3KQGA

Trimeric structure of langerin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
169
structure length
169
Chain Sequence
b'SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-type lectin domain family 4 member K
publication title Trimeric structure of langerin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kqgA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3kqgA02
3CDGE 4KHXA 5FFTA 1S9KD 1X2TB 5AVUB 3VYJA 3P7KA 3T3AA 2BRSA 2R32A 3VN0A 3FF7C 3C8JA 1KWTA 3GPRA 3M91A 2BPEA 2CL8A 4N34A 2E42A 3WBRA 1JUNA 1IXXB 1KWZA 1FM5A 3KDPB 2OX8A 1BYFA 4IOPA 3I5CA 2R5BA 1J2JB 4J6QA 1KZA1 5CMZA 4M17A 5APXA 4PDCA 3TK1A 3ALSA 2GO0A 1OZ7A 4CSYA 4AUWA 1G2CB 4WUWA 1NAFA 1DY0A 2I83A 1HUCA 3UBUB 3BX4A 4KMB1 4QKGA 4GT1A 1CZQA 2VRPA 4ZETA 3M9BA 2YNYA 3BDWB 3HUPA 1AFD1 1SB2A 3P5GA 4J6NA 4I6MC 1IODA 1E8IA 2ORJA 1BCJ1 1RDO1 3NXSA 3A2AA 5AW1B 2PF5A 2H2RA 5APQA 5F2QA 2BASA 4E52A 1ESLA 5AW3B 3B8EB 1UMRA 4YMDA 4C7NB 1AFB1 1HTNA 3VPPA 3MGNA 3P32A 1MUQA 4LQFA 4N32A 1B08A 1K9IA 3RS1A 3PARA 3TYYA 3CFWA 3HE4A 5B1XA 2IPPA 3OAKA 1HBWA 3WWKC 3HE5A 1RDJ1 1FVUA 2XU6A 1XPHA 4J6JA 4CAJA 4AK8A 4I2LC 1UOSA 3PAKA 5AVYB 3V4QA 1GTWA 1YPUA 1BJ3B 3NCXA 2BPHA 3WWKB 5M62A 3P5HA 4ZRVA 2ZWKA 1KWVA 5APVA 1GU5A 5AVQB 2N40A 1UV0A 4ZRWA 1MFZA 5APTA 3M0DA 1WMZA 1CI6A 4AYCA 1UEXA 4QKJA 4KI1E 4WRFA 2IT5A 3G81A 3IKNA 2VUZA 3WBQA 1V4LB 4J6LA 4WREA 4G9AA 1Y17A 1H89A 2MSBA 5KTHA 3ZHGA 1H8UA 5K8YA 4HYTB 2H7HA 1JWIA 1XARA 1TDQB 3P5IA 4YLIA 4AQRD 3VLGA 3P7FA 2RIDA 4N35A 3L37A 5APWA 1O7BT 4J6PA 1F02I 1KQLA 1GK6A 2H2TB 2ZXEB 1X2WB 3FF9A 4XE5B 1G1QA 4KZVA 3VTPC 4N33A 2XR5A 4G96A 1C3AB 2KV3A 4M3LA 1F00I 3V4WA 4JYCA 1R14A 3TNUB 1YXJA 1X2TA 2ORKA 4GI0A 2P2UA 5AVVB 1LITA 1R13A 1SL6A 1FOSF 1BUUA 5AVSB 3M0AA 2BPDA 2JJLA 1J35A 4RESB 2AFPA 4N36A 1JZNA 2VRSA 1SP4A 3NMDA 3NFQA 4ZESA 4EZMG 1YXKA 3VYKA 1IO4A 1KWUA 4GK1A 4B86A 3G8LA 3G84A 1HUPA 1DH3A 2RICA 4IOPB 3ALTA 5AW5B 1UKMA 2WWWA 1YPQA 2P67A 4C46A 1OZ7B 1E5UI 2PY2A 1WK1A 3BDWA 3BX4B 1U0OA 3NTNA 2GGUA 1KMB1 3P5EA 1CSBA 2VRPB 2XV5A 1SB2B 3P5DA 1DY1A 1IODB 1E87A 2ZQKA 3VMYA 2WPQA 4MTHA 1JA3A 1X8YA 1P4LD 4C9FA 4KZWA 5FFRA 5APSA 4DZOA 1KWWA 1TN3A 4J6KA 1FIHA 3FD4A 2LS8A 2RIBA 3A5TA 1GD2E 2N9BA 5B1RA 2WT7A 3L36A 2KP8A 1KZB1 3VYIA 4WCOA 5AW8B 3HE4B 2E3XC 3M06A 1GZLA 3HE5B 1NWQA 1FVUB 1FOSE 5AVWB 2OX9A 1SLQA 1UOSB 2OS9A 4QKIA 1B6EA 4UWWA 2IT6A 3CCKA 1FAVA 1J34B 1WT9A 1V7PA 2E3XB 1AFA1 5AVRB 1HYRA 1RDM1 1CWVA 1IJKC 5AW4B 2QM8A 2R3CA 1KOEA 3PBFA 4GKOG 1CI6B 3L9JC 4GKGA 3CADA 2RIAA 1IJKB 3VMZA 3WHDA 4N38A 4WR9A 3ALUA 4UXMA 3IKQA 1Y17B 2W6AA 3SWFA 2Q5UA 1RDN1 2R5DA 1EGGA 1KZD1 1JWIB 5AW9B 4WQQA 1YYCA 1GK4A 1KCGA 1JNMA 1RDI1 4EOTA 4S0UA 3G83A 3C8KD 1MV8A 3GPRC 3KQGA 2XZRA 4GJXA 4M1GA 2ZIBA 1QDDA 1IXXA 1T2KD 5J6GG 3UIAA 1G1SA 1H8AA 1RJHA 1T8DA 3P7GA 5AW6B 3GPRB 1HQ8A 5APYA 3A7OA 1OWAA 2YO2A 2MTIA 2C6UA 3A3YB 1J35B 3WH3A 4LC1A 1H88A 3WH2A 1G1TA 3P5FA 3UBUA 2C9LY 2Z5HA 1KX1A 4C16A 3L35A 1A02J 1T2KC 4WRCA 1FIFA 1T8CA 1MSBA 5FFSA 2P7JA 3C22A 1EGIA 2WPRA 3NCWA 1DY2A 1SL4A 3KMB1 1TLGA 1QO3C 1O7CT 1UKMB 1RDK1 3M9HA 2YO3A 5AW2B 2RIEA 1BNLA 3V5BA 3CDGF 2KMB1 1U0OB 1UMRC 3MD0A 1U0NC 2XR6A 4C7NA 1MUUA 1RDL1 3IR9A 2ZFCA 3VMXA 4LU5A 1KG0C 3WBPA 1HWTC 3WSRA 1U0NB 3LIDA 1G1RA 4QKHA 2WTYA 2C9NY 5APUA 1DV8A 1WMYA 3DBZA 1BCH1 1K9JA 3K7BA 1OXZA 5LGKE 2YHFA 1RTM1 2QM7A 1BJ3A 3WWKA 2M94A 3O8ZA 3LIEA 5AW7B 3PAQA 3ZHGD 4J6MA 5KTIA 1YPOA 1KZC1 3IKPA 2VUVA 3M9ZA 3P8MC 1KZE1 2WT7B 1MPUA 2Z5IA 4DN8A 1BV4A 1KWYA 1J34A 1KWXA 1A02F 3HTKA 2Q7CA 1P1ZD 3G8KA 3P7HA 4WUXA 1PWBA 1V4LA 3FF8C 1PW9A 1WT9B 1UEXB 1V7PB 4N37A 5AW0B 3IKRA 1KX0A 1HJBA 5AVZB 2GGXA 1SL5A 5AVXB 1YTTA 3GPRD 2W27A 1GZ2A 5B1WA 2WPSA 1S9KE 2E43A 1X2WA 5AVTB 4PP8A 4JYBA 1C3AA 1GU4A 4GJ0A 3TNUA 3T97A 4M18A 2Q3IA
chains in the Genus database with same CATH superfamily
1M57D 2OYOA 1HF9A 1S2EA 1AJYA 1VQ6P 2QVAA 2KS1B 5FFTA 2K9JA 3P7KA 3TF5A 1K8AQ 1EDLA 5CCGD 3FF7C 3C8JA 1KWTA 3M91A 2CL8A 3WBRA 1N7SD 1KWZA 2JP3A 3KDPB 1VQ5P 1ZR4A 1KYOE 3PJSK 4GODA 1KQSO 1BE3D 1P84H 3H1IE 5CMZA 3L72J 1PP9G 5KLIB 3IAOA 1ZOYC 1G2CB 1OX3A 1M1JC 2I83A 1LT9A 2K3RA 2XNXA 2N1TD 4O9BA 2ZT9C 3CWBE 3H1KD 3H1LJ 1NOHA 4WY4A 2HR3A 1EXIA 3BDWB 3HUPA 4EI2A 2HLOA 1S3JA 3K5BA 4I7ZB 1RDO1 1JM0A 3NXSA 4PV1D 3GG2A 1K05A 4H44C 4E52A 1ESLA 3SSUA 2M5AB 4U7JA 2Q1KA 3A0HE 1X22A 4C7NB 1AFB1 2JKVA 3JC22 4JPZB 3JSVC 3BCCJ 2E5YA 2A06D 3HE4A 1U7MA 5B1XA 3WWKC 2QSIA 5KKZB 1XPHA 4J6JA 4CAJA 1IFPA 1SQQG 3PAKA 2W6BA 2HYNA 1JTHA 3V4QA 1YPUA 5M62A 3P5HA 1KWVA 1NTKG 1UV0A 1E5WA 1CW5A 5APTA 1CI6A 2NPSB 2FYUD 2YMYA 3BRTB 4WRFA 2IT5A 3IKNA 3G71P 2Y9YA 2IX7C 3KZIH 1V4LB 4BWNA 4J6LA 3H1JD 4WREA 4G9AA 1Y17A 2MSBA 3V2NA 5KJ7A 5TISE 1FZCA 3RBZA 3F89A 1JCDA 5CCHC 2I1JA 4N35A 3FXEA 2D2CC 4R4MA 2H2TB 1X2WB 4KZVA 4N33A 1L0ND 3MTUE 1AFOA 1C3AB 4M3LA 1F00I 1YITP 3V4WA 1R14A 3ZDMA 3G6EP 1R13A 1SL6A 2YKQA 4C7RA 1MFTA 5AVSB 4LLHA 3H1KE 1LTJA 2AXTE 3B5NB 5E79E 3AE9C 1KORA 4WBAA 1KWUA 3L74G 3L73J 4YTPC 2P10A 2RN0A 2AEFA 1OZ7B 2HODA 1VQMP 1QVFO 3BX4B 2YIUC 2A06E 1UIIA 3JCUH 1NTMG 2VRPB 1YIJP 2KK7A 2KLUA 3CXHI 1JY2O 2QEXP 1KFMA 1N73B 1IC2A 3U1CA 2WQYC 1BSHA 2NPSD 2WPQA 1RY3A 3E1IA 1Y8AA 2POHA 1VQOP 1PGPA 4YXWH 4J6KA 2QJKC 4PD4D 3L70J 1S1CX 2K1AA 1L2PA 2KP8A 1KZB1 3VYIA 4WCOA 5BU8B 1IJDB 2IFMA 1KILB 1RQUA 2E3XC 3M06A 1YJWP 1GL2B 1NWQA 3CC4P 1FVUB 1URQA 1UOSB 1YJNP 1B6EA 2IT6A 3L75D 4UWWA 3GHGA 1HYRA 4U3FJ 4H13C 2ITAA 1Q82Q 2QM8A 1KOEA 2N9YB 2XNDH 1KTMA 3L74E 3MP7B 3B5ND 3HD7B 3WHDA 4N38A 1X79B 3CXHH 3IKQA 3WU2E 2W6AA 2ZYDA 4BRYB 1JWIB 3FWLA 4WQQA 4L76A 1LWUB 1YHQP 1JEKA 1JNMA 3AEEC 2P58A 1RDI1 1R8EA 1NYHA 3G83A 3C8KD 3CCJP 1GW4A 5B5EH 2XZRA 4GJXA 4M1GA 1NU1D 1Z56A 1IXXA 3RK2B 3P7GA 2PFXA 5AW6B 3GPRB 1HQ8A 2YXQB 1OWAA 2MTIA 1J35B 4ZKPA 1YI2P 1Q81Q 1G1TA 2E75B 5C39A 3P5FA 3UBUA 4HH2A 2C9LY 2Z5HA 4C16A 3IFMA 4IL6X 3V2PA 1MSBA 5FFSA 1EGIA 3SFDC 2WPRA 3CD6P 3NCWA 1DY2A 5CBNA 2M3BA 2KZIA 1O7CT 2H88C 4Z1MH 1KILD 2B87A 3P8CD 1VQPP 1GL2D 2V7QJ 4K35A 2KMB1 1U0OB 2WSCH 1U0NC 2OTKE 2IBZG 1P84E 1MUUA 2BCCD 1IFNA 1RDL1 1FC2C 1NTZG 1KG0C 3WSRA 4KT0J 3LIDA 1QX8A 3I55P 1ZN5A 3RBXA 3DBZA 3HD7D 4D6TJ 1BCH1 1RTM1 2QM7A 3WWKA 2M94A 3LIEA 2GA1A 2VUVA 3P8MC 