 A;  1HJB A;  3AEE C;  1QGK B;  1LNQ A;  1T8D A;  1YXJ A;  1M57 D;  1SQX J;  1KG0 C;  1J1E B;  3Q5P A;  1AA0 A;  4AUW A;  1GMJ A;  1WRG A;  4WY4 C;  1SB2 A;  1RH5 B;  1ZR2 A;  1URQ B;  4KZW A;  3MGN A;  1H0T B;  3V5B A;  1A02 J;  2KLU A;  3ZHG A;  2IT5 A;  2WSF H;  2DW3 A;  3PBF A;  4QKI A;  1HQ8 A;  4GOD A;  1Q7Y Q;  5DJU B;  1KB9 E;  2JDI H;  3FF9 A;  3P7G A;  2P1J A;  5KJ7 D;  5APX A;  1HWT C;  1S1C X;  2PP6 A;  1Y9B A;  4J6Q A;  4QKH A;  1URQ D;  1XPH A;  3L73 E;  4WUW A;  4IFF A;  1RF1 C;  2BCC D;  1BCC D;  4UB6 E;  1QVF O;  3A3Y B;  2AXT E;  3P7F A;  3EWK A;  2JEE A;  2W27 A;  4MN4 C;  1X2T A;  3V4Q A;  4Z1M H;  3FF7 C;  1T8Z A;  2R5B A;  1FE6 A;  1BGY G;  3LIE A;  1J34 B;  3CWB J;  1VQO P;  1OZ7 A;  1XAR A;  2M3E A;  3R4Y A;  1USE A;  3VMY A;  2KZI A;  1PP9 D;  4N34 A;  2HPC A;  1JCD A;  1FBM A;  2A06 D;  3H1I G;  3GHG C;  5F2Q A;  2JWA A;  2KNC A;  1X2W A;  4UXM A;  4JYB A;  1HH0 A;  3H1H G;  3H1I E;  1FOS E;  2P58 A;  3CX5 H;  5CCG C;  2WT7 B;  2XDJ A;  4U7J A;  1JY2 P;  4ZRV A;  5CCG A;  1OWA A;  3I5C A;  1S9K D;  2N1T A;  2D2C C;  1N7S C;  3RBZ A;  1URQ C;  3RK2 C;  3O8Z A;  5APW A;  5K5G B;  2C9N Y;  1KWU A;  5K8Y A;  3WWK B;  4EI2 A;  1U0N C;  3G4S P;  2YO3 A;  1SL6 A;  3A0H H;  1OXZ A;  1L0L K;  1RQV A;  1K9M Q;  3H1J G;  4J6J A;  1J34 A;  2YNY A;  2O01 J;  2BPH A;  1DEE G;  1IFJ A;  4N37 A;  1LTT C;  4PP8 A;  4N32 A;  2E5T A;  1X0T A;  3G6E P;  1MFZ A;  2ITA A;  1T6A A;  2K3R A;  3H1J E;  1H8A A;  1NHL A;  1S5L H;  3CMA P;  2FYU E;  1BV4 A;  2RKL A;  2ZT9 C;  1LWU B;  1AVO A;  3P5I A;  2VRS A;  3MZW B;  1LP1 A;  5CCG D;  3MIW A;  5CHX A;  1NTM J;  1KQL A;  4NPD A;  3G84 A;  5APY A;  2WMM A;  1N7S D;  1Q86 Q;  5APQ A;  3Q3D A;  3AE7 C;  1AFB 1;  1NVO A;  2RIB A;  2QJY B;  2R32 A;  4AK8 A;  1W5C E;  1Y8A A;  1EZV E;  4N78 D;  1R8E A;  2GGU A;  3L73 G;  1EXI A;  1EQ7 A;  3IKN A;  5TIS E;  1HUC A;  3PP5 A;  5GTH H;  1J1D B;  2K37 A;  1G1S A;  1M1K Q;  2H8P D;  1SQP D;  1KTM A;  3TGU D;  2HLO A;  1SQV K;  1YIJ P;  4L76 A;  1RF0 C;  4D6T G;  3BCC J;  4H0L D;  3V2P A;  3E1I