3KQKA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
436
structure length
436
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 138
structure length 436
sequence length 436
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqkA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqkA01
3CUEF 4HAZA 5LD2C 2O8CA 3VNVA 1E0JA 4TLCA 3TKLA 4Q4LA 5FR1A 4EJSC 3GJ4A 2YC4C 4TMWA 4EKDA 3WNBA 4DCUA 1K5GA 4EIWA 1Z6GA 1XD2A 4OI4A 4DCNA 3QBVA 2FSIA 2J1LA 3TE6A 2WAXA 1CJTC 4M9ZA 6Q21A 2J7PA 4HLUA 2VO1A 3GEIA 3BIFA 1G5TA 3DOFA 2WJGA 1KI1A 4MKFA 3NXSA 1YRBA 1NNEA 4IOJA 4Q9KA 5CM9C 1G3UA 4EJSB 1IN7A 3WHKA 1AM4D 2F3RA 3I5YA 4AI6A 2QRNA 3BORA 3QE0A 3LFUA 1NVXQ 1Q22A 2XZOA 1CU1A 2YNMA 4NCKA 3RS4A 1M7HA 2BMDA 3ZIAA 4FWTA 2IYLD 3TNFA 5AWFC 1KJZA 1G8GA 2BBSA 2GBLC 2Q3FA 3AF1A 4JJKA 3RAPR 4GI7A 3EZ6A 1XTIA 4AIIA 4TYYA 3IPYA 5D3MB 1XTSA 2ZYWX 1W47A 3DKPA 4XIGS 3SE0A 3THXB 4BEJA 1F5NA 2G83A 3O8DA 2RB4A 3CH5A 4OI0A 2O8DA 1E9EA 4PXAA 3A1UA 2LWIA 3AP1A 5K8UA 1CJVC 1E98A 2AL7A 4MGKR 2CCKA 3K1JA 2IS1A 5FPYA 2PL3A 4D4MA 4LV5B 2ZVPX 1A1VA 2ZU6A 2BKUA 2HLDA 3KXLA 4TTQA 4XWKA 2QQ0A 2IS4A 4F93B 3Q7PA 1ZNWA 2C03A 1RVDA 1J2JA 2ZRPA 1G3QA 2HXYA 2JEOA 3KQKA 3AF3A 5KSZA 1ETUA 4QM7A 2GNOA 1BOFA 2QU8A 2IUTA 1FMLA 2NOAA 2WWFA 4LCBA 2XXAB 3C16C 1NLZA 4CRWB 3I92A 4WXPA 2FFBA 1ZIOA 2ZAMA 4IDPA 1OB2A 5KHOC 5P21A 4M1KA 1OXTA 3ASZA 4G3XA 1HURA 2G0TA 3QXSA 3W6PA 2ZJ8A 2XITA 3K53A 2WWHA 5EXXA 1BH2A 3LXRA 4TYWA 1W49A 3PV0A 4ACBA 2RKOA 4EPTA 3A1TA 1X8KA 2QT0A 1OHHA 4NKRA 1NMYA 3B1WA 1E2MA 1LNZA 4WIAA 4RKEA 2XNDD 1FL9A 4BLQA 1SVWA 3OE7D 4UJ3A 5TXGA 1PLJA 1PZNA 3BB3A 3EAQA 4M9SA 1KMQA 4B34A 2P6NA 3PEWA 1QHHB 2JA1A 2NO1A 2A5GA 2RHMA 3F8TA 3U7GA 2ZJBA 2C95A 1GRRA 2NZJA 2B7BA 3I8XA 1IOZA 2FSFA 2H7VA 2R9VA 4F4JA 1KNQA 1RJ9B 2NZ8A 5FOUA 1EFTA 4MGYR 3ZGXA 2RMKA 3AVYA 2BMFA 1VTKA 2HV8A 3AB3A 3C14C 3ZH9B 1QHYA 1U8AA 2DFKB 3OF5A 4O0MA 2NGRA 4LI0A 1U81A 4Q4JB 1W36B 5HZKA 3M4YA 1OLOA 4Q01A 3AGQA 3JVUA 4GRAA 4JVMA 5EZ5A 1P7CA 5FTKA 1EK0A 4UQOA 3FHCB 2ZI3A 2ZEJA 4GZLA 3U7EB 4Q9LA 4QM6A 2HCBA 3AP2A 3L0PA 4MDEA 3O8CA 3EASA 3OIYA 1UDWA 3U5ZB 