1MZ9A 1KZE1 2WT7B 3AE3C 2Z5IA 1USEA 3AE4C 3G8KA 4WUXA 2LKMA 3CX5H 2J59M 1PW9A 3F5HA 1WT9B 3WUVA 2O1JA 3L70D 3AEDC 4ZMDA 4GIFA 1LTTC 5AVZB 3HUSB 3RK2D 3CC7P 1SQVD 1VQKP 1SL5A 3GPRD 2ZYGA 1S9KE 2E43A 4OGQC 2OYHB 5CCHA 2E75D 1BE3J 2B88A 2RMZA 4GJ0A 3U1AA 1L4AB 4XA4A 3CDGE 2JR8A 3PRJA 1Q7YQ 4KHXA 3R2PA 2FYUK 3H1KJ 3KZIE 1X2TB 3LW5J 5AVUB 3T3AA 2D2CB 2KI7B 2WSEJ 2KLVA 2KNCB 2J5UA 1KILE 1VF5C 2KOGA 2OX8A 2O01J 2R5BA 1J2JB 1SFCB 1KZA1 4OVNF 5APXA 3B4SA 4JBZA 2LXBA 2FXOA 4CSYA 2BCCE 2FXPA 4WUWA 1EDIA 1NAFA 1HUCA 1L0NK 2E74C 1N86A 1GW3A 3CCVP 3M9BA 1KYOD 1SB2A 3H1ID 5CCGA 1BCJ1 3D71A 4R4LA 2PF5A 2H2RA 1OVUA 1QEXA 5APQA 5F2QA 3L4FA 5AW3B 3L71G 3CWBD 2YIUB 2FYUJ 1KV4A 3S9OA 1IFIA 3VPPA 3P32A 4N32A 1T3UA 4Y99B 3OAKA 2ZJSE 1HBWA 3HE5A 1RDJ1 3JCUE 1AVOA 2G8YA 1URQC 4I2LC 1SQBD 2KXPB 3GHGC 1GTWA 2BPHA 4ZRVA 2AXCA 1L4AD 2QJKB 2N40A 1Q90D 5KLVG 1ZW0A 4K3AA 3M0DA 1WMZA 5GTHH 2K9YA 3L74J 1ZP0C 1UEXA 4KI1E 3HTKB 2VUZA 2O3JA 2D2CD 1PPJG 1W5CE 2KSEA 3ZHGA 1SQPG 2DW3A 3C1LA 1XARA 3ABVC 4YLIA 1K9MQ 2W90A 3VLGA 1WT6A 2E76C 1SFCD 1KQLA 4IL6H 1GK6A 3PH0A 2IFNA 1G1QA 1PP9D 4N3YB 4G96A 4JYCA 2C0WA 3TNUB 1YXJA 1KFNA 3L71E 4ASWA 1FOSF 1BUUA 3MUDC 3Q3DA 1NJIQ 3M0AA 2BPDA 2K9JB 4H0LB 3CXHE 5DJTB 4KJMA 1JZNA 2VRSA 3G9RA 4ZESA 1YXKA 3VYKA 3PLNA 4GDOA 4NPDA 2PAJA 1RHZB 1HUPA 1TU3F 1IK9A 3AE8C 3CCUP 2WMMA 2IBZI 1SS1A 5B5EE 1RE3A 5KLVE 1WK1A 1LT9B 3BDWA 3AE1C 3N7NA 3S4RA 1NU1K 2GGUA 1SQQD 2XV5A 4WY4B 1JMMA 1SQBE 1PPJE 2IYOA 3P5DA 3L75J 3SFEC 1J1DB 1NTKD 1AVYA 2ZQKA 4MTHA 3Q5RA 3FX0A 1JA3A 1X8YA 4WWIA 1P4LD 4C9FA 3AEGC 2KZJA 5FFRA 2FFDC 1OVVA 1EXJA 2MKVA 5GTIH 1FIHA 1LTBC 3FD4A 2RIBA 3TGUG 3A5TA 1GD2E 2N9BA 2JEEA 3L36A 4UB8H 3MZWB 1J1EC 3HE4B 1GZLA 2GUVA 1NHLA 5AVWB 2OX9A 1U57A 4QKIA 1JTHB 3AEFC 1FAVA 1J34B 1GDTA 1V7PA 1BGYG 3KYQA 5AVRB 3O6QA 1PP9E 1FBMA 1YTZT 3PBFA 3Q5PA 1CI6B 1W2EA 4Y28J 4GKGA 1NU1J 4H0LD 2M8RA 2RIAA 1S5LX 3B71A 1IJKB 3BATA 2PGDA 1SVFA 1SQXG 1S4XA 1Y17B 1RDN1 1JY2N 3RK3C 1FZCB 3CI9A 2V4HA 3Q5SA 3L74D 3CX5E 1GK4A 2M3EA 4EOTA 4S0UA 2OGUA 1L0LG 2A45G 2JDIH 1QDDA 3RL0g 2AEJA 4WY4D 3UIAA 1SQVK 1T8DA 4HB1A 1NTMD 3A7OA 2YO2A 3H1HG 1LTJB 2C6UA 1SQQE 2BCCJ 4LC1A 1H88A 3TGUE 3D6ZA 3WH2A 1PGJA 3EFFK 4EYYQ 2IZ0A 1HVVA 3FXDA 1NTKE 1A02J 3V2RA 1EC5A 1T8CA 3C22A 1L0NG 5CCGC 1BGYE 2LXCB 1RDK1 1LP1A 1N7SC 3II6A 1KZUB 2HODB 2YO3A 2RIEA 3VMAA 1DIPA 2OYIC 2E74B 2Q6QA 1KB9I 3IR9A 1IK7A 2ZFCA 3VMXA 4LU5A 2N1TC 4GOEA 2C9NY 1JY3P 1LTSC 1DEEG 3K7BA 1SQVJ 1OXZA 1M7LA 2UWJE 1P84D 1BJ3A 1G1JA 4PV1C 5KJ7D 1YPOA 3IKPA 3M9ZA 1FDIA 5KAFH 1L0LE 3M0DC 4EIJA 5KAIH 1WMKA 1LTAC 3L72G 1NH4A 1URQB 1JB0J 1QL1A 4N37A 3GHGB 4DCKA 2FY8A 5AW0B 3IKRA 2QA4P 2GGXA 3H1LG 4UB6H 5AVXB 2H43A 1YTTA 3HRNA 3GLMA 2KSJA 5TJHA 1SQBK 2IDBA 1KB9H 1NTME 1PZQA 1VPCA 1KC8Q 3T97A 1OIPA 4M18A 5GTHE 1NKNA 3BASA 2KYVA 3L71J 2Y0EA 5EFWB 2R3SA 3R4YA 4W7ZA 3BCCG 1EZVG 1AA0A 3CMAP 1S9KD 3VYJA 2BRSA 1JO5A 1JY3N 3VN0A 3H1IJ 3MUDA 4RKUJ 2YXRB 3GPRA 4N34A 3Q1MA 2E74D 2E42A 3WUUA 1JUNA 1IXXB 2I8DA 5KLIC 3RL0C 1R5SA 2YKOA 4IL6E 4IOPA 3CWBJ 2IBZD 4J6QA 4M17A 3TK1A 3CX5I 3EQ2A 2GO0A 1OZHA 1NTZD 1RE3C 5KLVJ 3BRVB 1DY0A 3UBUB 1RF1A 4QKGA 4I7ZC 1K73Q 1T8ZA 4ZETA 1M1JB 2YNYA 1FE6A 1SQBJ 1AFD1 1YJ9P 3P5GA 4J6NA 3V2QA 1IODA 1E8IA 2ORJA 1Y47A 2ZT9B 2WZ7A 5AW1B 2B87B 2JO1A 2BASA 4BXLA 1DD3A 1XTCC 2BEZF 1URQD 2O1KA 3B8EB 1X9VA 1KQGB 2QJPC 2FXMA 4YMDA 4L73A 4H44B 1S5LH 2BEQD 3H32A 3MGNA 5KKZC 1MUQA 1K9IA 2FFDA 3TYYA 1YTZI 4OWFA 3E1RA 2WSCJ 4N78D 4PJ0H 3CCMP 1FZFA 4TLFA 1EZVE 1SQQK 1FDMA 3NCXA 3WWKB 2E5TA 2OQQA 2NPSC 2ZWKA 1YQ3C 5AVQB 1XTGB 4IFFA 1PP9J 1NO4A 3L73G 4AYCA 1J1EB 2ZAEB 4QKJA 2SPZA 5B66H 3G81A 2RH0A 3WBQA 5GTIE 1VL2A 4HYTB 2H7HA 4UB8E 1ZR2A 3P5IA 3P7FA 2RIDA 2Q3EA 3L37A 2A45I 1H0TA 1F02I 2OTLP 3AEAC 2ZXEB 3FF9A 2WSEH 4XE5B 3VTPC 2IBZE 3FGAD 2C0XA 2JWDA 2XR5A 2KV3A 2CK3H 3CLQA 1NTZE 1X2TA 4GI0A 3TSIA 2P2UA 5AVVB 1LITA 2O01H 2WSFH 2ZT9D 2JJLA 4ZNCA 4RESB 1SQQJ 3GF7A 4N36A 2HPCA 3NFQA 4EZMG 3QH9A 1NTKJ 2FYNC 5H2FH 1RF0A 3GF3A 1IO4A 3L71D 3G8LA 3G84A 4H44D 4RO0A 4U3FG 3CXHD 2ZYAA 1FZBA 1UKMA 2WWWA 1HH0A 2QIWA 4C46A 2Y0CA 3S1KA 3CCEP 1JOCA 3NTNA 1N7SA 3KHUA 1N73C 1ZRTE 1PL5A 2A45H 4N78E 3QWOC 1SB2B 1NTMK 3KXDA 2OYIA 1DY1A 2MJZA 4TT3H 5KLVD 3VMYA 1FU1A 1RH5B 2N1TA 2QJYC 5CBOA 4DZOA 1TN3A 2M0BA 1PPJD 2LS8A 4HKZH 1KQFB 5B1RA 1SQPD 3HE5B 5DJUB 1HJ0A 1SLQA 2OS9A 2CPBA 5CCHD 3CCKA 2J58A 4PD4I 2E3XB 1VQNP 2W83C 3OA7A 1RDM1 5AW4B 2R3CA 3D70A 3A0BH 3L9JC 3CADA 1YQ4C 4H13B 3MIWA 2WSSH 3VMZA 1NTMJ 3ALUA 2LR2A 1EZVI 1YBKA 3WUTA 2Q5UA 5KAFE 1EGGA 1KZD1 5KAIE 3VP9A 1BCCG 2G3AA 2KS1A 1KCGA 1N7LA 2QE7H 3IF4A 1LJ2A 1N8RQ 5BU5A 1MKMA 3G3ZA 3RK2C 3GPRC 1M90Q 4D6TG 3Q2YA 2ZIBA 4UB6E 5BVZA 5J6GG 1G1SA 1H8AA 1NKZB 1RJHA 2E75C 3CX5D 1KB9E 3N4XA 3A3YB 4IOIH 3WH3A 3CC2P 4PD4H 2I1KA 1G2CA 2B9BA 1RF1C 3VOPA 3L35A 1T2KC 4WRCA 1FIFA 2P7JA 1FJKA 3RL0B 2W6JH 1RE4C 2Y0DA 4DT0A 1Y9BA 1AV1A 1JY2P 3TGUD 3AEBC 3M9HA 5AW2B 3PP5A 1UIXA 2M5AA 1SQPE 3CDGF 5L8RJ 2XR6A 1BE3G 4C7NA 3PHLA 1ZXGA 4N6JA 3H25A 1AQ5A 1BGYD 2NZ2A 1HWTC 1G1IA 1U0NB 1NTZK 1G1RA 4QKHA 2WTYA 4H13D 2FKWB 3H1KG 1DV8A 5CHXA 2L91A 3RK3E 1VQ8P 1BCCE 4NPFX 4DOJA 5LGKE 2K88A 2QJPB 2WPVB 1PFIA 3O8ZA 3ZHGD 3PAQA 4J6MA 5KTIA 1KZC1 1SQXD 2RKLA 1VDFA 1MPUA 4D6TE 4DN8A 2P1JA 2NPSA 4DJGA 2IYPA 1J34A 1KWXA 1A02F 3P7HA 3AE5C 1V4LA 1S5LE 3HUSC 1EQ7A 1V7PB 3CCSP 2A06G 3O6QB 1KX0A 1L0LD 2OYHC 3ITKA 4JF7A 2W27A 4PJ0E 1HGZA 2H89C 1LGHB 5B1WA 2WVRA 1L4AC 1FDOA 1X2WA 2ZVOB 5AVTB 3H1HD 4ASVA 1QGKB 1NAYA 4PP8A 1OW8A 3W67A 4JYBA 1C3AA 1GU4A 1D7MA 1NTZJ 2FYZA 1HTLC 4OGQB 2Q3IA 2FYUG 3RL0D 5B66E 3C8VA 4EDFA 1BE3E 3H1JG 3B5NA 3D6YA 4YXDC 2R32A 1RF0C 1SFCC 2BPEA 2NRGA 1IZNB 3C9IA 1FM5A 2XDJA 3CCQP 1BSNA 1BYFA 3BVHA 3I5CA 4PDCA 1RQVA 3ALSA 1R5LA 1VF5B 1OZ7A 4MN4C 4AUWA 2B89A 5CJ0A 2PRRA 3BX4A 1NVOA 3AE6C 3EWKA 4KMB1 4GT1A 1KMIZ 2FYNB 2KUBA 1CZQA 2VRPA 3CPWO 4I6MC 2Y9ZA 1N73A 1BDCA 3A2AA 1VQLP 1LP1B 3G4SP 5H2FE 1SQXE 4L75A 3CCRP 2WITA 1VQ9P 1UMRA 1KYOI 3L72D 3AECC 4Y99C 1E79H 1HTNA 2HFED 3EFGA 1T6AA 3CMEP 4LQFA 1B08A 3RS1A 3PARA 3CL3D 1VQ4P 3CFWA 1JCCA 2IPPA 1KILA 3AE2C 1GL2A 3H1LD 1FVUA 2XU6A 1DD4A 2FYUE 4AK8A 1UOSA 5AVYB 2QJYB 1LNQA 3H1JE 1BJ3B 4CPGA 5APVA 1GU5A 1EDKA 