3KQKA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 138
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqkA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA01
2QROA 4B6EA 1VYUA 3KQKA 3GP8A 4LJ6A 5C46F 3A6PC 1U0JA 2WMOB 2G1KA 2XTNA 4O3MA 4HUQA 1DG3A 2BWJA 2H7VA 1KI6A 2C04A 4DEYA 5KOYA 2IWHA 1EFUA 5IK2D 3KB2A 2IUSA 4NTZA 4LHWA 4RFSA 5AUQA 3CPJB 4OJQA 4EUNA 2OXRA 1NVXQ 2R65A 3UG7A 2QBYB 1NRJB 1SVMA 4MRVA 3KDSE 3FGNA 3W34A 3PEYA 4TLBA 5C18A 2CVHA 3GFOA 4LJAA 1J7KA 1T91A 4JT4A 1ETUA 2ZE8A 3KB1A 2LWIA 2FSFA 2O8DA 3UG6A 3GLIB 3DEFA 2ZRDA 1TPZA 3P4YA 3ZZTA 1TF5A 1D9XA 1W47A 2Z83A 5J5CA 4OQFA 3EG5A 2YNMA 4DDVA 3H4MA 1IY2A 1DEKA 5DO9A 1QF9A 5LDDC 1B23P 1KK1A 2I1VB 3T1TA 1Z6TA 5J4KA 3NDPA 2WM9B 4JJZA 3QF4B 1CJUC 2Y8EA 2JDIA 1NG1A 1OHHD 4IW3B 2IW3A 4H1UA 4HDCA 2RGGA 2ZRIA 4WXPA 3RANA 3DMNA 4GI7A 1P4SA 1WB9A 3SEAA 1G6HA 1KDRA 4GPTA 3X1YA 4PO9A 5P21A 5A4JA 1FMJA 2HXYA 3CH4B 4FMDB 1WDTA 4GP7A 4NPHA 1OFUX 5AJZA 3GLGE 3KKPA 2ANBA 5DLQC 4HAYA 4Q7JB 4DVGA 5JHGB 4B75A 5FOWA 1II8A 1G4AE 1X86B 2CXXA 4IRUB 4PX9A 5EP2A 3CR8A 4MRSA 4Q4HB 4QBIA 2WPDA 2YKGA 1E32A 4URXR 1TQDA 4LBZA 1Q12A 4JLKA 4ZDWA 4DHEA 4E07A 3O47A 5FTKA 4GFDA 3EPLA 2GK7A 5CDFE 1T4GA 1ZVQA 4W5WA 1DAEA 4CZ2A 3HWSA 5EUMA 4NHOA 1JJVA 1TADA 1HYQA 6Q21A 1XEXB 3GD7A 1U9IC 2D74A 2YINC 1P73A 5L3RA 3KUCA 1R5OA 3K9GA 4Q1AA 5HTKA 3ICQB 4BGDA 4OHYA 1W7AA 1W0KD 5JCPA 2IYSA 2WSMA 4BLTA 5JRJA 3AVVA 2CNWA 3K70D 1M7BA 4QNRA 4L15A 2ZYUX 1E4YA 4V0LA 1UBCA 2YWEA 4TSFD 1KKMA 1PLKA 1JECA 2AD1A 4GMXA 3DKVA 2ATXA 1YQTA 3OHMA 3C7KA 1NVVR 2W6ID 4QHTA 3MFYA 3B1VA 5HR5A 1NN1A 3VU9B 1NKTA 1HT2E 1E79D 1UEIA 3K8YA 4XSGA 3P32A 1GTVA 2IL1A 2ZSDA 3AVTA 2REXB 4WIAA 1RRPA 3F8TA 1RRFA 1PLLA 1XJ0A 4I1OA 1DVRA 3FWYA 2DWQA 2F3RA 4U5XA 1TQ6A 4QM7A 3CX7A 3KKOA 5KSOA 1UBEA 1DARA 1OJLA 2AN9A 3VR5A 4Q9HA 1HE1C 1XXHB 1Z6GA 1F2TB 4HZIA 1LF5A 5KYKA 2Z6VA 8OHMA 3DM9B 2HF9A 4A82A 5KDOA 1E0AA 3KTAB 2I3BA 4TLDA 3Q85A 4DLWA 1W48A 2ZE7A 1E2IA 1YR8A 2WJIA 4TYQA 2PX3A 1OH8A 2IYTA 4HZUB 5GJBA 1D9ZA 4AI6A 3I32A 3VHXA 3L2OB 3HYTA 5E95A 5FI1B 5K8LA 2Q3MA 3R9XA 1NG9A 2ZRNA 5EP4A 4AY2A 3F0TA 3VR6A 2QMUA 1AZTA 2ZJ8A 2ZS8A 1RW4A 4Z8YA 5FBRB 1OH6A 1MRNA 4WOPA 4M4SA 2ZR7A 3B1YA 4E09A 4TTQA 4D25A 3AF1A 2WJVA 3OFNA 4ARZB 4KV9A 2IUUA 2JLZA 1I4TD 2C9YA 1FZQA 4EPRA 4P31A 4L5BA 3T34A 1TQ4A 2GJ8A 1NI3A 3B2EA 2F1RA 4DLUA 3BH6A 3CW2A 1YRBA 4LHZA 4R7ZA 4TYNA 5L3SB 2XJ9A 1DG1G 3BGWA 3NXSA 2NZ8A 4JL5A 4B3XA 3CF2A 2PEZA 4EPYA 2Z4SA 2R62A 2BV3A 3GLIE 2RB4A 4Z8XA 1E2PA 2WKPA 4IDOA 3F3YA 3AKCA 1P9WA 3EA5A 1GZSA 1T6NA 3QNUA 1R0YA 5EZ5A 4DBLC 1VG8A 1GUAA 1SXJA 5AUOB 4X8LA 3FKSD 4ZIRB 2ODEA 3SC3A 1CRPA 1AM4D 1W4BA 4UNRA 4ZCMA 2DHRA 4QFMA 3ZGXA 4NZYA 2OILA 5DH9A 2JA1A 4Q9JA 5DHFA 3NEYA 1GKYA 5F9HA 2IYUA 3PUVA 2RCNA 5FBQB 1OLOA 2FWRA 3RS4A 3SFZA 2O8CA 2ZM5A 1YVDA 1JNYA 3K0SA 3NG1A 3GLHB 1FW6A 2PEYA 2QRNA 3J81k 2B7BA 4YC7A 3R8FA 2ZYTX 1S1CA 4JLPA 1V5WA 5FPKA 4JLJA 5HCNA 5L3QA 2QMHA 3LXRA 3KJHA 5G3YA 2IK8A 3EPKA 3EIHA 5KU1A 2Q9CA 2J7PA 3SYNA 3TQCA 1OIVA 4E5UA 4URVR 3DHWC 3EZ6A 1AS0A 1JR3E 2XNSA 2UZIR 4OBEA 4M1YA 4AWXA 4BZQA 1W0JA 1CR1A 1XCMA 2CE7A 1Q21A 2A2ZA 2FNAA 2FV8A 2GESA 4HUQB 3U3MA 1XFAA 2GNOA 3ND9A 2C5LA 2XZPA 3BB3A 1P2TA 2YJTD 1KI6B 3V00A 4ZV4A 2F7SA 4KVGA 1GILA 1JALA 4LV6A 2C96A 4ABYA 1OXTA 4RFSB 4CYMA 4NU0A 3KKQA 1PLJA 2ZYWX 4KODA 2W2TA 4V0MA 3ZS8A 421PA 4EAQA 2FMXA 5JI3E 4ZDKA 3SFVA 4NH0A 1RYHA 3WHLA 2O8DB 4Q1DA 3IEUA 4L4UA 4M1SA 4RD3A 4MUBA 3SN6A 1E0JA 2ZEJA 3AKDA 1Z07A 4RD4A 4IOJA 1QZXA 4PC6A 4DKXA 1CP2A 2ERYA 2FZ4A 5DN6D 3AVUA 1DE0A 1YZKA 2ZRAA 3QPWA 2O8BA 2WOOA 1YR6A 3GCGA 2ZU6A 2E9SA 2IS2A 1BO6A 3QQ5A 3MWJA 2IYZA 2JJ1A 3ICEA 3VMFA 1FTNA 2DPXA 4CIDA 4DRZA 1Y3AA 4B71A 3T5GA 4MGYR 3LDAA 3H86A 4NL4H 4B35A 2ZQ5A 3B7GA 2RGCA 1RPZA 3NVAA 2FFBA 3LA6A 4IFBA 4G3XA 2NMVA 3AGPA 4GRAA 3BJIC 3Q8XB 1GL9B 1FQJA 3WNCA 2QY9A 3U60B 3K09C 4LPKA 821PA 1FNNA 4DDWA 4LJYA 1HT1E 2RH5A 2EWWA 2C9CA 4US2R 2HEIA 1QBKC 3WY9A 4AYXA 1XXHE 1HTWA 2KWIA 3ASZA 3CH5A 2GZAA 1II8B 4LSGA 3OEHA 3A37A 4PPNA 3G5UA 4BFYA 4B47A 4RSGA 3KXKA 1Q1EA 5HE9A 3TGPA 4Q02A 3IDQA 3L43A 2GDJA 2XB2A 1E99A 3SBEA 1N0VC 3QPVA 5FR2A 4JJKA 2JLYA 1LB1B 1XTSA 2R6DA 1R8QA 5GVSA 3NHAA 2F55A 4C0SA 3CX8A 5J4YA 1IQPA 2WWFA 1F2UA 4LJ7A 2QENA 4MQBA 4PSAA 1KZGB 4PHHA 3OE7D 3SZRA 1QHSA 2BKEA 2PH1A 3C16C 2YC2C 3I73A 4PFSA 1N6PA 4C7OA 5UKDA 1DPFA 1Z2AA 2MMGA 2EFGA 1AKYA 4FMCF 5E4FA 4M9XA 2WVJA 1E2HA 5HPYB 2A5DA 4G0NA 3K0EA 5ELXA 2RAPA 2XSZA 4YONB 1K8RA 4U00A 2P6RA 1W4RA 5TV2A 4CEJA 3JZAA 1UEJA 2JIZD 2TMKA 1AGPA 5EJEA 1KDTA 1Z0JA 2NQ2C 2RHMA 3EW9A 1T0JB 3FE2A 2W6JD 4IHQA 1SULA 4LYHA 2G3YA 2XNDD 3B13B 1Q1QA 4UJ5A 521PA 1OXUA 1G8HA 5GVRA 3CNLA 4Y0VA 1ZP6A 4Q9IA 5F9FA 3U6BA 1WRBA 3LBHA 2EFHB 1CU1A 5FOTA 1N6NA 1G19A 3A1WA 3M0EA 1G4UR 4OI2A 1TNDA 2BBTA 4NP6A 4Q66C 1QHNA 3T1QA 3QXSA 1Q57A 3IPYA 4LBWA 4CF7A 2JJ8A 1XCGB 4D4KA 4D4MA 3P26A 2WOJA 3WXMA 2IYRA 4UXHA 4TT3D 4JBXA 4XJXA 1XU4A 4DLVA 2FSGA 2K5UA 2ASEA 2GEDA 3DZ8A 2H17A 4Q48A 3T5DA 1GNQA 1KTVA 1KZ7B 1ZNZA 3GJXC 4LJ4A 