1N6PA 4HAVA 3AF4A 3F3YA 3UMSA 3SHWA 2FGJA 1N0VC 4PZYA 1QRAA 1KJYA 3PR1A 4CZ2A 1NMXA 3PCRB 5F98A 2DWPA 1FNMA 1RRFA 1IN4A 4D4KA 1G4AE 2EQBA 3QPUA 5G3ZA 1LTQA 3QY0A 3NHAA 3TW8B 5GVRA 2J3EA 2R6GA 3VX3A 5A4JA 1Z6XA 4XVRA 3SJZA 1CXZA 2QT1A 4P3YA 3T5DA 3ZLJA 4CEHB 3EC2A 4DCTA 4F91B 2WSSD 2FFHA 2PMDA 1SGWA 5K8TA 4YXWA 4AD8A 3LX5A 2OHFA 4KCGA 4HAXA 4DXAA 4NDZA 2VP2A 621PA 1CR1A 2OV2A 3VAAA 1Z47A 2XB4A 4L9WA 4QG7A 3ZZUA 1P2VA 4HSEA 4KVGA 3RYTC 4DSOA 1KHTA 2CHVA 4BASA 2NMVA 3FOZA 1ZAKA 4Q03A 4PQRA 1OH6A 2P2LA 3LO5A 1JQLB 2ZETA 2CEAA 1COWA 1E79D 5TDHA 4DC9A 2OCPA 2CE2X 1XEWY 4TL6A 5IK2A 4HDOB 1YZUA 1XPUA 1TF5A 4K46A 2DWQA 2ORWA 5BQ5A 3E2IA 3LRPA 1Q12A 2EU8A 3ZVNA 1ZM7A 3ZDQA 2V8OA 2QZ4A 4DLUA 1CRQA 3B6EA 4A2QA 3I4LA 3JVVA 1Q1BA 3AUYA 2WWXA 4AK9A 1OXUA 2QROA 5F9FA 1E9RA 4JLOA 3PEVA 3TBKA 5L8VA 5CYOA 2Q9CA 2AWNA 4G5SA 3ECCA 3KTAB 2OT3B 2IYTA 4KI0A 2PEYA 4B48A 1W46A 2XNDA 1GTVA 4HZUB 4QJ5A 3OE7A 2OO7A 3REGA 3I61A 3WP0A 4B73A 2ZM5A 1ZU5A 2EFHB 1P73A 4FMDF 3ZZTA 4LJ6A 4IRUB 3CX6A 3C8UA 2F6RA 2BJVA 4TL9A 4RY2A 5JWHA 1QHGA 2Q9AA 2W00A 4NP6A 2J0QA 1TADA 1U98A 1Z8FA 2QPTA 2QTHA 1GNRA 4TQUS 1Z22A 4EQ6B 1XTKA 3MUFA 4TZ6A 4DDVA 2W2XA 1F48A 5F9HA 4MKIA 4KV9A 1PVOA 2EYQA 1GITA 2I1QA 2YHSA 2BBWA 4UNPA 4GZMA 2WJHA 4B71A 1J90A 2ZRCA 1VDZA 1ELOA 3LVQE 1ZUIA 2GEUA 1G4UR 4NTZA 3VTKA 3I5XA 4ZDJA 1NRJB 3NC1C 1XD8A 3QJYA 2J46A 5HTKA 2HF9A 5DI3A 3FKQA 1G6OA 1W4AA 2V6JA 3SYNA 4FXPA 2OFXA 4DLRA 2ZQ5A 4GSYA 5LB2A 3EARA 1YR8A 4PAOA 3WY9A 4OQXA 4A0FA 2ZREA 5EUMA 2OLJA 1AS2A 5EZ6B 2JJ8A 4E07A 1QHXA 3QEJA 1YR6A 5JHGB 1XZPA 3KJGA 3MLEA 2R6AA 1KDTA 2HUPA 1NKSA 1G41A 1WCV1 3HPQA 2OCAA 4GNKA 3K0CA 4XTRA 4HDQB 5HPYB 4ESVA 4AKHA 3SFVA 1UBFA 2ZSEA 5GJVC 2IXEA 1YE8A 2ORVA 3VNUA 1JR3D 2PH1A 2MSCB 2CNWD 4PZLA 5JJIA 1SZPA 4BWYA 1RW4A 1D6JA 1S96A 1SVSA 1T91A 1E9BA 1G6HA 5AJXA 4TYNA 1W44A 5G53C 3SQWA 5C4MA 3MWKA 4DKXA 4Z51A 3GLGE 1EESA 2GZHA 4JIMA 2J0UB 1F2UB 1Q20A 1VMAA 1XTQA 5DYGA 3CPEA 1WRBA 1YKSA 4NYMR 1IXSB 1E0SA 1KO5A 3BK7A 4ZI3A 1ZD8A 3BH6A 4P33A 3T35A 4DLVA 5B57C 4HLCA 1JALA 1E79A 4BRWA 3K09C 2RGXA 4QNRA 1E2IA 2WWGA 2VA8A 3WHLA 