3KQKA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
total genus 138
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqkA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA01
4Q4LA 1NSTA 2DWQA 3B1WA 3RYTC 1XTKA 1KI2A 3C16C 1OKKD 1F3OA 4JVLA 2VBCA 4RKEA 4PR0A 4RFSA 1CJMA 1DELA 1GAJA 1NVVR 1K8RA 2CLSA 1GRNA 1AN0A 5B64A 1NN0A 3KUCA 1TQDA 1FQJA 2FJUA 1ZBDA 2HLDA 1KI4A 3E2IA 1XTSA 4PFSA 3EZ9A 1NI3A 4HAVA 3LAWA 4G1UC 4NH0A 2VPPA 4PC7A 2WOJA 2J7PD 1H8ED 2IHYA 4OQMA 2FH5B 4MKIA 3R20A 1IHUA 3TK1A 5J5CA 2J0VA 3CH5A 5JJIA 4QL3A 3RRZA 2E87A 1W46A 4D26A 1XD2A 2DFLA 4QHSA 1CEEA 4EQ6B 4EPWA 2ZR7A 2QN6A 3K09C 1J8YF 4P0TA 2WWWA 1W0KA 1TX4B 1XMSA 2QORA 2FGJA 3SYKA 2SHKA 5CLQA 4A1FA 1W36B 3AB3A 2QAGA 3WMGA 1KAOA 4KYIB 1PLJA 4PAMA 5CIWA 1XCGB 5KPDA 2FV8A 5EXTA 2YNMA 2NPFA 2C98A 2V1XA 2ZR9A 3MAAC 4V0ME 3PJRA 4JLJA 3W8RA 1FMJA 3A1VA 3HYRA 3K9GA 1FUUA 2ZJ2A 3TE6A 4Z8YA 4BLQA 3PFIA 2ZRDA 2IYZA 1DAHA 3C41J 4KU4A 3AQ4A 4DHEA 4RSGA 2VA8A 1OXXK 2PZFA 1JXOA 3FMFA 1ZM7A 2V3CC 2XOKA 4US1R 1R7RA 2IYXA 4H1UA 2ZRHA 1G17A 2PJRA 3SS8A 4Q7KA 3J81k 2JAQA 4DLWA 4NMMA 4LHWA 4NBSA 1SXJC 2ZYVX 2OSBA 5ELXA 4LBWA 3AUYA 3AF2A 1UBEA 3CRRA 4BFVA 4UKDA 2LKCA 2HUPA 3WHKA 3KX2A 5FPHA 4TT3D 2D06A 2JATA 5DLQC 3ZVRA 2BMFA 1VYUA 5CB8A 1T3SA 2IXGA 4MGZR 4UXIA 1E9BA 2ZSFA 2PT7A 2RKOA 3NBFA 4ZPXA 2W0MA 4DCUA 1MKYA 3EZ6A 3I4LA 1IN8A 1KNXA 5HCNA 3I8XA 2ASEA 4LBVA 2QEQA 4NPHA 5C4GB 1P4SA 2DFTA 4IXNA 3GJXC 1AS3A 3UWKA 621PA 1E2HA 1LV7A 2QGNA 2ZSDA 3QE0A 3SFZA 2AXPA 1S2MA 4M1MA 2KBEA 4HZIA 2BCJQ 2R6CA 2AK2A 2GJ9A 3MWJA 4GZMA 2CE2X 1Q0UA 3A1WA 3N2IA 2OFOA 3K8YA 2CBZA 1F60A 1RFLA 3CUEF 3SHFA 5KSOA 1NL3A 2GEDA 2DBYA 2GAAA 5IHPA 3UK6A 2ZS9A 4DEYA 1E1QA 3PQCA 4XWKA 4P4TA 3WMEA 3B8HA 2CCGA 2GA8A 5KPJA 5M04A 1OE0A 4B35A 1FUKA 2ECKA 1DAKA 2IYUA 3FPAA 5AK0A 2P65A 2PT5A 3THXB 5CYPA 5KU1A 2WBLC 2JASA 2QPOA 1OXUA 4B3BA 3D31A 2WSSD 1Z0FA 3DKPA 2C78A 4DIEA 1N0UA 1RRFA 3KTAB 2ZJYA 4G5GA 4LC0A 3U44A 3TH5A 4V0MA 2ATXA 3ZS9A 2P6RA 3EPHA 4QG7A 4DLXA 5FOUA 4L15A 4S2EA 1KO5A 4GI7A 3UKDA 3U6KA 2FZ4A 1CTQA 4FW9A 2EQBA 4BFXA 1ZJ6A 2J0UB 4EFLA 5JBQA 4IJMA 4I1OA 1OLOA 2YWGA 3L43A 5EXPA 1W1WA 2O8FB 1G19A 3FOZA 3EPJA 2O8CB 5SZKB 1E2FA 1WRBA 1KK0A 421PA 3M1IA 4L9WA 4RZXA 2FE4A 2PMDA 2YC4C 2ZRLA 4Q9KA 5TXGA 3VHXA 1DADA 1E4VA 1KY2A 4W5HA 5FFMA 1RW4A 2CXXA 3QPWA 1DOAA 1TU4A 3CNNA 1QHYA 2KB0A 3KZ1E 2ZU0C 1Z6XA 1J8MF 1X86B 3O47A 2DPXA 3QXJA 1E9CA 2EWWA 2F7SA 3NWJA 3MCAA 4NCIA 4GT1A 3HR7A 1E2EA 3NHBA 5FTNA 1KK3A 4DJTA 1P60A 3AVXA 3PIRA 3CBQA 1F2UA 2XB4A 4GP7A 1S3GA 3WBJA 3VX4A 1YZKA 4BLPA 4WOPA 3T5DA 3KKMA 3BD9A 2Q3HA 5EXXA 5HKKA 3W90A 3ADKA 1F6BA 2TMKA 3DPUA 2WSMA 4LDJA 5AJYA 1FQKA 4GSYA 2XNSA 1YZGA 3KQHA 1E2JA 5K8TA 2Z4RA 1GUAA 3PUYA 1RIFA 1L7VC 2HEIA 4QOSA 5JI3E 2VHQA 1A5TA 1KI7A 1TQ4A 2RGCA 2XSZD 1T8UA 3MWYW 4B43A 3AF0A 1KMQA 1ZINA 1P72A 3NH6A 1H8HA 4LJYA 3V9PA 3CRQA 4DRZA 4EIWA 2OLJA 1HH4A 2PJZA 5AJZA 1P73A 1KTVA 4WA7A 1ZM4A 4D81A 4BFYA 4Q9JA 1ZC3A 4NTZA 2FEMA 3GMTA 3H86A 3JZMA 2GVDC 3CX6A 4UJ5A 1E1RD 4BGDA 4QNMA 4AKGA 2C96A 2F6RA 4TTRA 4HAZA 2AR7A 4MYTA 3U3RA 1KSJA 2R6AA 3I32A 4WZ6A 1M7GA 5KSZA 3EZ7A 4QBGB 5GADl 4KVAA 2A5DA 4O25A 3SOPA 1XZQA 2BWJA 2RCNA 2BBSA 3GLIE 2A3RA 2ORIA 1LF0A 4F4JA 1IN6A 2F9LA 1UM8A 2D62A 1FTNA 2AD5A 4AYWA 1C4OA 1E2PA 1SVMA 3RS0A 1GIAA 1M7BA 4ON9A 4DLSA 3ICQB 3I8SA 4DXAA 1S1CA 4Q1DA 1VMAA 3VAAA 3BE4A 2D4HA 3GEIA 3WP0A 4QJ3A 3WYFA 3LVQE 1E2LA 1JJVA 1QHNA 4HAWA 4NCHA 4NONA 4TL9A 1KKLA 2OXRA 2NZ8A 3WRYC 1ZU4A 4BUJA 4TLAA 4B2IA 3TSOA 2VP9A 2YOHA 3P4YA 1MT0A 4A2PA 1KGDA 3NC1C 3EWAA 2W6IA 1JPNA 1JNYA 1UKYA 1XD9A 2VHTA 5BYJA 5CK4A 1F48A 2OT3B 4TQ9A 2G1JA 4Q02A 2JEOA 3CPHA 5CIQA 3GLFB 3QENA 1E4YA 3PEVA 4OHWA 4Q7MB 4DDTA 1ZM2A 3SJCA 3JVUA 3ONWA 4PO1A 2ATVA 3ZH9B 2JLWA 4JLOA 4DSOA 1D9ZA 2NGRA 3EZFA 4AWXA 4WZAE 4Q21A 3UXMA 5AR1A 2XSZA 1L4UA 3WYGA 2FA9A 4XD7D 1MO4A 3BB1A 4AYTA 4B74A 1NBME 2XX3A 4B3GA 2DWOA 3K70B 4YXWA 4IEEA 3OHMA 2H17A 4JLBA 4LX0A 4JLDA 1YZUA 2O0KA 1N0VC 4V0NA 1QHXA 2J59A 1HE8B 3CO5A 5FOTA 1DEKA 1AJEA 2WAYA 3G82C 5JRJA 3TKLA 1GILA 1PUIA 2YV5A 4W5WA 2QZ4A 2YWFA 3IHLA 4U7DA 2NO6A 4K81B 4URZR 3AVYA 2QTHA 4LC1A 3NIBA 5FL3A 1Q1BA 2HXSA 4IHQA 3Q5DA 4TQUS 1X6VA 4BQSA 3SYLA 1L2TA 3V00A 1G5PA 1ZCBA 4XTRA 1XMJA 4JJZA 3LQQA 1BYIA 3U7FB 2JLRA 1II0A 1WF3A 1Q1ZA 3T12A 1ZIOA 2JCSA 2ZITA 3B5JA 4TQAA 5G3ZA 3P32A 1CP2A 4RZ3A 2XZLA 1R0XA 1UADA 2GHIA 1SVSA 4F38A 2Z5FA 3ZVMA 3P4XA 2VTKA 3SR0A 3C7KA 3L0PA 1G7TA 1XTQA 2QENA 2IYVA 2R2AA 2IYRA 4ZO4A 3TIFA 3VHLB 1KI6B 4G5SA 2RGNC 1NY5A 3HU2A 4M4SA 1D5CA 2FFQA 4TZ0A 2QGZA 2V7QA 3IIMA 3U7HB 1Z83A 4LHZA 1IONA 1UBCA 4RD1A 4PQFA 1R8QA 3AKYA 4HB2A 5J4KA 1D8TA 1XX6A 1RVDA 4LRWA 2I3BA 2EU8A 4UNNA 4M21A 5GVSA 3QEOA 4FMDF 2GDJA 4BLRA 4QXAA 1A2BA 2P5SA 1X1SA 1OH6A 2XAUA 3KQUA 3JZAA 1R8SA 2ZJ5A 1NN1A 3K9HA 1UBFA 4Y0VA 3KFXA 1NY6A 3QXHA 5H1YA 1NVXQ 2IYSA 3MJHA 1OXSC 2YWEA 4KCGA 5FUVA 4IVQA 4A2QA 3W3AA 3B1XA 4EJSC 4EPRA 1OH8A 4HZUB 4C0LA 1E98A 3ASZA 3T35A 2OCBA 1E9SA 1PV4A 2CHVA 1G8FA 1SXJB 4EAQA 5L3QB 2ERXA 2FWRA 