5JZVA 1XF9A 2KB0A 1NVVQ 2PT7A 4V02A 4A6PA 2BOVA 1MKYA 2W00A 3MG9A 4PPQA 4ESVA 1T5LA 4QM6A 2BEKA 4YMWA 2OM2A 3B1WA 3SJZA 1WMSA 3L8YA 4CDGA 4WZBE 3ZIAD 2OLJA 4EKDA 2PBRA 3SYKA 1DELA 1OH7A 5JSZA 2EFDB 4K46A 4GP6A 1L7VC 4JMPA 2IS1A 2XOKD 2J0UA 3TQFA 1OKKD 2IEYA 1XJQA 3TAHA 2WJGA 2ZI4A 4AIIA 5J40A 2PMKA 1O3YA 3CX6A 4HAZA 4MYTA 4OKSA 1WP9A 3H2YA 4P33A 5F98A 2VSXA 3DO6A 4XWAA 1E9SA 1IXZA 2A5GA 2R44A 2WIBA 4XD7D 4AG5A 1KK3A 3PUWA 3RS3A 5JS8A 1ZNWA 5B30A 5EP3A 2QTVB 1W2HA 5HZKA 1VHTA 2GCPA 3I3SR 5KUTA 5DI3B 3BORA 1U2RA 3N5CA 3THYA 1ZC3A 2DWPA 2HCJB 5AUPB 4AURA 2Q3FA 2WWXA 2QPTA 4NE2A 1Z3IX 5GJCA 2EYQA 4HDOB 3SI7A 1OV4A 4B3DA 2VL7A 3EAQA 4QOSA 1CULC 4LWZA 1SXJB 4C9BA 1N5LA 2P67A 1II9A 1M1YE 2VRWA 5IRCD 4FWIB 3ZJYA 1P60A 4KJZA 1HV8A 2BM1A 4B34A 3HPQA 2BJWA 3QG5A 4ZO4A 2VIIA 1KK2A 2IUTA 1G41A 1VYVA 5BQ5A 2O8CB 1G3RA 1XNJA 3GQBA 1ZYUA 3LQQA 3X1DA 3THWA 4AKIA 5A0FA 1Z6YA 2ZJBA 3QKTA 2BBSA 1A82A 5HKKD 3PITA 5L3QB 3QBTA 1X1SA 3TSOA 1KY2A 4WBSA 3T15A 2FEOA 2IC5A 2GXQA 4IVPA 5JJLA 1QRAA 2ZI5A 1D2NA 1WXQA 3S1AA 3K0FA 3C5HA 2YWGA 4NYMR 4C0BA 3WMFA 3AQ4A 1I2DA 2HLDD 1HUQA 1P3JA 4TN1A 1HQYE 1OHHA 2IF2A 3B78A 3OF5A 4YDSA 3TE6A 2RGNC 3LAWA 5LD2B 4WA7A 5E7JA 1EESA 1WBBA 3ONWA 3AGQA 3RAPR 4ITRC 1ESNA 1BYIA 4MDFA 2BHRA 2W2XA 2I4IA 5TMPA 1YR9A 3K0CC 4DUGD 5KHOC 4KHZA 5JRZA 4PZZA 1T3LA 2BMEA 1UBFA 5KNDA 1RC8A 4IDQA 5L3VA 4A15A 5LB4A 3MJHA 2CL0X 4LUCA 3RS7A 1P9NA 2B7CA 2A5YB 3KXLA 3MRSA 3KTAA 1L4UA 3DL0A 1G20E 3LQRA 3L0PA 3PR1A 4I1VA 1OXSC 3R7WA 2O8BB 2XEXA 1KSGA 1NP6A 3BFVA 2GJKA 3EASA 1M34E 1L2TA 3MJRA 4BFVA 1MH1A 4C0JA 1KMHA 4BASA 5FUXA 3PQCA 2Q6TA 4GSYA 5SZJA 4HYYA 4OQNA 3N70A 3TUIC 3ZQJA 1CF4A 3U3RA 1KO5A 2FFAA 1PVOA 4L9SA 5E3HA 2AK3A 2GKSA 3NC1C 3KQLA 121PA 1DADA 2ERXA 2VYFA 1G7SA 2ZI7A 4MH0R 3Q5EA 3BWDD 2CJWA 1FNMA 2WTUA 1OSNA 4G1UC 1H8ED 3EARA 3KQHA 4JLVA 1G64A 3RRYA 4TSFA 1T5IA 3LVQE 4JIMA 1XD8A 3K0CA 1GG2A 4UQOA 3SQWA 1RRCA 4R71A 4TMZA 3D7MA 4CT4B 1SHKA 2ATVA 1VCMA 4OHWA 5SZHB 1WE2A 1ZD8A 5H70A 4F4JA 2W6IA 1TU4A 3K9NA 4NCNA 4KFTA 1CKEA 3FMPB 3PENA 4RKEA 2C77A 1MO4A 3BB1A 4KU4A 1W44A 1E79A 2FSIA 3E5HA 2G1JA 4M22A 4TZ6A 1JQJC 1IN4A 4KYUA 5BYJA 1VIAA 1VCIA 4TYYA 3B9QA 4A9AA 1E2GA 3K9HA 3QE0A 3KKMA 4FCTA 1Z0KA 3OZXA 4EIWA 3TR0A 4N3NA 4XVQA 2GF0A 1XTIA 4ZPXA 2GK6A 2F1HA 1U81A 5BWMA 1AZSC 4C7OB 2V1XA 1UM8A 2DYKA 2NO9A 2QA5A 1UPTA 2YOHA 2PMDA 1G8YA 2UKDA 5CLQA 4G01B 4B44A 3Q9LA 3LBIA 4JLDA 3I62A 1TU3A 2FX3A 3CPHA 1BIFA 4J0QA 4CEJB 1E4VA 1VYTA 221PA 2CK3D 2GHIA 2OBNA 4LC1A 2QMOA 1KJYA 3U7HB 1COWD 4PO1A 4ZCIA 1IY0A 1TUEA 1RIFA 4XVRA 3NHBA 4N0EA 4BRWA 1E9FA 5JBQA 2WV9A 3H0KA 3IHWA 2IHYA 1T8TA 2J0QA 3U3KA 2GBLA 3QG1A 2H8KA 3HYRA 1FOEB 3K53A 1SXJE 2GCNA 3VKHA 2F6RA 1J8YF 4AYTA 1Q3HA 5J4VA 4PHGA 3ZLJA 1PZNA 1AK2A 3LW8A 2ODWA 3SJCA 4OYHA 3SE0A 4LY6A 1QVAA 4ZCLA 3VX3A 1UF9A 5FFMA 2D2EA 2G9NA 1QHGA 1N5IA 4W5JA 4XSHA 4GOXA 3KJIA 2YWFA 3GFPA 3QSYA 2QRZA 3TH5A 1NBME 4OHZA 1I4LD 2RGAA 2QP3A 4O2RA 3KX2A 3VNUA 5DI9A 3LLMA 1ZINA 2G77B 3RHFA 3M1IA 5FTNA 3PV0A 3OEED 5JHHB 4HAVA 4JVMA 2IEZA 1G16A 4LYFA 1YRAA 4DEXA 2J3EA 2VHTA 1AJEA 2NOAA 2QQEA 3RYTC 2R6FA 2Q0HA 1GP2A 3NBXX 4QL3A 2ZRKA 1IHUA 5EXTA 2VHQA 1P7CA 2ZVPX 2B21A 4H9GA 4DLTA 3IPXA 3QF7A 4XWKA 1NNEA 2FOLA 2JJ2D 2O8FA 3AVYA 5JSZB 3FKSA 1NLZA 3QXCA 2PLFA 3ZZ0A 2EFCB 3WRXC 1DO2A 4RVCA 1XB2A 2J0UB 2XITA 3IBYA 3HR8A 3N2EA 2D7DA 3SHFA 5JWOA 4B32A 3REGA 1G17A 4GMDA 3U3OA 2WWYA 1E2EA 1GRRA 2ZUBA 2V4ZA 1KJZA 4TL8A 4BLQA 4D0GA 1E2KA 3ZDQA 5J4LA 1JBKA 2QAGB 2W2VA 2C03A 3ZH9B 1W36D 4TYWA 3I5YA 3THYB 4NCJA 4A1FA 1NVWQ 3P4XA 1EFRA 1E9EA 2IYYA 1XDBA 2QPAA 4RFVA 2JLUA 2BCGY 3WP0A 3JVUA 2PZEA 2VEDA 1TAGA 2QP4A 2NGRA 4LC0A 1Q44A 2J9RA 4I1SA 4IOMA 3TBKA 1RFLA 4TYPA 1X8JA 2GTPA 3D8BA 3KUDA 2JAQA 4UKDA 5M04A 3I4LA 3GLFA 2ZR0A 1AGRA 1YZNA 4KFRA 3W6NA 1ONBA 5DGXA 4G5OA 2FDCA 3OIUA 1IOZA 2IA5A 4B2IA 2YOFA 3C14C 3U3JA 4CGZA 1EWQA 4KSBA 3T12A 3UWOA 5C4MA 2ODNA 5KSZA 2IYWA 4DSOA 1ODFA 5EE9A 3AH8A 3THWB 4EPWA 2Q9BA 1A7JA 1P2UA 2OCYC 5FI0B 3CRMA 4FD2A 4MUAA 4P3YA 4M2LA 4IFEA 4BFTA 2HT6A 1G291 1X8KA 3S1AB 3WMEA 2ZJ2A 3K0FB 1XCPA 4JVSB 1EFCA 1KO1A 1CJMA 2OLKA 1Z06A 3T1VA 5H8WA 3LD9A 1Q22A 3T06B 3A1TA 2VSFA 1ZIPA 4LHXA 1ZRHA 5JMTA 4ON9A 2HV8A 3Q7QA 1ZD9A 3VR3A 4TQAA 1FP7A 2OFOA 5L8VA 2J0SA 1KO4A 1Z0AA 2H1LA 5AWFC 1R4AA 3EZ7A 4OQLA 2AFHE 5AUNB 4QGFA 4LV8B 5KTYA 2H92A 3G0HA 3KFVA 3QVVA 4HUTA 2WZQA 2A3RA 4DIEA 4IJMA 3HJNA 3AEZA 3RS0A 3BH7A 4ILEA 1GVNB 1Z08A 3GEEA 4JLAA 1US8A 3TVTA 2ZJAA 3WNBA 1NLYA 3QJYA 3SYLA 1E2QA 2QT0A 5C4GB 2GAAA 1R0WA 3SJBA 4ZDJA 1SVIA 1SXJC 1TF7A 2ORIA 4HLQB 3R7WB 1E1RD 4NYMQ 1TX4B 3R8CA 2J1LA 4NYJQ 1E3MA 1W4CA 4JL8A 2QZ4A 1K6MA 2GZDA 1JJ7A 1KMHB 1XTKA 5JEDA 3ZD6A 5FTJA 1E0KA 1SZPA 4ZDIA 4US1R 2NPFA 2J59A 3B85A 4B3GA 4B43A 4LPSA 4IDNA 4AKHA 4WVFA 3GJ0A 4TMWA 3QKRA 3QI2A 1W4AA 2YOGA 2UVQA 1U8YA 3BERA 1ZW6A 3IEVA 4GZMA 1QHHA 3K70B 2CJWB 1UJ2A 4B6FA 5FUYA 4BWYA 4U02A 3KFXA 3FMIA 1YZUA 3B1ZA 3A1UA 4EQ6A 5DI3A 2ONKA 1GRQA 3BH0A 5D3QA 2C95A 5JCZA 3ADKA 4AD8A 2ZROA 1S96A 4II7A 3REFA 