2B21A 2JGNA 2L0XA 1RZ3A 2VTKA 4RCZA 4LV6A 1II8B 2C9OA 2NO6A 3MJHA 2ZJ2A 4A8JA 2O8BB 3IBGA 1OH8A 2HJVA 2P65A 1KSGA 2ZRKA 1P61B 2C8VA 3RS3A 4G5QA 2C77A 1GIAA 4IDOA 2OXRA 2WMNB 4YMTA 2XTZA 3GLHA 1N5KA 2ZE5A 3CRVA 1EG7A 1AQYA 1G7SA 3MFYA 1SXJB 3H86A 2PBRA 4W5JA 4URXR 1W36D 3L0SA 5KOYA 5SZJA 1JI0A 4JKIA 5EE0A 4A0GA 4C2TA 3TGPA 1IJEA 5C46F 2FSHA 5B2ZA 4DEXA 1E2EA 3B5JA 1L4YA 4M0LA 4B3DA 4PPQA 1YR7A 1ZNYA 3IEVA 1ZBDA 5FL3A 1XNJA 2ZSBA 4YMWA 1ZNXA 2WMOB 3P1JA 3RHFA 3NIBA 4ZV4A 2ZANA 1KSJA 1L2TA 2WWYA 1MR3F 3AVUA 2IS6A 2IWRA 4DLWA 3A1VA 4KU4A 2ZVQX 4PHHA 4MGZR 2ZTSA 3U3OA 1TNDA 2GXAA 1DADA 2AWOA 2OBNA 2GVDC 5H1YA 4BFTA 2OAQ1 2FPLA 1KI6B 2FGKA 4FCWA 2CHQA 3A1SA 4LZZA 1Z08A 4BFXA 3CF0A 5D3MA 5JS8A 2XEXA 1E2QA 3MAAC 4BZXA 3THXA 2GEDA 2YWHA 1GVNB 3GLFE 5FTJA 2G0NA 2CE7A 1T3SA 4FI3C 4OI2A 1GAJA 2ODWA 2MSDB 3SJBA 3ICEA 4N1AA 1QG2A 4OJKA 2IYRA 4A0HA 1Z0KA 4DDTA 3HR8A 4MYHA 4JT4A 4MKHA 4V0LA 2YJTD 2QAGA 1ZINA 4JMPA 5HZHA 4GFDA 5DI9A 4NMMA 1KKMA 2R6CA 4HB0A 3NG1A 4JBWA 2WV9A 4B74A 1JR3A 5LPNA 1NG1A 3D8BA 2PMKA 4M21A 1PJRA 1JAIA 2CNWA 2VBCA 1XEWX 1IY2A 2D7CA 3BGWA 4IJMA 1R0ZA 4LRWA 3SQXA 3SS8A 1CBUA 1OFUX 1NSTA 3NBFA 1Z6TA 2Q3MA 2XXAA 3KJIA 3D31A 2KE5A 3QXXA 5L3VA 2GTPA 4G5RA 1X1SA 1VG1A 3SDZA 4FWIB 4DIDA 2J45A 3FB4A 1QG4A 1HY3A 1GWNA 2H17A 1WBDA 2GETA 1VKJA 1J8YF 2UZIR 4YMUA 1XU4A 3ZZ0A 3I1FA 2I4IA 3T1OA 3LXXA 1RC8A 1CF4A 4DLSA 1QF9A 2GCPA 2A3RA 5DISB 3TRFA 2ZSDA 2GA8A 1I2MA 1JQJC 3NH9A 4A6PA 3IEUA 1L7VC 1M1YE 4L5BA 3IILA 2W6JA 1Z0JA 1QHHA 2IYVA 4AYWA 3T5GA 3QVUA 4EAQA 4AWXA 3B78A 4B2IA 2QSYA 5KUTA 2VP6A 3TSOA 2IUUA 4B3XA 1OJLA 1WQ1R 821PA 5JS7A 3QKRB 1KK3A 2BC9A 721PA 1ZD9A 2BEJA 4JL6A 3KDSE 2E9SA 1RJ9A 1XJQA 3B2EA 1Q0UA 4NYJQ 2EFGA 3PEYA 4FW9A 4BLPA 3HYTA 1EX7A 1E99A 1E2JA 1NI3A 1CLUA 2AD1A 2FEOA 1R6BX 2DHRA 3RC8A 2D4HA 5H8WA 2KBFA 4QGGA 1E9FA 2ORIA 4O3MA 2NQ2C 1DS6A 5JWOA 5L3SB 4WW0A 3T1TA 1KZ7B 4R2HA 1VYVA 1N6HA 2FPKA 1T5LA 2J0VA 4I81A 1UPTA 3IIJA 1RYHA 3KFXA 1ZUNB 3KB2A 2WJVA 3UXMA 1E9DA 1XWIA 3W9YA 4BECA 4CT4B 2XSZD 1ZM3A 3MWLA 1XB2A 1DO2A 2QPAA 3H1TA 1NN1A 4Q9JA 2K5UA 5TB5A 2ZRLA 4C0BA 2JLWA 