2P67A 4G5OA 4O0MA 4RZ2A 3RLFA 3K0CC 1GL6A 3VKHA 2NO9A 4FMCF 4IW3B 2PLRA 1Z28A 4M1KA 4AK9A 1CRPA 3ZD6A 3N5CA 4Q48A 3W6PA 1SXJD 4DEXA 3ZIAD 3TR0A 1G3QA 1E32A 4DWJA 4LWZA 4MH0R 5FPSA 1JXMA 1U8AA 1M1YE 5KNDA 3OEHD 4MRNA 1RJ9A 1D6JA 1NF3A 3QJYA 5JEDA 4MRRA 3FHOA 4DZZA 2IEYA 3W6OA 1ZUIA 2XTNA 3KDSE 1I2DA 1XXHA 3LQRA 1HURA 1DAFA 3QKTA 5AUPB 2I1VB 5A5GA 5K8UA 3UATA 2AFHE 1LNZA 1EWRA 4M2LA 2ZREA 1R5NA 1VG1A 1WA5A 1ZP6A 1GKIA 1XFAA 2RGDA 2ZTSA 3MG9A 4PAQA 4LZZA 1E2IA 4MRPA 3VNVA 3U3MA 2CVHA 2V4ZA 2JJ1D 2HT6A 4N3NA 2XZOA 1TEXA 3A37A 1AQUA 1CF4A 4NCKA 1UDWA 1LY1A 2X2FA 4LBZA 2IW3A 4DDUA 4CF7A 2QSZA 1UEIA 5C4MA 2WKQA 3KKQA 4D0NA 3BFXA 3LWNA 2W2XA 4Q19A 2HF9A 4NYIQ 1YHNA 3QXSA 2F43A 3I92A 4P33A 5IDVA 3ZLJA 4H9GA 2K5UA 4FCVA 4X8LA 5G53C 4PPNA 4YMWA 4G5QA 2W2TA 5CDFA 4GOJA 1OV4A 1VCNA 1SGWA 2ZETA 3DZ8A 5L3QA 5KHOC 5JFGA 5F9FA 4BECA 1T91A 2DFNA 2GEUA 3CRW1 1CJUC 1JALA 3P1JA 2XEXA 4JLPA 5C18A 3B82A 4A36A 2GK6A 1XXHE 4NYJQ 3B6EA 4CEHA 3TW8B 3WYAA 2Z4SA 4UNRA 1N5IA 4D0GA 4XVUA 1HE1C 2XXAA 1W36C 3AM1A 5DNYB 4LPSA 2KI5A 2WJVA 4QHTA 3ADBA 4PXAA 3MSXA 4JSTA 1Z0KA 2KWIA 3FHCB 3ND9A 2QI9C 2IYYA 2R6DA 4JSYA 4V02A 5KDOA 3NKVA 5A4JA 2E1RA 2HDNB 5FBLB 3TW4A 1BMFD 3PUXA 1HA3A 1NVVQ 4QC2A 2R62A 1XD8A 1XPUA 3EARA 1JAHA 1YQTA 3PUVA 2Z0MA 4O2LA 3B9QA 1S96A 1OFIA 4TYQA 4LBYA 4TMVA 1NMYA 2FPLA 3EAQA 4LGMA 5HE9A 2WKRA 2X19A 4BE7B 1AZSC 4JT2A 3CPEA 5SZHB 4B3XA 5JWHA 2ZE7A 2QP3A 2ZJAA 1N6HA 2GILA 1RRCA 2HT1A 1OF1A 3QKRB 4L16A 1GKUB 4PQYA 5DH9A 2HYDA 3SNHA 1DS6A 1JQJC 1XP8A 4TLDA 4OL0A 2ZUBA 2VHJA 1NSFA 1HV8A 4RVCA 2C9OA 2J0QA 1MABB 4Z8XA 4V03A 4QM6A 4ABYA 1VG9B 2GXSA 1ONBA 1N6PA 1AA9A 2QE7A 3RS2A 4BFUA 3DOFA 1W36D 4PANA 1KK2A 1RE0A 3QBVA 1Z06A 4BZPA 4B48A 4XSGA 4RFVA 1GZSA 2Q6TA 2Y8EA 4OHVA 2QU8A 3Q85A 3VQTA 2VSOA 3NBZC 4HLDA 4A15A 1M34E 3AVVA 3KTAA 2ZRKA 1JBKA 3EA0A 1R0WA 3TUJC 2I4IA 2CHQA 2V6IA 4UJ3A 3THOA 5B30A 3CW2A 4BFWA 5J4HA 1AKYA 1G6HA 4FI3C 3T1QA 2GZDA 4HLUA 1CXZA 1XEXA 4LHVA 3EG5A 2IYWA 2YYZA 2F1HA 4H1VA 5JHHB 4B75A 3O8DA 3HPRA 4F92B 2A5YB 4C0AC 3GJ3A 4Q4JB 1W49A 3BAFA 1YZTA 2IK8A 3RWOA 5K8LA 2GXAA 4O3MA 1P2VA 3GEEA 1G16A 2UVQA 1MO5A 4U5XA 4CEIB 2ZVQX 4I1UA 4OQFA 2VP2A 4N0EA 4E5UA 3SDZA 5LPNA 6Q21A 4XIGS 1JR3E 2XTZA 2C2HA 1I4TD 4C0KA 2RB4A 4E22A 2OE2A 1ZNZA 2F43B 3KFVA 4Q7LA 3I61A 5L8VA 1NMXA 1ESMA 2GF9A 5G40A 4B76A 3R8FA 4LJAA 5JECA 2ZYTX 2DB3A 5P21A 2C77A 2N1BA 4C9BA 4DCSA 2WKPA 1OYWA 2QM7A 1NBMA 2PMKA 1ZM3A 3I5XA 2OLKA 1NG9A 4UNSA 1OKKA 3VR5A 3OIUA 2BMEA 4OKSA 2YWHA 5FOVA 2UKDA 3S1AA 3LFUA 5DISB 1QRAA 2ZRNA 1KY3A 1GNRA 1IQPA 5EUMA 5FPKA 4KBFA 1EFRA 3IIJA 5J4YA 2W83A 2F9MA 4YQFA 1KJZA 4CT5A 4TLBA 3BS4A 4R7ZA 1FX0B 4JYCA 3X1ZA 3X2SA 2V1UA 2B8WA 2OG2A 2VO1A 2DWPA 5JS7A 4ZI3A 3A8TA 2ZSBA 3U4QB 3DZDA 4D4MA 2FEOA 1COWD 3CPJB 1DE0A 521PA 3E5HA 4OYHA 2ZQ5A 3SHWA 2QRZA 5C1BA 4G01B 4DCTA 1K5GA 4QFMA 4D4LA 2ZRCA 1XU4A 2W2VA 2FSIA 5J40A 1MH1A 2CCKA 3RWMB 4BZXA 4LUCA 4ZCLA 2WSSA 2OZEA 3CKLA 1OIVA 1Q44A 5LD2C 1IXRC 3CH4B 1EXMA 2ZAMA 2AHOA 3LBIA 2WV9A 2YZ2A 4C2TA 3IEVA 2IS6A 2VP5A 1K5DA 1D2EA 3QVUA 4OQNA 2Q21A 3BH7A 4BLOA 1CULC 4HUTA 2ZANA 2G3YA 2WMOB 1W0JD 2N46A 1SXJA 4Q9HA 1YU9A 2REXB 1IY2A 2BBWA 2LCFA 2QAGB 1AGRA 3KB1A 4LYJA 1W4BA 2VP6A 4Q00A 1J90A 2O52A 1G64A 1OFHA 4GFDA 2IL1A 3RANA 1II8A 3U2QA 2IXEA 2RGXA 3HDTA 3B60A 4CYMA 2OHFA 4KITB 4JL8A 2C04A 2CVFA 1E9AA 5FI0B 3KB2A 1SXJE 2VLIA 1VG0B 3PCRB 3QXCA 1Z07A 4LYFA 4MKGA 4NCJA 1GL9B 5DYIA 2XZPA 5TARA 1WDTA 2F1IA 4O2RA 2J41A 3DDCA 1TU3A 3IBGA 5LB4A 2WJHA 2ZEJA 3GFPA 5F2EA 4B3DA 2NO1A 1NLZA 2FN4A 1AQYA 3AVTA 4MUBA 4HUQA 3C15C 3T06B 3LH5A 4EPTA 3QG5A 5DHAA 1Z2CA 2NQ2C 2OV2A 1G4UR 3LLUA 4PZYA 3U3KA 2AKYA 3GQBA 1N6OA 3M6AA 1VYVA 3QIAA 4R2IA 1VHLA 2AKAB 3QF4A 1KI6A 1ESNA 4TLCA 3OEED 1QVAA 3LX5A 3LXRA 5C46F 3AF4A 2BBOA 3RS7A 3GD7A 3WNDA 2J0UA 2IA5A 4LK2A 3SU8A 3A1UA 3QKSB 3D7MA 1W5TA 2NMVA 3G5UA 4UNQA 3KJGA 1QG4A 3DMNA 2GWHA 2FFAA 4FN5A 4Q1EA 3IPYA 2XNDA 1W47A 2LKDA 5FBRB 5JSZA 1JR6A 4OBEA 1SKYE 3FYHA 3I1FA 4OJQA 4JZKA 4I1SA 1VCMA 3NH9A 3IBYA 4MYHA 1IAQA 4M1TA 5JCPA 3BWDD 3CF6R 2ZRFA 3NC0C 3OFNA 4HUQB 1PLKA 2OUKA 1OFUX 2D3WA 4DUGA 4US2R 4ZIRB 2R8RA 2QRNA 1GTVA 4C0BA 4B6FA 1WQ1R 3ZZTA 3ADCA 1V5WA 3TMKA 3A36A 1WE2A 3DL0A 1CR0A 1QG2A 1G7RA 2F1RA 3GLFA 3U5ZB 1KJYA 3GLHB 4ARZA 1M6NA 2HXYA 3H4MA 2KJQA 3THYA 4F4CA 3PITA 1CRQA 2GZHA 1SQ5A 3IDQA 1Q1EA 4M1SA 2ZM5A 3CLVA 3TLXA 1XCMA 3AVUA 2QA5A 1II9A 1ZU5A 5IT5A 1MRNA 4NZYA 3F8TA 1TF2A 3K0AB 4PPGA 1VYTA 1Q20A 5CM8B 1W48A 2Q9CA 4LV6A 4YMVA 3GFTA 5L3SB 2PH1A 3A58B 5LDDC 3B13B 1G8PA 1Q1QA 2PEYA 3UWOA 1W4AA 4URWR 1FX0A 5AJXA 1QZXA 4M0LA 5F98A 1XCPA 1NNEA 1A82A 2G6BA 3Q7PA 3B9PA 3IHWA 1R0YA 4MYUA 4OHZA 1UFQA 3RRMA 1OXVA 3B1YA 4TLEA 1TQ6A 2CJWB 5EP4A 2FOLA 4ZI2A 1E99A 2GCOA 3VR4A 5EE1A 3HR8A 4OQLA 3LBHA 3U4QA 2ZRAA 4AD8A 4TYYA 2QTVB 3BH0A 4YMSA 4C2UA 5KNBA 1WBDA 3AVOA 1BS1A 1XEFA 3K09A 3FB4A 4WXPA 3CIOA 1WP9A 2ZR0A 5GJCA 4EPXA 5JI2E 2D2FA 1IJEA 4E07A 1UKEA 3GLFE 1GSIA 4EKDA 2G88A 4R2HA 1HQCA 3VU9A 4Z51A 3UANA 1P5ZB 3K0FB 4PSVA 4MKHA 2H16A 