4OGQD 3H1HE 4ZRWA 4RJTA 1MFZA 2ZVNB 2XKMA 5KLVK 1M1KQ 1FZAA 3TDKA 3HD7A 5KTBA 3BCCD 1EZVD 1FZEA 1H89A 5KTHA 1H8UA 5K8YA 3VP8A 1L0NE 4BRYA 2QRXA 1K04A 1JWIA 1T3JA 1LTGC 1SQPK 1TDQB 4AQRD 1LWUA 5APWA 1O7BT 4J6PA 3L75G 2O01N 1KYOH 1VF5D 1WRGA 4IFDK 2E76B 1W2BO 2H8PD 4XFJA 4H0LC 1USDA 3A0BE 3W68A 2ORKA 3T97B 4WVZA 3CCLP 1OVRA 1J35A 2AFPA 1SP4A 3NMDA 3OW2O 1HGVA 2QG4A 3I56P 3MHVA 1NGMB 4GK1A 2AEMA 2V7QH 1X0TA 4B86A 3A0HH 1DH3A 2RICA 4IOPB 1LT9C 3ALTA 1PGQA 5AW5B 3OJAB 1GMJA 3L72E 1YPQA 2P67A 1E5UI 1RE4A 2PY2A 4WY4C 1M1JA 1NU1G 3E7KA 1SQPJ 1RF1B 1U0OA 1OFCX 1IFJA 1J1DC 1KMB1 3P5EA 1CSBA 1FS0E 3H1LE 3M9QA 2IZ1A 3KPEA 1PIXA 4PD4E 1IODB 2CPSA 1E87A 1ZMEC 2R44A 4NPEA 1OW6A 3L73D 1PV3A 1S72P 1BCCJ 1Q86Q 4KZWA 1ZRTD 5APSA 1BDDA 1KWWA 3L75E 3H32B 2GM4A 1U7JA 3BCCE 2WT7A 4IFMA 5TISH 2FFDB 5AW8B 1JY3O 3SWYA 4QMAA 1FOSE 1NTKK 2BCCG 2E76D 1KD1Q 1WT9A 1AFA1 4W80A 1CWVA 1IJKC 1IFDA 3HUSA 4I1LA 1AQTA 2FBWC 4GKOG 1VQ7P 1DEBA 1M56D 2W8ZA 5KJ7C 2OYHA 1FZCC 4WR9A 2AXTH 1DX7A 3LW5H 4W7YA 4UXMA 3SWFA 4WB4A 2R5DA 1L4AA 3AE7C 1SQXK 3H6PA 5E79H 5AW9B 1NU1E 4JQ0D 1OMIA 4LGDE 1YYCA 1H0TB 3RK3B 3B5NC 5K5GB 4U3FD 2OARA 3PTZA 3L70G 1MV8A 3KQGA 2KNCA 3TGUJ 3SWKA 1SQVG 1LTJC 1T2KD 1L0LK 1EDJA 2KIKA 3U59A 5M1BA 1SFCA 5APYA 3GW6A 2HPCB 3P8CE 1BGYJ 3RGUA 1KX1A 2ZXXA 2WSFJ 2K37A 3L73E 4A7PA 2YMKA 1SL4A 1FJPA 3KMB1 1KB9D 1TLGA 1QO3C 1UKMB 2OTJP 1SQXJ 1BNLA 3V5BA 2KB7P 1QVGO 1UMRC 1IFMA 1N2DC 1N7SB 1PGOA 3MD0A 4OH8B 1QLED 2OYIB 4YPCA 3WBPA 1KN7A 1KILC 2Z4EA 1GL2C 1ZLLA 5CJ4A 5APUA 1WMYA 1L0LJ 2N1TB 3WMM0 1K9JA 2YHFA 1LT1A 3H1IG 3H1JJ 5AW7B 4L74A 3H1HJ 3L70E 1JMBA 3WU2H 4HJGH 1SQVE 1BV4A 1KWYA 3CWBG 4PV1B 2YKPA 3HTKA 3RK3D 3HD7C 2Q7CA 3V6IA 1P1ZD 2HG5D 1BCCD 1P84I 1Q2NA 1PWBA 3FF8C 1FZGA 1UEXB 1QL2A 2L5GB 1L0NJ 4U3FE 3GMAA 1HJBA 4D6TD 2Q9IA 1LWUC 1OW7A 1SQBG 1GZ2A 2WPSA 4ZKUA 2PP6A 3FWNA 4GOFA 1LTIC 3USSA 1ZV8A 2GUSA 2JWAA 1M8OB 3IN6A 3TNUA
chains in the Genus database with same CATH topology
3BASA 2KYVA 3CDGE 3RL0D 4KHXA 3R2PA 2FYUK 5FFTA 4W7ZA 1S9KD 1X2TB 3B5NA 5AVUB 3VYJA 3P7KA 3T3AA 2BRSA 1JO5A 2R32A 1JY3N 3VN0A 5CCGD 3FF7C 3MUDA 3C8JA 1KWTA 2KLVA 1RF0C 3GPRA 3M91A 1SFCC 2BPEA 2CL8A 4N34A 2E42A 3WBRA 1N7SD 1JUNA 1IXXB 1KWZA 3C9IA 1FM5A 3RL0C 2YKOA 2KOGA 3KDPB 2XDJA 1BYFA 2OX8A 1ZR4A 4IOPA 3BVHA 3I5CA 2R5BA 1J2JB 1SFCB 4J6QA 1KZA1 5CMZA 4M17A 5APXA 4PDCA 3TK1A 3ALSA 3EQ2A 2GO0A 1OZ7A 4CSYA 4AUWA 1RE3C 1G2CB 4WUWA 5CJ0A 1M1JC 1NAFA 3BRVB 1DY0A 2I83A 1HUCA 1LT9A 3UBUB 3BX4A 2XNXA 1L0NK 1RF1A 4KMB1 2N1TD 4O9BA 4QKGA 4GT1A 1N86A 1CZQA 1T8ZA 2VRPA 1GW3A 4ZETA 1NOHA 4WY4A 1M1JB 3M9BA 2YNYA 3BDWB 3HUPA 1AFD1 1SB2A 3P5GA 4J6NA 4I6MC 3V2QA 2HLOA 5CCGA 1IODA 1E8IA 2ORJA 1BCJ1 1N73A 1RDO1 2WZ7A 3NXSA 3A2AA 5AW1B 2PF5A 2H2RA 5APQA 5F2QA 2BASA 4E52A 1ESLA 3L4FA 5AW3B 1XTCC 1URQD 2O1KA 2WITA 3B8EB 1X9VA 1UMRA 2FXMA 4Y99C 4YMDA 4C7NB 1AFB1 1HTNA 1IFIA 3VPPA 3H32A 3MGNA 4M18A 2HFED 3EFGA 3P32A 1MUQA 4LQFA 4N32A 1B08A 1T3UA 1K9IA 3RS1A 3PARA 2FFDA 3CL3D 3TYYA 1YTZI 3HE4A 4Y99B 3CFWA 5B1XA 1JCCA 2IPPA 1KILA 3OAKA 1HBWA 3WWKC 3HE5A 1GL2A 1RDJ1 1FVUA 2XU6A 4N78D 1XPHA 4J6JA 1URQC 4CAJA 4AK8A 4I2LC 1FZFA 1UOSA 3PAKA 2W6BA 5AVYB 2HYNA 1JTHA 3V4QA 3GHGC 1GTWA 1SQQK 1FDMA 1YPUA 1BJ3B 3NCXA 2BPHA 3WWKB 5M62A 3P5HA 2NPSC 4ZRVA 2ZWKA 1KWVA 5APVA 1GU5A 1L4AD 5AVQB 2N40A 1XTGB 4IFFA 1UV0A 1E5WA 1CW5A 1NO4A 4ZRWA 1MFZA 2XKMA 5APTA 3M0DA 1WMZA 1CI6A 4AYCA 5KLVK 1J1EB 2NPSB 1FZAA 1UEXA 2YMYA 4QKJA 3BRTB 4KI1E 3HTKB 4WRFA 2IT5A 3G81A 3IKNA 3HD7A 5KTBA 2VUZA 3WBQA 2IX7C 1V4LB 4J6LA 1FZEA 4WREA 4G9AA 1Y17A 1H89A 2MSBA 5KTHA 3V2NA 1H8UA 3ZHGA 5K8YA 4HYTB 3VP8A 2H7HA 5KJ7A 1JWIA 1FZCA 1T3JA 1XARA 1LTGC 1SQPK 1ZR2A 1TDQB 3P5IA 4YLIA 1JCDA 4AQRD 3VLGA 5CCHC 1WT6A 3P7FA 2I1JA 1LWUA 2RIDA 4N35A 1SFCD 3L37A 5APWA 1O7BT 2A45I 4J6PA 1F02I 1KQLA 1GK6A 2H2TB 2IFNA 2ZXEB 1X2WB 3FF9A 1WRGA 2WSEH 4XE5B 1G1QA 4KZVA 4IFDK 3VTPC 4N3YB 2C0XA 4N33A 2XR5A 4G96A 3MTUE 2H8PD 1AFOA 1C3AB 2KV3A 4M3LA 1F00I 3CLQA 3V4WA 4JYCA 1R14A 2C0WA 3TNUB 1YXJA 1KFNA 1X2TA 2ORKA 4GI0A 3TSIA 2P2UA 5AVVB 1LITA 1R13A 1SL6A 2YKQA 4C7RA 2O01H 2WSFH 1FOSF 1BUUA 5AVSB 4LLHA 1LTJA 3M0AA 2BPDA 2JJLA 1J35A 4RESB 2AFPA 4N36A 3B5NB 1JZNA 2VRSA 1SP4A 3NMDA 2HPCA 3NFQA 1HGVA 4ZESA 4EZMG 1YXKA 3VYKA 4WBAA 1RF0A 1IO4A 1KWUA 4GK1A 4B86A 3G8LA 3G84A 2PAJA 1HUPA 1DH3A 1IK9A 2RICA 4IOPB 1LT9C 3ALTA 5AW5B 1FZBA 3OJAB 1UKMA 2WWWA 1YPQA 1HH0A 2P67A 4C46A 1OZ7B 2HODA 1E5UI 1RE4A 2PY2A 1RE3A 4WY4C 1WK1A 1M1JA 1LT9B 3BDWA 3BX4B 1RF1B 3N7NA 1U0OA 1JOCA 1IFJA 3NTNA 1NU1K 1N7SA 1J1DC 1N73C 1KMB1 2GGUA 3P5EA 1CSBA 2VRPB 2XV5A 4WY4B 1JMMA 2A45H 3M9QA 4N78E 1SB2B 1NTMK 1JY2O 3P5DA 3KPEA 2OYIA 1DY1A 1IODB 2CPSA 1KFMA 1J1DB 1N73B 2MJZA 1IC2A 3U1CA 1E87A 2ZQKA 2NPSD 3VMYA 2WPQA 4MTHA 1RY3A 1FU1A 3E1IA 1JA3A 1X8YA 2N1TA 1P4LD 4C9FA 4KZWA 2POHA 5FFRA 5APSA 4DZOA 1KWWA 1TN3A 2FFDC 4J6KA 1FIHA 1LTBC 3FD4A 2LS8A 2RIBA 3A5TA 3H32B 1GD2E 2N9BA 2GM4A 2JEEA 5B1RA 2WT7A 3L36A 4IFMA 2KP8A 2FFDB 3VYIA 1KZB1 1J1EC 5AW8B 4WCOA 1JY3O 3HE4B 5BU8B 1IJDB 2IFMA 1KILB 2E3XC 3SWYA 3M06A 1GZLA 3HE5B 1GL2B 2GUVA 1NWQA 1FVUB 1NHLA 5AVWB 1FOSE 1NTKK 2OX9A 1URQA 1SLQA 1UOSB 2OS9A 2CPBA 4QKIA 5CCHD 1B6EA 2IT6A 4UWWA 1JTHB 3CCKA 1FAVA 2J58A 1J34B 1GDTA 1WT9A 1V7PA 3GHGA 2E3XB 3KYQA 1AFA1 5AVRB 1HYRA 3OA7A 1RDM1 4W80A 1CWVA 1IJKC 5AW4B 1IFDA 3HUSA 1FBMA 1YTZT 2QM8A 4I1LA 2R3CA 1KOEA 3PBFA 4GKOG 1CI6B 1W2EA 3L9JC 1DEBA 4GKGA 3CADA 3MIWA 2M8RA 2RIAA 1IJKB 3VMZA 5KJ7C 3B5ND 3BATA 3HD7B 3WHDA 2OYHA 1FZCC 4N38A 4WR9A 1X79B 1DX7A 1SVFA 3LW5H 4W7YA 3ALUA 4UXMA 3IKQA 1Y17B 2W6AA 3SWFA 2Q5UA 1RDN1 4WB4A 2R5DA 1L4AA 1EGGA 1SQXK 3H6PA 1KZD1 1JY2N 3RK3C 1FZCB 1JWIB 3CI9A 5AW9B 4WQQA 3VP9A 4LGDE 1LWUB 1YYCA 1GK4A 1KCGA 1JNMA 3RK3B 3B5NC 1N7LA 1RDI1 2OARA 5BU5A 3G3ZA 4EOTA 4S0UA 3RK2C 3C8KD 3G83A 1MV8A 3GPRC 3KQGA 1GW4A 2XZRA 4GJXA 4M1GA 2ZIBA 2A45G 1LTJC 1Z56A 1IXXA 1QDDA 5BVZA 1T2KD 1L0LK 4WY4D 5J6GG 3UIAA 1G1SA 3RK2B 1SQVK 1H8AA 1NKZB 1RJHA 3U59A 1T8DA 3P7GA 5AW6B 3GPRB 1HQ8A 1SFCA 5APYA 3A7OA 1OWAA 2YO2A 2MTIA 3N4XA 1LTJB 2C6UA 3A3YB 1J35B 4ZKPA 3WH3A 4LC1A 1H88A 2I1KA 1G2CA 3WH2A 1G1TA 3P5FA 2HPCB 3P8CE 3UBUA 4HH2A 1RF1C 2C9LY 1HVVA 2Z5HA 3VOPA 1KX1A 