A;  2IBZ G;  1L0N E;  2YIU C;  3OA7 A;  1E87 A;  3H1H E;  1YJN P;  5KLV J;  1SS1 A;  2B87 A;  4D6T E;  2C6U A;  3CCL P;  3A0H E;  3B5N A;  3L37 A;  4H13 D;  5AVS B;  1UOS B;  1OIP A;  2A45 G;  1FS0 E;  1BDD A;  4H44 D;  1SFC B;  3L72 E;  2W6A A;  1JEK A;  2FY8 A;  2MTI A;  1NTM D;  4H44 B;  5TIS H;  2HOD A;  4W80 A;  3P5F A;  1LJ2 A;  1LWU C;  2M5A B;  1RTM 1;  2M8R A;  1BSH A;  1F00 I;  1RDK 1;  4YMD A;  1SQQ E;  2M3B A;  1GU4 A;  1MKM A;  5AW1 B;  5KAF E;  1WT9 A;  1KFN A;  1NTZ E;  1SQB E;  1VQK P;  1IXX A;  1Y17 B;  1ZXG A;  4GIF A;  3V2N A;  3WU2 H;  1N2D C;  2W8Z A;  2OTJ P;  2POH A;  3H1K J;  2B89 A;  3L70 E;  1NTZ G;  1SQB G;  1S2E A;  1EDK A;  1E5W A;  3GPR B;  1S5L E;  3M06 A;  3C8K D;  1N73 C;  1BE3 G;  4JBZ A;  5C39 A;  3ZDM A;  1NTK D;  1VQL P;  1F02 I;  1QL1 A;  2J59 M;  3ZHG D;  5AW4 B;  3FXE A;  1AVY A;  3Q5S A;  1EGI A;  3B4S A;  1ZN5 A;  4M3L A;  1S72 P;  1YPO A;  2YHF A;  3D70 A;  1RE4 C;  5AW3 B;  1BDC A;  1SFC A;  5KTH A;  4J6K A;  4C16 A;  5L8R J;  2FXP A;  1NTK K;  1IFN A;  2PFX A;  1QDD A;  1SB2 B;  2KB7 P;  3T97 A;  2LR2 A;  2B87 B;  4IFD K;  4K35 A;  2ZVO B;  3OJA B;  1T2K C;  2MKV A;  1RDM 1;  1HTN A;  2ZVN B;  1H0T A;  2XND H;  2NRG A;  1ZR4 A;  2IX7 C;  2JP3 A;  1DY1 A;  2Q7C A;  1SQQ J;  1BE3 D;  5AVX B;  1P84 H;  2N9B A;  3VMZ A;  2KS1 B;  4LQF A;  2FYU J;  1EDJ A;  1MSB A;  4GOF A;  1BCC E;  4ASV A;  4GJ0 A;  2XR6 A;  4W7Z A;  1S3J A;  2FYN C;  2YKO A;  1NTK J;  4IL6 H;  2BEZ F;  1FAV A;  4I2L C;  2YXQ B;  3RK2 D;  1MUQ A;  1VQ6 P;  5BU8 B;  5FFT A;  2NPS C;  3A7O A;  2FYN B;  3TNU A;  2H7H A;  1EZV I;  1NU1 D;  3P5E A;  3WBQ A;  3QH9 A;  1ZRT D;  1DD4 A;  2GUV A;  3Q1M A;  1UMR A;  2A06 G;  3H1I D;  3WUT A;  1N73 A;  3P8M C;  2B9B A;  4OGQ D;  1BE3 E;  4KT0 J;  1NKZ B;  1VQ9 P;  5KKZ B;  3SFE C;  1VDF A;  1O7C T;  2Y0C A;  3CWB E;  2K1A A;  1L0L D;  2NPS D;  1G2C B;  1JB0 J;  1W2B O;  2ZQK A;  4U3F E;  2RMZ A;  4JF7 A;  2FBW C;  3P32 A; 
#chains in the Genus database with same CATH homology