3QVVA 2CEAA 4HB4A 1OFTA 2WWGA 3K1JA 1W0KD 1ZNYA 3EPKA 1XWIA 1CKEA 2GBLC 2OCAA 2RAPA 3DOEA 4GPTA 3FFAA 1FTSA 1FOEB 2GJSA 2P2LA 4CDGA 2YINC 3AUXA 4FMBB 1KDTA 3R9XA 4KHZA 1X8LA 4YMUA 5AUNB 3Q9LA 4IEIA 2WIBA 3ZYCA 5CK5A 1H8EA 2HF8A 2FPKA 4IXMA 2A9KA 4X8OA 2DFKB 4G5RA 1KDPA 1P75A 1YR9A 4PPFA 5FBWB 1XBTA 3GJ7A 4RY2A 4OHYA 3IGFA 1KSGA 3BGWA 5LBIA 2B7BA 4DBLC 4JL5A 4B32A 3Q8XB 4BFTA 3AV0B 1KDOA 3K0SA 4EQ6A 5D3QA 1U9IA 5AJVB 4A8JA 3QQ5A 4ACAA 4PC1A 2IS2A 2ANCA 3KL4A 2IUSA 5EE0A 4DC9A 3A4LA 1OHHA 3GLIA 5BN5A 4OK3A 1RYFA 4A0FA 1ZYUA 2GNOA 4G0NA 3DKVA 4PSKA 5FUYA 4LYHA 4NL4H 4L8GA 3H2YA 2CK3A 1VTKA 4MQBA 4A6PA 4HYYA 2YHSA 5EZ5A 1Z8FA 2R6GA 4C0HA 1EFHA 2FF7A 1ZNXA 2WWXA 4AURA 4EUNA 1CLUA 1JJ7A 2BDTA 3T5GA 3WHLA 5KSPA 2QMHA 2WPDD 3BFKA 5E7MA 5DGXA 1SVIA 2CCJA 2J5XA 2ZYUX 5L3RA 1AS2A 3NVAA 3QKRA 3OE7A 1U81A 2ODWA 5IK2D 2ERYA 1VHTA 3DEFA 2EYQA 2GEVA 1E1RA 4TN1A 2FGKA 2OO7A 4KI0A 1IY0A 3U3OA 2QM8A 3H1TA 3R7WB 4NU0A 3LA6A 1ZNWA 2JLQA 1GRQA 4HDOB 3KJIA 4E09A 3OEEA 2GJKA 4RD2A 3D6TB 4HDCA 1LVGA 2BJVA 1CJTC 2X2EA 4BPBA 1Z0JA 1H8HD 1PZNA 2XXAB 3W3ZB 2QQ0A 3LNCA 3VKWA 3AKCA 3TVTA 3L0SA 2OFXA 2WHXA 3D8BA 1E9RA 2V54A 3O8RA 3T1TA 2A2ZA 1Q22A 1I4LD 2JGNA 4GOKA 1U94A 1U0HC 2GCNA 3EIHA 1NMZA 1U0JA 1MO6A 4ZCMA 1TPZA 3NBXX 3O8CA 3AF1A 1W7AA 3G0HA 1N3BA 1Z2AA 1N6LA 5JWOA 3GLGE 1EFUA 4D25A 1COWA 4PC3A 4AKEA 4C3ZA 3RHFA 4DUGD 2O8BA 4B73A 1KHTA 1OPXA 5HCIA 2J87A 4C30A 4YMTA 2C9CA 3K0FA 4F91B 4PZZA 4D0LB 3C4JA 3M0EA 3A1SA 5LB2A 2QBYB 3DM9B 4K8OA 2W00A 4Q03A 4KXFB 1DG3A 5DI3B 5EUQB 2ZJOA 1N5KA 1IN5A 2BKUA 3PVSA 4BASA 1XEWX 3IIKA 4DCNA 2QMEA 4MRVA 1S0UA 3LRPA 1A7JA 4P31A 4CT4B 5JEEA 4D82A 3W6NA 4IOJA 1GOTA 3N70A 1T0HB 4FXPA 4NYIR 2ZRGA 4UNPA 4XVQA 5DN6A 1B23P 1EESA 1G21E 3CRVA 4Q1FA 2A30A 3VNUA 4LPKA 3HU1A 4DLYA 3EIEA 1I2MA 221PA 3DVLA 3Q3JB 2J46A 4FWIB 3TBKA 4A9AA 3EIQA 1S8FA 3B1ZA 1BIFA 3KQLA 4IFBA 2ZPTX 5AJWA 1AZTA 4AYXA 2GXQA 2VP4A 1ZC4A 4XOIA 3CNLA 1KOFA 1G8YA 3IO3A 4Q4AB 3VFDA 1CJKC 1E2GA 1T3HA 1ZD9A 2L0XA 4M9SA 2Q0HA 2G9NA 3GJ8A 4CEIA 2CLDX 4QGAA 1OHHD 1N0WA 3RC3A 4MGKR 2NZJA 3R8CA 3K0AA 4DB4A 4IFEA 3BIFA 1TUEA 1KDRA 1E79D 1XDBA 4TSFA 2IUUA 3ZQJA 1WCV1 2YJTD 4GL2A 1E9DA 1G4AE 1CR1A 1PVOA 3UIEA 1OXTA 4D2IA 1Z0AA 2O0JA 3THYB 4LSGA 2GKSA 3QY0A 4ARZB 1ZRHA 5TB5A 3MMPA 2EFGA 3ND8A 3PEYA 1M8PA 4CIDA 1EX6A 2R44A 5BN4A 1SKQA 1E2MA 4PHHA 3VR1A 2IBMA 1KI9A 4ZV4A 2RHDA 3IQWA 4Q9LA 2JJ8A 3Q72A 4KO8A 4HDQB 4D80A 2WVJA 5KSYA 4C0SA 3K0EA 3W8NA 4HAUA 2QY9A 5FR1A 1NLYA 2BEKA 3KQNA 2FMXA 3ZD7A 1P9NA 4MITA 4MRSA 4QHYA 3WY9A 1IJFA 2BCGY 3E1SA 3H0KA 5E7IA 3VKGA 2X1VA 4Q4HA 4G3XA 2ZUCA 2ZYWX 2XJ4A 2DCUA 4KV9A 1JEEA 1Z6GA 1DO0A 2P0EA 2RGNA 4LJ4A 4RKFA 3I3SR 2GBLA 1NKTA 2RGAA 4QGFA 3FVQA 2VEDA 2EFEB 1S4QA 5BXQC 2H1LA 1TQ2A 2VSXA 4ILEA 1P9RA 5E7JA 4GDFA 4D6PA 4NCNA 4KSCA 2J7PA 3I62A 3SQXA 2FSFA 4DVGA 2PX3A 1YRBA 1VIAA 1Z08A 1G6OA 1O87A 1MV5A 2HLDD 1G3UA 2QE7D 2PEZA 1DTSA 1W44A 3K53A 4X8HA 1VCOA 2IHBA 1YR6A 4KODA 4TT3A 4A6XA 1UPTA 5FPTA 2GF0A 2F3TA 2GESA 3FKSD 4DSUA 1P61B 1YZQA 3AVQA 4R98A 1CR2A 1NVUQ 3MD0A 1T4GA 5GJBA 4AKIA 4LHXA 4BFZA 1J7KA 1Z0DA 1ZUNB 4KSBA 3SFVA 4JKYA 3VX3A 2JIZA 2ZU6A 4RZUA 3U60B 4ZKDA 3U7EB 3KXIA 4M1YA 1RC8A 5D3MA 3UG6A 1F5NA 4Q1BA 4KLNA 4B2LA 1N25A 3AGPA 4ZDJA 4HEJA 3I72A 3FWYA 3X1XA 2ZAOA 3TUZC 3TR5A 4IDPA 1TADA 5DIFA 1Y3AA 5FOXA 5B2ZA 3C5HA 2J7KA 3L8ZA 4KFUA 3MRSA 3RSOA 2RGEA 1QHSA 1EWQA 1MRSA 3L82B 4Z1MD 1P6XA 3EZ2A 4HLUC 4WZBE 2QROA 2IS4A 5CJPA 2P5TB 3T34A 1EFTA 2R6FA 5CM9C 2WWYA 2G1KA 2WZQA 2HCJB 2DYKA 1R2QA 3F3YA 1GFIA 2IUTA 4MGIR 5FL7D 2IWRA 3MUFA 3T61A 1HEIA 5KYKA 4LJ8A 3RABA 4Z1MA 1X8JA 3K70D 3WRXC 4B3FX 4D4JA 4PSAA 5G3YA 3IO5A 5SZIA 1DARA 4CVNA 2AWOA 2GJ8A 3GLGA 1JI0A 2VF7A 5HKKD 4B6EA 2W6JD 1E0SA 1U99A 4Z54A 1GRRA 4EDHA 4A0RA 5K8IA 2QUZA 4KLZA 3GJ0A 2W58A 4ZDKA 4FWTA 4L5BA 2PLFA 5CLLA 1L4YA 1US8A 4JLNA 3QG1A 4PTLA 4A82A 1D9XA 1UBGA 1IN7A 1BYUA 4R71A 1EGAA 1SVOA 1VECA 4TMTA 3NEJA 2P3SA 1XPRA 3W5IA 2XITA 1JR3D 4LHYA 1R5BA 4BRWA 1P9WA 3BB4A 1E6CA 1Q3HA 4B34A 1W5SA 3IPXA 4B44A 4PZLA 1W4RA 3ZZUA 3F0TA 3SBDA 2D2EA 3S1AB 4D4KA 1U0LA 4UXHA 1GITA 4DDWA 5FPYA 3MWLA 4PAOA 1XXHB 2CL0X 3TQCA 2CLCX 3EX7C 4Q66C 4RD6A 5EP2A 1NN5A 2QMOA 1JAIA 2CDNA 3TAHA 2QPAA 3AP3A 3GLIB 5EE9A 3A6PC 4UXJA 2GCPA 2IXFA 3SJBA 3SEAA 2OBMA 1TNDA 3CWQA 5G41A 2CL6X 2JDIA 3IKJA 1YR7A 1RKBA 4TZ6A 1L8QA 4OJKA 3CRMA 5E3HA 4KFRA 2WMNB 2FSGA 2RH5A 2MMCA 3CX8A 4Q1AA 1VCIA 1XJ0A 3BB3A 4ASUA 1KK1A 4Q4JA 1FNMA 4BRUA 5KO2A 5FR2A 1G3MA 4N0DA 3FE2A 1GWNA 4IDOA 2BBTA 1TF7A 1NG1A 4ITRC 1S9HA 1J70A 4KFTA 4BEJA 2HYIC 1G20E 1RPZA 1EG7A 4QBHA 5CB6A 4L9SA 1W0JA 2JA1A 2VL7A 4XTCS 2QG6A 1SKYB 1P2UA 4OK5A 2ZI6A 2A5GA 3T1VA 4QBIA 4JLKA 4W5JA 1OH5A 2WWHA 3B78A 5AUQA 1H65A 1Y63A 2Q9BA 5HZHA 5BN3A 3GJ6A 3MLEA 3OF5A 2C9YA 2J45A 2BHRA 3ZVLA 1KO4A 1YR8A 2NTYC 1DBSA 4OI4A 5TY0A 1MR3F 3CNOA 1D2MA 3RNLA 1G3IA 2IF2A 5IRCD 2NO0A 2R9VA 1IOZA 2JJ1A 2NO7A 5DI9A 2BKEA 1G8HA 1HTWA 1UF9A 3PUWA 4EJSA 3CB4A 5HR5A 1VKJA 3QF7A 4P4SA 5FOWA 1CJVC 1LTQA 1X1RA 3CF2A 4IVRA 2OAP1 3ZGXA 