4C16A 3L35A 3IFMA 1A02J 1T2KC 3V2RA 4WRCA 3V2PA 1FIFA 1T8CA 1MSBA 5FFSA 2P7JA 3C22A 1EGIA 1FJKA 2WPRA 3RL0B 1RE4C 3NCWA 5CCGC 1DY2A 1SL4A 1FJPA 3KMB1 1TLGA 1QO3C 2M3BA 1O7CT 1UKMB 1JY2P 1RDK1 1N7SC 3II6A 1KZUB 1KILD 2HODB 3M9HA 3P8CD 2YO3A 5AW2B 2RIEA 1GL2D 3PP5A 1BNLA 3V5BA 3CDGF 2OYIC 2KMB1 2KB7P 2WSCH 1U0OB 1UMRC 1IFMA 1N2DC 1N7SB 3MD0A 1U0NC 2XR6A 4C7NA 1MUUA 4OH8B 1IFNA 1RDL1 3IR9A 4N6JA 2ZFCA 1AQ5A 3VMXA 4LU5A 2OYIB 1KG0C 3WBPA 2N1TC 1HWTC 1G1IA 3WSRA 1U0NB 3LIDA 1KILC 1NTZK 2Z4EA 1G1RA 4QKHA 1GL2C 1ZLLA 5CJ4A 2WTYA 2C9NY 5APUA 2FKWB 1ZN5A 1DV8A 5CHXA 1WMYA 3DBZA 1JY3P 1LTSC 3HD7D 2N1TB 3WMM0 1BCH1 1K9JA 3K7BA 1OXZA 4DOJA 5LGKE 2YHFA 1M7LA 1RTM1 2QM7A 1BJ3A 3WWKA 2M94A 1PFIA 3O8ZA 3LIEA 5AW7B 3PAQA 3ZHGD 1G1JA 4J6MA 5KTIA 5KJ7D 1YPOA 1KZC1 3IKPA 2VUVA 3M9ZA 3P8MC 1MZ9A 1KZE1 1VDFA 2WT7B 1MPUA 3M0DC 2Z5IA 4EIJA 4DN8A 1BV4A 2P1JA 2NPSA 1KWYA 1J34A 2YKPA 1A02F 1KWXA 3HTKA 3RK3D 1LTAC 3HD7C 2Q7CA 1P1ZD 2HG5D 3G8KA 1NH4A 3P7HA 4WUXA 2LKMA 1URQB 1PWBA 1V4LA 2J59M 3HUSC 3FF8C 1PW9A 1EQ7A 1FZGA 1QL1A 1UEXB 1V7PB 3GHGB 1WT9B 4N37A 1QL2A 2L5GB 2O1JA 5AW0B 3IKRA 1KX0A 1HJBA 4GIFA 1LTTC 5AVZB 3HUSB 2GGXA 2OYHC 3RK2D 2Q9IA 1LWUC 1SL5A 5AVXB 2H43A 1YTTA 4JF7A 2W27A 3GPRD 1HGZA 1GZ2A 1LGHB 3HRNA 2WPSA 2KSJA 1S9KE 1SQBK 2E43A 5B1WA 1L4AC 4ZKUA 2PP6A 1X2WA 2OYHB 5AVTB 5CCHA 4PP8A 1LTIC 1VPCA 4JYBA 1C3AA 1GU4A 4GJ0A 1ZV8A 2GUSA 3U1AA 1L4AB 2FYZA 3TNUA 1HTLC 3T97A 4XA4A 2Q3IA 1NKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDG E;  4KHX A;  5FFT A;  1S9K D;  1X2T B;  5AVU B;  3VYJ A;  3P7K A;  3T3A A;  2BRS A;  2R32 A;  3VN0 A;  3FF7 C;  3C8J A;  1KWT A;  3GPR A;  3M91 A;  2BPE A;  2CL8 A;  4N34 A;  2E42 A;  3WBR A;  1JUN A;  1IXX B;  1KWZ A;  1FM5 A;  3KDP B;  2OX8 A;  1BYF A;  4IOP A;  3I5C A;  2R5B A;  1J2J B;  4J6Q A;  1KZA 1;  5CMZ A;  4M17 A;  5APX A;  4PDC A;  3TK1 A;  3ALS A;  2GO0 A;  1OZ7 A;  4CSY A;  4AUW A;  1G2C B;  4WUW A;  1NAF A;  1DY0 A;  2I83 A;  1HUC A;  3UBU B;  3BX4 A;  4KMB 1;  4QKG A;  4GT1 A;  1CZQ A;  2VRP A;  4ZET A;  3M9B A;  2YNY A;  3BDW B;  3HUP A;  1AFD 1;  1SB2 A;  3P5G A;  4J6N A;  4I6M C;  1IOD A;  1E8I A;  2ORJ A;  1BCJ 1;  1RDO 1;  3NXS A;  3A2A A;  5AW1 B;  2PF5 A;  2H2R A;  5APQ A;  5F2Q A;  2BAS A;  4E52 A;  1ESL A;  5AW3 B;  3B8E B;  1UMR A;  4YMD A;  4C7N B;  1AFB 1;  1HTN A;  3VPP A;  3MGN A;  3P32 A;  1MUQ A;  4LQF A;  4N32 A;  1B08 A;  1K9I A;  3RS1 A;  3PAR A;  3TYY A;  3CFW A;  3HE4 A;  5B1X A;  2IPP A;  3OAK A;  1HBW A;  3WWK C;  3HE5 A;  1RDJ 1;  1FVU A;  2XU6 A;  1XPH A;  4J6J A;  4CAJ A;  4AK8 A;  4I2L C;  1UOS A;  3PAK A;  5AVY B;  3V4Q A;  1GTW A;  1YPU A;  1BJ3 B;  3NCX A;  2BPH A;  3WWK B;  5M62 A;  3P5H A;  4ZRV A;  2ZWK A;  1KWV A;  5APV A;  1GU5 A;  5AVQ B;  2N40 A;  1UV0 A;  4ZRW A;  1MFZ A;  5APT A;  3M0D A;  1WMZ A;  1CI6 A;  4AYC A;  1UEX A;  4QKJ A;  4KI1 E;  4WRF A;  2IT5 A;  3G81 A;  3IKN A;  2VUZ A;  3WBQ A;  1V4L B;  4J6L A;  4WRE A;  4G9A A;  1Y17 A;  1H89 A;  2MSB A;  5KTH A;  3ZHG A;  1H8U A;  5K8Y A;  4HYT B;  2H7H A;  1JWI A;  1XAR A;  1TDQ B;  3P5I A;  4YLI A;  4AQR D;  3VLG A;  3P7F A;  2RID A;  4N35 A;  3L37 A;  5APW A;  1O7B T;  4J6P A;  1F02 I;  1KQL A;  1GK6 A;  2H2T B;  2ZXE B;  1X2W B;  3FF9 A;  4XE5 B;  1G1Q A;  4KZV A;  3VTP C;  4N33 A;  2XR5 A;  4G96 A;  1C3A B;  2KV3 A;  4M3L A;  1F00 I;  3V4W A;  4JYC A;  1R14 A;  3TNU B;  1YXJ A;  1X2T A;  2ORK A;  4GI0 A;  2P2U A;  5AVV B;  1LIT A;  1R13 A;  1SL6 A;  1FOS F;  1BUU A;  5AVS B;  3M0A A;  2BPD A;  2JJL A;  1J35 A;  4RES B;  2AFP A;  4N36 A;  1JZN A;  2VRS A;  1SP4 A;  3NMD A;  3NFQ A;  4ZES A;  4EZM G;  1YXK A;  3VYK A;  1IO4 A;  1KWU A;  4GK1 A;  4B86 A;  3G8L A;  3G84 A;  1HUP A;  1DH3 A;  2RIC A;  4IOP B;  3ALT A;  5AW5 B;  1UKM A;  2WWW A;  1YPQ A;  2P67 A;  4C46 A;  1OZ7 B;  1E5U I;  2PY2 A;  1WK1 A;  3BDW A;  3BX4 B;  1U0O A;  3NTN A;  2GGU A;  1KMB 1;  3P5E A;  1CSB A;  2VRP B;  2XV5 A;  1SB2 B;  3P5D A;  1DY1 A;  1IOD B;  1E87 A;  2ZQK A;  3VMY A;  2WPQ A;  4MTH A;  1JA3 A;  1X8Y A;  1P4L D;  4C9F A;  4KZW A;  5FFR A;  5APS A;  4DZO A;  1KWW A;  1TN3 A;  4J6K A;  1FIH A;  3FD4 A;  2LS8 A;  2RIB A;  3A5T A;  1GD2 E;  2N9B A;  5B1R A;  2WT7 A;  3L36 A;  2KP8 A;  1KZB 1;  3VYI A;  4WCO A;  5AW8 B;  3HE4 B;  2E3X C;  3M06 A;  1GZL A;  3HE5 B;  1NWQ A;  1FVU B;  1FOS E;  5AVW B;  2OX9 A;  1SLQ A;  1UOS B;  2OS9 A;  4QKI A;  1B6E A;  4UWW A;  2IT6 A;  3CCK A;  1FAV A;  1J34 B;  1WT9 A;  1V7P A;  2E3X B;  1AFA 1;  5AVR B;  1HYR A;  1RDM 1;  1CWV A;  1IJK C;  5AW4 B;  2QM8 A;  2R3C A;  1KOE A;  3PBF A;  4GKO G;  1CI6 B;  3L9J C;  4GKG A;  3CAD A;  2RIA A;  1IJK B;  3VMZ A;  3WHD A;  4N38 A;  4WR9 A;  3ALU A;  4UXM A;  3IKQ A;  1Y17 B;  2W6A A;  3SWF A;  2Q5U A;  1RDN 1;  2R5D A;  1EGG A;  1KZD 1;  1JWI B;  5AW9 B;  4WQQ A;  1YYC A;  1GK4 A;  1KCG A;  1JNM A;  1RDI 1;  4EOT A;  4S0U A;  3G83 A;  3C8K D;  1MV8 A;  3GPR C;  3KQG A;  2XZR A;  4GJX A;  4M1G A;  2ZIB A;  1QDD A;  1IXX A;  1T2K D;  5J6G G;  3UIA A;  1G1S A;  1H8A A;  1RJH A;  1T8D A;  3P7G A;  5AW6 B;  3GPR B;  1HQ8 A;  5APY A;  3A7O A;  1OWA A;  2YO2 A;  2MTI A;  2C6U A;  3A3Y B;  1J35 B;  3WH3 A;  4LC1 A;  1H88 A;  3WH2 A;  1G1T A;  3P5F A;  3UBU A;  2C9L Y;  2Z5H A;  1KX1 A;  4C16 A;  3L35 A;  1A02 J;  1T2K C;  4WRC A;  1FIF A;  1T8C A;  1MSB A;  5FFS A;  2P7J A;  3C22 A;  1EGI A;  2WPR A;  3NCW A;  1DY2 A;  1SL4 A;  3KMB 1;  1TLG A;  1QO3 C;  1O7C T;  1UKM B;  1RDK 1;  3M9H A;  2YO3 A;  5AW2 B;  2RIE A;  1BNL A;  3V5B A;  3CDG F;  2KMB 1;  1U0O B;  1UMR C;  3MD0 A;  1U0N C;  2XR6 A;  4C7N A;  1MUU A;  1RDL 1;  3IR9 A;  2ZFC A;  3VMX A;  4LU5 A;  1KG0 C;  3WBP A;  1HWT C;  3WSR A;  1U0N B;  3LID A;  1G1R A;  4QKH A;  2WTY A;  2C9N Y;  5APU A;  1DV8 A;  1WMY A;  3DBZ A;  1BCH 1;  1K9J A;  3K7B A;  1OXZ A;  5LGK E;  2YHF A;  1RTM 1;  2QM7 A;  1BJ3 A;  3WWK A;  2M94 A;  3O8Z A;  3LIE A;  5AW7 B;  3PAQ A;  3ZHG D;  4J6M A;  5KTI A;  1YPO A;  1KZC 1;  3IKP A;  2VUV A;  3M9Z A;  3P8M C;  1KZE 1;  2WT7 B;  1MPU A;  2Z5I A;  4DN8 A;  1BV4 A;  1KWY A;  1J34 A;  1KWX A;  1A02 F;  3HTK A;  2Q7C A;  1P1Z D;  3G8K A;  3P7H A;  4WUX A;  1PWB A;  1V4L A;  3FF8 C;  1PW9 A;  1WT9 B;  1UEX B;  1V7P B;  4N37 A;  5AW0 B;  3IKR A;  1KX0 A;  1HJB A;  5AVZ B;  2GGX A;  1SL5 A;  5AVX B;  1YTT A;  3GPR D;  2W27 A;  1GZ2 A;  5B1W A;  2WPS A;  1S9K E;  2E43 A;  1X2W A;  5AVT B;  4PP8 A;  4JYB A;  1C3A A;  1GU4 A;  4GJ0 A;  3TNU A;  3T97 A;  4M18 A;  2Q3I A; 