 3P7G A;  2P1J A;  3FD4 A;  2C9L Y;  1G1Q A;  1J35 B;  1GDT A;  3CDG E;  1AQ5 A;  5KJ7 D;  5APX A;  1RY3 A;  1HWT C;  2WTY A;  3WBP A;  1MUU A;  1LTJ A;  4EIJ A;  1AFO A;  2GUS A;  4WUX A;  2PP6 A;  3HE4 B;  4QKH A;  4J6Q A;  4C7N A;  1URQ D;  3HE5 B;  1XPH A;  3LW5 H;  1CW5 A;  4HYT B;  1IO4 A;  1P4L D;  4WUW A;  1SL5 A;  2ZWK A;  1RF0 A;  4IFF A;  4Y99 B;  4AYC A;  1RF1 C;  1YPQ A;  2H2R A;  3HUP A;  2CPS A;  3A3Y B;  1K9I A;  3BX4 A;  2OAR A;  3P7F A;  1NH4 A;  2JEE A;  4ZRW A;  2W27 A;  3MD0 A;  1T2K D;  3RL0 C;  1X2T A;  4N38 A;  1U0O A;  3VP9 A;  3V4Q A;  5CCH C;  5J6G G;  4LU5 A;  3FF7 C;  1T8Z A;  1H88 A;  2IPP A;  2R5D A;  2NPS B;  5AW6 B;  2RIA A;  2R5B A;  1HGV A;  2FYZ A;  3LIE A;  2OYH A;  3PAQ A;  1B6E A;  1KIL D;  1J34 B;  1JNM A;  1W2E A;  3MUD A;  1MV8 A;  1OZ7 A;  1XAR A;  1LT9 A;  1CI6 B;  3GHG B;  3VMY A;  3UBU A;  4N34 A;  3G8K A;  1JTH A;  1FVU A;  1KFM A;  5AW0 B;  1FZF A;  1KWX A;  2HG5 D;  3M0A A;  2HPC A;  3VMX A;  3HTK B;  1JCD A;  1FBM A;  3CFW A;  1KZE 1;  3HE4 A;  1SL4 A;  2AFP A;  2ZIB A;  3GHG C;  5F2Q A;  4WBA A;  2OS9 A;  2KSJ A;  5AW8 B;  2FYU K;  3HRN A;  1G1I A;  3DBZ A;  3RK3 C;  2ZFC A;  3L4F A;  3WMM 0;  2N40 A;  1X2W A;  1NOH A;  1UKM A;  4UXM A;  2QM8 A;  4JYB A;  1HH0 A;  1KX0 A;  1GTW A;  5CJ4 A;  1FOS E;  4CSY A;  3M9Q A;  5CCG C;  5AVU B;  3V2Q A;  2WT7 B;  2XDJ A;  1X9V A;  3BRV B;  1JY2 P;  2P7J A;  4ZRV A;  5CCG A;  1IK9 A;  1OWA A;  3I5C A;  1S9K D;  1Z56 A;  2N1T A;  1JY3 P;  3KPE A;  3IR9 A;  1AFA 1;  1N7S C;  4WCO A;  1URQ C;  3RK2 C;  2A45 I;  3B5N D;  4EOT A;  1DV8 A;  4O9B A;  5M62 A;  3O8Z A;  3VYI A;  3A5T A;  5APW A;  2YKQ A;  1PW9 A;  1G1T A;  2HFE D;  4G9A A;  1M1J B;  2FXM A;  4WRC A;  2C9N Y;  1KWU A;  5K8Y A;  1ESL A;  3K7B A;  3WWK B;  2YMY A;  4WY4 B;  1HTL C;  2OX8 A;  1IFD A;  1U0N C;  4WRE A;  3II6 A;  2YO3 A;  1SL6 A;  3RS1 A;  1OXZ A;  1ZV8 A;  1UV0 A;  5AVR B;  2VUZ A;  1HYR A;  2JJL A;  3NXS A;  1L0L K;  3H32 A;  1GZ2 A;  4IOP B;  1JY2 O;  3M0D A;  1LTB C;  1RDN 1;  4J6J A;  1LTJ B;  1J34 A;  1WMZ A;  1NWQ A;  2OYH B;  4XA4 A;  2YNY A;  2C0X A;  3N7N A;  2BPH A;  3BDW A;  