3KQKA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
436
structure length
436
Chain Sequence
b'SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 138
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqkA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA01
4LWZA 3NBYC 4Z51A 3CLVA 3PENA 4LX0A 3GMTA 3I62A 1G8FA 1U0LA 3B78A 4FXPA 2XJ9A 3REGA 3X1XA 1ZM2A 4JLBA 1G19A 3RANA 5IT5A 3U3MA 4ON9A 4ASUD 2ORWA 4KI0A 4BWYA 2WICA 3FTQA 4M1OA 3NH9A 4CF7A 4Q4JB 4U02A 2IX3A 1U8AA 3SQWA 4LJ4A 1E2HA 1CEEA 3EPLA 4KODA 1SVSA 4IXNA 3L0PA 3RWOA 2AN9A 2AR7A 2RCNA 1JPJA 2GJAA 2VTKA 5GVRA 2OXCA 1P4SA 2Q6TA 4PFSA 5DSZA 3H4MA 3UPUA 4DDTA 3D8BA 1ZUNB 2MMCA 3TSWA 2EYUA 2OCAA 3MD0A 3CF0A 3QPVA 3TQCA 4DLXA 2ZJOA 4Z1MD 4LBVA 2XEXA 1T6NA 3EZ2A 5HZKA 4M1KA 3GJ3A 2Q9CA 1CR4A 3KTAB 3UMFA 2REXB 4PO8A 2OXRA 1XU4A 4HAUA 3TLXA 4L9WA 4TZ6A 4KO8A 3QUSA 3FHOA 2ORIA 5IDVA 3SJBA 3GLGB 2XXAA 2J5XA 1KSFX 2ZROA 3CO5A 1T0JB 4JMPA 4BASA 2ZQ5A 1XTQA 4JLOA 3VU9B 1E1QA 1UKEA 2YKGA 1W4AA 2CVHA 2VQSA 3AP3A 4BFSA 1ZAKA 4PC6A 4BGDA 1U90A 1EFHA 121PA 4LBZA 1A1VA 2P2LA 4AKEA 1OXVA 4MYCA 2CHQA 2H18A 4OYHA 3LW7A 1T8UA 3TVDA 4D4LA 2IW3A 3RYTC 4PSVA 2GKSA 3IBGA 4Q21A 2YWGA 2IYUA 1VIYA 1YJ5A 4KVAA 4B3BA 2C04A 4PO1A 3T1OA 3PEUA 4HUTA 5JJIA 2CLCX 3JVUA 1W0JA 4L5BA 4Q4HB 5H68A 3BE4A 1S3GA 2IS4A 4Q4LA 5D3MB 2RGEA 2Q9BA 3NEYA 2YWHA 2JA1A 2Z6VA 1UFQA 1BOFA 4JSTA 2ZUBA 4LCBA 1QHHB 3LDAA 3SHWA 4BLOA 3EX7C 4NYMR 1JJ7A 4C2UA 1ZD8A 3SDZA 3QBTA 2FFBA 4TYPA 1TQ6A 1KI9A 4Q1CA 3IHLA 3W8RA 1GZSA 2ZJ2A 3RNLA 1P9RA 1QVRA 4HAXA 1SXJD 2IXGA 1VYTA 2HDNB 2FWRA 4FCWA 4AI6A 2FV8A 3LAWA 2P6NA 1EFTA 1VG0B 4PR0A 4C0HA 4AWXA 1KI2A 1W48A 5KSYA 5L3VA 3EPKA 3BFXA 2Y8EA 1FW6A 2WKQA 1U9IC 5E7IA 5TDHA 3U7GA 4PAOA 1TF2A 4JT4A 1NIPA 3VFDA 4CGZA 1N6KA 1NL3A 4KFTA 1DBSA 5D3QA 5CIWA 1JI0A 3B2EA 3B9PA 4ZIRB 2CK3D 1KMHA 3FFBA 3UMSA 4BZXA 5JBQA 1WB9A 1IN8A 2ZUCA 2W6ID 2GILA 4PHHA 2OCPA 4CW7A 2ONKA 4IKEA 2X19A 2FSFA 5KU1A 2CHVA 6Q21A 2IYQA 2RGXA 4OK6A 3ICQB 1P7CA 4RD2A 1OV4A 5CYOA 1VECA 2LWIA 3NEJA 4XOIA 1P60A 4Q4AA 5DN6D 3K70C 4DDVA 4MRRA 2OILA 5CB8A 5TARA 3NHAA 4F4JA 1P9WA 1JBKA 1E69A 1R7RA 4PZZA 3B9QA 4MUBA 4Q1AA 2WJHA 2PX0A 2G1JA 5FR2A 1K5DA 5FPSA 2IS6A 3Q3JB 3ZIAD 1AZSC 3OIUA 2FF7A 3UMRA 2V1XA 3EIHA 4W5WA 1QG4A 3PUYA 1LS6A 1CJKC 1R0XA 5EXXA 4F4IA 2C98A 5AWFC 1NN1A 2ZE7A 3B8HA 3EC2A 3ZDQA 4Q00A 1KI7A 4GRAA 1HYQA 1Z5ZA 4TLAA 2XXAB 2BIFA 5G3YA 3IQXA 5JSZA 2H16A 2CCJA 2VSFA 5DE3A 4RCZA 2AK2A 2NMVA 3HJNA 2AWNA 4BUJA 3SU8A 1J2JA 4B75A 1NIJA 3LD9A 3QXXA 3WY9A 1RW4A 4JYCA 3EXAA 1GOTA 2PMKA 2QSYA 3RWMB 4BRWA 3E70C 1FUKA 1NN3A 2IA5A 2WJVA 2ZRPA 1W0KD 1DAIA 3F3YA 4R2IA 2EVWX 1WE2A 2GBLA 4X8OA 4A8JB 4E07A 5FOTA 4GMDA 2OLJA 3AF1A 3FWYA 4TTPA 1RPZA 1G41A 4HB3A 3CUEF 3LXRA 3THXB 1E2NA 2ZRHA 4XD7A 2ATXA 5LD2B 3O8BA 2KE5A 1N25A 3KQNA 4I1UA 4C0LA 4I99A 3QVUA 1TX4B 4OHZA 1OF1A 2WKRA 4LYJA 5FBWB 3LX5A 1KZGB 4AKGA 5DHAA 4QC2A 3DM9B 1GL9B 3L0IB 3THYB 5BYKA 4CEIB 2EFEB 1CXZA 3PIRA 1ZNWA 3NWJA 2RGDA 1IBRA 3U61B 3UWOA 3A8TA 3THWB 2OV2A 2C9CA 1OYYA 2QAGB 1LTQA 3AF2A 5A4JA 1J7KA 5H70A 3LH5A 2XOKA 1E0KA 1XD2A 1HH4A 3CR8A 5C46F 2VHQA 1AIPA 2ZETA 4DIEA 3MJRA 3N2IA 3QKSA 4M21A 1NLYA 4JVLA 1MO5A 3K09A 2ODWA 4LY6A 2ORVA 4OI4A 1NVUQ 4FMBB 3FKSA 1U99A 4PAQA 1G291 4CVNA 4DUGD 3QKTA 4P31A 2G9NA 1G7CA 2RGGA 3WNCA 4F92B 4B2PA 1FTNA 2BBSA 4C0AC 3W3ZB 3ZZUA 1EESA 2OBMA 4FW9A 1XP8A 2H7VA 1VG1A 3X1WA 3QEOA 3U60B 2NO7A 4JKYA 4YLGA 5KDDA 1XEXA 1HUQA 3TJZA 1E9SA 4NL4H 1L8QA 1KMHB 1N5KA 1IY0A 3T12A 2BDTA 2BMFA 3HP1A 1VYUA 1AGPA 1NY6A 1VG9B 4PZLA 2WHXA 3C7KA 2C2HA 1C1YA 4FMDF 5DGXA 1BKDR 2QL6A 3K9GA 4R9UC 2XZPA 2ZS8A 4Q47A 1KJYA 4PC7A 3SZRA 4TSFA 5CDFA 5L3RA 1W4BA 2ZR7A 5KPJA 5TXGA 5EUMA 5EE5B 3IPXA 3GLGE 1KY2A 3U4QA 3MWLA 3BBPA 5E3HA 5HCIA 2BC9A 1FMLA 4KSCA 3IHWA 721PA 3I72A 2FPLA 3SC3A 2ZRNA 4IVQA 1SVIA 3SNHA 4NCIA 2ZR0A 3KB2A 4C9BA 4BFVA 4CT5A 4I4LA 3QSYA 5DHFA 2WM9B 2JDID 5DYGA 4ARZA 2F1RA 3QKRB 2GAAA 3AKYA 2I3BA 2KB0A 4DLYA 2CVFA 2N1BA 4ZDKA 4JJZA 2DFKB 3KZ1E 5J5CA 1WMSA 5FOXA 1WBBA 1Z2AA 3KDSE 4XSHA 3VR5A 4YMTA 1E4YA 1YKSA 2V6IA 3A1TA 3KQHA 3LLMA 4M2LA 4TN1A 4XVRA 5BXQC 1XD8A 1Q3TA 4MGZR 5EQTA 3TKLA 4JJKA 4QBIA 1FNNA 2Q9AA 5K8UA 2VO1A 1T5IA 2HXYA 5HTKA 3AVVA 4MRSA 2RGNA 4JLNA 2P5SA 3A1UA 5K8TA 1KIMA 2W00A 1G6HA 2QRNA 1SZPA 2J41A 3K0AA 3PITA 4NCHA 5BN4A 5G41A 1OXTA 2OESA 4BFUA 1UBFA 5FUYA 2C99A 5KOYA 1Z0JA 4DDUA 1G4AE 1XNJA 3W8NA 2G6BA 2QRZA 4H9GA 4IEIA 1SQ5A 4KV9A 4NBSA 2AHOA 2UZIR 3FMFA 3U2QA 4DCSA 3EPHA 2KI5A 4TL7A 4EJSC 3QIAA 1OIXA 3HDTA 1TU4A 2B6HA 1RZ3A 2ZJ5A 1G7TA 2F1HA 4WVFA 5TB5A 1P2VA 1XPOA 1YR9A 3ASZA 3ZD6A 1RC8A 2P6RA 2OG2A 1D8TA 1DO2A 4B73A 2X2EA 4DKXA 1GILA 1WRBA 2AFIE 5FPKA 3A36A 3B1XA 3VR1A 2QQ0A 4XSGA 3U44B 5P21A 4M9SA 5BYJA 2ZRAA 1W2HA 1W47A 4EPTA 1L4YA 1GNQA 2R6GA 2FOLA 3FVQA 3W9YA 4AYWA 1ZM4A 3C5CA 2O8DA 3BFVA 3CH4B 4LPKA 3MCAA 2YOHA 3DHWC 3IBYA 3KQKA 3HR8A 2GVZC 4HB0A 2QN6A 4QHTA 4BEBA 3LVRE 2GEUA 1U0JA 4I1VA 3AF3A 3CZQA 2YVUA 1ZNYA 3ZVLA 3EZ9A 3FFAA 4NKRA 2FZLA 4U00A 3RRNA 4BECA 3OE7D 5KSZA 