2BMFA 1M6NA 4DLZA 1TQ2A 4BQSA 5LD2C 4OQMA 3DOFA 2BC9A 1Q20A 4LJ8A 3ND8A 4A0HA 2YZ2A 1UADA 1ZNXA 4OI4A 2ZSEA 2QGNA 4TLCA 4LYJA 1FX0A 1S3GA 4GL2A 2AHOA 3LX5A 4HLUC 4JVNA 4Z51A 3CRW1 3FTQA 4HB4A 4F4CA 4TT3A 1XMJA 4C4PA 3TVDA 4JL6A 2XTMA 2CMKA 5JLJA 4RD6A 3UWKA 2JDID 2P3SA 1S4QA 5CK5A 5JECA 3FFAA 3U7GA 2OG2A 4HAWA 4QBFA 3CWQA 1LVGA 2BBOA 2Z0MA 4BPBA 3PIRA 1RE0A 2R6AA 2P5SA 1KHTA 4KO8A 1A2BA 1EK0A 1N6KA 4QGGA 3ZIAA 3P27A 3W5JA 2N46A 4CT5A 2F1IA 4ASUD 4MYHA 5KSPA 1S8FA 4B73A 1KAOA 2XOKA 4QHYA 4Q4AA 1OKKA 5J47A 4RD1A 3MGCA 3UMSA 1NMZA 1F6BA 1N3BA 3QXHA 5FOVA 1KI4A 2EYUA 4PC2A 1XTQA 4XD7A 1IY1A 2A5JA 3DVLA 2QE7D 2AXPA 2W0SA 1R0XA 2NO6A 2XZLA 5CITA 4DCSA 3X1ZA 1FUKA 2GEVA 4HLUA 5LB2A 3UKDA 3VNVA 3SJAA 1VG1A 2JASA 4OI0A 3P1JA 4G5RA 4JS0A 3RVBA 2BEJA 4YMVA 5DE3A 2R6GA 2OO7A 4LV5B 1OF1A 1P2SA 2VP2A 4MKFA 5JI2E 4PZYA 1RJ9A 3IQXA 3QBVA 4UNPA 4C2TA 4M8NE 3E1SA 1W5TA 2OSBA 2ECKA 3BFKA 4KLZA 3KZ1E 3V4RA 2IYLD 2YWHA 4ZI3A 2IBMA 1XEFA 1YZTA 4UJ3A 3RNLA 2AL7A 1RKBA 2FU5C 3LVRE 2Q9AA 2O0KA 2O8FB 2H18A 3AUXA 4PC7A 3VX4A 3QY0A 1HA3A 3LLUA 5JWHA 4GOJA 4KBFA 1Q1BA 1Z0IA 4URZR 1N5JA 4BLOA 1IN5A 2DWOA 2J46A 4IEEA 4MKHA 3TK1A 1AKEA 5KNBA 5E7MA 3PEWA 1K5DA 5CIQA 5BYKA 4TMXA 5CYPA 4ESHA 3TSWA 5KDLA 4YMTA 2YHSA 2ZSBA 1R5BA 1OT3A 3MD0A 4L8GA 2YC4C 1LNZA 1X8LA 2EFEB 1W5SA 5HKKA 1XTJA 2KI5A 4Z1MD 1ZUHA 3E2IA 4MGZR 2NG1A 1U90A 3U4QA 2IS6A 2VQSA 4LYAA 4LX0A 2ZUCA 2GA8A 2EU8A 1MT0A 2DFNA 2RMKA 1HEIA 4OK5A 1AN0A 3TIFA 4DLXA 3GLFB 2ZJ5A 1LS1A 3H1TA 4TQUS 1WBDA 1FQKA 2VO1A 4DT1B 3OESA 2ZITA 2X77A 1S2MA 4I81A 4YDHB 3HP1A 2QG6A 3BD9A 1G5RA 4KSCA 5B64A 4JYBA 2NTYC 4EPTA 4NYIR 5DIFA 1ANKA 3Q3JB 3P20A 2ZS7A 4BLSA 1RYFA 2RGBA 1Y63A 1KO7A 1H8HD 1N6HA 1ZC4A 1W46A 3BC1A 3A4MA 1DOAA 2ZJZA 1MR3F 4BLRA 3OFND 1VIYA 2HJGA 1SHZA 5E7IA 3KL4A 5EXSA 1RRGA 3UK6A 2KBEA 1KSHA 2HF8A 1GSIA 2ZETA 5EXXA 4ZKDA 4AC9A 1J70A 1NVUQ 3VR2A 1E96A 2VP9A 1A5TA 1N2CE 1Z6XA 2LKDA 1DAGA 3EWSA 4HB3A 2HYDA 1M7HA 1XPUA 4YXWD 4LDJA 4B33A 3BE4A 4YMUA 1E1QD 4AKEA 2A5FA 1PUJA 2QAGC 2ZVQX 1CBUA 2BMDA 2CCGA 3CB4A 3GLHE 1US8B 5AR1A 1SXJD 1ESMA 2EW1A 1XRJA 4EDHA 3MMPA 1U8ZA 3MCAA 4QXAA 2VP0A 3OAAA 4A36A 4A0RA 2GEUA 1SKYB 4Q7KA 4OK3A 5CIWA 3ZVRA 3EA0A 2E1RA 1OB2A 2GILA 1W1WA 1IXSB 2WSSD 1WQ1R 1NBMD 1AQUA 2AWOA 3A8TA 1T0HB 3B6EA 3NBZC 5FPTA 1X3SA 1IJEA 2B8WA 2J41A 3FYHA 2G0NA 2PJRA 1U94A 3R9IA 1ZM4A 2ZS9A 3NEJA 5AJWA 1ZMXA 2G88A 4O2LA 2FA9A 2IYVA 1HH4A 1HE8B 1D6JA 1HQCA 1ZNYA 3QKRB 4KBGA 1P72A 1M7GA 1XEWX 4DLRA 1TEXA 3RLFA 1Z6AA 2J7PD 3M6AA 4WZ6A 4MGKR 1QHHB 3I8XA 1P9RA 1NN0A 3ECCA 2IT1A 1AS3A 4HAXA 5HCIA 5KSYA 1IN8A 2D4HA 2J0VA 3WHKA 1L8QA 4EQ6B 2QAGA 4PXAA 4JLNA 5DHAA 2V54A 2CK3A 2YVUA 4DJTA 1WA5A 2VA8A 4TLEA 3A1VA 4H1VA 2ZREA 2ZRLA 4US0R 4RZXA 1JAIA 2ZI3A 3AF2A 3FPAA 4A8JA 3U44A 3PEVA 2AKYA 3RDPA 5EE1A 2HYIC 3W9YA 4CEIA 4PR0A 4X8HA 3D31A 4KITB 1FUUA 3GFTA 2QSZA 5HE8A 4LK2A 3WMGA 2XAUA 1NIPA 3ETLA 4M1OA 2MSDB 2BCJQ 4TL7A 5IK2A 2IYXA 1FX0B 1JXMA 1JB1A 1II0A 1T9HA 3NH9A 4HDQB 1XMIA 5BW8A 1UDXA 4JLBA 1KYIA 3TUZC 1XMSA 4KAXA 5B57C 3VAAA 1BKDR 1YU9A 2OBMA 3ADBA 1DTSA 2OFWA 3KQNA 2A7QA 2ZYVX 3EXAA 2LCFA 4MKIA 1DAIA 1MOZA 2QORA 3OEEA 4BFZA 1G7TA 3FB4A 1PUIA 2ODBA 4FMDF 4HSEA 1LFDB 3T61A 1Z0FA 3PFIA 4UXJA 4FN5A 2G0TA 2AKAB 4RD2A 3O8RA 1E2DA 4NYJR 2J45A 2JJ2A 2BM0A 3R20A 3RRNA 4C3ZA 2WJJA 4URYR 4QGHA 4QBHA 1J2JA 1E98A 3FMOB 1YZQA 2RGDA 4F93B 4X8OA 4Q4AB 2WWWA 2WAYA 5KPJA 2GF9A 4NBSA 2DFLA 3K70C 4I4LA 1ZU4A 1N0WA 4LGMA 4C0LA 4OI1A 3EPJA 1OYWA 1GKIA 3AM1A 2ZJYA 3LFUA 1VTKA 2D62A 2I1QA 5TARA 5CB6A 5BXQC 3IIJA 3TJZA 4KFUA 3BS4A 2FJUA 4D4JA 1G9XA 3U2QA 3SU8A 2O8EB 1RJ9B 2FPMA 5F3WB 1F3OA 4QC2A 4M9QA 1KGDA 4OK6A 1UKZA 4WW0A 4WZAE 5EQTA 4HB2A 4F92B 4A2WA 2ZSFA 3ZD7A 1XJCA 1D2EA 2WWIA 4F4IA 1D5CA 2GVDC 1BOFA 2MMCA 1JAHA 3AB3A 1EFTA 4DSNA 4JBWA 2VBCA 1CTQA 2XXAA 2RHDA 4IOLA 4LJ5A 1QHIA 2D06A 3GPLA 2IXFA 2QI9C 1YZGA 2WJHA 1R10A 5G41A 1QVRA 3LY5A 1IJFA 1W0KA 2J5XA 2C99A 2DCUA 4BZPA 5CB8A 4W7SA 3LO5A 4MA4A 4RJLA 2OT3B 1XP8A 3AF4A 1P6XA 2OESA 1P5ZB 1ZJ6A 1KNXA 1UAAA 4MITA 1N0UA 1OXVA 3HR7A 1XD2A 1Z0DA 2GETA 1DS6A 4KLNA 3LX8A 3C41J 2BBWA 3JZMA 1PJRA 1V43A 2QPOA 1H65A 2G83A 2RGXA 2JATA 4DCTA 4FMCB 3PUZA 3ADDA 2GBLC 3U4QB 3CIOA 2HXSA 4DB2A 2DFKB 1GIAA 3KJEA 4HLDA 3IHLA 1G8PA 1SKYE 1MABA 1OH5A 4QHSA 4MDEA 1KDOA 2OE2A 1R8SA 3X2SA 4D26A 2NPIA 3NWJA 1G7CA 4QJ4A 1N25A 1KSFX 1OIXA 3CBQA 4D0LB 4FCVA 4GOKA 3TUJC 1GL7A 3GJ8A 3WBJA 1Z8FA 1OFHA 3A58B 5CM8B 1JXOA 3CZPA 2CBZA 1Q3TA 4TWZA 1KMQA 4QG7A 3AP1A 2B6HA 3MUFA 4DC9A 2Z4RA 5F2EA 4POAA 5FUWA 3ZZUA 3VKGA 2ZUDA 1U98A 4Q18A 4EPXA 3ZYCA 2EVWX 2ORVA 2ZRGA 2C78A 1CJKC 3UATA 4EJSB 3U61B 3O8DA 1E1RA 5TVKA 4DLSA 3BFXA 1JPNA 1NJFA 4JYCA 5FOUA 1DAFA 2D7CA 2XTZA 4RCZA 4O0MA 2Z5FA 1HURA 1A4RA 3GEIA 2G6BA 2V8OA 2BMJA 2QAJA 2FG5A 2FPKA 4M1MA 2FEMA 5EXPA 3CF0A 4FI3C 3M4YA 4TMKA 1F48A 4G5SA 1T3HA 4PAQA 3NH6A 4BFWA 1BMFD 4E03A 3ZVMA 4UNNA 4NYIQ 1JPJA 1Z5ZA 1JR3D 3AVQA 3EC2A 5FPHA 3LH5A 2OUKA 4P4SA 4ACAA 2AX4A 3A4LA 2IS4A 4JBYA 1IN6A 4OHVA 1J8MF 2GWHA 1OPXA 