#chains in the Genus database with same CATH topology
 1M57 D;  2OYO A;  1HF9 A;  1S2E A;  1AJY A;  1VQ6 P;  2QVA A;  2KS1 B;  5FFT A;  2K9J A;  3P7K A;  3TF5 A;  1K8A Q;  1EDL A;  5CCG D;  3FF7 C;  3C8J A;  1KWT A;  3M91 A;  2CL8 A;  3WBR A;  1N7S D;  1KWZ A;  2JP3 A;  3KDP B;  1VQ5 P;  1ZR4 A;  1KYO E;  3PJS K;  4GOD A;  1KQS O;  1BE3 D;  1P84 H;  3H1I E;  5CMZ A;  3L72 J;  1PP9 G;  5KLI B;  3IAO A;  1ZOY C;  1G2C B;  1OX3 A;  1M1J C;  2I83 A;  1LT9 A;  2K3R A;  2XNX A;  2N1T D;  4O9B A;  2ZT9 C;  3CWB E;  3H1K D;  3H1L J;  1NOH A;  4WY4 A;  2HR3 A;  1EXI A;  3BDW B;  3HUP A;  4EI2 A;  2HLO A;  1S3J A;  3K5B A;  4I7Z B;  1RDO 1;  1JM0 A;  3NXS A;  4PV1 D;  3GG2 A;  1K05 A;  4H44 C;  4E52 A;  1ESL A;  3SSU A;  2M5A B;  4U7J A;  2Q1K A;  3A0H E;  1X22 A;  4C7N B;  1AFB 1;  2JKV A;  3JC2 2;  4JPZ B;  3JSV C;  3BCC J;  2E5Y A;  2A06 D;  3HE4 A;  1U7M A;  5B1X A;  3WWK C;  2QSI A;  5KKZ B;  1XPH A;  4J6J A;  4CAJ A;  1IFP A;  1SQQ G;  3PAK A;  2W6B A;  2HYN A;  1JTH A;  3V4Q A;  1YPU A;  5M62 A;  3P5H A;  1KWV A;  1NTK G;  1UV0 A;  1E5W A;  1CW5 A;  5APT A;  1CI6 A;  2NPS B;  2FYU D;  2YMY A;  3BRT B;  4WRF A;  2IT5 A;  3IKN A;  3G71 P;  2Y9Y A;  2IX7 C;  3KZI H;  1V4L B;  4BWN A;  4J6L A;  3H1J D;  4WRE A;  4G9A A;  1Y17 A;  2MSB A;  3V2N A;  5KJ7 A;  5TIS E;  1FZC A;  3RBZ A;  3F89 A;  1JCD A;  5CCH C;  2I1J A;  4N35 A;  3FXE A;  2D2C C;  4R4M A;  2H2T B;  1X2W B;  4KZV A;  4N33 A;  1L0N D;  3MTU E;  1AFO A;  1C3A B;  4M3L A;  1F00 I;  1YIT P;  3V4W A;  1R14 A;  3ZDM A;  3G6E P;  1R13 A;  1SL6 A;  2YKQ A;  4C7R A;  1MFT A;  5AVS B;  4LLH A;  3H1K E;  1LTJ A;  2AXT E;  3B5N B;  5E79 E;  3AE9 C;  1KOR A;  4WBA A;  1KWU A;  3L74 G;  3L73 J;  4YTP C;  2P10 A;  2RN0 A;  2AEF A;  1OZ7 B;  2HOD A;  1VQM P;  1QVF O;  3BX4 B;  2YIU C;  2A06 E;  1UII A;  3JCU H;  1NTM G;  2VRP B;  1YIJ P;  2KK7 A;  2KLU A;  3CXH I;  1JY2 O;  2QEX P;  1KFM A;  1N73 B;  1IC2 A;  3U1C A;  2WQY C;  1BSH A;  2NPS D;  2WPQ A;  1RY3 A;  3E1I A;  1Y8A A;  2POH A;  1VQO P;  1PGP A;  4YXW H;  4J6K A;  2QJK C;  4PD4 D;  3L70 J;  1S1C X;  2K1A A;  1L2P A;  2KP8 A;  1KZB 1;  3VYI A;  4WCO A;  5BU8 B;  1IJD B;  2IFM A;  1KIL B;  1RQU A;  2E3X C;  3M06 A;  1YJW P;  1GL2 B;  1NWQ A;  3CC4 P;  1FVU B;  1URQ A;  1UOS B;  1YJN P;  1B6E A;  2IT6 A;  3L75 D;  4UWW A;  3GHG A;  1HYR A;  4U3F J;  4H13 C;  2ITA A;  1Q82 Q;  2QM8 A;  1KOE A;  2N9Y B;  2XND H;  1KTM A;  3L74 E;  3MP7 B;  3B5N D;  3HD7 B;  3WHD A;  4N38 A;  1X79 B;  3CXH H;  3IKQ A;  3WU2 E;  2W6A A;  2ZYD A;  4BRY B;  1JWI B;  3FWL A;  4WQQ A;  4L76 A;  1LWU B;  1YHQ P;  1JEK A;  1JNM A;  3AEE C;  2P58 A;  1RDI 1;  1R8E A;  1NYH A;  3G83 A;  3C8K D;  3CCJ P;  1GW4 A;  5B5E H;  2XZR A;  4GJX A;  4M1G A;  1NU1 D;  1Z56 A;  1IXX A;  3RK2 B;  3P7G A;  2PFX A;  5AW6 B;  3GPR B;  1HQ8 A;  2YXQ B;  1OWA A;  2MTI A;  1J35 B;  4ZKP A;  1YI2 P;  1Q81 Q;  1G1T A;  2E75 B;  5C39 A;  3P5F A;  3UBU A;  4HH2 A;  2C9L Y;  2Z5H A;  4C16 A;  3IFM A;  4IL6 X;  3V2P A;  1MSB A;  5FFS A;  1EGI A;  3SFD C;  2WPR A;  3CD6 P;  3NCW A;  1DY2 A;  5CBN A;  2M3B A;  2KZI A;  1O7C T;  2H88 C;  4Z1M H;  1KIL D;  2B87 A;  3P8C D;  1VQP P;  1GL2 D;  2V7Q J;  4K35 A;  2KMB 1;  1U0O B;  2WSC H;  1U0N C;  2OTK E;  2IBZ G;  1P84 E;  1MUU A;  2BCC D;  1IFN A;  1RDL 1;  1FC2 C;  1NTZ G;  1KG0 C;  3WSR A;  4KT0 J;  3LID A;  1QX8 A;  3I55 P;  1ZN5 A;  3RBX A;  3DBZ A;  3HD7 D;  4D6T J;  1BCH 1;  1RTM 1;  2QM7 A;  3WWK A;  2M94 A;  3LIE A;  2GA1 A;  2VUV A;  3P8M C;  1MZ9 A;  1KZE 1;  2WT7 B;  3AE3 C;  2Z5I A;  1USE A;  3AE4 C;  3G8K A;  4WUX A;  2LKM A;  3CX5 H;  2J59 M;  1PW9 A;  3F5H A;  1WT9 B;  3WUV A;  2O1J A;  3L70 D;  3AED C;  4ZMD A;  4GIF A;  1LTT C;  5AVZ B;  3HUS B;  3RK2 D;  3CC7 P;  1SQV D;  1VQK P;  1SL5 A;  3GPR D;  2ZYG A;  1S9K E;  2E43 A;  4OGQ C;  2OYH B;  5CCH A;  2E75 D;  1BE3 J;  2B88 A;  2RMZ A;  4GJ0 A;  3U1A A;  1L4A B;  4XA4 A;  3CDG E;  2JR8 A;  3PRJ A;  1Q7Y Q;  4KHX A;  3R2P A;  2FYU K;  3H1K J;  3KZI E;  1X2T B;  3LW5 J;  5AVU B;  3T3A A;  2D2C B;  2KI7 B;  2WSE J;  2KLV A;  2KNC B;  2J5U A;  1KIL E;  1VF5 C;  2KOG A;  2OX8 A;  2O01 J;  2R5B A;  1J2J B;  1SFC B;  1KZA 1;  4OVN F;  5APX A;  3B4S A;  4JBZ A;  2LXB A;  2FXO A;  4CSY A;  2BCC E;  2FXP A;  4WUW A;  1EDI A;  1NAF A;  1HUC A;  1L0N K;  2E74 C;  1N86 A;  1GW3 A;  3CCV P;  3M9B A;  1KYO D;  1SB2 A;  3H1I D;  5CCG A;  1BCJ 1;  3D71 A;  4R4L A;  2PF5 A;  2H2R A;  1OVU A;  1QEX A;  5APQ A;  5F2Q A;  3L4F A;  5AW3 B;  3L71 G;  3CWB D;  2YIU B;  2FYU J;  1KV4 A;  3S9O A;  1IFI A;  3VPP A;  3P32 A;  4N32 A;  1T3U A;  4Y99 B;  3OAK A;  2ZJS E;  1HBW A;  3HE5 A;  1RDJ 1;  3JCU E;  1AVO A;  2G8Y A;  1URQ C;  4I2L C;  1SQB D;  2KXP B;  3GHG C;  1GTW A;  2BPH A;  4ZRV A;  2AXC A;  1L4A D;  2QJK B;  2N40 A;  1Q90 D;  5KLV G;  1ZW0 A;  4K3A A;  3M0D A;  1WMZ A;  5GTH H;  2K9Y A;  3L74 J;  1ZP0 C;  1UEX A;  4KI1 E;  3HTK B;  2VUZ A;  2O3J A;  2D2C D;  1PPJ G;  1W5C E;  2KSE A;  3ZHG A;  1SQP G;  2DW3 A;  3C1L A;  1XAR A;  3ABV C;  4YLI A;  1K9M Q;  2W90 A;  3VLG A;  1WT6 A;  2E76 C;  1SFC D;  1KQL A;  4IL6 H;  1GK6 A;  3PH0 A;  2IFN A;  1G1Q A;  1PP9 D;  4N3Y B;  4G96 A;  4JYC A;  2C0W A;  3TNU B;  1YXJ A;  1KFN A;  3L71 E;  4ASW A;  1FOS F;  1BUU A;  3MUD C;  3Q3D A;  1NJI Q;  3M0A A;  2BPD A;  2K9J B;  4H0L B;  3CXH E;  5DJT B;  4KJM A;  1JZN A;  2VRS A;  3G9R A;  4ZES A;  1YXK A;  3VYK A;  3PLN A;  4GDO A;  4NPD A;  2PAJ A;  1RHZ B;  1HUP A;  1TU3 F;  1IK9 A;  3AE8 C;  3CCU P;  2WMM A;  2IBZ I;  1SS1 A;  5B5E E;  1RE3 A;  5KLV E;  1WK1 A;  1LT9 B;  3BDW A;  3AE1 C;  3N7N A;  3S4R A;  1NU1 K;  2GGU A;  1SQQ D;  2XV5 A;  4WY4 B;  1JMM A;  1SQB E;  1PPJ E;  2IYO A;  