4FCVA 2XJ4A 2ECKA 1FTSA 2J1LA 2OEPA 2QP4A 2ZSAA 1U9IA 4EQ6A 1S9HA 5IRCD 3X1ZA 3KKQA 1E9EA 2DFLA 3PVSA 2NQ2C 1ESNA 2O8FA 1UKZA 2BVNA 1KO4A 2KWIA 4B47A 2IYZA 2W2XA 1W1WA 3N2EA 1F2TA 1GM5A 3BERA 4YMWA 4BQSA 1DAMA 1OFTA 5EP3A 1Q3HA 2FH5B 3I4LA 5JECA 4HUQB 5KDLA 3KKNA 1RJ9A 2RAPA 3X1YA 1P62B 4DIDA 1DAGA 4KVGA 4Z54A 4LBYA 1UF9A 3QXSA 1VIAA 2F9LA 4F91B 2QTVB 3Q72A 1RVDA 3S1AB 1Z8FA 3VNVA 2VYFA 4WW0A 1QF9A 1EWQA 1XMVA 1T3HA 3B60A 1Q20A 4UQOA 1O3YA 2WJIA 3KUCA 2ZRLA 4QGHA 3PUWA 2CEAA 4PHTA 2Q3FA 4F38A 1OFHA 4A82A 2WSSA 2IYWA 3IIMA 5EE0A 4LV8B 5FTLA 2JLUA 1TEXA 4JSYA 1NKTA 3RHFA 4IOKA 5J47A 4BPBA 1E99A 4O25A 3QY0A 1T91A 3MMPA 1E0SA 2FFQA 4B71A 2VH5R 3FB4A 5HE9A 4IOLA 5SZKB 3AVWA 2QE7A 4D0LB 5CB6A 3FMOB 4KXFB 1OXUA 4DSTA 2HJGA 2ERYA 1EFCA 1CRPA 3MSXA 2QI9C 3H84A 2HLDA 1S96A 1ZM9A 3WP1B 4QJ3A 1N2CE 2ATVA 3PCRB 1XCPA 1E94E 2HF9A 1IQPA 2BKEA 2JASA 4A2PA 2VLIA 4BE7B 3TAUA 2HXSA 4A6XA 4YMUA 4IHQA 2JGNA 3WRXC 5AJZA 4C7OB 3CF6R 1KI6A 2O52A 1N5IA 2QA5A 4C0SA 4CT4B 1VYVA 1KSGA 1JR6A 2XNDA 3GLFB 2J0UA 1GWNA 2ZE8A 1NVWQ 2LCFA 4NDZA 4JBXA 2QGZA 4O2LA 4HLDA 3CW2A 1P3JA 4Q5IA 5J4LA 3WYGA 3NG1A 2RGAA 1G8PA 3M1IA 4D0GA 1W5TA 3U6KA 5CM9C 2CNWA 1WXQA 4XH9B 1FX0A 3RC3A 2G0TA 2VIIA 4DLSA 4TLBA 4IW3B 5FTMA 4FN5A 1CKEA 2YOGA 2J7PA 1EFRA 1II8B 1FQJA 1KI3A 3ETLA 2CCKA 2ZSEA 3MG9A 1XEWY 3B7GA 1I4DD 4PPQA 2ZTSA 1FL9A 3GEEA 3K9HA 2NO1A 1Z28A 1W7AA 2R9VA 1K6MA 4WBSA 2CE2X 4HZUB 5EE9A 5FFMA 4RZ2A 2O8EA 1VMAA 3W6PA 1TMKA 3AUYA 4GZLA 1IN5A 2WKPA 3QG5A 5EP4A 1GVNB 4JLJA 1XCGB 1I4LD 3MAAC 3B1WA 3AF0A 2OFXA 2PL3A 3HU1A 1G5TA 2OZEA 4P4SA 2OSBA 2GEVA 2PT7A 1BYUA 2C5LA 1KDPA 4TT3D 3QPWA 2ZSDA 1PVOA 2GAOA 4B43A 4Q7LA 2N46A 1KTVA 3FMPB 3SOPA 5KNDA 2OLKA 1W49A 3GPLA 1AS2A 2VP2A 1F3OA 3CRQA 2FGJA 4Q19A 3L43A 5CYPA 2ODNA 5A5GA 1TAGA 2GA8A 4LC1A 4LJ7A 4QRHA 2VP9A 1TUEA 1XMIA 3KXLA 3PG5A 1DAFA 4BLTA 5K8LA 1WBDA 2HUPA 2ZI3A 4LGMA 2QZ4A 1KI4A 4B48A 4E5UA 4NU0A 1SHKA 1PJRA 1XPUA 1V5WA 1XZPA 5HR5A 3CM0A 4LPSA 1YR7A 3GJ0A 1KNXA 3NBXX 1KNQA 1S0UA 4JIMA 3U7HB 1II0A 1OJLA 4H1VA 4KYIB 4RD6A 5FOSA 4C0QC 5HKKD 1X8JA 4XIGS 1F6BA 4QBFA 3VHXA 3C14C 3SI7A 3BH7A 5TV2A 1GSIA 2JJ2A 1M7GA 2EFCB 4OQLA 2JIZA 1W4CA 2ZRCA 1S4QA 1TEVA 5FL3A 4GNKA 4C4PA 3SFZA 1S3SA 1HQYE 2B8WA 2GJ9A 2WPDD 5KPDA 2ODEA 1ANKA 1M8PA 1OLOA 1KO5A 1ZC3A 2EYQA 2FEMA 3ND9A 1OB5A 3QJYA 1VHLA 4II7A 1IJFA 1YZQA 1YZTA 1E3MA 4UNRA 3NDPA 4X8LA 5L8VA 1Z83A 4A1FA 1OHHA 4Q9HA 3ZD7A 2FPKA 1S2MA 3UIEA 3AP2A 1G8HA 2ANCA 2G0NA 4URXR 3BD9A 3CRVA 2VEDA 4IXMA 1W44A 3BS4A 2GJ8A 4B2LA 2A7QA 4M9ZA 4RFSA 4WZAE 1DS6A 5FUWA 1SVOA 1B23P 3AB3A 5HE8A 4IOJA 2WWFA 2GXAA 2JAQA 2ZI9A 4DEYA 1NMYA 3G5UA 3K0FB 5CM8B 2W2VA 5FTJA 2VF7A 4HAVA 3AGPA 4F7WA 3LVQE 4HLUA 1N6NA 3WNDA 1U98A 1PLLA 4BLSA 5JHGB 1L7VC 5KDOA 4UNSA 5FPTA 2PLFA 3IQWA 2H8KA 4LUCA 3TR0A 4LJAA 1T8TA 3MWYW 3TK1A 1COWD 1XEFA 4US1R 5LB4A 1ODFA 2GVDC 4HDOB 4UKDA 2HCJB 2RB4A 1F2UA 1Z07A 1MV5A 1IXSB 5ANRB 4OQXA 2V9PA 1ZD9A 4EJSA 1H8ED 1W36B 1IHUA 2ZRBA 3BXZA 2GCOB 3N70A 1NBMA 4A0FA 5F3WB 5LDDC 3P27A 1NNEA 4URYR 3LLUA 2J46A 5CLLA 1NN0A 1L2TA 3U3RA 1N6LA 1NN5A 2QROA 2J3EA 2JLQA 3DPUA 3QPUA 1CR2A 1DELA 4ZI3A 2QTHA 4MRVA 4XVQA 1OE0A 4OHXA 2GK6A 4PHFA 2OT3B 4DZZA 1KO1A 1S1CA 1XDBA 5G40A 1Z6AA 1QHXA 1ZIPA 3LQQA 2FA9A 1HTWA 3I1FA 3IGFA 4CEHA 3DZ8A 3KL4A 1FOEB 3AVPA 4MKHA 1R8QA 1V43A 1XZQA 4UJ3A 2NZJA 1E1RA 2RGBA 3WP0A 5AJYA 2GHIA 4B74A 1UJ2A 4ZKEA 3WYAA 3QI2A 2B7BA 4DCNA 3T35A 1M34E 2R6DA 8OHMA 1R5BA 4K81B 1ZRHA 3RVBA 4IDOA 2GXQA 4HZIA 3KXIA 1UADA 1NP6A 4PC3A 5LB2A 1E9CA 1UEJA 1AKYA 4D4KA 1G3QA 1DARA 2O8CB 3GLIA 4DB2A 1E2GA 4L16A 3GJ6A 3CBQA 5JCPA 3RSOA 2I1QA 4NHOA 3PEWA 2Z83A 4F4CA 1BMFA 2Z4RA 1P2SA 2IYXA 4LHXA 3I8SA 4NONA 4Q7MB 1AQYA 2HT1A 2ZRIA 1D6JA 4X8HA 1FP7A 2QT0A 1JALA 1E79A 1YZGA 2HV8A 3R8CA 1SVWA 4PAMA 3RABA 3GLFE 1UBCA 2LKCA 3EIQA 4JLAA 3T1QA 4A6PA 4JLVA 4U7DA 2WJYA 2ZU6A 1WDTA 2V6JA 2QMEA 2BCJQ 2DYKA 1Z2CA 1AK2A 1GITA 3WMGA 2JLVA 4MA4A 1Q1EA 4JBWA 2JCSA 2QBYA 3WMEA 5IHPA 4BFYA 1CBUA 1E0AA 2OM2A 4NYJR 3AM1A 2DFNA 5JRJA 2ZEJA 2DFTA 4KITB 3TNFA 2YHSA 1KJZA 1DADA 3CRRA 4DLRA 3ZS9A 2FSIA 2L0XA 2NPFA 4G5GA 2UVQA 2GCNA 4UNPA 1XPRA 4PTLA 3K9NA 3IIKA 3A37A 4M1YA 3TIFA 3GJ8A 5K8IA 2QENA 2PZGA 3LRPA 2ZJBA 4DT1A 5IF9A 3V4RA 1MO6A 1J99A 1HE1C 1CU1A 1R0WA 1VKJA 4JL6A 1A82A 3QNUA 1ZU4A 4N0DA 4Q1BA 1X86B 3HYTA 2P5TB 5CJPA 4MH0R 1DAEA 2OBNA 2RHMA 3CONA 4WZBE 3IEUA 4V0OA 3UK6A 3LV8A 4NMMA 4TL8A 5FI0B 4ASUA 2YYZA 4YXWD 1UDWA 2GXSA 3QQ5A 1G21E 4K46A 3VR2A 5ELXA 2I4IA 4AG5A 2WWYA 4ZKDA 3U3JA 2D2EA 2DCUA 5EJEA 2BBWA 4IDQA 2GEDA 1ELOA 3SBEA 3ZYCA 4G1UC 1J8YF 2XSZD 4R2HA 4TMTA 3QENA 1AKEA 1I2MA 1ESMA 4BZQA 1R8SA 2A5YB 5AJVB 5JWOA 1R6BX 4DB4A 3KUDA 1M7BA 4MYUA 4Z1MA 2ZRMA 2JLWA 3LBNA 1OKKD 1AM4D 1KZ7B 2CLSA 3A1VA 4P4TA 4B76A 3WMFA 3B5JA 3DO6A 3NTUA 3SE0A 1RRCA 2WJGA 3GEIA 4QNRA 4M1TA 3BIFA 4UNQA 3QKUA 4OHWA 1Y3AA 2UZ3A 2WAXA 3OEHD 5FR1A 4DCTA 1LF5A 1FUUA 2DPXA 3ASYA 1F5NA 4DHEA 3WHLA 1UM8A 3AF4A 3OIVA 1OIWA 5AUOB 2QPTA 1G3IA 3FDIA 3CPEA 2MMGA 1Z47A 4IDNA 1N0UA 2IHBA 1E2EA 2W6JD 4KFSA 