4KLNA 1TMKA 1NN3A 3KL4A 3CF6R 3SHFA 4D0LB 1Z5ZA 2F55A 3K9LA 4ZIRA 1DO0A 2BHRA 2ZUCA 2XOKD 3L0IB 3GMTA 4DB4A 4Q47A 2ZS7A 5DIFA 1R5BA 2C96A 5L3QB 1D9ZA 4QGFA 1YHNA 2REXB 1UAAA 2F9LA 4ZDIA 4TQAA 2I3BA 2J9RA 1I4DD 1XJCA 2FPMA 4P0TA 2ODBA 4UNSA 3DO6A 3O8RA 1EXMA 1N6LA 2IXGA 3IDQA 4XD7A 2A78A 4JLNA 1XCGB 4XSHA 4D4JA 3U3KA 3V9PA 2QG6A 3ZIAD 4WXRA 1DAMA 4HB4A 2REOA 4DDWA 2ANBA 3WRXC 2FDCA 4OHYA 4OHVA 4GBMA 2YINC 5TV2A 3JZMA 2OZEA 2VLIA 1XTRA 4NH0A 4BLRA 3M6AA 3SU8A 2O8FB 2QAJA 2J5XA 2VSFA 4DJTA 2GZAA 3V00A 4ZCMA 1IJFA 1SVIA 2ZSAA 1N6OA 3LH5A 4LYAA 1FOEB 1KZGB 3UWKA 2CK3D 3WMFA 4IFBA 4NCJA 1WA5A 4IW3B 1T3HA 4RD4A 3FMFA 4F4IA 4C2UA 2H92A 1OH5A 4G0NA 1BYUA 4GDFA 3BB4A 3V4RA 1XTJA 4EPWA 3KJHA 3VR5A 2RH5A 1QVAA 4NBSA 1Y3AA 2IEYA 2XJ4A 3QENA 1GUAA 1E9CA 1SXJD 3KTAA 1NIPA 5CK4A 1OFIA 4M1YA 1F6BA 4HZUA 1SHKA 3CR7A 1NG9A 4TLDA 4B33A 4CF7A 4KBGA 3LV8A 4GOJA 1AGRA 1KO4A 3P32A 5FBVB 1OE0A 3RANA 5AJVB 3U7FB 1G8HA 4RKFA 4J0QA 4KFUA 2LKDA 3A37A 3UK6A 4URZR 3DKVA 4Z8YA 4EQ6A 2YOGA 2G1KA 2BVNA 2ZJZA 3CWZA 2ATVA 1U9IC 1MO3A 1US8B 1JECA 4KYUA 4LHVA 3R9XA 4TZ0A 3GJ3A 4URVR 2PCLA 3KUCA 2IYXA 3GCGA 3QVVA 1XEXB 2KJQA 4PPFA 4X8MA 1T3LA 4K8OA 3U3JA 3BERA 3J81k 2OBLA 1A2KC 1KI4A 1UDXA 4OYHA 2EW1A 4EPYA 2FJUA 3FFBA 3W6OA 5EE5B 1GSIA 4UXJA 3QKSB 2WVJA 1IXRC 3UIEA 1VG9B 4FMCB 2GJ9A 4JLPA 4US1R 1NLFA 3I62A 4Q00A 4PC2A 4KVAA 3ND8A 1XZQA 5CDFA 3TMKA 5TMPA 2XSZA 2FG5A 3A1WA 3B1ZA 4QHYA 2XNSA 3LBNA 5B64A 1ZYUA 5J47A 1AK2A 4AG5A 4LK2A 1NVWQ 5FOVA 2NTYC 1RE0A 4A6XA 5LB4A 2ZYVX 4Z8XA 3I3SR 1MRSA 4ARZB 4MQBA 1XMIA 1E2DA 3GFPA 3O8BA 1FP6A 4D82A 1FMJA 3KB1A 4LHZA 1VCMA 4KAXA 4DIEA 3LAWA 3T1QA 1M2OB 2XOKA 1G20E 2G77B 2F1RA 1HUQA 1U94A 1ZNZA 1VHLA 4S2EA 3K70D 5LD2B 2HYIC 4CGZA 4KLZA 4ZKEA 4QL3A 2BIFA 2V4ZA 4X8OA 2PZGA 5EQTA 2D06A 3LX8A 3H2YA 1U90A 1S1MA 2J0UA 4MGIR 2QY9A 3GD7A 2DB3A 3T61A 4DUGD 2OCBA 3KJEA 3EIHA 3K0FB 1K6MA 3B7GA 4D6PA 1S8FA 2X77A 1XXHE 4CDGA 5DO9A 4D0NA 3C5HA 4OI1A 1U8YA 2ZR9A 3CRMA 5J4KA 1W48A 1ZRHA 3ONWA 5JFGA 1PUIA 3I8SA 4DDUA 4YXWD 1ONBA 3RNLA 1FUUA 1DOAA 4BE7B 3OHMA 1CTQA 2VSXA 4XOIA 2BCGY 2ZS8A 2CHGA 4M53A 