3P5D A;  3L75 J;  3SFE C;  1J1D B;  1NTK D;  1AVY A;  2ZQK A;  4MTH A;  3Q5R A;  3FX0 A;  1JA3 A;  1X8Y A;  4WWI A;  1P4L D;  4C9F A;  3AEG C;  2KZJ A;  5FFR A;  2FFD C;  1OVV A;  1EXJ A;  2MKV A;  5GTI H;  1FIH A;  1LTB C;  3FD4 A;  2RIB A;  3TGU G;  3A5T A;  1GD2 E;  2N9B A;  2JEE A;  3L36 A;  4UB8 H;  3MZW B;  1J1E C;  3HE4 B;  1GZL A;  2GUV A;  1NHL A;  5AVW B;  2OX9 A;  1U57 A;  4QKI A;  1JTH B;  3AEF C;  1FAV A;  1J34 B;  1GDT A;  1V7P A;  1BGY G;  3KYQ A;  5AVR B;  3O6Q A;  1PP9 E;  1FBM A;  1YTZ T;  3PBF A;  3Q5P A;  1CI6 B;  1W2E A;  4Y28 J;  4GKG A;  1NU1 J;  4H0L D;  2M8R A;  2RIA A;  1S5L X;  3B71 A;  1IJK B;  3BAT A;  2PGD A;  1SVF A;  1SQX G;  1S4X A;  1Y17 B;  1RDN 1;  1JY2 N;  3RK3 C;  1FZC B;  3CI9 A;  2V4H A;  3Q5S A;  3L74 D;  3CX5 E;  1GK4 A;  2M3E A;  4EOT A;  4S0U A;  2OGU A;  1L0L G;  2A45 G;  2JDI H;  1QDD A;  3RL0 g;  2AEJ A;  4WY4 D;  3UIA A;  1SQV K;  1T8D A;  4HB1 A;  1NTM D;  3A7O A;  2YO2 A;  3H1H G;  1LTJ B;  2C6U A;  1SQQ E;  2BCC J;  4LC1 A;  1H88 A;  3TGU E;  3D6Z A;  3WH2 A;  1PGJ A;  3EFF K;  4EYY Q;  2IZ0 A;  1HVV A;  3FXD A;  1NTK E;  1A02 J;  3V2R A;  1EC5 A;  1T8C A;  3C22 A;  1L0N G;  5CCG C;  1BGY E;  2LXC B;  1RDK 1;  1LP1 A;  1N7S C;  3II6 A;  1KZU B;  2HOD B;  2YO3 A;  2RIE A;  3VMA A;  1DIP A;  2OYI C;  2E74 B;  2Q6Q A;  1KB9 I;  3IR9 A;  1IK7 A;  2ZFC A;  3VMX A;  4LU5 A;  2N1T C;  4GOE A;  2C9N Y;  1JY3 P;  1LTS C;  1DEE G;  3K7B A;  1SQV J;  1OXZ A;  1M7L A;  2UWJ E;  1P84 D;  1BJ3 A;  1G1J A;  4PV1 C;  5KJ7 D;  1YPO A;  3IKP A;  3M9Z A;  1FDI A;  5KAF H;  1L0L E;  3M0D C;  4EIJ A;  5KAI H;  1WMK A;  1LTA C;  3L72 G;  1NH4 A;  1URQ B;  1JB0 J;  1QL1 A;  4N37 A;  3GHG B;  4DCK A;  2FY8 A;  5AW0 B;  3IKR A;  2QA4 P;  2GGX A;  3H1L G;  4UB6 H;  5AVX B;  2H43 A;  1YTT A;  3HRN A;  3GLM A;  2KSJ A;  5TJH A;  1SQB K;  2IDB A;  1KB9 H;  1NTM E;  1PZQ A;  1VPC A;  1KC8 Q;  3T97 A;  1OIP A;  4M18 A;  5GTH E;  1NKN A;  3BAS A;  2KYV A;  3L71 J;  2Y0E A;  5EFW B;  2R3S A;  3R4Y A;  4W7Z A;  3BCC G;  1EZV G;  1AA0 A;  3CMA P;  1S9K D;  3VYJ A;  2BRS A;  1JO5 A;  1JY3 N;  3VN0 A;  3H1I J;  3MUD A;  4RKU J;  2YXR B;  3GPR A;  4N34 A;  3Q1M A;  2E74 D;  2E42 A;  3WUU A;  1JUN A;  1IXX B;  2I8D A;  5KLI C;  3RL0 C;  1R5S A;  2YKO A;  4IL6 E;  4IOP A;  3CWB J;  2IBZ D;  4J6Q A;  4M17 A;  3TK1 A;  3CX5 I;  3EQ2 A;  2GO0 A;  1OZH A;  1NTZ D;  1RE3 C;  5KLV J;  3BRV B;  1DY0 A;  3UBU B;  1RF1 A;  4QKG A;  4I7Z C;  1K73 Q;  1T8Z A;  4ZET A;  1M1J B;  2YNY A;  1FE6 A;  1SQB J;  1AFD 1;  1YJ9 P;  3P5G A;  4J6N A;  3V2Q A;  1IOD A;  1E8I A;  2ORJ A;  1Y47 A;  2ZT9 B;  2WZ7 A;  5AW1 B;  2B87 B;  2JO1 A;  2BAS A;  4BXL A;  1DD3 A;  1XTC C;  2BEZ F;  1URQ D;  2O1K A;  3B8E B;  1X9V A;  1KQG B;  2QJP C;  2FXM A;  4YMD A;  4L73 A;  4H44 B;  1S5L H;  2BEQ D;  3H32 A;  3MGN A;  5KKZ C;  1MUQ A;  1K9I A;  2FFD A;  3TYY A;  1YTZ I;  4OWF A;  3E1R A;  2WSC J;  4N78 D;  4PJ0 H;  3CCM P;  1FZF A;  4TLF A;  1EZV E;  1SQQ K;  1FDM A;  3NCX A;  3WWK B;  2E5T A;  2OQQ A;  2NPS C;  2ZWK A;  1YQ3 C;  5AVQ B;  1XTG B;  4IFF A;  1PP9 J;  1NO4 A;  3L73 G;  4AYC A;  1J1E B;  2ZAE B;  4QKJ A;  2SPZ A;  5B66 H;  3G81 A;  2RH0 A;  3WBQ A;  5GTI E;  1VL2 A;  4HYT B;  2H7H A;  4UB8 E;  1ZR2 A;  3P5I A;  3P7F A;  2RID A;  2Q3E A;  3L37 A;  2A45 I;  1H0T A;  1F02 I;  2OTL P;  3AEA C;  2ZXE B;  3FF9 A;  2WSE H;  4XE5 B;  3VTP C;  2IBZ E;  3FGA D;  2C0X A;  2JWD A;  2XR5 A;  2KV3 A;  2CK3 H;  3CLQ A;  1NTZ E;  1X2T A;  4GI0 A;  3TSI A;  2P2U A;  5AVV B;  1LIT A;  2O01 H;  2WSF H;  2ZT9 D;  2JJL A;  4ZNC A;  4RES B;  1SQQ J;  3GF7 A;  4N36 A;  2HPC A;  3NFQ A;  4EZM G;  3QH9 A;  1NTK J;  2FYN C;  5H2F H;  1RF0 A;  3GF3 A;  1IO4 A;  3L71 D;  3G8L A;  3G84 A;  4H44 D;  4RO0 A;  4U3F G;  3CXH D;  2ZYA A;  1FZB A;  1UKM A;  2WWW A;  1HH0 A;  2QIW A;  4C46 A;  2Y0C A;  3S1K A;  3CCE P;  1JOC A;  3NTN A;  1N7S A;  3KHU A;  1N73 C;  1ZRT E;  1PL5 A;  2A45 H;  4N78 E;  3QWO C;  1SB2 B;  1NTM K;  3KXD A;  2OYI A;  1DY1 A;  2MJZ A;  4TT3 H;  5KLV D;  3VMY A;  1FU1 A;  1RH5 B;  2N1T A;  2QJY C;  5CBO A;  4DZO A;  1TN3 A;  2M0B A;  1PPJ D;  2LS8 A;  4HKZ H;  1KQF B;  5B1R A;  1SQP D;  3HE5 B;  5DJU B;  1HJ0 A;  1SLQ A;  2OS9 A;  2CPB A;  5CCH D;  3CCK A;  2J58 A;  4PD4 I;  2E3X B;  1VQN P;  2W83 C;  3OA7 A;  1RDM 1;  5AW4 B;  2R3C A;  3D70 A;  3A0B H;  3L9J C;  3CAD A;  1YQ4 C;  4H13 B;  3MIW A;  2WSS H;  3VMZ A;  1NTM J;  3ALU A;  2LR2 A;  1EZV I;  1YBK A;  3WUT A;  2Q5U A;  5KAF E;  1EGG A;  1KZD 1;  5KAI E;  3VP9 A;  1BCC G;  2G3A A;  2KS1 A;  1KCG A;  1N7L A;  2QE7 H;  3IF4 A;  1LJ2 A;  1N8R Q;  5BU5 A;  1MKM A;  3G3Z A;  3RK2 C;  3GPR C;  1M90 Q;  4D6T G;  3Q2Y A;  2ZIB A;  4UB6 E;  5BVZ A;  5J6G G;  1G1S A;  1H8A A;  1NKZ B;  1RJH A;  2E75 C;  3CX5 D;  1KB9 E;  3N4X A;  3A3Y B;  4IOI H;  3WH3 A;  3CC2 P;  4PD4 H;  2I1K A;  1G2C A;  2B9B A;  1RF1 C;  3VOP A;  3L35 A;  1T2K C;  4WRC A;  1FIF A;  2P7J A;  1FJK A;  3RL0 B;  2W6J H;  1RE4 C;  2Y0D A;  4DT0 A;  1Y9B A;  1AV1 A;  1JY2 P;  3TGU D;  3AEB C;  3M9H A;  5AW2 B;  3PP5 A;  1UIX A;  2M5A A;  1SQP E;  3CDG F;  5L8R J;  2XR6 A;  1BE3 G;  4C7N A;  3PHL A;  1ZXG A;  4N6J A;  3H25 A;  1AQ5 A;  1BGY D;  2NZ2 A;  1HWT C;  1G1I A;  1U0N B;  1NTZ K;  1G1R A;  4QKH A;  2WTY A;  4H13 D;  2FKW B;  3H1K G;  1DV8 A;  5CHX A;  2L91 A;  3RK3 E;  1VQ8 P;  1BCC E;  4NPF X;  4DOJ A;  5LGK E;  2K88 A;  2QJP B;  2WPV B;  1PFI A;  3O8Z A;  3ZHG D;  3PAQ A;  4J6M A;  5KTI A;  1KZC 1;  1SQX D;  2RKL A;  1VDF A;  1MPU A;  4D6T E;  4DN8 A;  2P1J A;  2NPS A;  4DJG A;  2IYP A;  1J34 A;  1KWX A;  1A02 F;  3P7H A;  3AE5 C;  1V4L A;  1S5L E;  3HUS C;  1EQ7 A;  1V7P B;  3CCS P;  2A06 G;  3O6Q B;  1KX0 A;  1L0L D;  2OYH C;  3ITK A;  4JF7 A;  2W27 A;  4PJ0 E;  1HGZ A;  2H89 C;  1LGH B;  5B1W A;  2WVR A;  1L4A C;  1FDO A;  1X2W A;  2ZVO B;  5AVT B;  3H1H D;  4ASV A;  1QGK B;  1NAY A;  4PP8 A;  1OW8 A;  3W67 A;  4JYB A;  1C3A A;  1GU4 A;  1D7M A;  1NTZ J;  2FYZ A;  1HTL C;  4OGQ B;  2Q3I A;  2FYU G;  3RL0 D;  5B66 E;  3C8V A;  4EDF A;  1BE3 E;  3H1J G;  3B5N A;  3D6Y