4OL0A 4ZI2A 4WA7A 4D80A 2V4ZA 1BS1A 1IY2A 4GOJA 3A4MA 4M4SA 4DLWA 1OW3B 2FG5A 4RVCA 3AVXA 2CJWA 4AY2A 4V02A 3HPRA 4ILEA 3HU2A 2VSOA 3VKGA 3VR3A 1IONA 4P4UA 3UG6A 4PC1A 1LFDB 1X8KA 1DTSA 1OIVA 4S35A 1R0YA 1IAQA 3GJ5A 3T34A 1Z6YA 3DKVA 2ZSBA 2A9KA 1JR3E 2QT1A 3GP8A 1GG2A 2DHRA 5FPHA 4TL6A 2KBFA 5DISB 2E1RA 2HYIC 3AKCA 2VPPA 4G3XA 1M2OB 3WXMA 1EX7A 1HEIA 2D2FA 2P3SA 2WZQA 1W36C 3LX8A 4OJQA 1XD9A 1K8RA 3M0EA 4V0LA 1ZU5A 4Q03A 1SXJA 3EZ6A 1KYIA 1OH5A 3B6EA 4NYMQ 521PA 1FNMA 3T61A 3QXCA 3GLHA 5KTYA 2XTZA 1E2KA 2QMUA 3GEHA 1PV4A 1IXZA 1PLJA 2XITA 4FINA 3MLEA 1F48A 5CLQA 3SYKA 1G5RA 3RLFA 4ESHA 1D9ZA 1HURA 1KMQA 4RZUA 1GKYA 3CH5A 4JZKA 1KI1A 1J8MF 2QGNA 2QM7A 2ZRKA 1OXXK 4B32A 3EW9A 3IKJA 5FBQB 4TZ0A 2ZM5A 5JWHA 1GUAA 4Q02A 1D2NA 5EXTA 3DZDA 2CK3A 4Q4AB 2VP6A 3A1WA 2W6IA 1NVVQ 2GJSA 3B1YA 2XTMA 3OAAD 4I81A 1OXSC 4Q7KA 1ZNXA 1FMJA 4CZ2A 2QP3A 3NBZC 4TQUS 2XAUA 3LW8A 2R6CA 1Q12A 2QTFA 4Q9KA 1DG1G 1G17A 1TQ2A 2DB3A 5J4KA 5B30A 5DN6A 2FU5C 4QGFA 4U5XA 2CL0X 1X3SA 2V7QD 3T1VA 2KBEA 3P26A 2JLRA 2VHUA 4W5HA 2NO9A 3OEED 4M1SA 2J45A 1GTVA 2VA8A 5DNYB 4PQYA 4NYIR 4QG7A 5FUXA 3ZIAA 5CK5A 3NC0C 2REBA 4J0QA 3JVVA 5AJWA 1U8ZA 4LJYA 4C0BA 3V00A 5FL7D 5JSZB 4XWAA 4D4JA 2R65A 4ZDWA 2DWQA 1Z0KA 2JJ1D 1A7JA 3EAQA 4JLPA 3EASA 4ESVA 1BYIA 3U7EB 5J4YA 3V9PA 3RS7A 4EPXA 3TMKA 3MGCA 1NF3A 2RMKA 2RHDA 2WVJA 1E2PA 5JI3E 2XZOA 1YR8A 4QKQA 2Z4SA 3HYRA 4EAQA 3U6BA 2O8BA 3H1TA 3TUJC 5F98A 5G53C 1U2RA 4JVSB 2R44A 2P6UA 1OH6A 4ZV4A 2J0QA 5J40A 3DKPA 2ZPTX 4DSOA 1OFUX 1SGWA 1W0KA 2FN4A 3Q5DA 1RYHA 2E87A 3HWSA 1UKYA 1ZCAA 1P61B 1JEEA 2QMHA 1D2MA 2J7KA 4KU4A 3MWJA 3PUXA 1AS0A 4LC0A 3NBFA 3TW8B 3FPAA 1CS4C 1WCV1 4DXAA 2IWHA 4FMDB 4IRUB 1BIFA 2IF2A 3NC1C 1XD2B 2AFHE 3MFYA 1IN4A 3RS0A 1QRAA 5JEDA 1P72A 3IIJA 1JQJC 4JYBA 1P2UA 2NZ8A 3QKSB 4LOAA 5EZ5A 2CDNA 4Q1DA 3F8TA 1JR3D 5BN5A 4MUAA 3ZVMA 5EXPA 5JJLA 4H1UA 1I2DA 4XJXA 2AWOA 5EE3A 1VCOA 4RY2A 4MKFA 5KUTA 3QF4A 1NMZA 5AUNB 1ONBA 1Z0IA 3WBJA 5J4VA 3IEVA 1Z0FA 1SXJB 2DBYA 1W36D 4RZ3A 2Z0MA 5SZJA 5UKDA 1NBME 1XEWX 1XB2A 2Z43A 3GLHB 4LJ5A 5CIQA 4URUR 4DUGA 4E03A 1XEXB 4TTRA 2WTUA 2LKDA 4PQFA 4MYTA 2NO6A 1Q21A 1JXOA 4JLKA 1AS3A 4NCNA 1E2JA 5FOVA 5C4GB 2QQEA 3RDPA 2BKUA 2DWOA 2FZ4A 4OHYA 2IWRA 1RKBA 4DEXA 5FH9A 1E98A 4EKDA 4WIAA 1I4TD 1E9AA 3E1SA 2C8VA 4EUNA 1E0JA 3DM5A 3TRFA 2ZJAA 4UNNA 5IK2D 2GWHA 1ZD1A 2BBOA 2ZRDA 1XJQA 1KOFA 2R2AA 2VSXA 2I1VB 3C15C 3FYHA 3KJGA 3U4QB 3CX8A 4XWKA 1OFIA 1GRRA 2QP9X 3CIOA 4HATA 3EC1A 3L0SA 1IXRC 3VR6A 3CF2A 1II9A 2BEJA 1TNDA 2CHGA 4CRWB 4TMVA 3QEJA 3I73A 3D7MA 3UXMA 2QY9A 1GRNA 1U0HC 2C9OA 5EP2A 2X77A 4A8JC 5JWRA 5CK4A 4GBMA 4ARZB 3U5ZB 2E9SA 1FP6A 4G01B 2FMXA 4UXHA 1Z3IX 1KK3A 1PUJA 2JJ8A 3H2YA 2DY1A 5LD2C 3AP1A 3RC8A 3B85A 5BQ5A 4UJ5A 4BFTA 4RD0A 5H8WA 1E9BA 1GAJA 1Z08A 3LY5A 4NCJA 5AR1A 2ZS7A 4M9QA 2JDIA 4QXAA 1Q1QA 1ZINA 2WBLC 3O47A 1HY3A 1CJTC 1VG8A 4POAA 5GVSA 5L3QA 1GKIA 4A2WA 3FKQA 4B3CA 3AVQA 4B3FX 2NG1A 1IN7A 2QAGC 3NIBA 5C2JB 1LS1A 4RD4A 4LYHA 4IDHA 4TMKA 5FL7A 1MT0A 4A9AA 1U94A 4XTRA 2V1UA 1NRJB 4OQMA 3TBKA 3U3OA 2W0MA 2H5EA 3LQRA 4MKIA 2G88A 5GJVC 1NY5A 2TMKA 5JZVA 1E9DA 1Q22A 2QAJA 3K0AB 2YV5A 1FZQA 5EZ6B 3FHTA 1TTTA 1SVLA 1G8GA 3TSZA 4GMXA 2CLDX 4QBHA 3OIWA 1P2TA 3CNOA 1A2KC 3PUVA 1H8HD 1DPFA 1YE8A 2WSMA 3SEAA 1G4UR 4D4MA 4A2QA 2GRJA 2F6RA 3LA6A 3OHMA 2IYYA 2EFHB 5TY0A 2WWXA 3CX6A 2BCGY 4WAUA 5JS7A 2WJJA 1XMSA 2OE2A 2JEOA 2A5DA 1JXMA 2PBRA 4TWZA 1DE0A 4Z8YA 1GDDA 3RS5A 3U3KA 2NGRA 3VR4A 1CJUC 2ZIAA 2AKYA 5CJ2A 3D3QA 5KNBA 4G5QA 1ZCBA 4N1AA 4RZXA 1HQCA 2VHCA 4IFEA 4DWJA 3P20A 4ZCIA 5GADl 3OZXA 3A6PC 1NJFA 4RSGA 1XRJA 3C8UA 1OYWA 2AXNA 3AGQA 3PQCA 2PCLA 4M1WA 2O8DB 2F43A 1GP2A 3KQLA 4ACBA 1ZM7A 2WWHA 1VCMA 2YWEA 3MWKA 5DI3A 4ACAA 4D2IA 4CEJA 2ZITA 1XCMA 5AK0A 1ZYUA 1R0ZA 2D7CA 3REFA 1CR1A 4B3DA 4YC7A 2OBLA 3KB1A 1Z22A 2EWWA 3ZGXA 2FPMA 1A4RA 4EQ6B 4OBEA 1JAHA 2BJVA 4P32A 4Q4JA 1M6NA 2AL7A 3W34A 2O8FB 1JB1A 1JNYA 1S1MA 4KAXA 1MRSA 4PXAA 3SJCA 3ADKA 1G3UA 1C4OA 1DEKA 1F2TB 1E2LA 1KK0A 1S9DA 1ZP6A 1SVMA 3OE7A 2JLZA 2GF0A 2X8AA 4RCYA 3NH6A 1RJ9B 1Q1BA 3BB3A 1D2EA 1PUIA 4RFVA 4Q01A 1FPMA 2IEYA 4URWR 4P33A 1XMJA 2QEQA 3PR1A 4IFBA 3RS2A 1T3LA 2PX3A 2WOJA 5AUPB 3L8YA 3KTAA 4K8OA 1E1QD 4EPRA 2KJQA 1P5ZB 5JCZA 4M22A 3A4NA 1RIFA 3BJIC 3W5IA 5JLJA 3K70B 3ICEA 5JJKA 1XFAA 3W5JA 4PPFA 2GBLC 4OQFA 3BAFA 4W9MC 1E4VA 1CP2A 3IO5A 2G77B 4KFUA 3GJ7A 3VU9A 1UKVY 2C95A 1MRNA 4HSEA 4D0NA 4TYYA 1KSHA 4W7SA 2XB4A 1GL6A 3AKDA 1FQKA 5BW8A 1G8YA 1W0JD 1G7SA 2PLRA 1NKSA 3RRZA 2IS2A 1YU9A 4LV5B 2VHJA 1LV7A 1PLKA 1YRBA 3LXXA 3MRSA 1E2MA 5L3QB 2OAQ1 3AEZA 4LI0A 5KSOA 2FFHA 1DAHA 1N5LA 4MGKR 4TL9A 3CZPA 1AGRA 4BLQA 4JKIA 1KSJA 4BFXA 1OSNA 4Q4HA 4A4DA 4LJ9A 4A36A 3EA0A 2CL6X 1ETUA 1GFIA 1XXHA 4ZCMA 4QFMA 5D3MA 4B3GA 3Q7PA 4F93B 2NPIA 2YZ2A 1LF0A 3K09C 1KI6B 2CMKA 1Q44A 3VAAA 2J59A 1QHHA 5GJBA 3VMFA 3PXGA 1XJ0A 2FX3A 4KBGA 4G5OA 4URVR 2J0UB 1KO8A 1XWIA 4LRWA 4V0KA 5KSPA 4A0GA 4EDHA 2J87A 1SXJE 1RYFA 2B21A 2XTNA 4LV6A 4V0NA 4EFMA 2W0SA 3GLHE 3HU3A 1QBKC 4NCKA 4RD1A 1G9XA 2DWPA 