4EFMA 4LCBA 2ZE6A 3KKPA 2FDCA 5BWMA 2QQEA 2VRWA 1CS4C 2BMDA 1FZQA 1YZLA 2O8FA 721PA 2ZXUA 1KI8A 3PG5A 4CEJB 2CMKA 1Z47A 2PBRA 4JBXA 1XPOA 3SZRA 5DN6D 2AD1A 3FKQA 1OIWA 4LJ6A 1GNPA 4PX9A 2FFBA 1D2NA 1F2TA 4CRWB 2DR3A 1C9KA 3OIYA 3PENA 2QBYA 2FNAA 3QPVA 4CZ2A 1JR3A 1M2OB 3ZVNA 2PZGA 1KAGA 4R9UC 4J0QA 3BJIC 2JLUA 4JLAA 3SYNA 4A8JB 3CF0A 1Z63A 5AWFC 1T6NA 4TYWA 2HV8A 2ZS8A 1T8TA 2QP4A 3SI7A 3QPUA 4QRHA 5HZKA 2BVNA 4GMXA 2RMKA 3GJ5A 5JMTA 3U44B 4NDZA 2IF0A 1CBUA 2OCYC 5FTLA 1ZMXA 2ZVPX 3QKUA 5HPYB 2AL7A 3MJRA 1MO3A 3FTQA 5EE3A 1AGPA 5FL7A 4YDHB 4FMCB 4NYMR 5BW8A 5CITA 5LD2B 5HTKA 5JHGB 3SBEA 4EPVA 1G5TA 4DLZA 1DG1G 3N2EA 3HYTA 1LW7A 2LWIA 1N5JA 2UZ3A 4B3CA 3C14C 4P3YA 2WICA 4IDHA 1P3JA 1KO8A 3BRWD 4LJ5A 2ZRPA 3LO5A 3AVPA 4PC2A 4QBFA 4IRUB 2B6HA 2FG5A 3RVBA 1KZGB 4DSNA 5IF9A 4RD4A 4JBWA 4L4UA 3KJEA 4OI2A 4KAXA 1KMHB 4PQRA 4OK6A 2H92A 4A0GA 1A2KC 1ODFA 1Z6TA 1XEWY 1JPJA 3V4RA 4P32A 3B2EA 3QF4B 1NRJB 3FKSA 3BORA 3QI2A 4BFSA 4XJXA 1YJ5A 4FCWA 3FDIA 2KSQA 2BC9A 3UMRA 1HYQA 3U7GA 3L2OB 1FW6A 4NP6A 5EXSA 3UG7A 3AKEA 2FSHA 4JS0A 2OEPA 3KKNA 2XJ9A 2WM9B 2ZS7A 1XMIA 2OESA 1QDEA 3RS5A 2OCPA 4XWAA 2CNWD 5EP1A 1KIMA 4HB3A 1WB9A 4ERNA 3BH6A 1KI3A 2B21A 2BM0A 1KO1A 2NOAA 5TDHA 5FBVB 1II8B 3A1TA 3TSWA 1HQYE 2EW1A 4YXWD 3SQWA 3KJHA 1U8ZA 4JLVA 3R9IA 3P27A 5H8WA 2F55A 2O8EA 4YC7A 4I1VA 2CL7X 1TL7C 2AXNA 3ECCA 4JLMA 2GVZC 2OM2A 2C99A 1BOFA 1FFHA 2Q3FA 3EPLA 2O8EB 2Q9AA 1GL7A 3B7GA 3RS3A 3B85A 4Q1CA 1UJ2A 3ZJYA 1CIPA 1E9FA 3EW9A 5CJ2A 5FTKA 2GZAA 3AEZA 4HATA 2IYLD 2Q3MA 1Z3IX 2A7QA 4ZIRA 2ZI5A 2ZIAA 1SHKA 2OFWA 3A4MA 3F5FA 2C5LA 1T0JB 2VHUA 3IEUA 4QNRA 1XB2A 4B33A 2PCLA 1YRAA 1G18A 3VU9B 1J99A 1E79A 4TSFD 1TMKA 4QJ5A 1N6IA 1YKSA 2WOOA 3LLMA 1JEDA 3NG1A 4B47A 4RD3A 1ZM9A 1CU1A 4MUAA 3RAPR 4DCVA 4M1WA 2GK7A 4K46A 1FMLA 5JJLA 1F2UB 1E0JA 4JIMA 3X1YA 1P2TA 4PO8A 2H18A 1HY3A 4NHOA 4FCTA 5B58C 2GAOA 3QKSA 1ZW6A 4ESVA 1XJQA 3WP1B 4IDQA 2GCOB 2DY1A 4DLTA 2CJWA 1KJWA 2EFDB 2CHGA 1N2CE 1EFCA 4GRAA 4C4PA 1A1VA 3NBYC 1E2QA 4QM7A 3FHTA 3UPUA 2HJVA 1DAIA 4XH9B 1GKYA 1TAGA 1UKVY 2BJWA 4KVGA 3ASYA 4MYCA 4NKRA 3WNCA 4ZCIA 5KOYA 2YKGA 1UEJA 1M7HA 2H57A 3OAAA 4WIAA 3WBKA 1GP2A 4HB0A 2O8CA 5L3SA 1TEVA 2GETA 2UZIR 1FP6A 1T9HA 1ZAKA 1VG8A 1TF5A 1EK0A 4FIDA 4IVPA 3BOSA 3RRNA 1YE8A 5BYKA 5EQTA 2XB2A 3TUIC 3OEHA 4AIIA 1NJFA 2ZI3A 5FUWA 5GJWC 4MGYR 2GXUA 2Z43A 3PEUA 1CR4A 4TMZA 1WBBA 4FD2A 4E03A 1MOZA 4ACBA 4BWYA 3DHWC 1JQLB 1Z6AA 3PXGA 1E2NA 4X8MA 2IT1A 5UKDA 3VR2A 1X8KA 2IYTA 3GFOA 4OI0A 4QGGA 1XEXB 3WMFA 3QBTA 4DLRA 3QUSA 5EP3A 2A5JA 3KQKA 1GG2A 2IEZA 3A4NA 3D3QA 3HPQA 1LB1B 2ONKA 2FZLA 4DLUA 5DE3A 4KYUA 4M9ZA 2IWHA 1C1YA 4HSEA 1KO7A 4Y0AA 3KUDA 4C0JA 4PPQA 4I4LA 2XGJA 5KUTA 2B92A 4ZDIA 4OI1A 1E94E 1BO6A 2C95A 2QAGC 2YOFA 4F4IA 2W0SA 1TUIA 2D74A 3GP8A 1E0AA 1MABA 2WJGA 4JVSB 4JVNA 1F2TB 4CGZA 3NEYA 4JT4A 3AVWA 4EPYA 2ODNA 2AN9A 3M4YA 4RCZA 1OH7A 2JJ2D 1XTRA 2OBLA 4FMDB 2ZE5A 5KNCA 3OIVA 1B0UA 3AH8A 4M22A 4GOXA 2JLVA 5FTJA 3BXZA 4EJSB 3KKOA 3JVVA 3EA5A 3EC1A 3OAAD 4BLTA 1ELOA 3TQFA 3EASA 821PA 3BERA 2ZRIA 2JJ2A 1UKZA 3IILA 3QXXA 3LX8A 2WPDA 2NG1A 2QT0A 4IKEA 4TL6A 1AS0A 1ZVQA 2N42A 4LJ7A 3NTUA 2OILA 5DYGA 4POAA 4DSTA 3ZIAA 3K9LA 2AFIE 3OIWA 3NDBB 2REBA 2J9RA 3E70C 4C0QC 1LS1A 2ZSAA 5FOSA 4TMKA 3DMDA 4YLGA 3B1VA 2W6JA 1DPFA 2WJJA 2EWVA 3NXSA 3AGQA 5JLJA 2VSFA 2P6NA 1XTIA 2ORWA 4WXRA 2J0SA 2VYFA 4XVRA 3CR7A 5J47A 2C8VA 1LF5A 4U00A 2YOGA 2V9PA 4TTPA 2H7VA 2RHMA 2VH5R 4M1OA 3MFYA 5H68A 4Q18A 3C5CA 3VTKA 2F1JA 5E95A 3T15A 4ESHA 2IX3A 1OB5A 1G291 2EYUA 4MDEA 1G1MA 4TMWA 2BOVA 4XD7A 1E3MA 1IXSB 1RZ3A 1TTTA 1SVLA 1Q57A 4Q47A 2ZROA 4N1AA 2PZEA 3PEWA 4JYBA 2FX3A 1I4DD 2C03A 3LDAA 2QAJA 1PUJA 1SZPA 1G9XA 2V7QD 4ZDWA 3PV0A 4AG5A 2A5FA 3HWSA 1Q3TA 2VP0A 3BBPA 4DDVA 3HP1A 1P62B 3GJ4A 3QSYA 4QJ4A 2WAXA 2JIZD 1Z5ZA 3HJNA 1UAAA 2NIPA 5EZ6B 4DKXA 2R65A 2JLYA 1SHZA 3W5JA 1GM5A 1OW3B 1FNNA 3RDPA 4W9MC 1QBKC 2QTFA 1S3SA 5JSZB 4RFSB 2PX0A 4GMDA 3LV8A 1E9EA 2JDID 3QOFA 1JB1A 2I1QA 3ZS8A 4KJZA 3VR6A 5DSZA 1E0KA 4JMPA 4QKQA 5CDFE 1X3SA 2OAQ1 2J1LA 2MSCB 4AI6A 1Z22A 2G77B 1K6MA 2YVUA 1G7SA 5AUOB 2BM1A 2CK3D 3GLHE 3NDPA 1QHGA 2GTPA 3DO6A 1NJGA 5J4VA 5FI1B 1E2KA 1EFRD 1AK2A 2QT1A 1FP7A 3H84A 1P7CA 2VIIA 4PHTA 3AP1A 2ZRJA 3IQXA 3CZQA 1T3LA 2QPTA 1VIYA 3KXLA 1KMHA 4URXR 2OBNA 1OYYA 1KYIA 1XTJA 1IN4A 2Z83A 3LW8A 1BMFA 4Q01A 5H70A 3REGA 1ANKA 4A92A 4LJ9A 5DI3A 5FBQB 3RC8A 1SVWA 3ICEA 4HLQB 2QP9X 3Q5EA 5A0FA 3V4FA 3LXXA 1S9DA 5FUXA 1JECA 5JS8A 4V0LA 3GLGB 3FMOB 4B71A 2JLZA 3OESA 1RRPA 1G8GA 4A4DA 2ZRBA 5EE5B 3FGNA 3ZQ6A 4Q5IA 1UDXA 4W7SA 3THXA 3CR8A 4GZLA 4JKIA 2PL3A 3ZDQA 1Z6YA 4HZUA 3REFA 3THWB 2ZI4A 2ZI7A 1DAGA 1E96A 1T5LA 3MWKA 3K9NA 3U3JA 4QGHA 2NPIA 3FMIA 4IOKA 4KFSA 1VDZA 2W6ID 2V6JA 1OJLA 1Q12A 4URYR 1BH2A 1KSFX 1HT1E 4YONB 5KDLA 3U6BA 4C7OA 5JJKA 4U02A 5TVKA 4BEBA 5D3MB 3O8BA 2WWIA 3X1DA 2REOA 2B8TA 1U2RA 2ODBA 4JBYA 4IOLA 5JZVA 4KBGA 3AP2A 2HJGA 3ETLA 2RGBA 4PO9A 3DM5A 1OIXA 3EXAA 4TL7A 1E69A 3IUYA 4Q7JB 2IS1A 2YC2C 3BFVA 1A4RA 4Q9IA 3OFND 4LV5B 