A;  4YXD C;  2R32 A;  1RF0 C;  1SFC C;  2BPE A;  2NRG A;  1IZN B;  3C9I A;  1FM5 A;  2XDJ A;  3CCQ P;  1BSN A;  1BYF A;  3BVH A;  3I5C A;  4PDC A;  1RQV A;  3ALS A;  1R5L A;  1VF5 B;  1OZ7 A;  4MN4 C;  4AUW A;  2B89 A;  5CJ0 A;  2PRR A;  3BX4 A;  1NVO A;  3AE6 C;  3EWK A;  4KMB 1;  4GT1 A;  1KMI Z;  2FYN B;  2KUB A;  1CZQ A;  2VRP A;  3CPW O;  4I6M C;  2Y9Z A;  1N73 A;  1BDC A;  3A2A A;  1VQL P;  1LP1 B;  3G4S P;  5H2F E;  1SQX E;  4L75 A;  3CCR P;  2WIT A;  1VQ9 P;  1UMR A;  1KYO I;  3L72 D;  3AEC C;  4Y99 C;  1E79 H;  1HTN A;  2HFE D;  3EFG A;  1T6A A;  3CME P;  4LQF A;  1B08 A;  3RS1 A;  3PAR A;  3CL3 D;  1VQ4 P;  3CFW A;  1JCC A;  2IPP A;  1KIL A;  3AE2 C;  1GL2 A;  3H1L D;  1FVU A;  2XU6 A;  1DD4 A;  2FYU E;  4AK8 A;  1UOS A;  5AVY B;  2QJY B;  1LNQ A;  3H1J E;  1BJ3 B;  4CPG A;  5APV A;  1GU5 A;  1EDK A;  4OGQ D;  3H1H E;  4ZRW A;  4RJT A;  1MFZ A;  2ZVN B;  2XKM A;  5KLV K;  1M1K Q;  1FZA A;  3TDK A;  3HD7 A;  5KTB A;  3BCC D;  1EZV D;  1FZE A;  1H89 A;  5KTH A;  1H8U A;  5K8Y A;  3VP8 A;  1L0N E;  4BRY A;  2QRX A;  1K04 A;  1JWI A;  1T3J A;  1LTG C;  1SQP K;  1TDQ B;  4AQR D;  1LWU A;  5APW A;  1O7B T;  4J6P A;  3L75 G;  2O01 N;  1KYO H;  1VF5 D;  1WRG A;  4IFD K;  2E76 B;  1W2B O;  2H8P D;  4XFJ A;  4H0L C;  1USD A;  3A0B E;  3W68 A;  2ORK A;  3T97 B;  4WVZ A;  3CCL P;  1OVR A;  1J35 A;  2AFP A;  1SP4 A;  3NMD A;  3OW2 O;  1HGV A;  2QG4 A;  3I56 P;  3MHV A;  1NGM B;  4GK1 A;  2AEM A;  2V7Q H;  1X0T A;  4B86 A;  3A0H H;  1DH3 A;  2RIC A;  4IOP B;  1LT9 C;  3ALT A;  1PGQ A;  5AW5 B;  3OJA B;  1GMJ A;  3L72 E;  1YPQ A;  2P67 A;  1E5U I;  1RE4 A;  2PY2 A;  4WY4 C;  1M1J A;  1NU1 G;  3E7K A;  1SQP J;  1RF1 B;  1U0O A;  1OFC X;  1IFJ A;  1J1D C;  1KMB 1;  3P5E A;  1CSB A;  1FS0 E;  3H1L E;  3M9Q A;  2IZ1 A;  3KPE A;  1PIX A;  4PD4 E;  1IOD B;  2CPS A;  1E87 A;  1ZME C;  2R44 A;  4NPE A;  1OW6 A;  3L73 D;  1PV3 A;  1S72 P;  1BCC J;  1Q86 Q;  4KZW A;  1ZRT D;  5APS A;  1BDD A;  1KWW A;  3L75 E;  3H32 B;  2GM4 A;  1U7J A;  3BCC E;  2WT7 A;  4IFM A;  5TIS H;  2FFD B;  5AW8 B;  1JY3 O;  3SWY A;  4QMA A;  1FOS E;  1NTK K;  2BCC G;  2E76 D;  1KD1 Q;  1WT9 A;  1AFA 1;  4W80 A;  1CWV A;  1IJK C;  1IFD A;  3HUS A;  4I1L A;  1AQT A;  2FBW C;  4GKO G;  1VQ7 P;  1DEB A;  1M56 D;  2W8Z A;  5KJ7 C;  2OYH A;  1FZC C;  4WR9 A;  2AXT H;  1DX7 A;  3LW5 H;  4W7Y A;  4UXM A;  3SWF A;  4WB4 A;  2R5D A;  1L4A A;  3AE7 C;  1SQX K;  3H6P A;  5E79 H;  5AW9 B;  1NU1 E;  4JQ0 D;  1OMI A;  4LGD E;  1YYC A;  1H0T B;  3RK3 B;  3B5N C;  5K5G B;  4U3F D;  2OAR A;  3PTZ A;  3L70 G;  1MV8 A;  3KQG A;  2KNC A;  3TGU J;  3SWK A;  1SQV G;  1LTJ C;  1T2K D;  1L0L K;  1EDJ A;  2KIK A;  3U59 A;  5M1B A;  1SFC A;  5APY A;  3GW6 A;  2HPC B;  3P8C E;  1BGY J;  3RGU A;  1KX1 A;  2ZXX A;  2WSF J;  2K37 A;  3L73 E;  4A7P A;  2YMK A;  1SL4 A;  1FJP A;  3KMB 1;  1KB9 D;  1TLG A;  1QO3 C;  1UKM B;  2OTJ P;  1SQX J;  1BNL A;  3V5B A;  2KB7 P;  1QVG O;  1UMR C;  1IFM A;  1N2D C;  1N7S B;  1PGO A;  3MD0 A;  4OH8 B;  1QLE D;  2OYI B;  4YPC A;  3WBP A;  1KN7 A;  1KIL C;  2Z4E A;  1GL2 C;  1ZLL A;  5CJ4 A;  5APU A;  1WMY A;  1L0L J;  2N1T B;  3WMM 0;  1K9J A;  2YHF A;  1LT1 A;  3H1I G;  3H1J J;  5AW7 B;  4L74 A;  3H1H J;  3L70 E;  1JMB A;  3WU2 H;  4HJG H;  1SQV E;  1BV4 A;  1KWY A;  3CWB G;  4PV1 B;  2YKP A;  3HTK A;  3RK3 D;  3HD7 C;  2Q7C A;  3V6I A;  1P1Z D;  2HG5 D;  1BCC D;  1P84 I;  1Q2N A;  1PWB A;  3FF8 C;  1FZG A;  1UEX B;  1QL2 A;  2L5G B;  1L0N J;  4U3F E;  3GMA A;  1HJB A;  4D6T D;  2Q9I A;  1LWU C;  1OW7 A;  1SQB G;  1GZ2 A;  2WPS A;  4ZKU A;  2PP6 A;  3FWN A;  4GOF A;  1LTI C;  3USS A;  1ZV8 A;  2GUS A;  2JWA A;  1M8O B;  3IN6 A;  3TNU A; 
#chains in the Genus database with same CATH homology
 3BAS A;  2KYV A;  3CDG E;  3RL0 D;  4KHX A;  3R2P A;  2FYU K;  5FFT A;  4W7Z A;  1S9K D;  1X2T B;  3B5N A;  5AVU B;  3VYJ A;  3P7K A;  3T3A A;  2BRS A;  1JO5 A;  2R32 A;  1JY3 N;  3VN0 A;  5CCG D;  3FF7 C;  3MUD A;  3C8J A;  1KWT A;  2KLV A;  1RF0 C;  3GPR A;  3M91 A;  1SFC C;  2BPE A;  2CL8 A;  4N34 A;  2E42 A;  3WBR A;  1N7S D;  1JUN A;  1IXX B;  1KWZ A;  3C9I A;  1FM5 A;  3RL0 C;  2YKO A;  2KOG A;  3KDP B;  2XDJ A;  1BYF A;  2OX8 A;  1ZR4 A;  4IOP A;  3BVH A;  3I5C A;  2R5B A;  1J2J B;  1SFC B;  4J6Q A;  1KZA 1;  5CMZ A;  4M17 A;  5APX A;  4PDC A;  3TK1 A;  3ALS A;  3EQ2 A;  2GO0 A;  1OZ7 A;  4CSY A;  4AUW A;  1RE3 C;  1G2C B;  4WUW A;  5CJ0 A;  1M1J C;  1NAF A;  3BRV B;  1DY0 A;  2I83 A;  1HUC A;  1LT9 A;  3UBU B;  3BX4 A;  2XNX A;  1L0N K;  1RF1 A;  4KMB 1;  2N1T D;  4O9B A;  4QKG A;  4GT1 A;  1N86 A;  1CZQ A;  1T8Z A;  2VRP A;  1GW3 A;  4ZET A;  1NOH A;  4WY4 A;  1M1J B;  3M9B A;  2YNY A;  3BDW B;  3HUP A;  1AFD 1;  1SB2 A;  3P5G A;  4J6N A;  4I6M C;  3V2Q A;  2HLO A;  5CCG A;  1IOD A;  1E8I A;  2ORJ A;  1BCJ 1;  1N73 A;  1RDO 1;  2WZ7 A;  3NXS A;  3A2A A;  5AW1 B;  2PF5 A;  2H2R A;  5APQ A;  5F2Q A;  2BAS A;  4E52 A;  1ESL A;  3L4F A;  5AW3 B;  1XTC C;  1URQ D;  2O1K A;  2WIT A;  3B8E B;  1X9V A;  1UMR A;  2FXM A;  4Y99 C;  4YMD A;  4C7N B;  1AFB 1;  1HTN A;  1IFI A;  3VPP A;  3H32 A;  3MGN A;  4M18 A;  2HFE D;  3EFG A;  3P32 A;  1MUQ A;  4LQF A;  4N32 A;  1B08 A;  1T3U A;  1K9I A;  3RS1 A;  3PAR A;  2FFD A;  3CL3 D;  3TYY A;  1YTZ I;  3HE4 A;  4Y99 B;  3CFW A;  5B1X A;  1JCC A;  2IPP A;  1KIL A;  3OAK A;  1HBW A;  3WWK C;  3HE5 A;  1GL2 A;  1RDJ 1;  1FVU A;  2XU6 A;  4N78 D;  1XPH A;  4J6J A;  1URQ C;  4CAJ A;  4AK8 A;  4I2L C;  1FZF A;  1UOS A;  3PAK A;  2W6B A;  5AVY B;  2HYN A;  1JTH A;  3V4Q A;  3GHG C;  1GTW A;  1SQQ K;  1FDM A;  1YPU A;  1BJ3 B;  3NCX A;  2BPH A;  3WWK B;  5M62 A;  3P5H A;  2NPS C;  4ZRV A;  2ZWK A;  1KWV A;  5APV A;  1GU5 A;  1L4A D;  5AVQ B;  2N40 A;  1XTG B;  4IFF A;  1UV0 A;  1E5W A;  1CW5 A;  1NO4 A;  4ZRW A;  1MFZ A;  2XKM A;  5APT A;  3M0D A;  1WMZ A;  1CI6 A;  4AYC A;  5KLV K;  1J1E B;  2NPS B;  1FZA A;  1UEX A;  2YMY A;  4QKJ A;  3BRT B;  4KI1 E;  3HTK B;  4WRF A;  2IT5 A;  3G81 A;  3IKN A;  3HD7 A;  5KTB A;  2VUZ A;  3WBQ A;  2IX7 C;  1V4L B;  4J6L A;  1FZE A;  4WRE A;  4G9A