1NLFA 4Q9JA 3BH6A 3VX4A 2IC5A 5DH9A 5FOUA 1FX0B 2YJTD 4RJLA 2FEOA 5DLQC 1N6PA 3T15A 4ZDJA 2VP4A 3BB4A 4JBYA 3BK7A 2OFOA 4UXIA 3T1TA 3THOA 3OIYA 2MSCB 2B92A 2OAP1 3SJZA 1OT3A 1ZW6A 2V3CC 2FSHA 5E7JA 1AA9A 1ZUHA 1YZUA 1TUIA 3TQFA 3PV0A 2VHTA 2WMOB 5JS8A 1ZNZA 4LK2A 5KO2A 3BOSA 4ZIRA 5CDFE 4M1MA 4MDEA 3GJXC 1RRPA 2VL7A 2GNOA 2XX3A 2O8EB 2J0VA 2QU8A 1VHTA 4LHYA 4DLTA 1R4AA 4QM6A 2QNRA 1JAIA 1A2BA 2ZI4A 4ZCLA 3I5YA 1NSFA 4P4SB 3VHLB 4QL3A 3ZJYA 4CDGA 4GDFA 3PEYA 1Z6XA 5FUVA 2EWVA 3QG1A 3TH5A 1AN0A 2ZI7A 4MYHA 1YZLA 3TUIC 1Q0UA 1HV8A 4QBGB 1J70A 1QHSA 4XWOA 3EARA 1IOZA 3B1ZA 2P65A 3Q85A 2PEZA 3R9IA 1U81A 3TSOA 2ZUDA 5EUQB 4TT3A 2F3RA 4G5RA 4MKGA 4QNMA 4QGGA 4BFZA 1UBEA 2Z5FA 3ZH9B 1QHNA 3WNBA 1KAOA 2G83A 3NDBB 5F2EA 3QVVA 2GTPA 3GFOA 3TR5A 4KFRA 4MRNA 2GETA 2N42A 5FTKA 1WF3A 2RGNC 4EFLA 1HA3A 3TE6A 5FPYA 4KHZA 1N6IA 3GD7A 1R10A 3DVLA 4Q7JB 4C0JA 4DSUA 4IOMA 4Q48A 4XD7D 1YR6A 5A0FA 4EPVA 1BO6A 5BWMA 3O8RA 4LHVA 5F9HA 4TYWA 3DEFA 2BV3A 5C1BA 1IN6A 4MDFA 2QSZA 1X1RA 4I1SA 2V55B 4A8JA 2VF8A 3A58B 1NVXQ 2ZAOA 5HKKA 5H1YA 3DDCA 3THXA 2ZS9A 4QHSA 2H92A 3GQBA 4KLNA 4V03A 1ZJ6A 3BH0A 2REOA 1YZKA 2PMDA 2ZANA 1R5OA 5GJCA 3I92A 1XXHB 1KO7A 2WPDA 1S8FA 1TADA 2XOKD 3THYA 4CEIA 4P3YA 4PO9A 1MH1A 3ZQJA 4HAWA 2P67A 4RFSB 2WOOA 3TVTA 3THWA 1Z0DA 3FE2A 1Z6GA 2IBMA 2QAGA 3B13B 4PHGA 4QOSA 4TLDA 2IUSA 5FTNA 3VKHA 3FKSD 4PSKA 1XF9A 3SBDA 1US8A 1RE0A 4LSGA 5C4MA 3BRWD 3L2OB 4FWTA 1N6HA 4NP6A 3VTKA 3JZAA 1LW7A 1F2UB 4AIIA 3FGNA 3BC1A 4HAYA 1NVVR 3MJHA 4DSNA 3LFUA 4PQRA 4EJSB 2FFAA 4M0LA 4QJ5A 1G1MA 1EK0A 5B57C 4G5SA 4HB4A 1N6OA 4B33A 621PA 1COWA 2NO0A 3HPQA 1X6VA 4D6PA 2PJZA 4JT2A 1KDOA 3CRMA 1AZTA 1MO4A 1XTRA 1CJMA 3EZ7A 1G18A 1WQ1R 2ZRFA 1QVAA 1MKYA 1XTIA 1H8EA 4TSFD 1TF7A 2O0HA 3AKEA 2HCBA 5HPYB 4EFNA 2D4HA 2IYVA 1SKYE 2ZYVX 4YONB 1SKQA 1KDRA 4I1OA 4D82A 2GZDA 4LHWA 4LJ8A 1NG9A 2A5GA 3CX7A 5BN3A 4BRUA 4WXPA 4JVMA 3O8DA 4Q66C 221PA 4HDQB 3H0KA 2A5JA 2F55A 1N5JA 2NTYC 4C2TA 1KK1A 3K0CC 1N0VC 3ADBA 1E32A 4GOKA 4CEHB 4IDPA 5DIFA 1Z0AA 3L8ZA 5AUQA 1B0UA 1EX6A 2QUZA 4YDSA 3ZS8A 2EFDB 3CPHA 2WIBA 1TQDA 4PZYA 4IEEA 1CLUA 2AD5A 2F9MA 1MO3A 3PFIA 2JLXA 5HZHA 2IUTA 2AX4A 2G3YA 3QKRA 5SZIA 2ZJZA 2CL7X 2YNMA 1WP9A 2ZRGA 4GT1A 1M1YE 3KJIA 3SJAA 4ZDIA 2WWGA 3CWZA 2ANBA 1ZIOA 3W90A 3GLIB 4Q18A 2W83A 3HR7A 1W5SA 4JLDA 1U8YA 2GJKA 4YDHB 3SS8A 3JZMA 3AVYA 2C96A 3B82A 3RRYA 2K5UA 1NJGA 3LBHA 3L0OA 2FDCA 3IILA 1RFLA 2BOVA 2XNSA 1G20E 4DVGA 4FIDA 4G0NA 2YWFA 1N6RA 3PEVA 2MSEB 4E09A 4HLQB 1LY1A 4OI1A 4FI3C 1XTKA 4N0EA 2WWIA 4KSBA 5DO9A 3CWQA 4FD2A 3VQTA 2R62A 3D6TB 4D81A 3G0HA 1E2DA 2C78A 4JVNA 2EW1A 3C41J 1LNZA 4ZO4A 2VP0A 4AD8A 3L82B 2Q21A 2B8TA 1TF5A 2QBYB 2PCJA 3A4LA 3DL0A 1NLZA 1QHGA 2EQBA 3WYFA 4D26A 3FMIA 2Q3MA 5FBRB 1DG3A 1RRFA 1CULC 3GFTA 1VPLA 2BM0A 2ZYWX 1CJVC 1US8B 4JL8A 2QG6A 2IYTA 3MUFA 4GFDA 3UG7A 3EWAA 3U44A 2OUKA 4QGAA 1KAGA 4WXRA 5CITA 4US2R 4LYAA 3O8CA 4DT1B 2ZREA 4OQNA 3NVAA 3IPYA 1GNPA 4L15A 3NXSA 4YQFA 4C3ZA 4V0MA 4MRPA 3R20A 4TLCA 4IJMA 1X1SA 5DI9A 5E95A 2ZI5A 1G5PA 4CYMA 1VCNA 4O3MA 4FWIB 2IL1A 5C18A 4NYJQ 4P0TA 1G3MA 2CBZA 4URZR 1PZNA 2EU8A 1ZM3A 2QM8A 2FE4A 2PJRA 4QM7A 1QHYA 1CTQA 4E22A 4BFWA 3QE0A 3I61A 2AD1A 4KLZA 2GZAA 1DO0A 2ZSFA 4OI0A 4JS0A 1UPTA 2YC4C 3LWNA 3BORA 4GP6A 2G1KA 3CPJB 2PZEA 3RAPR 3U7FB 1TL7C 2OHFA 1W2GA 4YMVA 4OK5A 3RS4A 2RKOA 1YVDA 1FFHA 5FOWA 2V8OA 3NKVA 4TTQA 3BB1A 3W6NA 4MGIR 1P75A 3A1SA 3GJ4A 4HDCA 4R7ZA 2WWWA 4WOPA 2CCGA 4YXWA 3SHFA 4AK9A 2GF9A 4DLVA 4NPHA 2GDJA 2OFWA 1QDEA 2KSQA 1KK2A 2GESA 4HUQA 2EFGA 3R7WA 1E2QA 3K70D 4EIWA 3K0SA 1HT2E 4RKFA 4BLRA 3CKLA 1Z29A 1SULA 1EG7A 1G6OA 4IVRA 2FNAA 4KCGA 3S1AA 1CRQA 5DYIA 2WSSD 4PPGA 5LBIA 1LB1B 2ZVPX 3T06B 1EWRA 2AXPA 2XSZA 3EZFA 5KYKA 3ZZTA 3SR0A 3IUYA 3ZZ0A 2ZR9A 1HE8B 2ZJYA 5EE1A 5B64A 4KYUA 4C30A 2BHRA 3PJRA 1F60A 3X1DA 1P9NA 1H65A 3RSLA 1CIPA 1OKKA 4A92A 3EA5A 1YZNA 1T4GA 2QE7D 2V54A 2ONJA 4FMCF 3ECCA 2X1VA 2Q0HA 2XGJA 3LNCA 3KKMA 2HLDD 3C4JA 1QG2A 3E5HA 421PA 5KNCA 4B2IA 4FCTA 1X8LA 2FGKA 2F1JA 1XXHE 1GL7A 3DOFA 3OEHA 4ABYA 3RRMA 4Q1FA 1VCIA 2AK3A 5EXSA 4A0RA 2BM1A 3QBVA 5B58C 4QHYA 2CJWB 1TQ4A 1N0WA 4HB2A 3FHCB 2IF0A 2ZRJA 2XNDD 3W3AA 4TQ9A 1OPXA 4HLUC 2W6JA 1NSTA 2ZVQX 2WMNB 3ZLJA 4C7OA 2NIPA 3D31A 2QMOA 4A0HA 4D25A 2A2ZA 1GRQA 1JJVA 2VBCA 1YRAA 4R98A 3ADDA 2D62A 1IY1A 1E6CA 3UKDA 3GLFA 1R2QA 1UBGA 5JEEA 2ZE5A 4HYYA 4TMZA 1KKMA 2WAYA 1EGAA 4S2EA 4KJZA 2CNWD 2IHYA 3UATA 1WA5A 2X2FA 1KI8A 2O0KA 2ZAMA 1XTJA 3Q7QA 3Q5EA 2F7SA 3VX3A 4TMXA 2ZU0C 3QXJA 1YQTA 4AC9A 2PT5A 4PSAA 2J7PD 4O0MA 1EFRD 2J0SA 1Q1ZA 3I3SR 3K8YA 3T5DA 3ZVRA 1D5CA 4GOXA 3W6OA 3K0EA 1E9FA 4LZZA 2ZYTX 3SFVA 4JLMA 3FOZA 4NE2A 3KX2A 1II8A 2MSDB 1T9HA 3F5FA 1QHIA 3P4XA 1XX6A 2IT1A 4XTCS 3I8XA 1UEIA 4YMSA 2SHKA 1Y63A 3OFND 4HZUA 2C77A 4B44A 1NMXA 2H17A 4GPTA 3C16C 3AVOA 3SYNA 3OESA 3OF5A 2IYLD 3H86A 4HEJA 4HLCA 5L3SA 3AVTA 4FMCB 821PA 4B34A 1E2IA 4JL5A 4RD3A 4DBLC 2IUUA 2H1LA 3OAAA 1XJCA 4DJTA 4L4UA 1JQLB 4MITA 3ONWA 2A5FA 1SHZA 3TUZC 2IS1A 2ZXUA 4AKHA 5FBVB 4OHVA 1MABA 1C9KA 