1GW3 A;  1IFJ A;  5AW5 B;  4GKO G;  4MTH A;  3U1A A;  4N37 A;  1LTT C;  4PP8 A;  2GM4 A;  1BJ3 A;  3WBR A;  1FZG A;  2XR5 A;  1CSB A;  4WRF A;  1U0O B;  3VYK A;  1E8I A;  4B86 A;  4N32 A;  1IC2 A;  3HD7 A;  3R2P A;  3NMD A;  3BX4 B;  1MFZ A;  1G2C A;  3VLG A;  5AVV B;  1H8A A;  3TSI A;  5AVZ B;  1NHL A;  2OYI B;  1FU1 A;  1LGH B;  5B1X A;  1RDI 1;  1BV4 A;  3G3Z A;  5AW9 B;  5AVY B;  5AVW B;  1LWU B;  3ALU A;  3P5I A;  2FFD C;  2VRS A;  4GJX A;  2FFD A;  1FJP A;  5KJ7 C;  5KTI A;  4IFM A;  3GPR A;  5CCG D;  4I1L A;  1PWB A;  3MIW A;  5CHX A;  4W7Y A;  1KQL A;  3HUS C;  1KWZ A;  2MSB A;  3G84 A;  1UEX A;  3M9B A;  1TN3 A;  5APY A;  1C3A A;  4M18 A;  1UOS A;  1FZC C;  1N7S D;  1KCG A;  4M1G A;  2W6B A;  1IFI A;  1LTG C;  1FZC A;  2E43 A;  3B5N B;  5APQ A;  2XZR A;  2BPE A;  3HD7 D;  2OYI A;  2E3X B;  1AFB 1;  3SWF A;  2KMB 1;  1SLQ A;  2RIB A;  3V2R A;  4N6J A;  2R32 A;  4AK8 A;  2E3X C;  3P8C E;  3HD7 B;  2Q3I A;  2WZ7 A;  5CCH A;  3RL0 D;  1UKM B;  4N78 D;  3PAK A;  2KLV A;  3WWK A;  1RDJ 1;  1YPU A;  2GGU A;  2O1J A;  1KIL A;  5LGK E;  2XNX A;  3L35 A;  2KOG A;  3KMB 1;  2RIE A;  1EQ7 A;  1V7P A;  1GL2 B;  4ZKU A;  4HH2 A;  3IKN A;  3WHD A;  1HUC A;  3HTK A;  3PP5 A;  3RK2 B;  1FM5 A;  3KQG A;  3CCK A;  2M94 A;  1J1D B;  1G1S A;  3HUS A;  2OX9 A;  2VRP A;  4QKG A;  2H8P D;  3GHG A;  2WT7 A;  4GK1 A;  1XTG B;  2PF5 A;  1T3J A;  2HLO A;  1C3A B;  1FJK A;  1SQV K;  5APS A;  2GO0 A;  1RF0 C;  1J1E C;  3BRT B;  4PDC A;  1NU1 K;  1QO3 C;  3M9Z A;  1H89 A;  1A02 F;  3P7H A;  3V2P A;  1KIL B;  3BAT A;  3E1I A;  1JUN A;  3OA7 A;  1GW4 A;  1NTM K;  1E87 A;  1FDM A;  1KZU B;  3BVH A;  1LWU A;  1KMB 1;  4C7R A;  1V4L B;  4UWW A;  5BVZ A;  4OH8 B;  1JY3 O;  2O1K A;  3TYY A;  2C6U A;  1LTS C;  3LID A;  2WSE H;  1JCC A;  2ORK A;  2N1T C;  2E42 A;  2BPD A;  2BAS A;  1TLG A;  1JY2 N;  3B5N A;  3L37 A;  1LT9 C;  1WT6 A;  4GI0 A;  1GL2 A;  1KX1 A;  1GK4 A;  3B5N C;  5AVS B;  2IFM A;  4LLH A;  1UOS B;  1JY3 N;  2FKW B;  3WH2 A;  2PY2 A;  2A45 G;  1M1J A;  1IOD B;  4DZO A;  1FZA A;  2CL8 A;  2NPS A;  