1NVUQ 2XTNA 4OHZA 5H68A 3W34A 5KSPA 4KO8A 1II8A 2JJ2D 1M7GA 3AP3A 2CK3A 1UBCA 3K9HA 4B43A 2O8BA 4IXNA 4X8LA 2QM8A 2RGBA 4LHXA 4Q18A 1N5LA 4Q1FA 1E2PA 4DSNA 1COWD 3HWSA 2N1BA 2IHBA 1ZC4A 1ZMXA 4B2PA 4LC1A 4RD0A 2H16A 4Q66C 4H9GA 1D8TA 4Y0AA 5IK2D 4HATA 2DWOA 1D2EA 1G3IA 1SXJA 4Q1AA 4BFYA 1W4BA 3PFIA 4DRZA 4UNQA 2O5VA 2WBLC 1KO7A 4Q7MB 5FH9A 2XX3A 1QHSA 1Z0DA 4GP7A 2CJWB 4US2R 1H8HA 3FPAA 5KO2A 1E0AA 3SFZA 1SULA 1R0XA 2WSMA 4IKEA 5BN4A 3GEEA 2N46A 2ZE7A 3SZRA 2P67A 1VPLA 2ZI5A 4M4SA 3U3RA 1X1RA 2J7KA 1R0YA 3IBYA 2R6DA 3IO3A 4A15A 2FZLA 5TY0A 1KDRA 3REFA 5J4HA 1VG8A 1NKTA 1N5JA 5GJBA 3GJXC 4PO9A 3EPHA 1OFTA 2X1VA 4BZPA 2TMKA 3R9IA 3C15C 3CZQA 4KFRA 3CKLA 1NN0A 1SVMA 1WB9A 1XFAA 3ADKA 4JKYA 1TEXA 2CLCX 1LB1B 5DYIA 1KI6A 2IWHA 5EUQB 4DLTA 4GP6A 2VPPA 4X8HA 3CF2A 3RRZA 1XX6A 1GKIA 1Z2CA 4FN5A 5K8LA 1TUIA 1KK0A 3QG5A 4Q4AA 1EWRA 5EE9A 2RGNC 2JASA 4G1UC 5BXQC 1Z63A 1XDBA 3LA6A 5JCPA 3BOSA 4CIDA 1NP6A 2ZUDA 1Q1QA 5TVKA 4V0ME 4KSBA 4IDQA 2ANCA 2ZRHA 3KX2A 1ZW6A 4Q7JB 1MABB 1QVRA 3GLGB 4PHGA 1GNQA 5FUVA 3DPUA 2RGEA 1WBBA 2CL6X 3PUXA 3U7HB 3H84A 3KKNA 4EPXA 2J0SA 2DCUA 1R2QA 1GZSA 1DAEA 2ODNA 4TSFA 2P6RA 4MRPA 4QBIA 3KZ1E 3U4QB 2FV8A 2GAOA 3EWSA 3B9QA 4I1UA 3AV0B 4DUGA 3B8HA 2Z4SA 2R6FA 2CLSA 2GK7A 4QRHA 4XWOA 4GMXA 5GJCA 4M22A 4MRVA 4PZZA 2IYZA 3UMRA 2YWGA 2A2ZA 2EYUA 1U0JA 2AR7A 2J41A 3W5JA 4I1VA 1KAOA 2QE7D 2ZRIA 2C78A 3GLHE 4WAUA 1Q1EA 4LJ8A 4M8NE 2JJ2A 3TAUA 2F1HA 4V0OA 4B76A 1S0UA 1LVGA 3UWOA 3QIAA 2BM0A 3EIEA 2QP9X 3OIVA 5AK0A 1JEEA 2YVUA 3EZ9A 3W5IA 2RGDA 1DARA 1RKBA 3NEJA 4M1TA 4NCNA 1P9RA 2GCNA 3QKRA 4K81B 2Z4RA 5D3QA 3GEHA 2JLXA 1KAGA 3BJIC 2BKEA 4JL8A 3T34A 4C9BA 3THWB 1DPFA 1C4OA 2VH5R 3N5CA 1NL3A 1GDDA 2J87A 2F43B 1DBSA 5F2EA 5J40A 3ZQJA 3CNOA 3CR8A 3CPHA 3GLIE 1ESNA 2ZJOA 1T6NA 1AS0A 1KMHB 3EZFA 2C9CA 1EWQA 3GFTA 4A9AA 1ZCBA 3RABA 2JLVA 1S3GA 1TF7A 2A5YB 2JAQA 4TMZA 1YZGA 5KU1A 3RS7A 1Q21A 4DSUA 3RWOA 1W7AA 2E87A 2QQEA 3FDIA 4KHZA 2VL7A 4LJ5A 3UG7A 2H5EA 4MYUA 4QHTA 4LOAA 3GLFB 1R5NA 1Z3IX 3QXCA 1YVDA 5JWRA 4B75A 4HZIA 4F38A 2QMHA 4LJYA 3EPJA 3W8RA 2JLQA 5L3QA 1TAGA 4IXMA 4LWZA 