5EP1A 1JPNA 3IDQA 2FSGA 4HI0E 3R7WB 3Q9LA 1RRGA 4AKIA 2V7QA 3EIEA 1IM2A 2RH5A 1KKLA 4C0KA 3GLIE 4Q9LA 2A78A 1IJEA 2ZI6A 3OEEA 2ODBA 4AYTA 3IO3A 4DC9A 4US0R 3R8FA 3ZQ6A 4KBFA 1DOAA 3AQ4A 1VDZA 4PANA 3F0TA 1BH2A 3UWKA 1ZC4A 2VRWA 4LYFA 2IYSA 2BMJA 2JJ2D 2BJWA 3GFPA 1M7HA 2JIZD 3CB4A 1HT1E 2O8BB 2WIAA 3K0CA 1M74A 2JJ1A 3I5XA 2QORA 2UKDA 2GK7A 3V4FA 4NYIQ 4TMWA 2WV9A 3M4YA 1XBTA 2ASEA 3GCGA 1OHHD 1NG1A 2XB2A 3I32A 3SYLA 4O2RA 1CF4A 3AV0B 1KGDA 2OCYC 4BEJA 5E7MA 1P73A 3AUXA 4Z8XA 2A3RA 3QF7A 4OJKA 5SZHB 3WBKA 1W4RA 3ND8A 1GNRA 3UANA 1Z06A 2GZHA 3KKOA 4B3XA 3ADCA 2YC2C 1Z63A 2ZYUX 1T3SA 4PX9A 1ZVQA 4GL2A 3T5GA 2HJVA 1MR3F 1P6XA 1ZBDA 2BMDA 2JATA 1GIAA 2IEZA 3J81k 1EXMA 3WRYC 2BMEA 4GSYA 1G64A 3VNUA 2F3TA 5B2ZA 4Y0AA 1JECA 3K0FA 5JI2E 4PC2A 3K1JA 2AKAB 4AURA 1KDTA 2ZE6A 3QOFA 3QF4B 3DOEA 1QZXA 5JMTA 4DDWA 2F1IA 2PZFA 2ZJ8A 2A30A 4HAZA 1R5NA 2PH1A 2C03A 1JR3A 1N3BA 1LVGA 5KHOC 4NTZA 1NBMD 5JFGA 3EPJA 5M04A 1E96A 3CNLA 4L9SA 4Q1EA 1JEDA 2CXXA 3TW4A 3DMDA 3C5HA 5JHHB 1TPZA 1UDXA 1TU3A 3AVUA 3K53A 2R6FA 2QPAA 2R8RA 2W58A 2GCOA 3P4YA 3KXKA 1E9RA 2C9YA 1VTKA 3B1VA 2D06A 4OK3A 4LDJA 4UXJA 4WZ6A 4Q9IA 1T5LA 2OCBA 2RGCA 1OH7A 1G7RA 2IXEA 3BFKA 3PUZA 2XZLA 2HT6A 5G3ZA 4DCUA 3TGPA 3K9LA 1K5GA 4M8NE 1DVRA 4GP7A 5L3SB 4DLUA 4AYXA 1DAKA 2QPOA 3R9XA 1SKYB 2H57A 3BWDD 3TAHA 2O5VA 2PEYA 4MGYR 2YOFA 5IK2A 3NHBA 4EPWA 4Y0VA 3OFNA 3R9WA 3P32A 2OO7A 1YHNA 4M53A 4EPYA 4B35A 3RS3A 1E1RD 4DRZA 5J4HA 2IXFA 2IK8A 4B6EA 3KKPA 2JLYA 4TLEA 4XVUA 2IYRA 3KFXA 5AJXA 3GLGA 1MABB 4TYQA 2HYDA 4DLZA 2D74A 5JRZA 1OH8A 4LJ6A 2GCPA 4N3NA 3M6AA 3LBIA 3LO5A 4QJ4A 4RKEA 4LBWA 3EWSA 5FI1B 1Z6TA 3P1JA 5FBLB 1Q57A 5F9FA 4PPNA 4BZPA 4ITRC 1G16A 3QXHA 1CR0A 1G3RA 2BWJA 2ERXA 1BMFD 2HF8A 4AG6A 3CNNA 4LHZA 1T0HB 3WHKA 1MOZA 3ZVNA 4R71A 1KJWA 1D9XA 2O8CA 5HCNA 1E79D 4OI2A 2CE7A 2DR3A 1SVKA 2JLSA 3KQUA 1O87A 1ZMXA 4OKSA 3Q8XB 4GZMA 1EFUA 4MQBA 4W5JA 1ZUIA 2W2TA 5TVKA 1AJEA 3BGWA 3N5CA 3KFVA 3CRW1 4A15A 2BBTA 2D7DA 3E2IA 4IVPA 3SN6A 2NOAA 3AH8A 1SXJC 2B7CA 5E4FA 3KJHA 4NH0A 5GJWC 2HEIA 5LPNA 2FJUA 2GXUA 2VP5A 4DCVA 3VKWA 2BEKA 3G82C 1AQUA 1KY3A 3SQXA 1H8HA 4GI7A 5TMPA 2Q3HA 1A5TA 3DMNA 4L8GA 2D3WA 1KHTA 1W46A 1L4UA 2O0JA 4ZPXA 4B6FA 4X8MA 2YINC 2R6AA 4NZYA 1XTSA 3CR7A 1UAAA 3EG5A 1J90A 2J9RA 4ERNA 4V0ME 3KJEA 4BLPA 4CIDA 4M9XA 1OB2A 2F43B 1GKUB 3X2SA 1E2FA 5DI3B 1NI3A 2P0EA 4TYNA 4CEJB 4TQAA
chains in the Genus database with same CATH superfamily
3PJEA 9GPBA 3ONNA 3NBYC 3G2QA 4ZEVA 1EVLA 4M0KA 4HDSB 4HRYA 4MMXB 5AOAA 4EMBA 1R9NA 2PGJA 5EGSA 4MW2A 1Z34A 3D3KA 3X1XA 4I3HA 4MJXA 1U1GA 5EA2A 5IT5A 4CEIA 4IFTA 2O50A 3B51X 4BWYA 3D5TA 1NXQA 3ZDFA 1AF4A 3WQHA 1MQ8B 3NH9A 4CF7A 3VR2D 2VK4A 3O3MB 5A7GA 4OQPA 2FZEA 2Z08A 5J3JA 4EY4A 2ILTA 3RBVA 2M9MA 3ZJUA 1J7JA 3KQOA 2XWQA 4O29A 3E03A 3RWOA 5DX8A 4C7MA 5EMMA 1FIUA 3ROMA 2GJAA 4P0QB 1VMKA 1VL5A 4ZT4A 2Q6TA 4PFSA 5DPMA 1TM5E 1ZUNB 1NU6A 3B48A 2MMCA 4L7QA 2OCAA 3IPRA 3MD0A 4JWKA 3TQCA 5BOVA 3ICCA 3CW9A 3DMTA 4LBVA 3OZDA 1JMKC 1PGNA 2GN2A 4OCZA 1Z62A 5HZKA 3IMCA 4HQFA 1ZI8A 5JUWA 2PRSA 2I4LA 3G9TA 5BSMA 2WA1A 4B7XA 4D8TA 4DARA 4TZ6A 4EW1A 4YCAA 1WDLA 3PR2B 1QZ3A 3QUSA 4GPIB 3F5QA 1EJ0A 4KQGA 1FNSA 3KT3A 3PR3A 1R64A 2X13A 3MPUA 4AN4A 3J7TA 2ZROA 4EL5A 4AJ4A 4JMPA 3NGLA 3EFOA 3FBWA 1A1SA 1E1QA 3ZGZA 1TMGE 2JIDA 2A9QA 2V0CA 3AP3A 1C30A 3DE6X 3EUFA 1CRLA 3AFIA 2C9DA 4GYJA 4BGDA 5LMNB 2FUCA 1TOAA 1VJ0A 4F7DA 1O97D 4LRTB 4AKEA 1A1VA 2VZLA 2ZBEA 4GHWA 3TG8A 5BSEA 2G6TA 3MCTA 4OYHA 2FEAA 1T8UA 4X20B 3TVDA 3PQ6A 3F6YA 2UU9B 4BVEA 4XWGA 3NNSA 1C5KA 4N03A 1VKNA 2IYUA 1YJ5A 3ABIA 4TMFA 2C04A 2CGEA 3T1OA 5B6IA 4NS4A 1YB4A 2IW1A 2CLCX 4HUTA 1X1QA 5SYAA 5JJIA 5DRTA 1KBOA 3BE4A 3O4HA 2IS4A 1DUSA 4Q4LA 3NAGA 2UZ1A 2CHFA 2RGEA 1K3UB 4CPDA 1CIJA 3RCBA 3Q10A 4G1EB 4WK6A 3P9RA 5AKEA 4JSTA 4LIPD 5GQSA 4C7BA 3WMRA 3M6LA 4NYMR 4ZEWA 2OHVA 2NUTB 3CEPB 1PR9A 4EA7A 5IH7A 1LNQA 1JEJA 1TQ6A 3ZXUB 4LTMA 4J0JA 4MYDA 4PLWA 4N3AA 1XZLA 3W8RA 3KCNA 3Q7IA 2IZ1A 4K9PA 4RVOA 4CLEA 5T41A 2C1EA 1WB6A 3LY9A 4FJ2A 4I9NA 4LE2A 4MIYA 2VJKA 4NAHA 1VYTA 4J4TA 4JITA 1DQRA 4ZVMA 2VTBB 5AM0A 1HEYA 3LLSA 2VYND 4A5SA 8GPBA 4G0ZA 1VG0B 3HA7A 1RS0A 2PBLA 1IM8A 1FTWA 1M2OA 1W48A 4IXWA 5HKAA 5KSYA 5L3VA 4NPCA 1NAHA 1XDWA 2Y9MB 2WKQA 4TYMA 1U9IC 3EMBA 5TS3A 5TDHA 2O19A 3PICA 1NIPA 1QGAA 1SIWA 2OO3A 3EXEB 2BEUB 1FMFA 1LPPA 3Q6MA 1UAGA 2VRNA 2VUTA 4LXXA 2JFZA 1Y6FA 5D3QA 2HKIA 2GH1A 2ZDQA 3QHQA 4LGYA 5CIWA 3ZJ5A 3B2EA 3B9PA 2FSPA 2YJ4A 4IHJA 4QELA 2P9ZA 1FUEA 1NP3A 2CK3D 3R7DA 4ZIRB 3M9XA 1IN8A 3KQMA 4IMPA 2GILA 4UM7A 5DWQA 2MOKA 2EV9A 2RJ3A 2ZBRA 1EDBA 2NU8B 4IKEA 1HMYA 2JKYA 4RPIA 3IPLA 4IDFA 5KU1A 6Q21A 2IYQA 4OK6A 4RD2A 2PD6A 2P4UA 5CYOA 2FB9A 1FXWA 3AXSA 4MHSA 2W6QA 1S7CA 2HAEA 4OM7A 4AZ0B 1L5RA 1N1GA 1JIXA 2PV7A 4CUJA 1ESCA 2J09A 4GZ5A 1Q77A 3WWDA 1I2ZA 3BJRA 5CB8A 2ECPA 3D7KA 5TARA 1P9WA 4F4JA 4ILKA 4C0XA 1E89A 1USKA 4PZZA 3TPZA 4BYGA 1EE1A 3U26A 3TOSA 4DMUB 4Q1AA 1GNTA 3FYUC 3GT7A 3IA7A 1K08A 1JHQA 4E46A 3VJRA 3QVSA 1MMFB 2A0XA 4BMCA 2VT7A 3Q3JB 3OIUA 1KEKA 