4PPGA 5B2ZA 2ZI6A 2WJYA 3NBFA 4C0HA 1JEDA 2IHBA 4BECA 3O8CA 4IDHA 3SHWA 3NC0C 5FBVB 1E2JA 3BOSA 4BEBA 5K8UA 2BDTA 3TSZA 1ZUIA 2C2HA 2FFHA 3K1JA 3OIWA 1CS4C 4JSYA 4TLAA 5IDVA 3KKNA 1CR4A 5FTLA 1S3SA 4S2EA 4PQRA 4A0GA 5LPNA 2QU8A 4D0NA 2JLWA 2VF7A 4YLGA 3TMKA 4MRPA 2W0MA 4V0ME 2IYQA 2FH5B 2JGNA 4QBGB 4U7DA 3AKEA 3QUSA 2WBLC 5AK0A 4O25A 2F1JA 4B3FX 1NN3A 4Q1CA 2QEQA 4NKRA 4NMMA 4TMTA 4V0NA 5CJ2A 3GJ7A 4RZUA 1N6RA 2ANCA 2ZI9A 1XMVA 5JFGA 3U44B 2P65A 2J7KA 4A8JB 5BN4A 1KAGA 1QDEA 1TTTA 3CKLA 4CEIB 1KI9A 2ZPTX 3VFDA 1QG4A 1EX6A 2AR7A 2V7QD 2ZXUA 4LHVA 4ASUA 1CR2A 1ZUNB 4DT1A 1FFHA 3L0OA 3LBNA 1ZBDA 1NMYA 4GT1A 4DIDA 4KXFB 1R7RA 3IIKA 1G21E 3ZQ6A 3X1XA 2QE7A 2MSCB 3C8UA 4M53A 3I5XA 1ZM2A 2DR3A 2ZE5A 3TKLA 3K0AA 2VPPA 4Q1EA 2HJVA 621PA 2HDNB 4CEHA 3CPEA 4HATA 3KXIA 4M0LA 3TAUA 1R0ZA 2REOA 3PVSA 4PPFA 5FBLB 4C0KA 5K8IA 1NN5A 1S9DA 1R2QA 5FBWB 5FH9A 5DN6A 1AA9A 5FPSA 1Z22A 4HI0E 2YYZA 3EX7C 1T8UA 2JLRA 1Z83A 1VPLA 1G3IA 3IO5A 1FL9A 3PXGA 4F7WA 2P2LA 3IBGA 2GXSA 4JVLA 5DYGA 4F91B 4XOIA 3WBKA 1M74A 2PL3A 3MWYW 1J99A 3QEJA 1E69A 2KSQA 5FTMA 3PUYA 1NKSA 3V9PA 1XD9A 4PQYA 5KO2A 4I1UA 3VR1A 2GJSA 2QL6A 3BIFA 2CL6X 4LBYA 2O0HA 2V3CC 2REBA 4UNSA 1ZD1A 3TR5A 3B9PA 3HPRA 2IXGA 1ZM9A 2F43A 5AJYA 5D3MA 3UIEA 1W36B 1DAKA 2H16A 3GEHA 3UPUA 1Q1ZA 2VHCA 2XX3A 4LJ9A 2CE2X 5FL7D 2PCLA 2WHXA 4IXMA 3PJRA 4Z1MA 3BAFA 3PCRB 4URWR 1P2VA 4BLPA 1IXRC 2OBLA 3SNHA 4EFMA 1EGAA 2JLVA 3V4FA 1JQLB 1SVWA 3UXMA 1LTQA 4ZKEA 3NTUA 3U7FB 1IONA 2OHFA 3R9WA 2UZ3A 2PJZA 2EWVA 1E2LA 2X19A 1U9IA 4NDZA 3K9LA 1G3MA 3A4NA 2KE5A 3H84A 1ZCAA 4JZKA 2VF8A 3RABA 4PAMA 1QHXA 3HDTA 4LI0A 2XXAB 3THXA 4C2UA 5AJXA 1E2FA 2GVZC 3MAAC 4FWTA 3OE7A 5EE0A 2IWRA 1N6LA 4JT2A 1SVKA 4OJKA 1OYYA 1LY1A 4IEIA 3CUEF 4JLOA 1C1YA 2GCOA 3LW7A 1E0SA 4PQFA 3PG5A 2R6CA 1NSFA 1E9BA 1R6BX 2CLSA 2QQ0A 3CLVA 3EIEA 3FDIA 5EE5B 1XD2B 3C5CA 1H8HA 3T35A 1NJGA 2B92A 2JIZA 3RS5A 4YMSA 4BUJA 1G18A 1OFTA 4JSTA 3CR7A 3QKSA 2W6JA 4LZZA 4D82A 2HUPA 1FTSA 1Z47A 1EWRA 2XNDA 1MABB 4DSTA 5K8TA 3I92A 4KFSA 3AP2A 3EPHA 1MO5A 3AVOA 5H1YA 3UMRA 4DSUA 2X8AA 2ZR9A 4B3BA 2VHJA 4Q03A 4RZ2A 4MKGA 4K8OA 2V55B 2OZEA 3BRWD 4Z54A 4HAUA 4M1KA 2OCPA 4YXWA 2EQBA 2VP6A 1E1QA 1G1MA 3AUYA 4Q47A 3F5FA 1GL6A 4IVRA 3SOPA 4BFSA 3D3QA 2JCSA 4EFNA 3B82A 5C2JB 2WMNB 4BE7B 1KK0A 3MWLA 3T1OA 1CLUA 2F9MA 1EXMA 5C1BA 1LS6A 1GM5A 1KI8A 1BYUA 4A4DA 2AK2A 5EP1A 3AV0B 1JEEA 1DAHA 2WICA 4BEJA 4IDPA 1Q0UA 3SS8A 1T3SA 1Z29A 1F5NA 4FIDA 4G5QA 4TMVA 4UNQA 3ZS9A 2WIAA 2WSSA 2V9PA 1NBMA 4JLMA 5J4HA 5GADl 4W5HA 1UFQA 1R5NA 1G6OA 2DBYA 1KSJA 3QPUA 2QMEA 4C30A 4C0AC 2VTKA 4A6XA 2IXEA 1NMXA 1VCNA 2FE4A 2QTHA 4QNMA 2ZTSA 5TDHA 4A92A 1NIJA 3EC1A 2N42A 2ZIAA 4PAOA 4Q19A 4NCKA 3FKQA 3RS2A 2CL7X 4NONA 1EFRD 1GOTA 2R8RA 2WPDD 4QJ5A 2ZRPA 1GNRA 3VQTA 1C4OA 3QXXA 3WNDA 5ANRB 1G7RA 2QNRA 4P4SB 1CJTC 2P5TB 3EZ9A 1VMAA 4B2PA 2P6NA 4IXNA 4MYCA 5G53C 3AF3A 2C8VA 3NBYC 2C9OA 1GRNA 1SKQA 3U6KA 1CJVC 2L0XA 4LBVA 1LF0A 1MO6A 1MV5A 1YHNA 3W3AA 2Q3HA 3B1XA 3G82C 4N1AA 1SVOA 4TL9A 2WAXA 2O8EA 1N6IA 1KY3A 2BKUA 2KBFA 2OAQ1 1OXXK 1KI3A 4PO8A 1UKYA 1YZLA 4FXPA 4S35A 1FP6A 2CNWD 1YKSA 1AIPA 5SZKB 3THOA 3GLGA 1M2OB 3RRZA 3PEUA 3QIAA 1KO8A 4B74A 4Q4JA 4AKGA 1XX6A 3TRFA 4DDTA 2YV5A 3BXZA 1XZQA 4FMBB 4XIGS 2ZRFA 2OEPA 4Q21A 3QOFA 5B58C 2XB4A 3U5ZB 3DMDA 3EZFA 2FSHA 3LWNA 4R2HA 1DBSA 2KJQA 3MWKA 3TW4A 1XBTA 2VLIA 5CDFA 1LV7A 4CRWB 3UANA 4IVQA 2ZRCA 4HB0A 4EJSC 1ZCBA 3DDCA 4TTPA 5FOSA 2ZSAA 2GXUA 4UXIA 2PCJA 4V03A 2NIPA 4R2IA 1I4DD 1OB5A 2VP5A 2AFIE 4XVUA 3DM5A 1E9AA 4ZI2A 3GJ5A 2HLDA 1S9HA 2WKRA 4OQXA 3CWZA 3W8RA 1L4YA 2FGJA 4DDUA 3W6OA 2F3TA 3ADCA 3NIBA 2CCJA 2BVNA 3DKPA 4RCYA 3HU2A 2ZRMA 2OCBA 3D6TB 2B8TA 4LHYA 3SQXA 2AWNA 721PA 1ZAKA 1SGWA 3L0SA 1K5GA 2PT5A 2V6JA 4DUGA 1YJ5A 2PZFA 3WRYC 3WYFA 3RC8A 1KI1A 1W2GA 1NY6A 2OXCA 4L16A 2QSYA 4DXAA 3GMTA 3UMFA 2CHQA 2VH5R 3TNFA 3K0AB 5DNYB 5AJVB 1UKEA 2GJAA 1FPMA 2VHUA 4LCBA 4TZ0A 1U8AA 4EFLA 4CEHB 2ZE6A 3E70C 2DB3A 4RY2A 2GXAA 4E22A 3QENA 2O52A 4B3CA 4FCWA 2JEOA 4XH9B 4EJSA 5IT5A 1TMKA 2QP9X 3VHLB 5FUVA 3LXXA 2VSOA 1MO3A 1GFIA 3IILA 1E2MA 2OFXA 4KYIB 5EUQB 3CNOA 4URUR 4CW7A 2CLDX 2FPLA 1E9RA 3NDBB 3CO5A 4Q4LA 3RSLA 1VG9B 1D2MA 4M1TA 2QM7A 1ZM7A 3Q7PA 4N0DA 3ZVLA 3K09A 1PV4A 3IIMA 4JKIA 4GDFA 4M21A 3HU3A 2OCAA 4B2LA 4NCIA 3AF0A 2GZHA 1QG2A 1G3QA 2ZAMA 1P62B 1XTRA 3BB4A 2ZJOA 3EZ2A 3HU1A 2A9KA 2FFQA 3CZQA 1HY3A 2P0EA 4MRNA 5CLLA 4KVAA 1S0UA 3GJ6A 1H8EA 2F43B 4P4UA 5D3MB 3B60A 4A8JC 1M8PA 1UDWA 1LW7A 5CK4A 2HT1A 1J90A 1JI0A 1G5PA 3QVUA 2OV2A 2JLXA 2JLQA 1NLFA 3OIYA 4DZZA 3EIQA 1IN7A 1SVSA 1G3UA 3RRMA 4QKQA 1P61B 2R2AA 4I99A 2QBYA 4Q7LA 1YR7A 1VECA 1VKJA 1SVLA 3W90A 3THXB 4PHTA 1NL3A 4V0KA 5JS7A 4Q01A 1XPOA 1G8FA 4RD0A 3GLIA 3VR4A 1GAJA 3FHOA 5KNCA 3DZDA 2CDNA 2CVFA 3QEOA 3O8BA 1KIMA 2N1BA 2ZAOA 1D8TA 1X1RA 1IM2A 5TXGA 2GCOB 5A5GA 3FHCB 4AK9A 1TEVA 3AVPA 3CNNA 3RWOA 4D80A 4MGIR 1YE8A 4Q7MB 4DCVA 1A2KC 1W0JD 1GNPA 1TL7C 4Y0AA 4B76A 3QF4A 3WYAA 3B5JA 4K81B 1COWA 1KJWA 1U0HC 3Q5DA 3QKSB 4X8MA 5BN5A 1CRQA 2F9LA 