1LFDB 1V43A 4IOMA 3UMSA 3NHAA 1WMSA 1YVDA 3SC3A 3X1WA 2WWFA 3EC2A 3BK7A 3AKDA 1NIPA 4DT1B 2O0HA 3FMPB 4AY2A 2X77A 2AK3A 1P2SA 3GCGA 2FU5C 2P6UA 2FPMA 3KXKA 4AC9A 4A2WA 1BKDR 2EVWX 4PHFA 2EFCB 1W4CA 1Q21A 2G0NA 2XNDD 1RYHA 2VQSA 1E2DA 1R4AA 2ODEA 3T1OA 4CEJA 1DAMA 1NVWQ 1J2JA 2ZJZA 3TAUA 3TVDA 5EJEA 4OHXA 2IYQA 4URVR 4GP6A 4MDFA 4YDSA 5ANRB 2AWNA 4P4SB 4M8NE 2RGGA 1G3RA 1ZD1A 1VPLA 1YZNA 2G0TA 3BC1A 4HI0E 4V0OA 4WBSA 2ZE8A 3GPLA 4BZQA 4Q4HB 1HUQA 8OHMA 1U8YA 4DIDA 2F3RA 1EX7A 4TYPA 1NLFA 2CE7A 5C2JB 1R6BX 4TWZA 3L0IB 4V0KA 4BLSA 3U61B 5DO9A 121PA 4TTQA 2XTMA 4TL8A 5BQ5A 3RS4A 4UQOA 1NP6A 4M9XA 4CW7A 5TMPA 1QHHB 2D7CA 1KI1A 4CEHB 2QSYA 1W2HA 2V55B 1XF9A 4MA4A 1N6KA 2BIFA 4FINA 1LS6A 3OZXA 2E9SA 1T5IA 2MSEB 3PUZA 2QNRA 1ZIPA 3P20A 2O8DA 1DAEA 2QL6A 3SN6A 2B7CA 3GEHA 4HAXA 5SZJA 3P26A 1R10A 1KZ7B 1NIJA 3K0CA 1XD2B 3I73A 1QHHA 4WAUA 3TJZA 1KKMA 5F3WB 3FFBA 1FPMA 2O8DB 1DVRA 1GVNB 1NN3A 1IY1A 1O3YA 4XSHA 1E1QD 2V8OA 2ZRMA 4IDNA 5JRZA 1SULA 3K70C 4GNKA 1S1MA 2WJIA 2PCJA 2WTUA 4I81A 3VR3A 1XRJA 3MGCA 5J4LA 1IBRA 3L0OA 4DLVA 5FTMA 2QMUA 4LOAA 3TRFA 1DO2A 3SE0A 2BEJA 2GRJA 2MSDB 5KTYA 4JVMA 1G7CA 4WVFA 2KE5A 1IM2A 2KBFA 5GJVC 4AG6A 4Q4AA 2O5VA 4RD0A 1XNJA 4LI0A 1AM4D 3TGPA 3EWSA 1GDDA 1AKEA 4JL6A 4LY6A 1IXZA 4ZKEA 4OQXA 5L3VA 5F9HA 4US0R 2IC5A 2VF8A 4DT1A 3LVRE 1U98A 1QHIA 4II7A 1OB2A 4DB2A 4GBMA 4P4UA 3RSLA 4A0HA 4HLCA 4PC6A 2GJAA 4LYAA 3R9WA 3AF3A 4LV8B 1GNQA 2ZJ8A 3PR1A 4MKFA 3W34A 1PJRA 4PHGA 1RJ9B 2G83A 3UMFA 1U90A 2X8AA 1OT3A 4TYNA 5GVRA 5FH9A 2AX4A 4TMXA 4M9QA 3LW7A 1ETUA 5HE8A 4NYMQ 4XWOA 5CYOA 1G5RA 2MMGA 1M74A 5E4FA 1US8B 1ZUHA 1NBMD 1KSHA 2DHRA 3WNBA 2H8KA 2O8BB 1U9IC 2ZJBA 1PLLA 3TNFA 2XOKD 4WW0A 1QF9A 4A8JC 4S35A 3I5YA 2D7DA 5TV2A 4EFNA 2ZUDA 2WIAA 4C7OB 3HU3A 4HAYA 1ZCAA 2A78A 2VHCA 2ONJA 2JLXA 2EFHB 3CZPA 1XMVA 3L8YA 1RRGA 1AIPA 1XJCA 1W2GA 2ORVA 3THWA 3ZZ0A 4F93B 3CWZA 3WXMA 1XZPA 4M53A 4RJLA 4NE2A 3GLHA 1Z29A 4ASUD 2H5EA 1QVRA 3OE7D 1SVKA 2FFHA 4RCYA 5IK2A 3Q7QA 3VMFA 2JLSA 2OXCA 4URUR 5DHFA 3LBNA 1NKSA 1FL9A 1ZD8A 3CX7A 3CONA 4JJKA 1R0ZA 2CNWA 2J3EA 2ANBA 3LD9A 3LY5A 2ZI9A 4B2PA 3R7WA 4F7WA 4I99A 5B57C 1N6RA 1HT2E 3TSZA 3ADDA 3CM0A 1OSNA 2WJYA 3W9YA 3QEJA 1N6NA 5JCZA 2BMJA 1KNQA 5KDDA 2Z6VA 1WXQA 4NYJR 3SJZA 3C8UA 2ZSEA 5JWRA 1R5OA 2BV3A 1N5LA 2HCBA 1G41A 4AKHA 3QNUA 3SJAA 3RRYA 1Z0IA
chains in the Genus database with same CATH superfamily
4NNPA 3I9OA 1UEXC 3B1WA 1MJFA 2HC9A 3FF4A 3C16C 2YICA 5H59A 5A71A 1O89A 1DELA 1DKRA 4N7MA 1GAJA 2GGSA 3KV1A 3BREA 3OH8A 2FMKA 1KE2A 4O08A 2BYTA 1SIBE 2ICAA 3CKYA 3T3OA 1AN0A 1M6WA 3HA3A 1E6WA 4UBJA 2DH6A 4TTVA 3O21A 5DM0A 5JUWA 2J9FA 3IMEA 4J0DA 1OA0A 3WADA 3W9BA 1UXHA 3O3CA 3AINA 2I99A 4CQMB 4PFSA 1CSEE 1ZKDA 1NI3A 3PNBA 3LAWA 2XD9A 3AR3A 4G1UC 1NF9A 5KBYA 2D13A 1Z36A 3TE7A 3VUFA 3ZCXA 4DE5A 1YL5A 1MB3A 4Y2JA 1JLLA 2FH5B 4WJLA 5B6IA 1QVVA 2I62A 1UPFA 2Q8NA 3R20A 4UTVA 1I3KA 3CH5A 5AW1A 1X7DA 3MSCA 3RRZA 2FLVA 3TIXB 1KFEB 2JH3A 1FF9A 3INNA 3N6RA 2WWWA 3ITNA 1W0KA 1L8LA 4AN0A 4L8YA 1SA0B 4RL4A 3PYMA 4CR6A 4ZREA 1W36B 2QAGA 3W7AA 1CZRA 4EARA 1KAOA 1RM5A 2PQ0A 1KOLA 5CIWA 2WHPA 1T4MA 3TQQA 3UJBA 2W4MA 5E9JA 5EXTA 2C4VA 5BN4B 4PINA 3R7DA 4EHIA 1I1OA 1QSGA 2V1XA 4J90A 3W8RA 4Q3DA 1S4MA 3A1VA 3HYRA 2H85A 3K9GA 4A03A 3DOJA 4BVAA 4GM4A 4JQYA 4BLQA 2ZRDA 3C41J 4ZQCB 1STOA 5CT5A 1A8QA 1B8OA 1RWNA 1WETA 3IPCA 4UQLA 1GUZA 1L1QA 4DIKA 2Q27A 1JYEA 1RI4A 4CM8B 3O6VA 3K5PA 4D6XA 2MYTA 1GXSA 5FF9A 1BFDA 1XRSB 1GY8A 2GB4A 2IYXA 3F47A 3SS8A 4Q7KA 5TPZA 5A3RA 1TM1E 2XMPA 2QJOA 2AFVA 2VTEA 2OSBA 2ZYVX 3GGOA 4UW9A 5I9MA 4N0QA 1U8FO 2CBXA 2V7VA 1XVTA 3LWDA 3CBGA 2HJWA 3HXTA 2QLTA 3E0QA 5U1PA 3WHKA 2GZ2A 3OJXA 3QVGA 3UW3A 4YFVA 2D06A 2YBDA 3K96A 2JATA 4KL8S 1LGYA 4LHEA 1QH1A 1VYUA 4UEQA 2QLFA 3W79A 1HEYA 1O6ZA 1NASA 1XKXA 2QTVA 2ZSFA 3KSRA 3NORA 3RVJA 2PT7A 2CSXA 3VV2A 3NBFA 1HLDA 2HPVA 2W0MA 1IHDA 4ZPXA 4YRZA 5DCYA 3UICA 1FBTA 2DG2A 1B0PA 4G09A 4RDHA 3LGAA 3LHIA 4DCUA 2ZJ4A 4RF5A 5TPWA 5BVHA 3FW1A 3W6UA 1IN8A 5JANA 1K8YB 2DY0A 2NP6A 1C0EA 2FZGA 3O9ZA 4I4NA 3ZJTA 3RTCA 2D2VA 5C4GB 1P4SA 1SC3A 1U3GA 2DFTA 2DPMA 4IXNA 4S12A 1FNBA 3O2NA 5E1MA 3UWKA 1LV7A 4K1XA 2H59A 4RSHA 5F1PA 2B8EA 4NV1A 5EYPA 2OCIA 4F9GA 3Q3GE 4QULA 1WMDA 3IKVA 3PRHA 4Q9AA 2ZP1A 2GM9A 3LXUX 2BCJQ 4BNIA 5FX2A 2AK2A 1HX7A 3QVOA 5COAA 1D2RA 1YB4A 4QVIA 3N2IA 3HO8A 2OFOA 3K8YA 2CJPA 4MV4A 5CB4B 2VNAA 3HABA 2FPPA 1F60A 3EW7A 1RFLA 1T2FA 3CUEF 1KZ9A 1BD4A 3BSYA 3Q7SA 4XVCA 1ATIA 2QX7A 2D2XA 3OZIA 3QYAA 4J07A 4DEYA 2ZS9A 2XMGA 1T29A 1YHZA 4RTMA 1JDPA 3OE5A 4P4TA 4ZTUB 5JPCA 4GWLA 2XHZA 2XYQA 1G21B 3KYJB 4TT8A 4HNRA 1N9ZA 5AK0A 4Z99A 3RASA 4TTIA 4GMGA 1TVCA 2Z1DA 3LMKA 3FCEA 4GX5A 4CHTA 2RKWA 2XGSA 2WBLC 5LSAA 1C9NA 1CF2O 1PE0A 3AUTA 2EGGA 2WY2D 2QPOA 3AR8A 2GKGA 5B1DA 3EODA 1PR0A 3D31A 1V8OA 2VJNA 1V16B 2WSSD 4KDEA 4ATNA 2R1VA 4DNOA 2BE9A 3BWYA 3DKPA 4QDOA 3WL4A 4C7BA 3T3EA 2P9HA 4ALLA 4OP2A 4JKOA 3QJ5A 4MUGA 1WNFA 4ARAA 2GM5A 1N0UA 2A1UA 3WMRA 2ZJYA 4G5GA 4YDRA 1IZZA 4V0MA 3R6GA 1CB7A 3G1WA 3LCMA 