1H93A 2V1XA 3PTLA 3F3MA 2Q6IA 1LQTA 2ISSD 1CJKC 3NHLA 2YRXA 3E48A 3A4IA 1FRZA 4R1OA 5TEVA 3EEIA 1N9GB 1NN1A 3DJFA 2YJZA 3B6JA 1ESEA 4FZ5A 2EF1A 1KI7A 3TZQA 5IXJA 1PNQA 2Q3BA 1BXGA 2XXAB 4H31A 5HRUA 3L1KA 3FPBA 4WK2B 5G3YA 5JSZA 1UBRS 1YS9A 3BCHA 4PCVA 3K15A 3DCJA 2AK2A 2NMVA 2HMSA 2AWNA 4BUJA 4GMKA 3DLHA 1J2JA 1O6CA 1NIJA 2XIJA 4AM8A 2G07A 3EXAA 3K5HA 1LBQA 1GCOA 3SR4A 5AVXA 1YDHA 2GN6A 3QU5A 5DX1A 4C05A 1FUKA 3V8EA 5TPZA 1Y34E 3QU7A 1IHYA 5BUSA 1V6SA 2EVWX 1WE2A 4X8OA 3NHKA 3FUUA 4E07A 7AT1A 5JXIA 1C3XA 2OLJA 3FWYA 3MTDA 3CUEF 2EQ5A 5C8YB 3THXB 1E2NA 1IDN1 2G63A 1W35A 2ATXA 3VHRA 2KE5A 4KW7A 5JFTA 2XT6A 5JADA 4I1UA 3HRHA 1LWOA 4EW3A 2DETA 3EUAA 2PKXA 3FRJA 4UCFA 4OHZA 2V7EA 4AKGA 3SM9A 2GMWA 1GL9B 3DM9B 1E1CB 5BYKA 4YJDA 2BZ0A 1XG5A 4WLVA 1LLDA 5JYDA 2UYHA 4IIJA 4YI5A 1AUOA 4BS9A 1J0DA 2Z57A 1L8XA 1JDTA 1T2AA 2C5FA 3U61B 3TLGA 5L3ZA 3TW8A 3UWOA 4E2XA 3SQMA 4D1YA 2G0AA 2OV2A 2C9CA 4OD0A 4DDMA 1YKFA 1XAIA 3U4CA 1WMDA 1ZOLA 4XQEA 4DGSA 4OXRA 1CWUA 2A94A 2A58A 2Y1KA 3N0TA 3ZWNA 4CKWB 1IRXA 3AETB 5AK6A 1WCYA 2ZQYA 1L7MA 2ZETA 3GA7A 3I58A 3EF3A 1USVA 4HKTA 2BFCA 3MJRA 3QKSA 3IP6A 2MINA 4KXUA 2V4UA 4JVLA 3OBBA 3S2IA 3N8NA 4LY6A 3M3DA 4REMA 1ESZA 3ZHTA 4PG7A 4Z9AA 4CVNA 2A92A 3QKTA 2I91A 3VYUB 3TF5A 3WNCA 2P91A 4HNGA 2QUBA 3FYCA 1D1QA 3FPJA 4B2PA 3BRWA 4C0AC 1V7QA 3ENWA 2R8XA 3FG9A 1XP8A 2SBTA 3SLRA 2W6OA 2W11A 5CT6A 3OM9A 3U60B 2NO7A 4HN9A 4K9KA 3UMGA 4NL4H 1U9CA 1ZCJA 1KMHB 1N5KA 1IY0A 2R5NA 2YVKA 2HJWA 1V1MB 1DEHA 2FE1A 5K4HA 1C81A 1JDVA 4M8SA 3ZBQA 1UK9A 2AQKA 2I71A 3T52A 4NK4A 4I0WB 1JQDA 1QE5A 1TZ2A 2OP1A 2RAUA 3PEEA 4BBJA 4FQ8A 1NASA 5DGXA 2QL6A 4L78A 1GU7A 5CJJA 1QTNA 1AC5A 4IH1A 4Q47A 5CUQA 1UFKA 1M3SA 2PX6A 1KJYA 3HEMA 3HKDB 1L4GA 1RM3A 3FVWA 3NYIA 4OF4A 3AUKA 5CDFA 2BUCA 3S6JA 3UOAB 4NZZA 4P81A 5BN3B 4HVTA 2QDXA 4RUKA 1QIHA 4CL2A 2AI2A 2PD4A 4BKMA 3M7IA 3DEAA 1QWSA 3ZHUA 1O54A 1RP1A 2FFJA 4RPKA 3SMQA 2FJPA 4WXHA 5HCIA 3HCBA 1PHPA 4KSCA 1ZHHA 4P58A 1TYDE 2IYAA 3ELDA 3OCCA 4RDHA 2FPLA 3A6LA 4JI6B 3SC3A 3E5NA 3EZGA 4TVKA 4D3ZA 5I51A 2OLEA 1S8AA 1PVDA 2ZR0A 4BFVA 4CT5A 4MV7A 3W3AH 5DHFA 3SZUA 3N3AC 1VE1A 5LKAA 3FOFC 3OPVA 2C31A 1APBA 2BFEB 3AKYA 2HPAA 4XYMA 1TDJA 2A9OA 2I3BA 3IT1A 3LSYA 3R23A 2KB0A 5KTOA 1SQ6A 4ZDKA 2N1BA 5KOIA 2KW5A 3W1VA 4LISA 4N3BA 3KZ1E 4GE0A 5FOXA 1PYDA 5J5CA 3T7JA 3OLZA 1WBBA 1SQSA 1Z2AA 4JJEA 2GYYA 5JNVA 4KOAA 4NOLA 3AIIA 3H16A 2WIJA 4KLCA 1L1FA 4DNQA 1E4YA 1YKSA 3A1TA 5KJCA 2DKOA 3KQHA 2V0NA 4TN1A 4XVRA 2WM3A 4C6TA 2NYVA 2HDOA 1XD8A 2GYVA 2XMPA 3DYVA 1DSSG 2PH5A 4JJKA 4W99A 3A6JA 4QBIA 3L6RA 5K8UA 2C83A 2VO1A 3K31A 2PXHA 5FV7A 3BVPA 1T5IA 4WLNA 3ZLBA 4M7WA 1E3EA 4KR0A 4NU8X 2BD0A 1QH9A 3AVVA 1QGUB 3AILA 4OQZA 2X23A 4L5CA 4CMEC 3V48A 3A1UA 1U7ZA 2VDMB 3P0IA 1H05A 1SZPA 3BICA 2AH5A 3ZQKA 5E4TA 4NBNA 5AVKA 1PK8A 3QE4A 3ENVA 3KFLA 1FLNA 1OLSA 3C6KA 2OESA 4S2UA 5G41A 3SEFA 2C99A 2CLOB 2G6BA 1FP4B 3M34A 2W2KA 1XLWA 1RLUA 1SQ5A 1IUOA 2AHOA 4NBSA 3BMNB 3F6CA 1PU2A 3FMFA 3IV7A 3U2QA 1V5IA 4DCSA 5A9SB 3EPHA 1T4CA 3E84A 3QIAA 3MOSA 2M98A 1PNTA 1DMRA 4ZO6A 4D7AA 4LN1A 2ZJ5A 1TW2A 1G7TA 2B78A 4HCJA 3O94A 4WVFA 3PDIB 4YRJA 4EG5A 1WD7A 1MA3A 4DPMA 1EK5A 2HWXA 5K5EA 2F3UA 1DO2A 2FN8A 4XQ0A 1ADCA 1WRBA 1HETA 3GI1A 5K6TA 2BEWB 4YMHA 2XE4A 2Y1XA 3JWHA 3QFCA 5ALNA 2JAPA 1W87A 3UB2A 3VR1A 4TX1A 2ZWMA 3U44B 1YBAA 5P21A 3EQ6A 4Q9AA 2X4GA 2XMZA 1W2HA 3HCCA 4UW9A 1S6YA 3IQHX 1L4YA 3KU4A 5M34A 3P0FA 4RHEA 1WV0A 3P96A 2FOLA 4RZSA 4QYIB 2HK7A 2WAAA 1ZM4A 3C5CA 1T4MA 1EXVA 3VNAA 3CH4B 2P9HA 4ZEOA 2VPQA 5F4ZA 1U7XA 2GVZC 2QN6A 3K7EA 4IJWA 4N65A 2OZVA 3SLKA 4XASA 1M2HA 4WRRA 3TMYA 1D7AA 4B4OA 1DDOA 1M6HA 1DC7A 2JFXA 2XGMA 1I6LA 1YVEI 4I3FA 4J1TC 4JGGA 2Z56A 3AF3A 2YVUA 4E21A 3MIZA 1OBFO 3ZVLA 4RSHA 2FZLA 1MC5A 1Y3IA 5SICE 3HO8A 1RRVA 1GPYA 2ECKA 1NGSA 4EQ6A 4TVBA 2QKYA 1JUDA 2HK9A 4QOJA 3ZE0B 2LDXA 4G0PA 1KC3A 1SOVA 4YRDA 5K2MA 1ESNA 5HM6A 5JG7A 2ZSHA 4N0PA 4UE6A 1B6SA 4HVLA 2IYZA 2W2XA 4BQSA 1B7GO 1HNWB 1Q3HA 2FH5B 3HUDA 3QKIA 5KDLA 2IP4A 3ZNOA 1RJ9A 4BGEA 4FSXA 4EY5A 2X8WA 5AK3A 2RGRA 1QHEA 1Y4UA 2IHZA 3IQFA 1UF9A 3IL2A 3NHMA 2F9LA 3GGPA 1MV8A 2JIBA 1OREA 3Q72A 4KN5A 5EMNA 2RBEA 1M9NA 3VNVA 2C4HA 2WFLA 1ISMA 2ZWPA 1EWQA 5EYPB 1FYWA 3ZOZA 1Q20A 1PFGA 4NBKA 1NXPA 3OM8A 2WJIA 5GVSA 1YE3A 2FPUA 2WF8A 2HO4A 1JVBA 1UXIA 4ZOAA 4PHTA 1EUDB 3ZWDA 1Y5RA 1P1KA 2J3QA 2Q3FA 4FFPA 2QSUA 5DM0A 1TTHA 1CY4A 2I0FA 4Z86A 5D2CA 4A82A 3DOOA 4A23A 3RUEA 2IYWA 3OUUA 5FP0A 5EE0A 2PAFA 2GPJA 4JSYA 4R1UA 1NKTA 3RHFA 3TL2A 3MCVA 1QIMA 4BQNA 3K6RA 5J47A 4DV2B 4BPBA 1V48A 2VHEA 3M4XA 4GBED 4C04A 2FFQA 3KG2A 2CFOA 1NW3A 2FI1A 2ZVJA 4IS3A 4MV5A 2ACEA 1X80B 3HA5A 3PCXA 1E0DA 2ODPA 2HQ1A 1T8PA 5IUJC 3AVWA 1NFQA 4D0LB 3FMOB 3OPYI 4JEUA 4S1NA 4RIEA 4XUCA 5IAJA 1EFCA 4DSTA 5JATA 4UMFA 3H84A 2M6LA 2V74B 5HF9A 4NNJA 2ATVA 4BV8A 4F2WA 1U5BB 3TIXB 5DBFA 3E1KA 4DQXA 1G4HA 4KE6A 5GGXA 4WXMA 4A2PA 3QV1A 4ATNA 4R2KA 4F5YA 4A6XA 4C7OB 5HQJA 5FXMA 3IAFA 1RVV1 5AJZA 3B3GA 3CF6R 4RHTA 2DECA 2DVMA 4MKXA 2Q7OE 2O52A 5A9TA 4CL3A 3K8QA 1TM4E 