2H57A 5G40A 4AYWA 1OE0A 4Q1BA 5GJWC 4BFUA 4MRRA 3U7EB 5SZIA 3RSOA 1XZPA 2MSEB 4Q1FA 2GAOA 4OL0A 1ZU5A 4DCUA 2FN4A 4BRUA 3IKJA 3TLXA 3IQWA 2QM8A 4XWOA 3BK7A 2V1UA 3C4JA 2Z43A 4PHFA 4P0TA 4EPVA 4G5GA 1N6OA 3DOEA 3SDZA 4Q4HA 2J87A 5EE3A 4D2IA 2CLCX 1BMFA 1FMLA 4M9ZA 1KDPA 3X1WA 1W36C 2SHKA 3W3ZB 1JR3A 4Q9KA 1RVDA 4R98A 1QHYA 2WWHA 3FOZA 1WF3A 2JJ1D 2P6UA 1OW3B 2NO1A 2ORWA 4B48A 4BFXA 3CRVA 1BS1A 3EWAA 1ZM3A 1Z28A 4NCHA 1VDZA 2DY1A 1WCV1 1XEXA 3L82B 3VKWA 2BJVA 3LNCA 2CHGA 3MLEA 2VP4A 2RGEA 2ONJA 2D2FA 1E9DA 5FPYA 1EX7A 1E6CA 1VG0B 1JR6A 5CM9C 2E87A 2FGKA 3OIVA 3GLFE 3SBDA 2A30A 1G8GA 5JWRA 3ZVNA 3L0IB 1U0LA 4PC3A 3I1FA 2HCBA 3JVVA 4D81A 4WAUA 3OEHD 1RZ3A 1S1MA 4C0QC 1KKLA 2C98A 2XGJA 3N2IA 1IBRA 3W6PA 1VHLA 4A2QA 3IUYA 1TUIA 2NO7A 3CONA 4TTRA 3C15C 4GZLA 4KI0A 4XTRA 2CEAA 4CVNA 5IF9A 1CEEA 3AVXA 1GDDA 3VU9A 4F38A 1Z2CA 1EFHA 3DPUA 1XPRA 4TQ9A 1G5TA 3KJGA 4LOAA 4D6PA 2AXNA 3CM0A 2O0JA 5CJPA 3CRRA 1TF2A 5FR1A 2QGZA 2CHVA 2PLRA 3FFBA 4Q9LA 3KQUA 1ELOA 5CYOA 3FHTA 2ZRHA 5DISB 4AG6A 5HZHA 3MSXA 3I72A 3IGFA 5FOXA 4QJ3A 3AP3A 4BZXA 4FW9A 3IO3A 1SQ5A 1A1VA 1EG7A 3VTKA 2V7QA 3I61A 2QTFA 3GLGB 2PX0A 3I8SA 2XSZD 1XXHA 4Q4JB 1BH2A 1F2TA 2RKOA 2O5VA 5DYIA 1AS2A 1MRSA 3AKYA 4Q5IA 2QT1A 4DWJA 5GJVC 3ASYA 1VCOA 4DLYA 1W49A 2H5EA 2ZRJA 1XWIA 5LBIA 4A0FA 1E9CA 1KNQA 4RKFA 3CF6R 1XEWY 4HZUA 4KCGA 1CXZA 4MYUA 3Q72A 3BBPA 2D3WA 3LRPA 1KI7A 2R9VA 1CIPA 4IKEA 3GJ4A 4R9UC 5IHPA 5JEEA 2X2EA 2XZOA 4A2PA 4IOKA 2XJ4A 2IX3A 3W5IA 2V6IA 5FL3A 2GRJA 4ARZA 2Q21A 2A78A 4GBMA 4XTCS 3WP1B 2RGNA 4PC1A 4PSKA 1ZIOA 2GJ9A 1I2MA 1F60A 1GITA 3QXJA 4PANA 4PSVA 3RC3A 5L3SA 4Q00A 4OHXA 2BIFA 3LV8A 3SR0A 4ERNA 1IAQA 4DB4A 2AD5A 3GJ3A 1AQYA 4QRHA 4P32A 2WWGA 5TB5A 4HLCA 2IF0A 3TW8B 4M9SA 4RZ3A 1UBGA 4GNKA 1B0UA 4L9WA 5H68A 4YQFA 2X1VA 3OAAD 4V0OA 1X6VA 3WYGA 5JJIA 1GWNA 1KI2A 1KOFA 2OAP1 3A1SA 1C9KA 2DFTA 4DCNA 2LKCA 3FMFA 1NSTA 1DO0A 1OIWA 1E2NA 5FL7A 3L8ZA 4FINA 4TL6A 4M1WA 2QN6A 4WXRA 4ZIRA 1GKUB 1F2UB 2WKQA 3NKVA 3B8HA 2NO0A 5TY0A 2W58A 1O87A 1OFIA 2NZJA 2W83A 3A36A 4HEJA 4JKYA 3CRQA 5EZ6B 2X2FA 1P75A 2PZGA 2JLSA 2ZANA 1E94E 5BN3A 3AVWA 3PUXA 4QGAA 2FZLA 1U99A 3GLHA 4PTLA 5DSZA 4D4LA 4W9MC 5KPDA 5G3ZA 2ZRBA 1CR0A 5KDDA 2CCKA 3W8NA 1UKVY 3FVQA 4ACBA 1NY5A 4P4TA 2FF7A 1Z63A 4LRWA 4PZLA 5JJKA 1NF3A 3RWMB 1DAMA 2ZU0C 2QUZA 1N5KA 3QKUA
chains in the Genus database with same CATH superfamily
1V1RB 2IKSA 2QROA 2WIJA 2NVUA 1WZNA 3UJ7A 5C46F 1MD9A 1JQDA 2IGTA 3QWFA 4TGLA 4FEYA 1YULA 4D7AA 3O92A 1MUUA 4YR7A 4LQ4A 1DG3A 4TUYA 1UXJA 1ZG3A 3KXPA 3UCFA 5KOYA 4B31A 2ZB2A 1WZ2A 1T43A 5IK2D 1BW9B 1UK8A 1XR3A 3INGA 4CMBA 5GZ1A 2XUZA 3OQNA 3CPJB 2R65A 1NVXQ 3FWNA 5KZMB 4WBNA 1NRJB 3VSDA 2XMDA 1R9JA 3W34A 4RULA 3FGNA 3OG9A 5BVHB 4HN4B 2CVHA 4W1QA 2H7XA 5C18A 1OY1A 3RK4A 3TZCA 3WK7A 4DQKA 3LC0A 4MYDA 1LI7A 1EFDN 1A76A 2FSFA 3GP3A 3UG6A 2Z6UA 3BRWA 1B6TA 3GLIB 1KVTA 2YZKA 3LXMA 3VVCA 4IF4A 4N5LA 1QFSA 3N87A 1FP2A 1VA4A 2DUUA 1HC7A 1JX6A 2YFHA 3BGVA 1IY2A 2BSAA 1BX0A 1CY0A 2Y1OA 4ITUA 5EWMB 3IP5A 2FP4B 1X14A 3IMKA 1B23P 2I1VB 4HPJB 5SYMA 1T36A 1Z6TA 3CZAA 2Y8EA 1M1YA 1Q2XA 1SHTX 1NG1A 4JB3A 1C8LA 2OXFA 5A2GA 1ES9A 5FNZA 4IQFA 2HMAA 1T0BA 2ZRIA 1P1HA 2BGKA 5CEJA 2D1FA 2HBQA 5EJAA 3PXAA 1QDLB 3DMNA 2HD4A 4UU0A 2ZIXA 4CMEC 5KOJB 3GWGA 3R2JA 1G6HA 1O1YA 1KDRA 1QFMA 1NW5A 1U1EA 2G1UA 2GN8A 2TECE 4GPTA 1R64A 4PO9A 5F4BA 3IDOA 2BN4A 4BLVA 1T8RA 5A4JA 1FMJA 1FTQA 4IH9A 2P5YA 1WDTA 3ONVA 1KEVA 3EXEB 3FM9A 3KKPA 3DV0B 2E48A 2PYDA 3DV2A 2XE7A 4NZNA 4B75A 1DI0A 1OFVA 1X86B 2XMZA 3MJTA 1YB2A 1AC5A 2R3SA 2XMBA 3NVDA 4IRUB 3EDYA 3HCWA 2C7OA 4MRSA 3OPYB 4LSZA 3CISA 2WPDA 1CZOA 1GCIA 3TBFA 5A9TA 4LBZA 1Q12A 4LJLA 1P8AA 2WTNA 1PGQA 3AEUA 3O47A 3EPLA 2ERCA 1D0IA 4GFDA 2PANA 1ZA1A 1PNRA 2AB0A 2UYHA 4LFBB 3DBHA 3FG9A 1E7QA 1OZ0A 3IOYA 1DAEA 5BSVA 1IDOA 4EA9A 1YV9A 3HWSA 1OCEA 2GSDA 3KUUA 1L5HB 1Y5RA 1Z68A 5EUMA 1JJVA 1DEAA 1XZEA 1YH3A 5WRFA 3I6IA 4YCLA 3S7ZA 3ST7A 3GD7A 3T6KA 3O9VA 2R84A 5AOVA 1U9IC 2XYVA 2YYYA 3CLHA 3EVNA 4WL0A 4R3UC 3F74A 5GGYA 2WUFA 1JLSA 2I91A 4XUGB 4ZPJA 1XFDA 2X8LA 4BGDA 3IEMA 2QTZA 5JCPA 4KMOA 2C2ZA 1P6QA 2IYSA 3OM8A 2CXTA 1U9ZA 4PZEA 3K70D 4AROA 3UAYA 1Q0ZA 4GLOA 4L15A 1E4YA 4V0LA 1UBCA 1G2OA 2AD1A 2NT3A 3DKVA 5HJ7A 3KZMA 3HYSA 3AYZB 3C39A 2W6ID 4YCBA 4KN5A 4KR9A 5GINE 1J22A 4LVCA 4Q6BA 5JXJA 4KN8A 3DOOA 2H4YA 4BNMA 3KYIB 4UQPA 3VU9B 1NKTA 4FHEA 5C7IO 3L7KA 3DCYA 4KMRA 1Z35A 1UK6A 4CM8A 1E5XA 2BFBA 5IANA 4R7GA 4MWBA 2QN8A 1AHHA 1QO0D 2PGAA 4EB6B 4WIAA 4NV0A 1QX4A 5DLEA 1ZN2A 4NBKA 3CCFA 3H2JA 1FRZA 1JIJA 1QXSA 3SF8A 2F3RA 2F90A 4U5XA 4QM7A 4RS4A 4JYZA 1KOGA 5TGTA 2EJUA 2FSPA 3COWA 3ORSA 5ARBA 3K1AB 1N4AA 1VLZA 4MV7A 4EG7A 5J23A 3KKOA 1S2GA 4P0QB 4Y2VA 2I9KA 4XYMA 4S12A 3VR5A 4MAAA 4Q9HA 3SSOA 5MF6A 1HE1C 1QZ3A 1BH6A 1F2TB 3HEAA 2FMKA 4YRQA 3QJ5A 1Q7TA 4F04A 3VHRA 1SKUA 4LE0A 2HF9A 4LXQA 1TA9A 4UDNA 4GKAA 3T7AA 1FZTA 4H6XA 5D2CA 4D8WA 3ANMA 1IUKA 5DNCA 2ZE7A 2O7SA 2PX3A 3G2PA 2PWPA 3TSYA 5GJBA 1U8XX 4K88A 1CE8B 3E35A 3BTUA 3VHXA 1HLGA 4TWAA 