4JZYA 1FNSA 3ILHA 3UHOA 3GXOA 1KO5A 4MCHA 4K6MA 5D5HA 3ZI0A 3BMOB 3U6KA 1Q0QA 1ZJ6A 3LRTA 3WXBA 3IV9A 4I1OA 1ZMBA 1JDBB 2YWGA 4QA9A 4EYGA 4YLEA 5CFRA 5EXPA 1W1WA 1I30A 1P39A 5HBRA 3K1YA 3LQYA 1V3QE 5JXHA 2L82A 3FOZA 2O8CB 1WEKA 2XYVA 3DVAB 1KK0A 4LZJA 3KYDA 4EMBA 3FNHA 3HV2A 1P45A 1MVNA 2YC4C 2ZRLA 3DV9A 3JATA 3TNLA 1DKMA 1DRKA 1E4VA 1XTBA 3F1LA 2RJNA 5EMLA 4KFCA 1Y98A 1Q15A 5FFMA 3QPWA 1HFKA 3GCZA 1C7FA 2DQYA 1X86B 1J2UA 1QIEA 1QQ6A 1ARZA 1TM3E 3O47A 4ZN6A 1SOMA 3QXJA 5AVJA 2QZ9A 2JAPA 1AQIA 2VTVA 5JVDB 2L19A 1D4OA 1U3WA 3KOXA 4J8PA 4GT1A 3UYLA 1L7OA 3IA7A 1P60A 4M0FA 1XQ1A 2PWYA 5HMMA 3FPEA 3TF5A 1TECE 3OP4A 4GP7A 2QPLA 2QX4A 1NM5A 1YIOA 3EVFA 3UJ9A 3EY9A 3KEGA 3NP9A 4YRJA 1ICIA 3SWWA 4F5WA 3KKMA 5DHRA 3WBBA 2Y4OA 3BD9A 3N0XA 4PQGA 4EJMA 4X20B 2ZWMA 3NU1A 5A9RA 1V1JA 1QNFA 1F6BA 2TMKA 5AJYA 1M6VA 1SRRA 1EFPA 2HADA 3QIVA 3V5NA 3L40A 1UWLA 1EGHA 1FQKA 1X0VA 4LOJA 4RK0A 1FQWA 3E81A 3B2QA 1BE6A 5ENVA 2X2PA 1GUAA 2AHRA 3F5QA 4H3KB 4EHHA 1L7VC 2XNJA 3EFBA 3JALB 4Z53A 1JQ3A 4QOSA 4EHNA 2VHQA 1PZHA 3VI4B 3U7JA 1KI7A 1B4DA 1A27A 3KT0A 2A0YA 4PZUA 5CDHA 3PWTA 3ZWQA 3NHUA 4O4JA 1EGMB 1UUFA 1P4AA 1ZA1A 3BGOS 4LJYA 4CF4A 1H8HA 1YFLA 3MLAA 3L5OA 2OLJA 1DB3A 4Z9BA 3WGVA 5F7JA 4WUVA 2JFQA 1P73A 4V3CA 3TQSA 2FW9A 4D81A 3PNMA 4BFYA 3ISJA 2XRFA 3CLTD 4MJ3A 4NTZA 4P22A 3GMTA 1XZKA 2Z2JA 4G0MA 1VJCA 5DT9A 4DWWA 1CQPA 4U7HA 3CX6A 1E1RD 1U31A 4BGDA 3CR3C 4QNMA 5JAMA 4MX8A 2C96A 4MQFB 4FE4A 4HAZA 4I50A 4KXUA 2AZMA 2P9TA 4MYTA 5SYNA 1MENA 4AP6A 5ADHA 5KAPA 4NMHA 1KPGA 1M7GA 5K7SA 2IYFA 2SKDA 1SCUA 4LGYA 5GADl 1FTYA 4QUIA 1XZQA 1NF2A 2H4JA 3DFMA 2P4UA 2BWJA 1LX7A 3NBQA 4RJJA 5D84A 4CM4B 1PG0A 1IN6A 4P34A 1UM8A 4P3PA 1TMGE 1C4OA 1E2PA 2QN9A 4CI9A 4TVSA 1GIAA 1M7BA 2PKYX 5CGZA 3AHJA 3KZOA 2G4LA 3QW2A 1S1CA 1IEVA 2D5IA 2G7ZA 3DWFA 4Q1DA 5K4AA 5T3YA 3RVDA 3VAAA 4LY3A 3GEIA 5EWMA 3M2TA 3LVQE 1JJVA 1ZDMA 3LL4A 2F3UA 1USUA 3WWZA 2OXRA 3W8DA 1UOPA 2OO5A 4FW8A 1ZKMA 3TLMA 2G25A 4B2IA 3TSOA 1EVEA 1QQ5A 4D42A 1KPHA 1BCRB 3P2JA 4WCFA 3CN7A 3EWAA 4QYIA 1H2WA 2MR6A 3GLVA 2D1SA 1UKYA 3E61A 1HNWB 3FOAA 2VN8A 1A7UA 3N75A 4TQ9A 3D59A 2FWJA 3O74A 3BTOA 4WT7A 5IAJA 3QVSA 1HQKA 3CPHA 3QENA 5IDQA 3ANTA 1FVXA 3HB9A 5B3AA 5JZOA 4KQHA 4MMZB 3JVUA 3ROTA 1VJRA 1FTWA 2ZKLA 3ABIA 4GE3A 3ZH9B 6CHYA 4R3UC 4NOJA 4ICIA 5AKXA 5IVKA 3ZBTA 4Q21A 3UXMA 2QRHA 1L4UA 4AYTA 4XD7D 5K3BA 1MO4A 3BB1A 1NBME 3PF8A 1U0TA 4B3GA 3AUFA 1Z4LA 3GPIA 4HGYA 1GCGA 1M67A 3DCNA 4U2EA 4JLBA 3T52A 4HQKA 2VTBB 2QS9A 2GX6A 4I2VA 5HK8A 3E15A 5JAQA 4V0NA 1QHXA 4YAJA 1J1UA 3VU1A 1NW6A 3CO5A 3BIXA 1ZPDA 3UC9A 1OYVA 5F21A 2R66A 1ENYA 3E3NA 1GILA 3PHLA 4E11A 2I2WA 2YWFA 4U7DA 4UUNA 1RXIA 5A05A 3MPOA 4MUHA 2QTHA 2ESRA 4LC1A 4KMSA 4R81A 1DIOB 1CUYA 1FXWA 2IXTA 3EQZA 4BQSA 5CEFA 3OQIA 3SYLA 2H1RA 2WU4A 1JHYA 2AOUA 2ZB4A 3GFRA 3NHLA 3F2IA 1BYIA 4OJYA 3QVXA 1UDAA 2IHKA 4J16A 3WZMA 4MMXB 4TVBA 4PLHA 1LV8A 1F2DA 1UBMS 2AEEA 4KI7A 4YBZA 3WKBA 4EW1A 5KTRA 2XE4A 3B5JA 5E9QA 4G1CA 1U2EA 3AETA 4WCDA 4TOIA 1CP2A 3LL7A 2WJ6A 2RGWA 1EYZA 1U3TA 3R75A 3INYA 4BGUA 1LSOA 1J5PA 2Z5FA 3P4XA 3VSCA 1G7TA 2Q7OE 5C52B 4LX8A 4ZO4A 3GRZA 1TO2E 2AEMA 4RPLA 3D4LA 2DQSA 3HU2A 4UEWA 4CTOA 2GBCA 4BNDB 3WNZA 3DAYA 4LZPA 3SF0A 1KEUA 1GGFA 2QGZA 2V7QA 3PNSA 4O4LF 3VDRA 1EZ1A 2QJFA 1IONA 1BKSB 4JI6B 4FUTA 4RD1A 1L7XA 4PQFA 5IYZF 1DKQA 4C7XA 3KOOA 2WABA 5J4KA 1GG8A 3FOEC 1EPUA 2EU8A 1BE8A 4M21A 1ISJA 3N0WA 5BMVA 1E2BA 1SUSA 3MT9A 4G1FA 4QXAA 4ZZ1A 2P5SA 1X1SA 4P7GA 3WJ2A 4WOJA 1W8DA 1S2OA 1MJ5A 3KQUA 2Y6UA 4XR9A 3BYZA 1ND5A 2CY0A 1NXXA 1OMOA 1UBFA 2IIQA 1KU0A 1NY6A 2ZT5A 3KFXA 3QXHA 3V2HA 4QPPA 3UXHA 2K4MA 2YWEA 4YP0A 1TK2A 1E1YA 1WSWA 4Y2HA 1M2NA 4OQZA 5E3IA 5IJ0B 2I2XB 4OXRA 1P0FA 2M98A 4YP9A 1M2WA 4IF6A 4C0LA 4DOMA 1KMMA 3ASZA 3EUEA 3WLKX 1N1MA 1PV4A 1G8FA 1L5QA 3UMJA 4E88A 2YJGA 3GZTB 4RZ2A 4G5OA 4MRMB 1T6YA 4O0MA 3RLFA 1N3LA 1P2GA 2W6OA 3FNBA 3JQ9C 3TR6A 3KLNA 1I33A 3CUWA 3L46A 3F6CA 2W42A 1ONPA 2W6ZA 1HBJA 5CNJA 2Y0CA 1I0LA 2BFEA 1RSZA 4Q48A 1AXEA 1SXJD 2ABWA 4DEXA 5CVEA 1XMQB 3TR0A 4H08A 2ZUEA 5EJ9A 5T4FA 2JFVA 3DNPA 4DWJA 4MH0R 2N1MA 3VTFA 1CRWG 4RDIA 4YCCA 1U1FA 2GH1A 3R0XA 3MCVA 1WF6A 1DJPA 3G5LA 2V6MA 5EEHA 4IPTA 2JFFA 3AK4A 2XF8A 3EB9A 3FHOA 1NUPA 3FWPA 4KQCA 1R88A 4OGWA 4UEOA 4UM7A 3W6OA 1I2DA 3GRFA 2OB1A 1DAFA 3TNJA 3WGMA 3ITEA 1DIRA 1E60A 3DD5A 2QVBA 1MPXA 1YS9A 2GRUA 1SFRA 3PRJA 3PC3A 3RU3A 2AFHE 3UATA 3VH1A 3W9SA 3X2FA 3UMVA 4EA7A 1EWRA 4M2LA 3Q40A 5JMPA 3DTNA 4H6PA 3IUNA 5REQA 2RGDA 3ENWA 4ISBA 3MG9A 1WG8A 1ZAYA 4LZZA 1P1HA 5DJ5A 1L5FA 4B6GA 2HJSA 4MRPA 1H66A 2OC4A 4UC0A 3KTFA 5JBNA 4LZAA 1QP0A 1D7AA 3FXAA 4ZK6A 1FYFA 1W9HA 4WXEA 3U3MA 4ROTA 2AMLA 3P52A 3ND5A 2JJ1D 4FSXA 3P4UA 1YVUA 4X66B 1TEXA 4BLWA 3ENQA 3QHQA 4OQYA 4EG8A 1AQUA 5MF6A 5EQDA 3VPFA 4NCKA 1PHRA 1SMKA 1XDWA 1FLAA 4ZOBA 3KKQA 4D0NA 1GZ4A 4EB0A 3AL2A 1TD1A 4XOUA 2GPBA 2X0DA 4IIYA 1J8FA 3B1JA 2V0NA 3A6ZA 3NYWA 3QXSA 3GJRA 1R12A 4FYHA 5EPUA 3ZLJA 1QZZA 4X8LA 1JDSA 3FI0A 2HRRA 5AD1A 5TPZD 4GYKA 4GKKB 3CNEA 4G5QA 2W2TA 4YMWA 