1E9SA 1OKKA 2FWRA 4IEEA 1JR3E 4UXHA 4C3ZA 3IHLA 5UKDA 5G41A 1W2GA 5J4LA 2PLFA 4AY2A 1SVOA 3MJRA 4KITB 1LS1A 1MO5A 2CL7X 2Q21A 4LPSA 4N0DA 5BYJA 3ZJYA 5J4YA 4JVSB 4H1UA 4PFSA 4AYTA 5DE3A 4M1MA 1O87A 4A36A 1X86B 3T15A 1R0WA 2EFEB 4E5UA 3ADDA 1ZU4A 3B1VA 2YWFA 4R7ZA 4BLOA 2O8FA 1IBRA 4JT2A 4CYMA 1KDPA 1S4QA 4Q19A 1LF5A 5HKKA 4IDHA 3RS0A 1XMSA 2B92A 4TYQA 4DCVA 2ODEA 2DFTA 4ASUA 1D9XA 1GKYA 3BS4A 4C4PA 4QXAA 1N0UA 4TWZA 4B3CA 3NKVA 3ZVLA 1IHUA 2QMUA 1E4VA 4NCHA 4BFUA 1AKEA 2GXQA 4C0JA 4DCSA 5C1BA 4WZBE 1GILA 2QM7A 2HDNB 3OZXA 1T9HA 3G82C 3A4NA 3P4YA 4HLUC 5BN3A 1YQTA 2QL6A 2BBOA 1RRGA 2R62A 3PUWA 2QE7A 5C18A 5AUPB 4C30A 3TH5A 1N2CE 1Z0IA 4L16A 4NYIQ 5FUWA 3N2EA 1MO4A 1RYFA 3QOFA 4BEBA 1GRNA 3LWNA 2JCSA 1VIYA 4W5WA 2V3CC 3CH4B 3AVQA 1OH7A 2JATA 5A5GA 3DM9B 3U60B 1ZD1A 2JLYA 2KWIA 2R44A 2A5JA 1US8A 2QP3A 3LY5A 4OQFA 1L8QA 3RS5A 4TLEA 1X8LA 4II7A 3SI7A 3DDCA 2HXSA 5FUXA 3KKOA 3MMPA 2W6JD 3HU3A 4W9MC 1XEXA 1R4AA 4D26A 2G88A 1S9HA 1JEDA 2ZR7A 2GRJA 2FEMA 4ACAA 1PLKA 2GESA 121PA 221PA 3QKSA 1NVVQ 3IPXA 3QPVA 2IW3A 4AKGA 4MH0R 3Q8XB 4QBHA 2RCNA 1YJ5A 3N70A 3K0EA 3ZD7A 1P2UA 1YZLA 1E4YA 4JLDA 1R10A 1QHNA 2WWIA 3UANA 3UKDA 1KIMA 2REBA 1HE1C 5DN6D 4PO8A 1G9XA 4Z54A 3FE2A 1UEJA 2WOJA 4ARZA 1K8RA 3S1AB 2HYDA 3D3QA 3WP1B 2FMXA 1XD9A 1SVKA 5AJWA 1IN5A 3WBKA 5AR1A 2ZRNA 4G5OA 2DBYA 2NG1A 3HU2A 5EXPA 2HT1A 1YZKA 5KDLA 1GFIA 1T0HB 4HI0E 2ATXA 3RRMA 3OESA 2Z6VA 1P9WA 3EXAA 3QEOA 3Q85A 4URUR 4JLAA 1KOFA 4EJSA 5JSZB 2V1UA 5AUOB 1H65A 1HV8A 4L4UA 1RRPA 2IYYA 5IHPA 2EWVA 1VG0B 5FI0B 5FPKA 2ZI9A 4HAYA 2PX3A 5FBLB 3NBZC 1WMSA 4JSYA 4C0QC 4A1FA 4B3FX 1TQ2A 1CEEA 4E09A 4DLZA 2WIBA 3LVRE 2XB2A 1YR9A 4XD7D 4H1VA 3NVAA 3FWYA 3FHTA 1NBMD 2IYWA 4Q4HB 5F3WB 2VIIA 1HT2E 4LJ7A 4ABYA 4HAUA 3TAHA 3OFNA 3SYLA 1UADA 1VYUA 1D2NA 4TQ9A 4MUBA 2HCJB 1W0KD 2GBLA 3KKQA 5FOWA 4PSAA 3WYGA 4M1OA 2AHOA 5E7IA 4PSKA 4JLBA 5EP1A 3JZAA 3U61B 1HQCA 4TMVA 4A0RA 2H18A 3QQ5A 1II9A 2XTMA 2C04A 1IAQA 2JLRA 1ZVQA 3AVPA 3K70C 2ZJ5A 4WZAE 3BXZA 1Z83A 3DMNA 4M9QA 4QKQA 2D3WA 3ICQB 2PT7A 2KI5A 4HLQB 2YC2C 1G8FA 4PTLA 4LJ4A 1DEKA 4IVRA 3FYHA 4R98A 