5K8LA 1YF3A 1RAHA 5I9SA 2A14A 2ZRNA 1GEGA 1YTLA 3VR6A 2VZLA 4AXXA 2ZJ8A 2PFGA 1E7RA 2ZS8A 2P7IA 7REQB 1OH6A 5HIKA 4WOPA 3RTDA 4M4SA 4Z99A 4E09A 1JAZA 3N05A 5DN9A 5JUWA 3AF1A 5JAPA 5MFZA 4KV9A 4LVUA 3LOPA 5K8VA 1FZQA 2JIMA 2JIPA 5JISA 1P4JA 4PWZA 2XUHA 4FVTA 2OZKA 3T34A 2C4HA 3CSSA 2Q4TA 4EF6A 1NI3A 4NMWA 2FUG6 1U4SA 5K4AA 3CW2A 1K86A 4R7ZA 3OTIA 1SD5A 4OHUA 5IFKA 4PHCA 4C7KA 4X54A 5DBFA 2O3RA 4ZARA 1DG1G 5TQ0A 3M4ZA 5D85A 2NZ8A 4JL5A 1BMTA 2CV2A 5HGXA 5EJIA 4EPYA 4UE6A 4ETNA 1ZITA 4FHDA 3VZPA 1KOJA 2WB2A 1RAAA 2V7EA 4RACA 1OFGA 3AKCA 1P9WA 1IZ9A 3B3GA 2H1FA 4HDAA 2G9VA 1ZHFA 3ICVA 3L6OO 1R0YA 5EZ5A 2H4WA 4FGKA 3TSAA 3R4VA 1WCXA 2VDNB 3UB2A 4AN1A 3G2HA 4BO7A 4DG9A 4GPAA 8LDHA 3F47A 5DWDA 4FBMA 4CLRB 4HNHA 4IM7A 4DXDA 1EKXA 4AAYA 1P2GA 1A9TA 3X1JA 4AY3A 4CN8A 3L1UA 4OX9B 1P6UA 2E6UX 4D9HA 3Q2KA 2VJMB 2OA0A 1VL6A 3DHNA 3ZD8A 4QFMA 3F9CA 4NZYA 2I29A 2BP7A 2RBGA 4DY4A 3RG8A 3GDGA 4Q9JA 1IXKA 5DHFA 3NEYA 5F9HA 5FBQB 2RCNA 1CY8A 1L0BA 1OLOA 5BN3B 4EL5A 5L6MB 1O97C 3QEMA 5TLSA 1FW6A 4V0QA 2ZJ6A 2B7BA 5DCLA 3DYIA 4C1BA 3VPDA 4QQKA 1V5WA 2D0OB 2QRQA 1PX0A 1QV6A 3HSYA 3ROPA 3EIHA 3LKZA 2Q9CA 3SYNA 3TQCA 4IHJF 3GFFA 1OIVA 4DIKA 1UBTS 3CUWA 3H2KA 3M6XA 1QK5A 2EKZA 4I8XA 4MWZA 2NVUB 1GTSA 3L0CA 1NQWA 4AK9A 5FA6A 4BZQA 3QKWA 4CWAA 4QG3A 1Q21A 2GESA 3T9FA 2FV8A 3WIDA 2GJ4A 2W4MA 3VU0A 2VJNA 3ND9A 1FW8A 5CYGA 3G85A 1REQA 1V11A 3OZGA 4TUYB 3W78A 2XUDA 3V00A 3HN2A 4BP9A 2AOTA 2C96A 5LBTA 3SZMA 4TXMA 3MW8A 1ILWA 2NWQA 3H9EO 3KKQA 2FUKA 1CHDA 2HA6A 3KT6A 2ZYWX 1NM5C 1SA0A 4PWYA 4WBNB 3C1OA 5KWJA 1IB6A 1QNFA 3DF7A 4KQHA 5LUAA 5CA0A 2EGUA 4KXVA 2COEA 2QRPA 2FMXA 421PA 4EAQA 3GPBA 3SFVA 3QMMA 1SCJA 1U7PA 2QD3A 4NH0A 3S2YA 1OBHA 4FB5A 1MC5A 2TMDA 3DTNA 5KVSA 2DJ5A 3L77A 3HUUA 3IEUA 3SN6A 2FW6A 3C43A 3RVDA 2XMRA 2ZEJA 1NTRA 2C57A 1KYYA 3ICPA 3MXOA 4OIFA 4IOJA 2Z95A 1QZXA 4PC6A 4WNCA 1CP2A 2VWHA 2XIQA 4OYRA 1KJ8A 1W8DA 3GEGA 4IF6A 4CCSA 3QITA 4YCAA 4Z49A 3IAXA 2BAGA 4XVCA 1DE0A 3G0GA 3VXKA 2O8BA 2WOOA 1JAXA 2E9SA 3CUKA 1F20A 4C76A 3MWJA 1FRQA 3JYQA 4FP9A 1GNSA 2JJ1A 3Q7SA 5EJ7A 3OOWA 5IKXA 1YC5A 1T36B 1MGOA 1FTNA 3QVOA 2XUFA 4RHTA 4CIDA 1CPYA 3K3PA 3PU6A 2JVKA 1M1YB 3O3CA 4KGDA 3T5GA 4C21A 2PS0A 3CG0A 2B1IA 2DTDA 5LQJA 5F7XA 1FA9A 3NB0A 2ZIVB 4ND5A 5CB4F 3A6EA 3AM5A 1EFAA 3OU7A 2ZIXB 2P27A 1FQJA 3WRVA 1OWMA 3HDGA 3CVXA 4LJYA 3H19A 3PQ6A 2ZUFA 2LPMA 2EWWA 3JVIA 3GUYA 3WY9A 2E1PA 3ZDDA 1FRNA 3ASZA 1XZKA 3DBVO 4C6HA 3RVKA 4LSGA 3TZHA 5FP0A 3G5UA 1GY8A 5HE9A 2A67A 4LGCA 2GDJA 2PWYA 3MVEA 5B53A 4D79A 3TQQA 1XIVA 3DZFA 4MWGA 3AEUB 3LXUX 3EMVA 3DS8A 1I4WA 3BXPA 1F2DA 5FR2A 1CC1S 2OGUA 3QPVA 2YRXA 1SB9A 4ML3A 2QUAA 4R0VA 4FX2A 3DBHB 4YP5A 4DCPA 5JNUA 1U3VA 2J4FA 2I4OA 2WA1A 4GM4A 3WGQA 2QRVA 4DC0A 4KWHA 3UAZA 5J4YA 3IUSA 1JDZA 5M7EA 4QEDA 4Y6LA 1F2UA 3QMWA 2QENA 2ZT6A 4MQBA 5C3UA 1Q7RA 2LBPA 3UJ8A 3FTNA 2PH1A 3F97A 3JQ9A 3ZUGA 4C4XA 4C7OA 1MW8X 1VSBA 1Z2AA 1ADYA 2EFGA 1AKYA 3N59A 4GD3Q 5E4FA 4U5QA 2R00C 2ODQA 4W7IA 3OT5A 1YJBA 1QE5A 3IRUA 5LU8A 3CZRA 2A8YA 3H9CA 1K8RA 2P9HA 4C4SA 3N1UA 1W4RA 3N0TA 4JFAA 4OSOA 3T38A 3JZAA 4N18A 4NIMA 4DCGA 2ZUWA 5LNK1 4X60A 1AGPA 4ZTBA 3F3KA 1V4BA 2WR8A 3MPUA 4KO2S 4MMZB 4PG5A 3EW9A 3QOWA 3TINA 3WNQA 2JIDA 2QM3A 1MOQA 1S7CA 2W6JD 2XBLA 5AOAA 5IXJA 1JHDA 2I6UA 3TTSA 1ESCA 2G3YA 2XNDD 1T2DA 2ETVA 4F5ZA 5EESA 4UJ5A 4CM8B 1OXUA 1G8HA 2W9XA 2BFBB 1PT8A 1RC0A 4I6GA 5F9FA 5EKSA 3ZU2A 2EFHB 5SV2A 2R1UA 1N2JA 3WKEA 3OJ0A 4C29A 3A1WA 1G4UR 1D07A 1QE0A 4NP6A 3HWRA 3EQ7A 1QHNA 5JQWA 1CW2B 4Y2YA 2PLWA 5JDIC 3F4BA 4FIZA 4F8YA 2O19A 2JJ8A 1PR9A 3SQNA 1XCGB 4F12A 3P26A 1Z34A 3KB8A 4MHOA 4YRIA 3ENWA 4UXHA 2QRGA 3GFBA 4CE6A 4XJXA 1R27A 4DLVA 1KJJA 3TLMA 1KZYC 2H17A 3W8DA 5EG5A 4CUKA 1H3EA 1RYBA 1GNQA 1AZWA 5SYNA 1TTPB 2CXQA 3EH2A 1Z13A 5JZVA 1KP2A 4PRZA 5ICEA 4LJRA 1WCIA 1NVVQ 2PT7A 4LDRA 3UA3A 4A6PA 4CDNA 2BOVA 2WMYA 3WI7A 1MKYA 1T24A 3MG9A 3RO7A 4AKTA 4DEYA 4KFCA 2BEKA 1WXFA 1EUCA 1FNSA 1MJ5A 3LK6A 4XLLA 3SJZA 4LRTB 1ZJYA 1PJ2A 3L8YA 4X1YA 4CDGA 1LTKA 2RH4A 3LZCA 3IHKA 2EFDB 4OHCA 4OLFA 4GP6A 2E0IA 2F48A 4W7HA 5GQSA 4ABTA 2IS1A 2O2XA 3Q3CA 3VOSA 3ZWNA 4E7PA 4G8DA 2AX3A 5DNEA 5F12A 2EHDA 4KH1A 4P33A 4QEKA 4A91A 3DO6A 4BNTA 1GZ4A 4XWAA 2A5GA 3KCQA 2ZYGA 1UL1X 4KN9S 3UOGA 4L76A 4D41A 1BQ4A 4E2ZA 4KPYA 3PC8C 4CL3A 1SBIA 2J3IA 4PFJA 5JS8A 1KC1A 3CCCA 5EP3A 4RTJA 2C7PA 5TQ0B 3HJCA 1DRWA 1Z7EA 1VHTA 2JBWA 1GPKA 2QVXX 3I3SR 4G84A 4OQDA 4DYDA 2I9PA 5HYVA 5KJCA 1NDHA 1U2RA 4QLOA 3THYA 5JOQA 2HCJB 2I33A 1HQDA 2PR2A 3X44A 1QP4A 2GD2A 2Q3FA 5TIIA 1CD5A 1LDYA 3W3AD 3MCTA 2X9GA 2IV3A 4HDOB 3K94A 2HWWA 4OHFA 2FR8C 5DYTA 3TM4A 4B3DA 1T4DA 1DUIA 3OQ1A 2VL7A 4QOSA 1SCQA 2X5XA 2JFPA 5AKGA 4JP5A 2J33A 3AEQA 3EEFA 3IOEA 3PQEA 1SM4A 2OYCA 5K3OA 1J1ZA 2CWWA 4EW1A 1H5NA 4QATA 4LZNA 2V7PA 2WI8A 4PXYA 3G7SA 2BM1A 3FROA 3OIGA 3PPYA 2GRUA 2HNKA 3OLWA 5CXSA 3GGSA 2VJOA 4AN4A 4DZRA 3K05A 1U3DA 2NQ8A 3AJAA 1MT3A 2VIIA 3QG5A 4WFQA 1XKXA 4WKGA 1C9DB 3ZN2A 3ZW7A 3UH1A 1VYVA 4PAWA 5BQ5A 1OBVA 3F9RA 2FCAA 3OURA 5CG2A 3GQBA 1ZYUA 