4EZEA 1ATZA 1F51E 1P3Y1 2HNAA 5D86A 2P2NA 4DRXA 5AW1A 1E62A 5E9QA 1G20A 1DHTA 3DLBA 1HNZB 5HVNA 1JS1X 3HMQA 2J0UA 4RL6A 3RFFA 3F2IA 2ZE8A 4RZHA 4QPCA 5HUQA 4JDUA 4NDZA 4Y9DA 1J06A 4DKJA 2QGZA 4OSOA 3N8HA 4BO6A 2WWTA 4RY8A 4P3XA 3RU9A 3TCXB 3KAKA 4I8IA 1GGVA 1P3JA 3GBSA 4CCWA 2IEIA 2OBYA 3BTSA 5GAJA 2C2XA 4S05A 1SQ0A 1G8PA 2RGAA 3M1IA 5C5EA 3SVLA 3GBVA 2P2ZA 4PAGA 2J6CA 3F9CA 5DOZA 3ZU5A 2JI7A 5HXAA 1WXQA 1LPBB 1WBJB 2OK8A 5JLAA 1L4LA 3E3MA 1GN8A 3MIIA 4NBVA 2KLBA 2GGSA 3WO0A 4C07A 4FN5A 2YOGA 3I42A 5CA0A 4II2A 4PO3X 3UJDA 3QX8A 1EFRA 3VC2A 4ZYVA 4WOBA 1II8B 1KI3A 4L22A 3HYNA 1BVYF 1TQ8A 2C29D 2CCKA 2GM3A 3B7GA 4XDYA 2QW8A 5IU6A 4PPQA 3K96A 5I7HA 4LF8B 1I1NA 3GEEA 1L5OA 1WHSB 2IP2A 4F46A 2BP7B 3ZE7A 4NV3A 4QXQA 4WBSA 5KQPA 5EE9A 2OCLA 4QAQA 4RZ2A 2FZVA 3AUYA 2PYZA 3VOSA 1KRHA 4DV0B 1IN5A 2DHQA 5HBRA 1ZH6A 3K6KA 1GVNB 1N5MA 3U4AA 4ZQHA 1UWCA 3JAKA 3HXPA 3MAAC 4HH3C 4LJLA 2UUOA 4UUBA 5J2UB 4F96A 2EEPA 1KYYA 3SQXA 3HU1A 1G5TA 3WHPA 4FI3F 3QELA 3I83A 1FJGB 1DKLA 3DE5X 2XV1A 2PT7A 1QCZA 2JBWA 5AM2A 5CCXA 3HVJA 3I5UA 4ID3A 1KDPA 1M5TA 1H4SA 3QPWA 1PVOA 2DHDA 1SR8A 4F6RA 3DO8A 3FMPB 3GDWA 2KYRA 1R88A 4MIKA 1TXGA 1BCSB 1FS6A 1ZRMA 2HHCA 3AR7A 3HBJA 3WYEA 1LLUA 3OUTA 4JI8B 1IBLB 1O97C 1AS2A 4PYLA 1M66A 3N0WA 1CUFA 1FYDA 4HO1X 4ANFA 4ZZ2A 2FCAA 4AJPA 1ISPA 1YCFA 3OA2A 4LGCA 1ABFA 1TUEA 1XMIA 3KXLA 3LOUA 4FKBA 5TGTA 3IV9A 5K4GA 2ZI3A 3FZEA 4HD8A 2PTHA 2BGJA 3PHCA 2H1RA 4LGMA 3E7WA 4R81A 3OOWA 1AT1A 1GNVA 5AI8A 2FW6A 2I4OA 3RJZA 1SHKA 2O3TA 2QD1A 4B48A 1PS0A 4AF6A 3CVYA 3C24A 3U7QA 3AL3A 1AV7A 5CVEA 1BJTA 1KNXA 1S0UA 3ND6A 3G9UA 1IUNA 1UODA 2BRUA 2Q6KA 4QXMA 4ND5A 1EPUA 2WP0A 4JUDX 4ETWA 3VH1A 3C3BA 1GTSA 3GMIA 5HKKD 2HW8A 2WIGA 4R83A 3BH7A 4RVNA 2FG6C 3EXIA 1M7GA 1O95A 3DTYA 3SZ3A 3PC8A 2ZAGA 4MLDA 1TZJA 1TEVA 4ZYYA 4J4BA 3KWMA 1S3SA 1ND5A 3BWBA 1FSSA 4GIBA 4NWIA 1C3JA 1M8PA 2FEMA 4H7EA 1KO5A 2CL5A 3OY2A 2H1FA 1G8JA 2GAIA 3QJYA 1CUXA 4MWBA 4DXHA 1YZTA 1YZQA 4Z7QB 2IOFK 5FX2A 1RXCA 4QO7A 1QS0A 1OHHA 1OX4B 2JLCA 4Q9HA 2FPKA 1E66A 3C1UA 4P84A 1QONA 3WLIA 1YZVA 3TQOA 1GPMA 2F9FA 1G8HA 4GD3Q 5H3CA 1JKIA 1VHDA 1NRXA 2Q5FA 3DJYA 3CRVA 2VEDA 4C20A 3A6KA 5JNLA 5EZYF 3G0DA 3BS4A 1N2IA 1SQGA 1T36A 4JB0A 1R6TA 4O2BB 4HAOA 3K9QO 1DKOA 4IGIA 2EZ4A 4BHTA 1YR3A 3FZNA 4H2DA 1MIHA 3RK0A 4E4TA 1L7AA 4DEYA 5SYMA 5IEBA 4M8LA 4RQTA 2W2VA 2VF7A 2NVBA 3AGPA 1EHCA 3LVQE 3AT1A 4HLUA 1U98A 1YKGA 2R8YA 3WNDA 5DP2A 4ZHSA 1QRRA 5FPTA 1V3TA 4IUCS 4D5GA 3BGVA 3KTDA 3ABRB 4YP6A 4EJMA 3HCAA 4S0XA 1LFAA 3DZGA 3BJZA 4I9HA 5EWLA 1U1DA 2EW8A 3CE6A 5HJ7A 1JR2A 3LG2A 4RABA 4Y2QA 5LB4A 2RB4A 5ANRB 5FRDA 4A16A 4UOZA 4TUYF 1C8KA 3RGGA 2H2WA 1IHUA 5BXYA 4YA6A 2OD2A 3E0XA 3ZK7A 1O89A 4KWHA 1D0VA 1KVRA 4IGEA 5F3WB 5DOVA 5LDDC 2X22A 3T1NA 3MWEB 1P91A 1F6DA 2XXBA 3NHSA 4NU5A 4WXYB 1L8OA 1MVNA 4URYR 4KP7A 3GDOA 5ED4A 5ILOA 1DJQA 1XQ9A 3HXOA 4EB6A 3U3RA 5CXXA 2P40A 5ALJA 1NN5A 4DA8A 4UQPA 2RGWA 1HF3A 2J3EA 3DPUA 3QPUA 4L76A 1DELA 4ZV9A 1NURA 2GUWA 3LKZA 1OZAA 4MHOA 4BMOB 4BO2A 3P9CA 2WQZA 2OV6A 3BWCA 1RAAA 3C4VA 3DONA 1GTRA 4OHXA 2W2QA 2BGKA 3DL7A 3EGDA 4YYZA 3DHEA 3OVMA 3I4CA 1XDBA 5TX7A 2XDYA 1MENA 1Y4ZA 4UTVA 4BKQA 1Z6AA 3HUFA 5C8VA 3MERA 1PHRA 3N7TA 3DKKA 3LQQA 4BGIA 1RLOA 3ML1A 4HWOA 1J1IA 3A4YA 1JLLB 1IH8A 5IULC 4W63A 1R8QA 1VP3A 1QHFA 2GZ1A 4UJ3A 2JC3A 4OLHA 3RH0A 2NZJA 1W1UA 1E1RA 2Z5LA 3NXKA 5AJYA 5K3FB 5THQA 4JB3A 3TNLA 4D9GA 2WYUA 4XA8A 1NXVA 2MJLA 3IPAA 5CNJA 4C22A 4C4YA 5K45A 3WYAA 4DQLA 2JS7A 4B80A 4JV5B 3JYPA 1RDFA 3L4EA 4KQ1A 5ITZA 8OHMA 2KX7A 3GB9A 4K81B 4KQEA 2E4XA 4LXHA 4PTZA 1Q6YA 4X60A 3RVBA 3F47A 5IBPA 4XGQA 2Z58A 2ZTLA 3C1OA 1E9CA 3MUEA 2ZTVA 4U0KA 1DU4A 5MFPA 1I0LA 2C2BA 4DB2A 1RM5A 4L16A 3BCSA 1H2YA 6ADHA 2X15A 3P52A 3ZWWA 2DBVO 2VJLA 1L4NA 1GPBA 3CC8A 4KAFA 3WLQA 4F4CA 1NXXA 1PNRA 4ZTUB 2HT1A 1YS4A 4GRIA 3I8SA 4NONA 3ZKWA 3OZAA 5FEUA 6PFKA 4CFZA 1SUEA 3IQGX 1FP7A 1JVSA 2QT0A 5DW3A 3BQMB 4PAMA 3R8CA 1I7QB 2DR0A 2J07A 2LKCA 2GX6A 3HFRA 4JLAA 5J2TB 3LCRA 1UPFA 4DL9A 2I6QA 2IYEA 4EHDA 4UHBA 1KVTA 2V6JA 1I7SB 3VM6A 3E8XA 2PFGA 2Z2YA 1Y1TA 5K0ZA 3ZDCA 1E3SA 4XM2A 4BV2A 3GLRA 1KYXA 2HIHA 2JCSA 4HNVA 1HL7A 5LR6A 3Q11A 5DIZA 2QBYA 1MVOA 3WMEA 2B4YA 4YRIA 3B5EA 4JJ4A 3RODA 3IXQA 1JEYB 1L7RA 1W34A 1ZJYA 2VBGA 3IXLA 2DFNA 2ZIEA 2ZTHA 2VQ6A 3ZCTA 1ZN2A 3ODGA 7REQB 1DADA 1R1DA 2O2YA 1V8ZA 3IC5A 1W85B 3WBFA 3C3XA 2O3QA 2XTJA 3ZS9A 5ICMA 3TD2A 4IG4A 2UVQA 4FFBA 4UNPA 4G0WA 5HDBB 4RJ2A 4P7FA 3K4QA 4ZODA 3IIKA 3AHDA 3FSGD 1E5QA 3A37A 3I6YA 4M1YA 2H7YA 1CLEA 1IZ9A 1NVDA 2QENA 4YNBA 3FCSB 1MZPA 2C9BA 1PG0A 4DM7A 4YUYA 5KOJA 1VPDA 3AQIA 4EJSC 4UMDA 1Z9BA 2BE7A 2FQWA 1J99A 4KDEA 5GM2A 3VNQA 1Z8HA 5I3CA 4BNGA 2CWWA 3OE5A 4N8SA 1D4ZA 4KO3S 1KR2A 1E3QA 1J2TA 1CETA 1OZFA 2P5TB 4JX8A 5TMDA 2C4VA 3NRCA 3V1YA 1I1HA 1U0TA 3H2HA 4WZBE 4CV3A 2NWQA 3O75A 4Y0NA 1C80A 3EMDA 3I12A 4MCIA 3LV8A 4RV4A 3VC3A 4B83A 4QYXA 4TL8A 2X3UA 5DBHX 5FI0B 4I08A 3Q9NA 3UXHA 2VTVA 2XB6A 3GEDA 3N53A 4OU4A 1DRVA 1TFUA 2YVQA 4AG5A 1YL5A 4ZKDA 1AQLA 2FETA 5BV1A 3U19A 4MS4B 5G4LA 