A;  1Y17 A;  1H89 A;  2MSB A;  5KTH A;  3V2N A;  1H8U A;  3ZHG A;  5K8Y A;  4HYT B;  3VP8 A;  2H7H A;  5KJ7 A;  1JWI A;  1FZC A;  1T3J A;  1XAR A;  1LTG C;  1SQP K;  1ZR2 A;  1TDQ B;  3P5I A;  4YLI A;  1JCD A;  4AQR D;  3VLG A;  5CCH C;  1WT6 A;  3P7F A;  2I1J A;  1LWU A;  2RID A;  4N35 A;  1SFC D;  3L37 A;  5APW A;  1O7B T;  2A45 I;  4J6P A;  1F02 I;  1KQL A;  1GK6 A;  2H2T B;  2IFN A;  2ZXE B;  1X2W B;  3FF9 A;  1WRG A;  2WSE H;  4XE5 B;  1G1Q A;  4KZV A;  4IFD K;  3VTP C;  4N3Y B;  2C0X A;  4N33 A;  2XR5 A;  4G96 A;  3MTU E;  2H8P D;  1AFO A;  1C3A B;  2KV3 A;  4M3L A;  1F00 I;  3CLQ A;  3V4W A;  4JYC A;  1R14 A;  2C0W A;  3TNU B;  1YXJ A;  1KFN A;  1X2T A;  2ORK A;  4GI0 A;  3TSI A;  2P2U A;  5AVV B;  1LIT A;  1R13 A;  1SL6 A;  2YKQ A;  4C7R A;  2O01 H;  2WSF H;  1FOS F;  1BUU A;  5AVS B;  4LLH A;  1LTJ A;  3M0A A;  2BPD A;  2JJL A;  1J35 A;  4RES B;  2AFP A;  4N36 A;  3B5N B;  1JZN A;  2VRS A;  1SP4 A;  3NMD A;  2HPC A;  3NFQ A;  1HGV A;  4ZES A;  4EZM G;  1YXK A;  3VYK A;  4WBA A;  1RF0 A;  1IO4 A;  1KWU A;  4GK1 A;  4B86 A;  3G8L A;  3G84 A;  2PAJ A;  1HUP A;  1DH3 A;  1IK9 A;  2RIC A;  4IOP B;  1LT9 C;  3ALT A;  5AW5 B;  1FZB A;  3OJA B;  1UKM A;  2WWW A;  1YPQ A;  1HH0 A;  2P67 A;  4C46 A;  1OZ7 B;  2HOD A;  1E5U I;  1RE4 A;  2PY2 A;  1RE3 A;  4WY4 C;  1WK1 A;  1M1J A;  1LT9 B;  3BDW A;  3BX4 B;  1RF1 B;  3N7N A;  1U0O A;  1JOC A;  1IFJ A;  3NTN A;  1NU1 K;  1N7S A;  1J1D C;  1N73 C;  1KMB 1;  2GGU A;  3P5E A;  1CSB A;  2VRP B;  2XV5 A;  4WY4 B;  1JMM A;  2A45 H;  3M9Q A;  4N78 E;  1SB2 B;  1NTM K;  1JY2 O;  3P5D A;  3KPE A;  2OYI A;  1DY1 A;  1IOD B;  2CPS A;  1KFM A;  1J1D B;  1N73 B;  2MJZ A;  1IC2 A;  3U1C A;  1E87 A;  2ZQK A;  2NPS D;  3VMY A;  2WPQ A;  4MTH A;  1RY3 A;  1FU1 A;  3E1I A;  1JA3 A;  1X8Y A;  2N1T A;  1P4L D;  4C9F A;  4KZW A;  2POH A;  5FFR A;  5APS A;  4DZO A;  1KWW A;  1TN3 A;  2FFD C;  4J6K A;  1FIH A;  1LTB C;  3FD4 A;  2LS8 A;  2RIB A;  3A5T A;  3H32 B;  1GD2 E;  2N9B A;  2GM4 A;  2JEE A;  5B1R A;  2WT7 A;  3L36 A;  4IFM A;  2KP8 A;  2FFD B;  3VYI A;  1KZB 1;  1J1E C;  5AW8 B;  4WCO A;  1JY3 O;  3HE4 B;  5BU8 B;  1IJD B;  2IFM A;  1KIL B;  2E3X C;  3SWY A;  3M06 A;  1GZL A;  3HE5 B;  1GL2 B;  2GUV A;  1NWQ A;  1FVU B;  1NHL A;  5AVW B;  1FOS E;  1NTK K;  2OX9 A;  1URQ A;  1SLQ A;  1UOS B;  2OS9 A;  2CPB A;  4QKI A;  5CCH D;  1B6E A;  2IT6 A;  4UWW A;  1JTH B;  3CCK A;  1FAV A;  2J58 A;  1J34 B;  1GDT A;  1WT9 A;  1V7P A;  3GHG A;  2E3X B;  3KYQ A;  1AFA 1;  5AVR B;  1HYR A;  3OA7 A;  1RDM 1;  4W80 A;  1CWV A;  1IJK C;  5AW4 B;  1IFD A;  3HUS A;  1FBM A;  1YTZ T;  2QM8 A;  4I1L A;  2R3C A;  1KOE A;  3PBF A;  4GKO G;  1CI6 B;  1W2E A;  3L9J C;  1DEB A;  4GKG A;  3CAD A;  3MIW A;  2M8R A;  2RIA A;  1IJK B;  3VMZ A;  5KJ7 C;  3B5N D;  3BAT A;  3HD7 B;  3WHD A;  2OYH A;  1FZC C;  4N38 A;  4WR9 A;  1X79 B;  1DX7 A;  1SVF A;  3LW5 H;  4W7Y A;  3ALU A;  4UXM A;  3IKQ A;  1Y17 B;  2W6A A;  3SWF A;  2Q5U A;  1RDN 1;  4WB4 A;  2R5D A;  1L4A A;  1EGG A;  1SQX K;  3H6P A;  1KZD 1;  1JY2 N;  3RK3 C;  1FZC B;  1JWI B;  3CI9 A;  5AW9 B;  4WQQ A;  3VP9 A;  4LGD E;  1LWU B;  1YYC A;  1GK4 A;  1KCG A;  1JNM A;  3RK3 B;  3B5N C;  1N7L A;  1RDI 1;  2OAR A;  5BU5 A;  3G3Z A;  4EOT A;  4S0U A;  3RK2 C;  3C8K D;  3G83 A;  1MV8 A;  3GPR C;  3KQG A;  1GW4 A;  2XZR A;  4GJX A;  4M1G A;  2ZIB A;  2A45 G;  1LTJ C;  1Z56 A;  1IXX A;  1QDD A;  5BVZ A;  1T2K D;  1L0L K;  4WY4 D;  5J6G G;  3UIA A;  1G1S A;  3RK2 B;  1SQV K;  1H8A A;  1NKZ B;  1RJH A;  3U59 A;  1T8D A;  3P7G A;  5AW6 B;  3GPR B;  1HQ8 A;  1SFC A;  5APY A;  3A7O A;  1OWA A;  2YO2 A;  2MTI A;  3N4X A;  1LTJ B;  2C6U A;  3A3Y B;  1J35 B;  4ZKP A;  3WH3 A;  4LC1 A;  1H88 A;  2I1K A;  1G2C A;  3WH2 A;  1G1T A;  3P5F A;  2HPC B;  3P8C E;  3UBU A;  4HH2 A;  1RF1 C;  2C9L Y;  1HVV A;  2Z5H A;  3VOP A;  1KX1 A;  4C16 A;  3L35 A;  3IFM A;  1A02 J;  1T2K C;  3V2R A;  4WRC A;  3V2P A;  1FIF A;  1T8C A;  1MSB A;  5FFS A;  2P7J A;  3C22 A;  1EGI A;  1FJK A;  2WPR A;  3RL0 B;  1RE4 C;  3NCW A;  5CCG C;  1DY2 A;  1SL4 A;  1FJP A;  3KMB 1;  1TLG A;  1QO3 C;  2M3B A;  1O7C T;  1UKM B;  1JY2 P;  1RDK 1;  1N7S C;  3II6 A;  1KZU B;  1KIL D;  2HOD B;  3M9H A;  3P8C D;  2YO3 A;  5AW2 B;  2RIE A;  1GL2 D;  3PP5 A;  1BNL A;  3V5B A;  3CDG F;  2OYI C;  2KMB 1;  2KB7 P;  2WSC H;  1U0O B;  1UMR C;  1IFM A;  1N2D C;  1N7S B;  3MD0 A;  1U0N C;  2XR6 A;  4C7N A;  1MUU A;  4OH8 B;  1IFN A;  1RDL 1;  3IR9 A;  4N6J A;  2ZFC A;  1AQ5 A;  3VMX A;  4LU5 A;  2OYI B;  1KG0 C;  3WBP A;  2N1T C;  1HWT C;  1G1I A;  3WSR A;  1U0N B;  3LID A;  1KIL C;  1NTZ K;  2Z4E A;  1G1R A;  4QKH A;  1GL2 C;  1ZLL A;  5CJ4 A;  2WTY A;  2C9N Y;  5APU A;  2FKW B;  1ZN5 A;  1DV8 A;  5CHX A;  1WMY A;  3DBZ A;  1JY3 P;  1LTS C;  3HD7 D;  2N1T B;  3WMM 0;  1BCH 1;  1K9J A;  3K7B A;  1OXZ A;  4DOJ A;  5LGK E;  2YHF A;  1M7L A;  1RTM 1;  2QM7 A;  1BJ3 A;  3WWK A;  2M94 A;  1PFI A;  3O8Z A;  3LIE A;  5AW7 B;  3PAQ A;  3ZHG D;  1G1J A;  4J6M A;  5KTI A;  5KJ7 D;  1YPO A;  1KZC 1;  3IKP A;  2VUV A;  3M9Z A;  3P8M C;  1MZ9 A;  1KZE 1;  1VDF A;  2WT7 B;  1MPU A;  3M0D C;  2Z5I A;  4EIJ A;  4DN8 A;  1BV4 A;  2P1J A;  2NPS A;  1KWY A;  1J34 A;  2YKP A;  1A02 F;  1KWX A;  3HTK A;  3RK3 D;  1LTA C;  3HD7 C;  2Q7C A;  1P1Z D;  2HG5 D;  3G8K A;  1NH4 A;  3P7H A;  4WUX A;  2LKM A;  1URQ B;  1PWB A;  1V4L A;  2J59 M;  3HUS C;  3FF8 C;  1PW9 A;  1EQ7 A;  1FZG A;  1QL1 A;  1UEX B;  1V7P B;  3GHG B;  1WT9 B;  4N37 A;  1QL2 A;  2L5G B;  2O1J A;  5AW0 B;  3IKR A;  1KX0 A;  1HJB A;  4GIF A;  1LTT C;  5AVZ B;  3HUS B;  2GGX A;  2OYH C;  3RK2 D;  2Q9I A;  1LWU C;  1SL5 A;  5AVX B;  2H43 A;  1YTT A;  4JF7 A;  2W27 A;  3GPR D;  1HGZ A;  1GZ2 A;  1LGH B;  3HRN A;  2WPS A;  2KSJ A;  1S9K E;  1SQB K;  2E43 A;  5B1W A;  1L4A C;  4ZKU A;  2PP6 A;  1X2W A;  2OYH B;  5AVT B;  5CCH A;  4PP8 A;  1LTI C;  1VPC A;  4JYB A;  1C3A A;  1GU4 A;  4GJ0 A;  1ZV8 A;  2GUS A;  3U1A A;  1L4A B;  2FYZ A;  3TNU A;  1HTL C;  3T97 A;  4XA4 A;  2Q3I A;  1NKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...