3THWA 5AI6A 3QEMB 1I3NA 3DH0A 2EZ4A 1QIKA 1W1UA 1VJRA 2EEZA 2VAPA 4HVAA 1NF2A 1RZRA 3QKTA 1H4TA 3PVCA 2HU5A 4G1VA 5A3JA 1KFBB 2ZZNA 1X1SA 2BGUA 2J9XB 4NCXA 4PLYA 1QIMA 1Y3BE 3K6RA 3T15A 2FP3A 3JWHA 1GZ7A 3RRBA 5CT6A 4BZWA 3N6XA 4IVPA 2ZI5A 1FU7A 1VIMA 1YJ8A 3S1AA 4UOEA 4X1IA 3I0MA 2YWGA 4L9RA 4CQMD 1I36A 5ICFA 4HWPA 2AOUA 3OPMA 4IDCA 4C0BA 3DB2A 3ICWA 3IEIA 3AETA 4UAJA 1GSOA 1FS5A 3VI3B 2YHUA 3TIXB 5B1DA 3BHJA 2OP0A 1G5HA 1JSXA 1V11B 3OF5A 1A2QA 4KIUA 4F11A 2AOTB 3QLTA 1F8XA 3RAPR 3I45A 4ITRC 4I6EA 1ESNA 2V7XA 1ZD5A 2IYOA 3RC1A 4B4WA 1IEQA 1HRKA 1SA0B 2BHRA 2W2XA 4EDFA 2UYQA 4U2FA 1U7OA 1NF9A 2DUWA 1YR9A 4OHBA 5CA0B 4JI8B 4KHZA 2N3ZA 5U9CA 1UBFA 1RC8A 3BT7A 1TEHA 5L3VA 4R9RA 1ND6A 1P9NA 7AT1A 2G82A 3EZNA 3ZXYA 2A58A 2PTHA 4XXHA 3KTAA 3LQRA 3DL0A 1G20E 5BMVA 4M0EA 2YVLA 2GQ0A 2J9FA 4UAVA 1OXSC 5DTEA 3R7WA 2O8BB 4HMOA 5LQKA 4ENVA 2QUJA 3IAFA 4YAOA 3EASA 1KQPA 4YRTA 4AJIA 4J6FA 4IILA 1BU8A 4F97A 3AJDA 2B8JA 3AHHA 1KMHA 4AUKA 5FUXA 1CFJA 5B1HA 2E6KA 3PICA 3CY6A 4GSYA 4ZVKA 3U13A 3JR7A 3EZXA 3I53A 4OQNA 4UBNA 3TUIC 2A88A 3FNQA 3L84A 4I50F 1FYEA 2BLNA 4HH1A 1SG0A 4NEQA 1WDKA 1RHQA 4DC1A 1T0PA 1I7DA 1BMDA 3B6IA 3JD2A 2K4MA 3KQLA 3MMXA 3NC1C 4NZOA 2ERXA 2XMQA 4JJIA 1G7SA 2W2LD 4MH0R 4R8RA 3BWDD 3NETA 4K9DA 4B4DA 4BMOB 9MHTA 4PG6A 1Z62A 2CJWA 3D6VA 4FQ8A 1OSNA 4D56A 2VS1A 5FQOA 4ND8A 4DUYB 1CUYA 1W9HA 3ZNOA 4XYLA 1NFFA 4W8OA 3UV6A 2VDVE 3OQBA 4CT4B 2LIVA 4JJ7A 1K1EA 4QUEA 1E92A 1ZD8A 4F4JA 1JEAA 3QVLA 4BC1A 1TU4A 5BWLA 5IC5A 5G0UA 1K6IA 3FMPB 2AMFA 3IBSA 1MO4A 3ZTYA 2VHXA 1W44A 5HQ3B 2FSIA 3P9YA 4J16C 4M22A 1EXDA 4TZ6A 1IN4A 3GFGA 2QRVB 5ERYA 4CR8A 1VIAA 5F7ZA 4Y1EA 3QE0A 4ZT6A 1R0RE 2Z2XA 2INGX 3HB0A 3ZC3A 5B3JC 3LPAA 1NJ6A 4J2TA 1HDYA 1RQXA 4M8LA 3OZXA 3UCXA 4EYSA 1OU4A 3H3XA 2XVMA 4FFSA 2ZTUA 1KA9H 4C4ZA 3VYSB 4POOA 4M9CA 4G9GA 4UTZA 3UW1A 3V9AA 5BWMA 1AZSC 4L8YA 1QQAA 4BQPA 1IZZA 2HHHB 4C7OB 2NO9A 4BNLA 2YOHA 3W1EA 2UKDA 3TZQA 1PR5A 3QELA 3Q9LA 3LBIA 4G01B 4GVLA 2HRRA 3TEFA 4GSKA 2JI9A 3IAM6 4Z3KA 1YB7A 1TU3A 3E27A 3FNRA 1YNSA 2QZJA 3OP1A 4C0WA 4G81A 2XADA 4J0QA 1V96A 1E4VA 4X6LA 1UKAA 2FLWA 4FFBA 5D3KA 3C24A 1FEZA 1TXGA 2QMOA 2QTRA 1KJYA 3ILSA 4E1VA 2K6GA 1COWD 3LX6A 1LQ2A 1IY0A 5IF3A 1TUEA 2WP8J 5FNVA 5JXIA 2O59A 2Q29A 2GPWA 3GEDA 3NHBA 4N0EA 4EUEA 1E9FA 4X7MA 4L51A 4S04A 2WV9A 4OMDA 3HJFA 2BSQA 1PEDA 2G9ZA 2GKOA 1W5BA 3FFWA 5AFSA 5H82A 2Z5VA 3K53A 2OC4A 1XKLA 3HUEA 2F6RA 4AYTA 2R1VA 4L85A 2ECOA 2XNJA 2UXCB 1GU0A 3PUIA 4BTVA 3LW8A 3MBOA 1MB2A 2ODWA 5CG1A 4C4TA 3LKVA 2BFNA 1NYRA 1PR0A 2Q07A 3OWHA 4WMLA 4ZCLA 4Z9XA 3VX3A 1BD4A 1RAIA 4FK8A 4UULA 3OF2A 4OQPA 4NMHA 5IM4A 3FJOA 4IFTA 3EBOA 1ML3A 1KPGA 5E6SA 4F8EA 1B7GO 2C07A 4OHZA 2WU4A 4MMYB 4F2DA 1XPJA 4Q15A 3BTSA 2RBKA 4H77A 4DV3B 1N5RA 4O2RA 2QP3A 1YBAA 1NNUA 4JMLA 3QVXA 3M1IA 4HADA 3RKRA 5JHHB 4HAVA 1WCIB 4MROA 2PKQP 4LYFA 1QIDA 4DEXA 4UHFA 3BQ9A 2D1SA 4Q9DA 3CF4G 3ONNA 1WU8A 1AJEA 3GGOA 2I6TA 2NOAA 2VCEA 2R6FA 1B8VA 3NBXX 4S1OA 3RYTC 4BVAA 5GOTA 1EUCB 1FLNA 1ST3A 5E1DA 3SCZA 2BR3A 4H9GA 4KEAA 4X1YB 5I51A 2JJ2D 1KXJA 2YDXA 1NHWA 1P0MA 2IQ5A 4NNJA 2R1TA 4TRJA 4E5VA 2OM6A 4JT9A 1Y8ZA 2P3QA 2ORED 1CDEA 1S89A 3YASA 3ZGNA 1J1UA 4HGYA 4AMVA 4JXZA 3IBYA 1VHDA 2IXTA 3GZJA 3KD2A 3S1LA 4BE4A 4F5DA 1ULSA 1VJ5A 1AQ6A 4JR0A 4I8DA 1PFKA 3JQDA 2WWYA 5M5BA 4YP1A 4QYSA 1AXEA 1GRRA 1ZESA 2V4ZA 2ZUBA 3LUJA 2ABWA 4BLQA 2IHKA 3KJZA 5DLYA 1TT7A 5JNWA 1N7GA 1W36D 2EZ8A 5JSHA 3H1FA 3I5YA 3I2HA 3MRXA 3THYB 3S2FA 4A26A 2I3GA 4A1FA 2P2SA 3VZDA 2WFLA 3BXGA 1QP7A 1E9EA 1ZMRA 1F2VA 2I4RA 4MO9A 5AHXA 1YS4A 1UEXC 4CIWA 2DGDA 3JVUA 1NHGA 4J1TA 1LNSA 1K97A 5DU2A 4YQFA 1Q44A 2J9RA 2XYQA 3TBKA 5M29A 1KAQA 3O94A 1RFLA 2G71A 3B2NA 3G68A 3GXBA 3KUDA 3AEQB 3DPIA 5KS2A 4ISCA 2GVNA 3GJQA 5B4UA 4FI3F 1EBFA 4OGFA 5K45A 5I4KA 2ZR0A 4YJ3A 1GU1A 4HBGA 4ZOAA 1AGRA 1F8GA 4KFRA 4BMPB 1NLUA 1ONBA 4G24A 1FNDA 1TFRA 4QPJC 3OSUA 1VYHA 3S5UA 4ATNA 5LKRA 2FDCA 4E32A 1H6DA 2FKAA 3HUDA 3IEPA 4UPDA 1SCUA 3SYRA 2ZZMA 4FNMA 1EWQA 3MTQA 2AC7A 3WRXA 1JDBB 5HFNA 1XDDA 2IYWA 4DBZA 2JFZA 4DSOA 4NFHA 5EE9A 5C4MA 1GZDA 3F6BX 3GQBB 3THWB 4JX8A 2HQOA 4GLJA 3L8EA 5F2KA 5HIIA 4GEGA 3DZJA 4AQYB 5EIBC 1P2UA 3Q15C 2OCYC 4HK4A 3TD2A 3CRMA 2I1LA 4FD2A 3EXHA 4EABA 1A71A 3LPNA 4MUAA 1DRVA 3VPCA 1AKWA 1IQ0A 3LQ1A 5LZ8A 3R7BA 2VDRB 4J4HA 3BJEA 3M82A 2WIFA 3HFRA 3LM8A 2IZOA 4CM6A 3S1AB 4N5DA 2ZSHA 3U19A 2A6PA 4BNHA 1KO1A 1YQGA 4Q93A 2Q5CA 2Q2VA 4X1IB 2J5RA 1Y89A 2P9EA 1SUBA 1Q0QA 2AOUB 1SZCA 1CF2O 4H4DA 4LHXA 3JQ7A 4TLLB 1F38A 3Q7QA 1JYFA 3WLTA 4H1WA 5A03A 5AIBA 3AETB 2V5UA 3LU1A 1FLVA 2LCQA 2I55A 5G1NA 2CXNA 1GPJA 3BTOA 3MS4A 2HA4A 2AFHE 5AUNB 1GAXA 4QGFA 3F5DA 4L6AA 3QVVA 3D59A 5FO1A 5KI6A 4WKNA 3AR3A 4YS6A 4BMSA 2WZQA 4W5QA 4CIBA 2H2DA 4MAFA 5CGQB 4EG3A 3HJNA 1N78A 3OJFA 4ILEA 2QUIA 1NVKA 3ONFA 5IAKA 3TPZA 1Z08A 3ABOB 4DA0A 2C61A 4WI1A 1US8A 5D5PA 3UBTA 5AK4A 1SCKA 4FGLA 3S70A 1T8SA 3UBMA 2Y9MB 4FBLA 4H7DA 5JBNA 5LMUB 1AURA 4AP9A 3D6AA 2VSNA 4JWTA 5A3VA 4ZOEA 3DMYA 2ZP1A 3SJBA 5BMVB 2J9FB 3R7WB 4FJ0A 1E1RD 