3L9J C;  3BDW B;  1SFC B;  2W6A A;  4C46 A;  4JYC A;  2MTI A;  1X2T B;  4WR9 A;  1E5U I;  2KYV A;  1SFC D;  1HBW A;  2HOD A;  4ZET A;  1FOS F;  4W80 A;  3P5D A;  1R14 A;  3M0D C;  3A2A A;  1R13 A;  4N3Y B;  3HUS B;  3P5F A;  1CI6 A;  5FFR A;  4J6P A;  1CWV A;  2O01 H;  1LWU C;  1GD2 E;  1IJK B;  1V4L A;  3C8J A;  2HOD B;  1KZD 1;  1BCJ 1;  1RTM 1;  2YKP A;  1RF1 B;  3H6P A;  1DX7 A;  2N1T D;  5CMZ A;  3NTN A;  4KZV A;  2M8R A;  1BUU A;  2WWW A;  1HGZ A;  2GGX A;  1F00 I;  1RDK 1;  1GL2 C;  1NKN A;  4YMD A;  2M3B A;  1URQ A;  4E52 A;  1O7B T;  3G8L A;  1GU4 A;  5AW1 B;  1WT9 A;  4KMB 1;  3C9I A;  1J1D C;  1KFN A;  4RES B;  4G96 A;  1NAF A;  3RK3 D;  3P5H A;  1IXX A;  3WSR A;  1RE4 A;  1Y17 B;  1HUP A;  1SVF A;  4GIF A;  3C22 A;  3V2N A;  3IKQ A;  2XU6 A;  1N2D C;  3UBU B;  5KJ7 A;  4C9F A;  3OAK A;  3GPR C;  2POH A;  3RK3 B;  4WY4 A;  1HVV A;  2WIT A;  1BJ3 B;  1DEB A;  1H8U A;  5B1W A;  4GKG A;  1L4A C;  1KWV A;  1KWT A;  1IOD A;  1L4A A;  1DY0 A;  1E5W A;  3GPR B;  3M06 A;  3C8K D;  3NCX A;  1N73 C;  1JO5 A;  1JZN A;  1LIT A;  3NFQ A;  1RF1 A;  1YTT A;  1RE3 A;  1NO4 A;  2N1T B;  1FVU B;  1F02 I;  2Z4E A;  4I6M C;  1GU5 A;  4M17 A;  1QL1 A;  2J59 M;  3ZHG D;  5AW4 B;  1RDO 1;  1J2J B;  1FZC B;  1EGG A;  1KZB 1;  4Y99 C;  1MPU A;  1OZ7 B;  2LS8 A;  3MTU E;  1EGI A;  3G81 A;  4GT1 A;  2I83 A;  3PAR A;  1ZN5 A;  3EQ2 A;  4M3L A;  1YTZ T;  2XKM A;  5APV A;  1YPO A;  4QKJ A;  1FIH A;  2YHF A;  1L0N K;  1RE4 C;  5AW3 B;  4ZES A;  1JWI B;  4DOJ A;  2I1J A;  1SFC A;  5KTH A;  1N7S B;  2XV5 A;  2Q5U A;  4J6K A;  4C16 A;  3NCW A;  3VN0 A;  5KTB A;  2Q9I A;  4N33 A;  1NTK K;  4LC1 A;  1IFN A;  2RID A;  3V4W A;  1SQP K;  1QDD A;  1SB2 B;  1LTJ C;  2KB7 P;  2HPC B;  1JMM A;  3T97 A;  2WPQ A;  3CDG F;  1X8Y A;  1Y17 A;  1M7L A;  1GL2 D;  4IFD K;  3HE5 A;  2PAJ A;  5AVQ B;  1GK6 A;  1LT9 B;  1RE3 C;  3B8E B;  5CJ0 A;  2ZXE B;  1P1Z D;  3OJA B;  2IFN A;  1T2K C;  1RDL 1;  1T8C A;  2Z5H A;  1IFM A;  1J35 A;  1RDM 1;  1YYC A;  5CCH D;  1HTN A;  2WSC H;  4YLI A;  3IKP A;  2J58 A;  3KDP B;  1S9K E;  1RJH