2JRCA 1U2PA 4FYMA 4L85A 2CF5A 3IERA 4DUPA 5I45A 1K3FA 1ZCZA 4WKNA 2HRQA 4XXHA 4TRNA 4YR9A 2XSZD 4P34A 3ZE8A 4YRGA 1AKEA 1XRSB 4KIWA 4O4LF 4RJKA 4D8VA 3P94A 1Z8NA 5JO0A 2I03A 3HJCA 1JAYA 1M7BA 3KUDA 1VM6A 4MYUA 5D7BA 4BO0A 3RGWS 3EFOB 4P4TA 2HRCA 3UY4A 2QZSA 2CT8A 5B1SA 3DO6A 4JP5A 4BGVA 3GEIA 5LCXA 4BOYA 1F20A 3DCNA 4R1TA 3OZCA 1YJQA 3RHTA 1BRMA 1LDMA 3BILA 3EGIA 4M1TA 4PBTA 3OQIA 3WI7A 3BIFA 4UNQA 5BMVA 4OHWA 3D3EA 1HFKA 1BMTA 2YIJA 3GVHA 1YBHA 4X3OA 4ZAYA 3RR2A 1SWWA 5GM1A 1FUUA 2XWPA 3ASYA 3ORQA 3QA3E 4HGZA 1XIVA 1G66A 4LZJA 2PLAA 2YUTA 5EIBD 4BC1A 3WHLA 4HTFA 3LRTA 4JOSA 1OIWA 3UGKA 1RXSA 4DV7B 2ZUFA 4G0YA 4GGMX 1G3IA 1OA0A 4OATA 1W76A 3W3AD 2QRVA 3CPEA 2MMGA 1W94A 2DHCA 4PR3A 4S3MA 3VZPA 4O3FA 4ZI2A 2UZ1B 4OL0A 4WA7A 4GPBA 1L5FA 1FCJA 1IY2A 2DRIA 4D80A 1DJMA 4EH1A 3WQSB 2PHZA 2PZ8A 4IO1A 2BY4A 2GYWA 2RFLA 2FXVA 3JYHA 4AY2A 4ZAVA 4MUGA 4C4SA 4F2HA 5KYNA 3K71B 3VR3A 2DKNA 1UFVA 4DC0A 4ZJPA 1B4DA 1RM4A 3L7CA 4PC1A 1JVNA 3T9DA 1QGZA 3FVTA 4XB2A 1RI3A 1V25A 3ONVA 3T3OA 2QT1A 3GP8A 2COUA 1GG2A 2DP4E 3HFJA 4QPDA 1ODKA 4IYRA 4TL6A 2KBFA 3TZEA 4EZBA 2ALJA 2H5JA 2VC2B 3AKCA 4H7HA 4KGZA 1MFPA 4R1LA 2VPPA 3R4CA 5FD8A 4CWAA 4IUYA 5AI5A 1M2OB 3WXMA 1HEIA 2P3SA 4B3HA 1W36C 4OJQA 3GU3A 1C7FA 1K8RA 3ITDA 3M0EA 3MJVA 4FE4A 4V0LA 3JD0A 2JFNA 1CUZA 1GR0A 1W0CA 1SXJA 1R0SA 2PQMA 3EVFA 3EZ6A 3HDYA 4HQRA 3V80A 4M88A 1CG6A 1FNMA 521PA 3MQ2A 2FEKA 5LLTA 5KTYA 4PHCA 3TZHA 3VBEA 5CLHA 2X0NA 2JD1A 1EX9A 2GN4A 2MCFA 4ZMRA 2B82A 4P7KA 4IHJB 2JZNA 5CLQA 3GGCA 4ESHA 1JLKA 1D9ZA 2A14A 1HURA 2GCIA 4OHKA 4RZUA 1M2KA 2XTAA 4JZKA 3L4JA 1NE7A 2HLNA 5LLSA 2ZRKA 1NTRA 4LVUA 2F62A 1KTIA 2HMTA 3IKJA 1SKBA 1ZH4A 4HADA 3G2OA 4OLFA 2JAUA 5JV5A 4RLFA 1QH1A 1E8MA 5A9RA 4BQOA 5EXTA 5IZCA 2Q4BA 3E9ZA 3LBFA 2NZYA 3AW8A 4BMZA 5BWOA 2NXNA 1PNVA 3S2ZA 1Z5PA 4Q7KA 2L42A 3KAPA 1XRLA 1ZNXA 2A88A 1FMJA 2X40A 1Z36A 2Y71A 2VDKB 3AK4A 3CG4A 4TQUS 2AYXA 5DHUA 3LE8A 2QX6A 3IX7A 2R6CA 1XTTA 1Q12A 3FSRA 4PVCA 4Q9KA 1DG1G 1KIFA 1G17A 4EB0A 4M60A 3R7NA 1JH9A 5DN6A 5I8WA 2FU5C 4PE5B 1OLUA 2WDPA 4LZOA 3A7DA 3HB4X 3LHKA 2Q1TA 2JLRA 4U39A 3ZYZA 1QPGA 4W5HA 3T5CA 3OEED 5LYYA 4D3YA 1F4VA 2AEFA 3BIOA 5DBIA 2BKXA 5DNYB 2W2PA 4PQYA 1ULUA 3FI0A 4P22A 3EZLA 1L4HA 4QG7A 1NT4A 2I29A 3DWIA 3JR3A 2OQVA 3T4EA 5F7OA 2WILA 1OJ7A 1BXGB 2FUNB 2REBA 3DQZA 3EIOA 3JVVA 5BV0A 1D03A 4LJYA 5JSZB 2HL6A 5I01A 4MVJE 2W5UA 2OD9A 1YQGA 1MJGA 3KIPA 2FX2A 2QGFA 3EASA 2PUAA 1YIAA 2WHEA 3JSXA 3Q6NA 4UVIA 4BJ3A 3H6GA 5FQNA 4Z4GA 2YRWA 1RU3A 1YR8A 2O3RA 3L79A 1K4MA 4NMHA 3ANTA 3B3JA 4WY8A 3U6BA 4QJIA 3R7FA 4TXMA 2AZMA 2J9XB 4YRSA 4B46A 2B9EA 3W1EA 3KVOA 2P6UA 5IVDA 1OH6A 3EEQA 2HU7A 1H9CA 5AD1A 1E8NA 1UANA 4Q0MA 3DZFA 5KJEA 1KP9A 2OZKA 3KOYA 1OFUX 1SGWA 2PKQO 3G2KA 4ZQIA 2FN4A 3ZWVA 4ER0A 1RYHA 3HWSA 3L7JA 4ZOQI 1NUTA 1ZZGA 2CVQA 2WE8A 4B4UA 3OH8A 1UKYA 3ZLTA 1P61B 2EKDA 3ILXA 1IPEA 3N6XA 4IIJB 4LSZA 4KU4A 3PUXA 3TLGB 1AS0A 3TW8B 1KOJA 3W2TA 4WNYA 2XQIA 3H99A 4DXAA 2IWHA 3EXHA 3PFHA 3AY3A 1VSUA 4IHAA 4I3GA 1V96A 3NJ8A 4DGQA 1IN4A 3T38A 1GPUA 3HCNA 2FRVA 1UOOA 5C9ZA 5DSXA 4JYBA 2IITA 2NZ8A 1WQ3A 2BFCB 2O2GA 3GUUA 3NM4A 2MINB 3NP7A 2P3LA 3QKSB 2GZSA 3WK9A 4E2YA 2WB2A 3F73A 2XIQA 2XRZA 2GPTA 3C7TA 8ABPA 4MUAA 3TDMA 4GAEA 1HX7A 5TE9A 3LWZA 4XJXA 1Z4IA 1PK7A 3GPIA 3G0GA 3USZA 5CG2A 1H4VB 1ZA1A 3QLUA 4GXRA 2A5LA 1EDDA 1NONA 1N2EA 1K8YB 1Z0FA 1J09A 1U2GA 1Z4LA 2GBCA 5J4VA 2DBYA 1IDOA 1K1EA 3ZCVA 2Z0MA 3FSJX 1NBME 1XEWX 2Z43A 2CBGA 3HSYA 4DWVA 1T9CA 3CXUA 4URUR 1EP3B 3IUPA 4NOKA 3WHIA 2WSBA 4HS4A 3S1LA 5ECYA 5LZ4A 3UJPA 5EHNA 3GVPA 4CI9A 3VV3A 3A9VA 1KY4A 3L5KA 4ZK2A 1UBOS 4COOA 3HEBA 1Z5VA 5BORA 1MT3A 5JAIA 5K0SA 1XYYA 3GL9A 2E89A 3JQ6A 3ZZ0A 2GN8A 2DWOA 3UN1A 1K06A 1QR2A 2G71A 3NP9A 1N9ZA 3P7MA 4EP1A 2XZDA 5U1PA 4EKDA 1CE8A 2EX1A 1TI7A 1CDOA 3ZHRA 2F8TA 2B1QA 2O6HA 2ZJAA 1XTPA 3GCWA 1QX4A 4XD2A 5IK2D 3USCS 2ZRDA 2P2YA 3N6VA 2Z5GA 2QNIA 3C2QA 2I4MA 2VHXA 1CY8A 3BSWA 1WZCA 2I1VB 2VSXA 3C15C 3FYHA 3KPVA 4CDRA 3NT4A 3MINA 1JTEA 4XWKA 3M81A 4F3KA 1V71A 4G25A 1GRRA 1A95A 2QP9X 4OTZA 2QR5A 4K9NA 3CY6A 1NXWA 3GPBA 1RT9A 3HV2A 4GQBA 3O3NB 5E9AA 3LSTA 3D7MA 3PIIA 3S68A 3OPNA 1DTWA 4QVKA 3FCUB 3KAQA 3EGXA 1IVYA 3RARA 5D8DA 4ZJYA 1U0HC 3UHFA 3W9BA 4KQFA 4ZMSA 3EVEA 5FKJA 1NFRA 3RIYA 3U5ZB 2E9SA 2C3UA 3N2YA 1UFOA 1SOAA 4KQ6A 2AI3A 3H2YA 5CVCA 1LRJA 4MI6A 3RC8A 3R76A 5JAMA 4N6OA 2W98A 2V7UA 1N5RA 2TMYA 4G5XA 4KIFA 2HHLA 1RXYA 2JFBA 3ITEA 4RD0A 3TECE 3A28A 3HKBB 3COYA 3LPDA 1L4BA 4L73A 3UJ7A 2JDIA 3V3TA 1ZINA 3WLAA 5CNIA 2WBLC 3DEYX 1HY3A 1NDQA 1VG8A 1WSDA 1BHSA 5F2OA 5G1PA 3TINA 4A2WA 4C6TB 3FKQA 4ZVPA 4B3CA 4OFXA 4TLMB 1DLIA 9LDBA 1SCAA 1RKXA 1TD9A 1IN7A 1NW4A 4Z4FA 2VNIA 5C2JB 5FL7A 2OHGA 4GWLA 2W6NA 3MTAA 1NRJB 3LNTA 3TBKA 3F97A 1EA5A 4WGGA 1SUIA 3PRJA 2G88A 3AERA 1JLSA 1E9DA 1GEEA 2BTOA 2OZLA 2Q41A 4XIYA 4I50A 3ZCRA 4YAJA 2R4UA 5CDGA 1OLSB 1SVLA 2OENG 2VAPA 3H0EA 1TTTA 3ZDDA 4MLZA 5CCBA 3R2JA 3CZ9A 3TSZA 2CLDX 3OIWA 2JL1A 2C4TA 5B6JA 1EUQA 3CNOA 2W2KB 3HTXA 2WMDA 3BG5A 1DPFA 4CL0A 2VNSA 3JQ9C 3EH1A