4L9AA 3LQ4A 2HU8A 4DE5A 3DMTA 3DDSA 3NTVA 1MOSA 1HTTA 2QHXA 2WC1A 1AO0A 2WTEA 4JL8A 1I24A 2GZDA 3UJHA 1KMHB 1RXEA 2PIDA 1J2UA 3ZD6A 2RK3A 3WLRA 3M6VA 4YX9A 2DHQA 1P5FA 4ZDIA 2VNHA 2ENUA 1C4KA 2SBTA 4B9AA 4X66B 5B58T 3V80A 4B43A 4LPSA 5DSTA 4Z4HA 4YMLA 2VQFB 1W4AA 3DCIA 2IVFA 3E3AA 1PGOA 4HGZA 1YI1A 2V7VA 4XDHA 3WIVA 1Y4AE 2G63A 2I2CA 3K2QA 2CJWB 2ON6A 2XNKA 1E3DA 3BMQA 4J4TA 1ABBA 3NTOA 4B6FA 3L0DA 4BWYA 4JJ4A 2D13A 4ND8B 4BVBA 1MV8A 3GUZA 3MB8A 1XP5A 4WQMA 3B1ZA 4EQ6A 5HXAA 1T9DA 2WUGA 3QU5A 5DI3A 2I6XA 2OC9A 2XGSA 4CMAA 5JO0A 3W1VA 2HN9A 3BH0A 4PZUA 3BHIA 4Z7QB 2RCYA 5JFTA 3LC7O 1YS1X 4QVGA 3RUIA 3QFCA 4AD8A 1D7AA 3PRYA 1M2HA 2HQSA 1JHXA 2QLMA 2CVOA 3NBQA 1WR8A 2VNAA 1E1YA 3DOFA 2BC9A 3C4QA 3JZIA 4MX8A 2IDJA 3ND8A 1OZHA 1XSEA 5EJ8A 2O3JA 1GGJA 3K4QA 3JS5A 2QTNA 4TLCA 4ZYLA 4MWDA 1S3GA 4GL2A 1ZEJA 4IMPA 2MSNA 3M1YA 2C4WA 1PF7E 3CRW1 4CM9D 3Q8LA 1SMKA 3FTQA 3GELA 2PV7A 3I9V6 4HB4A 4TT3A 4TXNA 4DR7B 2FG7C 2HEGA 3L7MA 3O95A 5FDFA 3CH6A 2ZBFA 2SKEA 4FFBB 4J0JA 3GC6A 1F0NA 1ZH4A 3F5QA 3HV0A 4RD6A 3H9UA 5DYYA 1LC0A 2H63A 5AM1A 3SZLA 4NH4A 1P8JA 3UWKA 3O6VA 3MBKA 5F4ZA 5FNVB 2PKEA 5B6IA 5JECA 3U7GA 5ER6A 3VZQA 2B25A 3WGVA 4QBFA 2Y9PB 5IEJA 4BC0A 1LVGA 3E84A 5KQRA 2Z0MA 3FB1A 4QAJA 1W59A 2JH8A 2P5SA 1KHTA 4KO8A 4Y98A 4AUEA 2MTBA 4G0UA 3S29A 4E12A 2R1VB 4I5FA 1Q2UA 3OETA 2EV9A 2WNIA 4JI3B 4AMGA 2XOKA 1S2DA 3MGCA 5FOVA 3KS9A 3K8ZA 3ESYA 3HRHA 1KI4A 5A1JA 5EIHA 3PR3A 4H4EA 1IY1A 1UPCA 1G8SA 3FOEC 5E6SB 1C8BA 4XCQA 4I5IA 4NF2A 2XZLA 3QV1A 2H31A 2WVHA 4JP2A 5AVRA 3GJRA 4HLUA 4ZJPA 4G6ZA 1CT9A 3WWPA 4JS0A 4YMVA 2C2GA 2Y0CA 3C3PA 4ZVPA 2XBMA 2FPOA 3RSQA 2P9CA 2J3DA 1KJQA 5JI2E 2HREA 2QTMA 4UNPA 5AM3A 4M8NE 3RUHA 5I7RA 4F6RB 1BWPA 2ECKA 2PKCA 3D8SA 3KZ1E 2IYLD 4PZAA 1Z33A 2IBMA 2NM0A 3HZZA 3EGVA 3H2SA 3NT5A 1OROA 3FCAA 3LVRE 1OBOA 1ZQ1A 2Q9AA 2R1TB 2VK1A 4FYKA 2DBZA 4UPEA 3LDFA 4IIFA 4QUJA 1PGPA 1ICEA 1A3CA 4H7JA 2HHLA 3DR3A 2AKEA 1I5RA 1YL5A 2DWOA 4I1YA 3TK1A 1AKEA 3V8NA 2JVJA 2XF8A 1K5DA 4QDOA 4CQLA 1BAPA 1G21A 1FC0A 2MDTA 5CIQA 4JHXA 2Q2QA 5BYKA 1CJBA 3L93A 1F0YA 1PWYE 2WF7A 4ESHA 5KDLA 3SS7X 2PKRA 4PFQA 1R5BA 1OT3A 5GONA 4C2BA 1ZMTA 3MD0A 1VLVA 2B78A 5K3SA 4DEVA 3LECA 3P0JA 2O1WA 4MQUA 1XALA 2WFLB 2ZYSA 4OTZA 6NULA 4YAFA 1ZUHA 5F5NA 2QKYA 2HJWA 4KQ9A 3ECSA 4ZT2A 2DQSA 2ZVJA 4LYAA 5G0SA 4AKSA 2RDMA 1TM7E 2NYRA 2XF2A 3G9TA 4LEIA 3ZCVA 5ITZA 2ZUCA 2IXDA 4Z2YA 1E3JA 3IP9A 3O4RA 1LSOA 2ZWVA 1RHMA 2Q45A 3WLIA 4WJLA 1KZ4A 4DLXA 4MUHA 2QN1A 1UK9A 2ZJ5A 4UVDA 1CZKA 3QUCA 1RKQA 4N48A 1ULHA 4YJ3B 5NLLA 1KZHA 4XB2A 1FQKA 2VO1A 4DT1B 1MXHA 4DDHA 4RHEA 2ZITA 2X77A 1NOKA 4II3A 5DM2A 1N7IA 2IPNA 3HP1A 2IZ7A 4OMUA 1SCUB 4FS8A 4OLAA 4EO4A 2Y93A 3LKDA 3MMNA 1CUGA 2WJ4A 4IR7A 3GA7A 4G0ZA 1PYGA 4S1NA 4S0ZA 1WPQA 4H18A 3TJMA 4NYIR 4RLFA 5JZOA 1QG0A 4BUCA 2GZ3A 1CJSA 3GFRA 1FF9A 5ALYA 4TMFA 3N75A 4BLSA 5F33A 4C88A 1JHMA 3EXHB 1TKRA 2XYPA 5CJJA 1Y63A 3IAM1 5CYFA 4ZZ3A 5LDHA 1H8HD 1N6HA 2QTCA 5CPFA 1M75A 4ALJA 5DSXA 4ISBA 5IUNC 1DOAA 2ZJZA 1MR3F 1BFKA 1MJGM 3D2BA 3H4TA 1Q15A 1MTZA 2FPSA 2OHGA 4AP5A 2HJGA 4JKOA 4U9HS 5E7IA 4DCJA 1OTYA 2GD0A 3JQ7B 3RFVA 5JTUA 2XUQA 5AXCA 3B7PA 3OZFA 2Q8QA 5AW5A 1R0BA 1SVNA 2HF8A 5LP6A 3VZRA 3PHIA 3DFUA 5EXXA 4OFZA 5JCOC 4LF6B 2O05A 1P7PA 2X8BA 3PPVA 2VP9A 3UENA 1MP0A 2B0JA 3ZCPA 3SIPA 3EWSA 4HB3A 3WWDA 5LSAA 1CZLA 1SWVA 1AHPA 4YXWD 4LDJA 4B33A 3RSCA 3P9ZA 5JYCA 3K9FC 2BONA 1RJWA 4WK0B 4AKEA 2ZVQX 2E3JA 2QAGC 3GPCA 4CODB 4KNVA 3WLEA 2G70A 2UVDA 3IT2A 3CB4A 1RLJA 2F00A 4L5JA 3PGA1 4CGYA 1JIKA 1US8B 4PS0A 3C3DA 1QQTA 3EZYA 3TTXA 3WRYA 5EJ4A 2CVQA 3KHKA 2VDQB 4Z0HO 3MMPA 2EP5A 4W63A 3MSCA 1ZHOA 2HQBA 3A11A 2I7DA 3G0OA 4YCSA 2BUCA 1X87A 1U8UA 4XIJA 2WHPA 1MX3A 1TMYA 3EA0A 2E1RA 1XEAA 8GPBA 5JNSA 4BQQA 1FDWA 3H5OA 4DTCA 3NFRA 2WSSD 4Q9AA 4CF3A 1NBMD 2IY7A 4EFKA 5FPTA 2B8WA 2P1RA 4JQCA 2PJRA 2UXBB 5BO5A 4RLHA 4QDJA 2O2YA 3KP1A 2RARA 4O2LA 1Z4OA 2OV1A 1A5BB 2VNIA 3DWEX 4MPJA 3CE9A 3PQ5A 5E8JA 1JFLA 3RRFA 3TLAA 3WZMA 4F45A 3BGDA 5ESDA 3V8QA 3WHIA 1E0DA 2B0CA 5J59A 4B7UA 4WZ6A 2CYBA 3KSRA 4B6QA 3BMQB 3ECCA 4ZJUA 2VOEA 1AS3A 5HCIA 3BA6A 2Q3EA 1WABA 2D4HA 2G4LA 5G4KB 2BW0A 3G02A 1KJIA 4EQ6B 1TI7A 4WLNA 4JBHA 5DHAA 4ZJZA 1FDIA 4ZALA 5IMBA 4Z4EA 1TLFA 1Z4JA 3BXHA 2RIRA 1Z3CA 3EUWA 1WA5A 1P9LA 4JB8A 5JPCA 3IT3A 1NAHA 1OYOA 4JD5A 2V5AA 3KL2A 4TXJA 5LQRA 1JAIA 2ZI3A 2V45A 3D02A 3FPAA 3PEVA 1NDQA 5B7NA 5AKJA 3CT4A 2Z2JA 1TUGA 3VO8A 3CURA 3OTQA 4X8HA 2X6RA 4KITB 5DT9A 4MAMA 3AFMA 4R1LA 2C3PA 2XAUA 2EC5A 3PQDA 1WM1A 1QTQA 5KQGA 5F23A 1V71A 1Z0ZA 2BCJQ 4TL7A 3TMAA 1UBSB 3AY6A 1Y6QA 1JXMA 1JLLA 2AN3A 1PQWA 1Z73A 1II0A 2C8JA 3NH9A 3OTGA 4L1KA 5JSFA 5BW8A 2X8JA 3AHIA 4JLBA 2FX5A 3NDJA 2VDPB 3TUZC 5B57C 1IAVA 1SIOA 4PCLA 4BO2A 2OBMA 1YU9A 1HOXA 2YY7A 3BL5A 3KAJA 3KVVA 3JQFC 3M6WA 1UDRA 3C3XA 4BFZA 2ZBPA 4KXLA 3H2IA 1G7TA 2W2KA 2QJRA 5FUQA 2XRFA 2P6PA 3W6UA 3C6QA 5K99A 4FKBA 3SPXA 1YR2A 2FZKA 1QRDA 3Q9NA 1A96A 2B4RO 1U5CA 3PFIA 4UXJA 1CDDA 3SIXA 3OPVA 3V8BA 1JFRA 1HDOA 2HMYB 3PEEA 3T7SA 5I7FA 2NADA 4TROA