4XTCS 2VHTA 1BIFA 4RVCA 1PV4A 2ZAOA 1OXXK 2YKGA 3NH6A 1OPXA 3Q7QA 2O0JA 4QBGB 2KSQA 1TF2A 4OHXA 1EGAA 2V55B 5K8IA 4PO1A 4URYR 2AKAB 2ZYUX 2AK2A 1UKVY 5CITA 2A7QA 1K5DA 5DNYB 1P60A 2ZUBA 2PZEA 2ZXUA 5CDFE 1F2TB 1P72A 3W6NA 4TT3A 4U00A 5FTMA 2WKRA 3WMEA 4HYYA 1A5TA 5LBIA 4JS0A 3CNNA 2Z83A 2FX3A 1I4TD 4GT1A 5SZKB 5CLQA 3AF0A 4AG6A 1IN8A 3GJ6A 3PJRA 1E2LA 1Z2AA 4OQNA 1LV7A 5B30A 3GFOA 4HEJA 4OKSA 1BKDR 4Q4JA 1E2NA 3V4FA 1U99A 3SR0A 2NO0A 3CWQA 2ZPTX 2E1RA 1Z0FA 5DN6A 5JI3E 2AX4A 1TL7C 2AXNA 2NO7A 3UMFA 1TTTA 1NIJA 3LW8A 3R8CA 3GLGA 1AJEA 4IEIA 3VKGA 4MYTA 2AKYA 2BWJA 3T06B 1VCOA 4TTRA 1IY0A 2W6ID 2AN9A 1ODFA 1KYIA 2Y8EA 5DH9A 4C0AC 1JXOA 5FFMA 4ESHA 1E0KA 1XXHB 3LNCA 4Q1EA 5CIQA 3U4QA 5IDVA 4FMBB 3AVTA 1FPMA 2PX0A 4P4TA 1AGPA 1KJWA 1I4LD 4EDHA 4PAMA 2Q6TA 4A2WA 2R8RA 2FA9A 3WYAA 4CEHA 3IIKA 4DBLC 3MG9A 3TK1A 2ECKA 3CIOA 1G3MA 2AD5A 5HCNA 1VECA 4C0HA 2HF8A 1XMJA 2OSBA 4LBWA 3EPLA 2MSEB 1NBMA 4PX9A 4PC3A 4OQLA 1G18A 5JCZA 2IC5A 3T1VA 1NY5A 1SXJE 4D4LA 3IUYA 5JLJA 4B6EA 4PPNA 4RFSB 5FUYA 1W0KA 1ZUHA 1TQDA 1UF9A 1XEFA 4PC1A 5FPSA 1JPNA 3U6KA 3LLMA 3NDPA 4NCIA 4WOPA 4EFLA 3KQUA 1AQUA 1MKYA 1AIPA 3KKMA 3VQTA 1FZQA 4W7SA 4KJZA 2G1JA 2V6IA 4GL2A 1T8TA 5JECA 2CBZA 5C2JB 2FFAA 3THWA 2QBYB 4JJZA 3X1WA 3ADCA 2IK8A 2XZLA 1CKEA 2CMKA 2F43A 3K9NA 1E1RD 3PIRA 3K0CC 2WIAA 4D81A 1E69A 1SVLA 3LD9A 3THYB 2A5FA 3CPJB 3Q3JB 4NPHA 1HA3A 2ZRBA 2QMOA 4M1SA 2ZRMA 1KI9A 5TARA 5JI2E 3RSOA 4TMKA 3VU9B 3A4LA 3RRNA 3BBPA 1KMHA 3RRYA 1E2FA 3RSLA 2VF7A 4JLVA 4ZCIA 4EUNA 1Z28A 1F3OA 2IL1A 2C5LA 3QXHA 1SHZA 1Z6YA 2OAP1 5HE9A 1HTWA 2IXFA 2ONJA 5KTYA 1KY2A 3K8YA 1JJ7A 1H8HD 1O3YA 1TQ6A 4XVUA 5KNBA 3PUYA 3OEED 3ZD6A 3OEHD 1ZP6A 2IYQA 2ZRJA 4OL0A 4XJXA 5FOSA 3X1YA 2ZRAA 2PJRA 2W0MA 1AN0A 3TJZA 3QKUA 3K0AB 4I1OA 1U0HC 2WM9B 5JJKA 4MRSA 4HLDA 3BAFA 1CR4A 1E96A 4BFZA 2QA5A 4XVQA 4BFWA 1G8YA 2OXCA 1KKLA 3HDTA 4RZXA 4A8JC 2QI9C 4V0KA 4B47A 3NDBB 5SZHB 4A82A 3X1XA 5BW8A 4JL5A 4CEJB 4QNMA 2QGNA 4UNRA 2IX3A 1G1MA 3RC3A 5E7JA 1V43A 4BZQA 1S9DA 1Q3TA 3R9WA 2W6IA 3B82A 1YZNA 4LYHA 5AJZA 1QHIA 2V54A 4B44A 5FL7D 2CVHA 3TUJC 3FKSA 2D74A 