3U4GA 2JEZA 4GOJA 2H9AA 1E3TA 3BAZA 2ZETA 1VCNA 2PGOA 1O0SA 4IGIA 4Z9XA 2X5NA 1L4FA 1LRJA 4CTNA 4EJ6A 4MS3B 4BECA 1T91A 1YZVA 2DFNA 2P78A 4Y18A 3ZDEA 5BY2A 1AQJA 4L50A 1XNRB 4CN8A 4JLPA 3FRJA 4EATA 3B82A 1R6XA 1KYXA 2NT4A 3WAGA 3TNDA 4RWEA 3GT0A 4CEHA 3TW8B 4YX9A 1N5IA 1XTVA 2YXEA 4BX9A 2XXAA 2C4WA 4EMTA 1W36C 1T9BA 5DNYB 4LPSA 4JGGA 1PZFA 3JAWB 3B2NA 4EBBA 5D6OA 4OXXA 1DRUA 4B17A 4AZ0A 3ZY2A 1XTZA 4AJ9A 1H9BA 4MVWA 4MKXA 2VPWA 4RPHA 5GTDA 1C4XA 2R6DA 4JSYA 2IHJA 2I54A 1TTQB 4ZT2A 3FLAA 4DIFA 5AI0A 3TW4A 1HA3A 4KRXA 1A76A 3FUUA 4MUMA 2O1XA 4R5MA 3FPHA 4XFDA 1JSZA 1PFWA 1JAHA 1QLHA 4FYXA 3MD9A 1YQTA 2V9ZA 2Z0MA 4DR1B 4EYQA 4ITVA 3B9QA 4RH1A 5GZ6A 2GNPA 4BNUA 4AULA 4LGMA 5JSQA 2ZK7A 4R40A 5HE9A 2P9BA 3H7AA 3HBLA 3IOYA 1VL0A 4LSWA 2AF3C 4BE7B 3WX0A 1OBFO 3WFIA 3MT8A 4QATA 4PN7A 5AK5A 4EI9A 4JT2A 3IUSA 1X39A 1JDTA 4W8OA 4DV0B 3ITKA 4O2BA 1A4UA 5LZ7A 2GILA 4EG4A 3VKVA 2XIQA 4L16A 4YI3A 1M1UA 2HYDA 5DH9A 3SNHA 1BDBA 4JODA 1JQJC 4RX1A 3ZU5A 2AI2A 3ZU3A 3WTCA 2ZUBA 3QE4A 1PL8A 3JD0A 3ZJVA 2X42A 3OOWA 1R9NA 3IP5A 3HCCA 3I05A 4XWYA 1LLUA 1HV8A 3DOUA 4HDMB 4Y2SA 4RGVA 5CHEA 4HWTA 3ZHCA 2V74B 1OC2A 1SKAA 4IAOA 4QUAA 4QM6A 3PHIA 3J81A 3D8HA 2GXSA 2PZBA 1ZOSA 5DHQA 5A5EA 2FWBA 2QE7A 1RLUA 1M5TA 4K28A 4MLPA 3RS2A 1I9CA 4PANA 1W36D 1KK2A 4FFLA 3QBVA 1J0XO 1Z06A 4BZPA 4B48A 4DW8A 1SWWA 2VJLA 3BRSA 3P9CA 4H3VA 2ZDHA 2ZRKA 3EA0A 1C3VA 1WMFA 1R0WA 1LI4A 4MS3A 4ZU6X 5EEGA 1CEXA 2VNJA 3HBJA 4RTPA 3P45A 2HR1A 1RRMA 4IUBS 1Z25A 1CXZA 2EFYA 1XEXA 3I34X 3L1IA 1MUUA 1P4GA 3EG5A 1M34A 2YYZA 4B3TB 3L49A 5LYJA 1B2LA 1NV9A 5CDSA 5FWNA 1I7SB 2A5YB 2BISA 1YVPA 4DJEC 1IY8A 1W49A 3U0BA 2IKQA 2IK8A 3GEEA 2RI1A 1ABFA 2CMHA 2LDBA 5K0GA 2EL9A 3AF5A 2NU6A 3WIEA 3ZI7A 1OC4A 2M1ZA 3ETJA 2XCUA 5JXJA 4Q7QA 1Z0UA 4R69A 3QI7A 4J7CA 4OQFA 1W88B 4DS3A 4ZYXA 5IUNC 3C3AA 3SDZA 1KEEB 2QVYX 4XIGS 3ZV6A 6Q21A 1JR3E 4K40A 2C2HA 2RB4A 2H7CA 1ZNZA 2AMJA 2F43B 2FSUA 3KFVA 1OLSA 4Q7LA 3UK1A 4MV6A 5LP6B 2GF9A 4CM9D 3GPCA 5C3MA 1NQOA 1YO6A 3KAPA 2C88A 2P4HX 2GEBA 4LJAA 3S6JA 4DPKA 3A11A 3K9FC 4GVXA 5MN5A 4RTRA 2JNWA 4HDRB 1PNQA 2PMKA 4HRVA 1U7DA 3EEYA 1H22A 4X24A 4F3CA 1OKKA 3JWIA 2C4HA 3B53X 3KYCB 4WZAA 5P8WA 3REQA 3DDOA 1TUBB 2YWHA 4L72A 3VNRA 3ZE1B 2Y68A 1BRTA 3L0ZA 1TLTA 1U4SA 1Z7WA 4CL2A 3NXKA 5DISB 4C4OA 2ZRNA 1RWOA 3MS2A 5LNK1 2Y1LA 3UF0A 5CU7A 3FCSB 5HWSA 2G28A 4HVTA 1QX4A 3OJFA 4MP3A 1IQPA 1V2GA 3N2NA 4RAQA 5EWJB 4D7AA 5IMSA 1W59A 4KBFA 3UMYA 1J0CA 2EX4A 1OBVA 1M2GA 1KJZA 4TLBA 3BS4A 4CM7A 2V5AA 1FX0B 1ZXXA 4TS4A 4JYCA 3KQPA 3OTGA 5E1DA 1IM5A 5BV8A 2CLLB 2Q5EA 3WWCA 1PI3A 4EZBA 4HN9A 2ZJ0A 2B8WA 1EM8B 1XHEA 2OG2A 3KT3A 4I9UA 4OFZA 1KAQA 4PIMA 2B4YA 2FUEA 1V9CA 5GPBA 5AW6A 1DBIA 2ZB8A 1COWD 3G9ZA 5D51S 2BN4A 4WLOA 5JNTA 5C1BA 4JK3A 4LISA 4DM4A 1YB2A 2YQ5A 3IQIX 1K5GA 3I01M 4CLRB 2ZRCA 4RGBA 3HO6A 4D5GA 2DFVA 5CXQA 1U2TA 1WVGA 2VVTA 3ENKA 2YW9A 3CKLA 3A2NA 1OIVA 1QYVA 5EQJB 5ESWA 1IXRC 3GZNB 3P8ZA 3LBIA 3VPBA 4YAKA 4DRYA 4C2TA 4MZDA 2NVWA 3R4VA 1IYZA 1K97A 2BUAA 4OQNA 2Q21A 3BH7A 3A6GA 1CULC 3TPZA 3UC5A 4BJ1A 1PJ8A 1AG9A 2FW0A 1PDVA 4EENA 1RJGA 2WMOB 2N46A 3UK0A 3HKBA 3LVBA 1TEHA 1JI3A 4ZCTA 3ZIUA 2AS0A 2Q0QA 4W1SA 3PQ7A 1AGRA 1EK1A 3S7TA 4ZYWA 1Z88A 2C7PA 3QVKA 2O52A 1JKJB 1OFHA 2GLTA 3Q98A 3M6VA 1II8A 5BW6B 2FI1A 3U2QA 1J56A 4BKPA 4X7PA 4YRGA 5BN1A 4KITB 2XDQB 2R00C 4U2DA 1Z82A 3KVNA 5JTUA 3VA7A 1PWXA 4JOCA 4O4IF 1I1NA 1CV2A 2X3YA 4ZOCA 3TYXA 3WNVA 2A9JA 3IUQA 3PCRB 4MKGA 3UAGA 1Z07A 5JSFA 4OU5A 1SHUX 1ISFA 3BE5A 4BXOA 1WDTA 2O2JA 1N57A 3UBTA 4PGMA 2RI0A 3DLTA 3GJQA 3GJZA 3IBGA 2ZEJA 2H4XA 3L1KA 1QYRA 2YWXA 3JV7A 2FN4A 1GA4A 1AQYA 4UOQA 4MVJF 4ZXFA 1Z17A 5JPIA 3SD7A 5K09A 1Q0LA 4U4AA 4WLFA 1QKJA 4U6QA 5FADA 5DHAA 4EPTA 3P2KA 4P9NA 2NQ2C 5F2OA 2PDAA 2OV2A 2ADMA 2VZ0A 2JC3A 3QLUC 4MW7A 2H1VA 5DGIA 5DYWA 3W2GA 3LLUA 3DULA 5BYBA 4OD0A 2Q99A 1GVHA 4PNEA 5ITZA 3M6AA 2BEVB 2R8OA 3QIAA 1VHLA 3DFZA 5CVJA 4WL0A 1KI6A 3N3AC 1CPYA 3L7YA 4AUMA 1ST2A 3CG4A 2PVPA 3LX5A 2A33A 1VMEA 3AF4A 3RS7A 4MI3A 1GADO 3DKKA 2J0UA 1E58A 2P41A 5FA5A 1I4WA 2Q29A 3SU8A 2VPYA 4IZHA 1SHLA 3DZJA 3ZXXA 4HEQA 2QIPA 1BA3A 3N2ZB 2NMVA 4RMJA 4YCNA 3AG5A 3SEQA 2BFMA 4CUKA 1YGPA 4GLOA 1GCOA 2FFAA 4AO7A 3LPNA 4E4YA 4LWPA 1AURA 1W47A 3S0JA 1XNQB 3F67A 3R2JA 3IBFA 3QU2A 2J3LA 4RGQA 5DULA 3S44A 3SSMA 1JR6A 4K9LA 3VVMA 4MUJA 3I1FA 4Z0PA 1M2KA 4OQDA 1W2WB 3NH9A 3PNPA 4MYHA 1IAQA 4M1TA 5IZ4A 1P5HA 4IR7A 3OU6A 1NVTA 2JCBA 4TKMA 4YREA 1JEAA 2VH1A 2ZRFA 4FKBA 1Q1NA 3FM9A 3R0QA 2KW5A 1INLA 5JD6A 3H9GA 2OUKA 1OFUX 2D3WA 2FR8C 3HQ4O 4LA4A 3TJRA 4DUGA 2R8RA 2Y67A 2D4AA 1FBNA 4G1EB 1HNZB 2YVKA 1E62A 1QG2A 3PC8C 1ABBA 5EJ4A 4JI8B 2HTFA 4WKNA 3U5ZB 5CTJA 4LXQA 2C2MA 1K27A 2HXYA 4OP1A 5HFNA 2KJQA 2F9FA 3RK0A 4S05A 1WHSB 1PK7A 4EABA 4GI3A 2GZHA 2HDWA 1KWGA 2CXNA 5FWYA 5F5NA 2XCSB 1GAEO 1XNGA 3TLXA 3TNYA 2QA5A 3EISA 2BHSA 5EHXA 1ZGGA 4EO9A 1RQ7A 3Q10A 3PNKA 1E77A 3VSAA 3PRKE 1G63A 2XADA 5TGDA 5JASA 3R0JA 4LFCB 1N78A 4D4HA 2P30A 1RFGE 2DMRA 4AY4A 1RAIA 4RZHA 1Q1QA 2ZTLA 1WPGA 1ZHHA 2PEYA 1NAIA 