A;  1BNL A;  3WWK C;  2R3C A;  3T3A A;  1ZR4 A;  1X79 B;  2Z5I A;  2IX7 C;  3M91 A;  3P8C D;  2WPS A;  5AW7 B;  2MJZ A;  2L5G B;  3SWY A;  1SQQ K;  3VYJ A;  1KIL C;  3VOP A;  1LTA C;  4J6M A;  1JTH B;  2KP8 A;  4XE5 B;  2WPR A;  2Q7C A;  4AQR D;  1BYF A;  1L4A D;  1DY1 A;  3ALT A;  4N35 A;  1TDQ B;  4J6L A;  2RIC A;  5AVX B;  1K9J A;  1SP4 A;  2N9B A;  1KOE A;  3KYQ A;  3VMZ A;  1IJK C;  1M1J C;  4LQF A;  4C7N B;  1UEX B;  1V7P B;  1N7L A;  2BRS A;  3FF8 C;  1MSB A;  2C0W A;  1X2W B;  2YO2 A;  2KV3 A;  4CAJ A;  1G1J A;  3VP8 A;  2FFD B;  3L36 A;  1ZLL A;  1AFD 1;  4GJ0 A;  4N78 E;  1B08 A;  2IT6 A;  2XR6 A;  4LGD E;  1KZC 1;  4W7Z A;  4KI1 E;  5AW2 B;  5APT A;  2VRP B;  3CL3 D;  2YKO A;  4IOP A;  1FIF A;  4WY4 D;  1JA3 A;  1UMR C;  3G83 A;  4WB4 A;  5BU5 A;  1IJD B;  4N36 A;  2CPB A;  5APU A;  4ZKP A;  4KHX A;  1DH3 A;  1SQX K;  1WT9 B;  1WMY A;  1FAV A;  1FZB A;  3IFM A;  2QM7 A;  3M9H A;  3HD7 C;  4I2L C;  1G1R A;  3RK2 D;  1MUQ A;  1N7S A;  2VUV A;  5BU8 B;  1T3U A;  2I1K A;  3CLQ A;  2P67 A;  2A45 H;  3P7K A;  1KZA 1;  3VTP C;  1FZE A;  1HJB A;  5FFT A;  1WK1 A;  3TK1 A;  1DY2 A;  5FFS A;  1QL2 A;  3BAS A;  1XTC C;  2NPS C;  3EFG A;  3ALS A;  3A7O A;  1T8D A;  1YXJ A;  2ORJ A;  3H32 B;  1JOC A;  4EZM G;  1KG0 C;  1J1E B;  3TNU A;  3RL0 B;  3TNU B;  2H43 A;  1IXX B;  1U0N B;  4AUW A;  1WRG A;  4WY4 C;  2H7H A;  1SB2 A;  3GPR D;  1YTZ I;  3P5E A;  2LKM A;  1GZL A;  3IKR A;  3WBQ A;  1YXK A;  2H2T B;  3UIA A;  1ZR2 A;  1URQ B;  1NTZ K;  1SQB K;  2GUV A;  1KWY A;  5KLV K;  1UMR A;  3CAD A;  4KZW A;  4WQQ A;  1MZ9 A;  3P5G A;  1N73 B;  3MGN A;  1N73 A;  2P2U A;  1BCH 1;  1JWI A;  3V5B A;  5AVT B;  3P8M C;  1VPC A;  2OYI C;  1A02 J;  4DN8 A;  1NKZ B;  3WH3 A;  3ZHG A;  2IT5 A;  1VDF A;  2WSF H;  1KWW A;  1O7C T;  4S0U A;  5B1R A;  3PBF A;  1PFI A;  4J6N A;  1CZQ A;  3U1C A;  1N86 A;  4QKI A;  3U59 A;  2NPS D;  1HQ8 A;  1G2C B;  2ZQK A;  3N4X A;  3VPP A;  1LTI C;  3FF9 A;  1SFC C;  2HYN A;  4JF7 A;  2OYH C;  3CI9 A;  1L4A B;  3P32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...