4GRIA 5F98A 3MERA 4BNHA 1YRWA 3WLOA 4MCIA 3IHWA 4HDKA 1SCUB 2CZQA 1IK6A 1RAHA 3B48A 3KHUA 4FYYA 4J0IA 3RRMA 1UQUA 4KPFC 4WY8A 1UJBA 3T0IA 4TLEA 1TQ6A 2I1LA 4OMUA 3RAJA 4ZI2A 5HIMA 1F2VA 5EE1A 4OQLA 1Q5PA 2EDAA 4WVLA 1ZK4A 2F8MA 4TYYA 2QTVB 4YAUA 5KNBA 1U2DA 4QUDA 5BT9A 4MI1A 4G0OA 1IZ0A 3LBFA 3MWDB 1XEFA 1XMPA 2ZR0A 3SHOA 1JT2A 4EPXA 3U7IA 4TYMA 5A04A 3HDYA 5E6RB 1RRVA 1U5CA 4UTXA 3CJQA 5CA1B 1HQCA 2WEKA 5K3AA 4UAJA 3KQYA 1ZJ5A 1P5ZB 2F1KA 3SX0A 4AL4A 4PSVA 3GG2A 4YUWA 4MKHA 3QVVA 1U7WA 1OFTA 3ESZA 3EUFA 2D0DA 2VR1A 1T25A 1QKKA 1FNDA 1IUKA 1ZNYA 1XWIA 2NT3A 2PQMA 3EPKA 4LG1A 1CKEA 2Q7DA 2RAPA 3DOEA 4R3NA 4QTUB 3AJEA 5LYYA 1FOEB 3LYAA 1QQTA 5ALMA 2ZBUA 1OLSB 5LA6F 3AUXA 1FU7A 3R9XA 1KC1A 1DWPA 1TCVA 2VDQB 4OBBA 3ROGA 3S2ZA 4AWAA 2WIBA 1GV1A 3BHMA 1CUAA 4Z0HO 4YASA 1KDPA 2YN2A 2E21A 3U37A 3IUPA 2NWQA 4PPFA 3TCXB 1GQFA 2QUBA 3NVKI 5M7EA 4FI3F 5G0TA 1WUIS 2NXEA 2VYQA 3PXEA 4JT8A 7ADHA 3I6IA 2B7BA 2HRBA 1AKMA 1NXQA 3G0IA 1Y6ZA 5HF6A 1O96A 3P9XA 4HQNA 4BFTA 3LUCA 5IXJA 3K0SA 2RKBA 2HWKA 4EQ6A 4QODA 3FZYA 5D3QA 3UK2A 2GT1A 2AH5A 2EF1A 2EJTA 3MJEA 1VB3A 4WEQA 2XUIA 4X7BA 1UPXA 2B3DA 4FNMA 3ZNQA 1WOYA 4FOTA 1WPRA 3R24A 2JHGA 5KINB 5LNK6 3JQBA 5FNVF 3TG2A 5BN5A 1RHQA 2J9FB 1JPUA 4KR7A 4JJEA 3NBKA 1U6KA 3KQQA 5CTAA 2ID9A 1KQOA 4ZI5A 2GNOA 2RIPA 3PFNA 3GZJA 2VP3A 3IAAA 4PSKA 4EM6A 1DIHA 4L8GA 2QUJA 5BSWA 1KOGA 1VTKA 2TMDA 4A6PA 2JH9A 1ECJA 1VB5A 3ESDA 1U0EA 2O50A 1LWNA 2QT9A 2XOEA 3HJGA 3M5CA 4AZVA 3I64A 1BMTA 1EFHA 2FF7A 1YBFA 3IAEA 2WWXA 2DUJA 2ECOA 1U6JA 4KTVE 4YRCA 1GCIA 4NG5A 5AW9A 2Q2VA 3UAYA 2FK8A 2IVZA 1WSDA 4PG8A 5DGXA 3EXHB 2PVSA 2J5XA 4EAAA 1M0SA 4EFKA 5L3RA 4FXOA 3H9BA 3WIOA 1G5QA 3ILXA 2WP8J 1Q3KA 2ODWA 1IHXA 1PJAA 1ZH4A 5DOZA 3DQZA 1PFQA 3IDFA 1C9DB 5T4BA 5ALQA 4BXOB 2EYQA 3NTRA 4I4CA 1UWKA 2CN1A 4KI0A 3GQBB 1IY0A 3RV3A 3U3OA 4CUZA 2C7QA 2JLBA 2QM8A 3H1TA 4OHPA 2BRUA 1ODLA 1AK1A 3UJHA 4RVGA 5EWLA 3OKCA 5FHRA 1EVZA 3A9WA 4MVJH 4M86A 3G3EA 1KAEA 1CJTC 2X2EA 3CMCO 4IRMA 1E18A 1H8HD 1RADA 4FBLA 4BPBA 3D6UA 5FWDA 4BP3A 5BOSA 2XDQA 1C5KA 4LYGA 2WLSA 4A10A 1RWXA 2WHXA 3QNWA 4GKAA 4QEDA 1L7AA 2G7MC 3AB8A 3W5BA 1VDMA 2O5CA 1PR1A 1R6AA 1I4LD 3KK0A 2QG4A 4F4HA 2JGNA 4GOKA 3RKSA 4I9HA 2P9CA 1GAWA 2C7RA 5A5VA 2GCNA 3D2LA 3L8GA 4J4HA 5ESXA 3VC2A 2OL4A 2RIRA 4PW0A 2ZKIA 3ZJ5A 3UV7A 3K4HA 1TPZA 4XB1A 4ZCMA 1ILEA 3F9RA 1FMCA 2XUZA 5F77A 3CVWA 3C24A 2FN3A 3H75A 4HAOA 5SV2A 3OOSA 3O83A 2N0SA 3VPCA 2V9CA 4KN6A 3VSBA 1COWA 4IY1A 2VYCA 4AKEA 4DUGD 3ORSA 2O8BA 4B73A 1OPXA 4B3MB 4C30A 2C9CA 3VYVA 4RXTA 4F91B 1QV6A 1IUNA 1C1DA 3H42B 4PZZA 3C4JA 5CVCA 2OYCA 4OGLA 5LB2A 3VXKA 1LPSA 3DM9B 3LUGA 4GUAA 4K8OA 3FG9A 4R68A 2XIJA 3NHJA 1H4TA 3JQ8A 3NDJA 1M8GA 3PVSA 1DT3A 3IIKA 3GOQA 4ILKA 2SICE 1OU4A 1UDBA 1Y42X 4CT4B 1LDMA 1WXEA 1ITZA 5JEEA 2OC9A 5K6TA 3UHJA 5K0TA 1GFWA 5DEIA 3EGEA 5CFLA 2QZSA 3F5MA 3E22B 3SFTA 1GOTA 1RYBA 1T0HB 3MINA 5DN6A 4ES6A 1Y8ZA 1HYEA 1B23P 3CRVA 3LI2A 3WLTA 4EZIA 3VNUA 4DQXA 3H5WA 4FFNA 1BE1A 4KKVA 4DMMA 5KOJA 1ONSA 3EIEA 2BFDA 1Q17A 4G0WA 1I2MA 3M83A 3DVLA 3E5MA 2J9ZB 1A9QA 1HRDA 3Q3JB 3SC2B 4UAVA 2AMFA 2C7GA 4DY6A 3W2IA 4D6YA 4UM9B 5IJWA 2E18A 1NBAA 3C8ZA 4GMHA 4HZGA 5H81A 2ZPTX 3V33A 2XXJA 3CH6A 1GZ6A 4R41A 5BV1A 2HB6A 2I78A 3PFCA 1CJKC 4XIYA 3VFDA 5I8WA 1GQOA 3NIDB 1FP4B 1ZD9A 2BY4A 2TMGA 4IJ5A 4DANA 1F7UA 3EOAI 2R25B 2ZB7A 5U4XA 4ND8A 3S99A 2PUFA 1IBCA 4YFYA 2G9NA 3R74A 1PJTA 2V59A 2XWBF 3UYKA 1D6NA 1OAOC 1N0WA 2EAUA 3AFHA 3D7NA 4HS9A 1VIVA 1DWQA 3IMKA 3R8CA 4E3ZA 2LIPA 3O8OA 3CYFA 4UHKA 1YRYE 5I3CA 2VDMB 4P84A 5ALZA 3S7ZA 4RTJA 1K2VN 1LH0A 2YJTD 1W87A 4IH4A 2WTNA 1G4AE 2EFJA 3RFCA 1BWSA 1UAYA 5F1OA 1V3UA 1XAJA 1OXTA 1XVIA 1XWWA 1GAXA 2O0JA 3THYB 1DFIA 2R8EA 4U2BA 3WWOA 4P0QB 3QY0A 3NM6B 4H15A 4UHFA 1ZRHA 1R0BA 4P93A 5EA2A 1JG6A 2YFQA 1EFVA 1M8PA 2ZJ1A 1EX6A 1SBHA 3D1LA 1SKQA 3ET4A 3OJEA 5CPBA 5DASA 1E2MA 2G04A 4B79A 1LXCA 4JUAA 1KI9A 4OAOA 1CDEA 3ZHXA 1NUTA 4JAVC 1NW8A 2JJ8A 4KO8A 4N8EA 3TJMA 2DOKA 4RHYA 2WVJA 3BMQB 1P6UA 1J0EA 3H6HA 5INTA 3W8NA 4FT4A 4HDNB 3H16A 1NLYA 3C0KA 3JQQA 3H8JA 4LJSA 3GUCA 4LOKA 5IANA 1P9NA 3QPAA 1VHWA 1YVRA 5K0NA 1IJFA 4E07A 2YRFA 3I23A 3AOEC 2BELA 3E58A 1RCTE 4OGKA 1X87A 1YDFA 4P2BA 1TZCA 1JEEA 1Z6GA 4BY9E 2RGYA 5JXWA 1E5TA 4KQGA 1X1BA 4AMUA 1JVSA 1S4QA 2VRNA 3GFSA 4KXXA 4UUAA 1TQ2A 4PGGA 3B70A 1P9RA 1GR0A 1D07A 2JHCA 4GDFA 5G2OA 1N5RA 1RXSA 1U7HA 2J7PA 3I62A 4TWRA 2ECFA 4DVGA 2OHXA 2HPZA 1JQBA 4KXVA 1QQ7A 2HRQA 3K71B 1G6OA 3TTUA 3K73O 2HLDD 4D8TA 1G3UA 2QE7D 5HOEA 2UUPA 4X8HA 1H6AA 1H9AA 3HDVA 3H2JA 4JA2A 2PA0A 3T3IA 1UP7A 3FKSD 2F3TA 3ZK9A 3IURA 3HEBA 2C5FA 2GZ3A 2ZXEA 3KZXA 4ZVTA 4GKBA 1FSGA 2YJ3A 4JLSA 3UOAB 2JFNA 5IKXA 13PKA 4GXNA 2J6BA 1J7KA 4BFZA 1Z0DA 3KALA 5WRFA 4KAAA 5EY5B 1DC5A 4BX2A 4E94A 3DBRB 4ZKDA 4AZ0B 3TFOA 2Z6AA 1REQA 3KXIA 5D3MA 2X13A 3K92A 1W19A 3A3YA 3G2JA 3ABRB 4Q1BA 1WDMA 2Z3WA 3FZGA 2EZTA 1QM5A 3HYSA 1YS7A 4M8KA 3B7PA 3PXAA 5JO0A 3A9VA 1HFJA 5KVQA 2GMWA 3ZIDA 2JK0A 4BN4A 2ZYGA 1W4LA 2ZAOA 4OUKX 5CNKA 4X94A 4L5JA 5DIFA 3TR5A