2D2EA 4Q02A 1G17A 2QORA 4EPRA 4PQFA 1KO8A 2ZE6A 3FHOA 4HUTA 2DR3A 4DVGA 3QF4B 4D0GA 1M8PA 3GLHB 3U6BA 2QEQA 4FMCF 4OHWA 1D2MA 1CJUC 1EFCA 4QHSA 2FF7A 1X6VA 1FX0B 1VCIA 1ZC3A 1C9KA 5GJWC 4TSFD 4AKIA 1D5CA 3DOEA 4W5HA 3CONA 4MA4A 1Z29A 1OT3A 4HB2A 1VCNA 1VIAA 4RD2A 5CYPA 5JRJA 1TQ4A 2VP9A 1F2UA 1YRAA 2CDNA 1P62B 2H57A 2VP4A 4O2RA 4CEIB 1A2BA 4MUAA 4QJ4A 2W2VA 4JLJA 1KNXA 2FNAA 1OIVA 4HB3A 3QBTA 4C0KA 1E2KA 3CB4A 3DZ8A 4NONA 1G64A 4U02A 3AUXA 3TUZC 2D62A 2R65A 1KY3A 3LW7A 4OK6A 1XF9A 1R8SA 1N3BA 3L82B 4V0NA 4RJLA 3T12A 1EFRD 4D25A 3GLIB 2NO9A 1DE0A 5CB8A 2WICA 1GM5A 5ELXA 3NHBA 2ZRGA 2QAGC 4F4CA 1GOTA 2ZRFA 5M04A 1E1RA 1MV5A 2C9YA 5FPHA 3PENA 5CLLA 1KSFX 3K09A 2IF2A 4YQFA 3C5CA 4NU0A 4RZUA 5KDOA 4TLBA 4NYMQ 2P5SA 4LUCA 1E3MA 2QGZA 3P26A 1KK2A 1XP8A 5FBRB 4WZ6A 1MT0A 4TLAA 3CZPA 1KI7A 3EA5A 3FMPB 4FCTA 2QAGB 4KODA 2JLSA 3P20A 2F1IA 4LSGA 1CULC 3GQBA 1JR6A 1U8ZA 2VQSA 4TL8A 1E32A 4TL7A 3EX7C 2SHKA 4ZPXA 3S1AA 4PHFA 5IRCD 1E1QA 3OEEA 3VX4A 3OEHA 2GKSA 2GXUA 4GPTA 3PUVA 4PC6A 4PANA 4R2IA 4IVPA 2FSGA 4AC9A 2V1XA 2VSOA 2GVZC 3KQLA 2AFHE 2P0EA 2O0KA 3RWMB 2QMEA 3DHWC 4IFEA 4V02A 4OJQA 5JSZA 2NPIA 1Z0AA 3ETLA 4Q9IA 2N42A 5CK5A 4QBFA 3FMIA 1SQ5A 3AVWA 4RD3A 1JBKA 1JAHA 3BH0A 4NYJR 1G8PA 2BV3A 1NY6A 4IOLA 3AQ4A 5FOXA 3QF7A 1B0UA 1VHTA 1OKKD 2CL0X 3F5FA 1HH4A 2I1VB 2WJYA 3RVBA 4AKEA 3PUZA 4DB2A 5L3RA 5G40A 3ZS8A 2O8EB 1IONA 2GK6A 4Q4HA 1ZCAA 3AKEA 4KBFA 2WJIA 4BLTA 3A6PC 1YZTA 3KXIA 1HYQA 3L2OB 1W36C 4OK5A 5FL7A 3QNUA 2KBEA 2OFOA 4TN1A 3FVQA 5AUQA 4PHTA 4A4DA 4QGAA 4RZ3A 1N0WA 3TLXA 2QENA 4Q7LA 4B6FA 4UNNA 3U3MA 3WMGA 2ZSFA 3UPUA 3O47A 3PXGA 4ERNA 3L43A 3N2IA 1X8JA 1XJ0A 2ZE8A 3AKDA 1GG2A 5HKKD 2Z43A 3LDAA 2H8KA 1JPJA 4E03A 3U44B 1KTVA 1A4RA 3L8YA 1CP2A 2HT6A 2W2TA 3Q5EA 4ASUD 5J5CA 4D2IA 1UKEA 1OW3B 5KNDA 1WP9A 2J59A 1Q3HA 3HPRA 4ZO4A 3RDPA 3TVDA 2WWWA 3EW9A 4IOKA 1G3RA 1NLYA 1BYIA 5KDDA 2QP4A 4P4SB 1FNNA 3WXMA 5JEDA 1P6XA 2GILA 1E94E 1YU9A 3DVLA 4G5GA 5BN5A 2V7QD 1IY1A 1WF3A 4YMVA 2ZI7A 3BWDD 4C7OB 2X19A 1BO6A 1H8ED 4JZKA 1HEIA 1XRJA 3IQXA 1RRCA 2D2FA 5KPDA 2YV5A 2XZPA 2AXPA 1LW7A 4DT1B 1WDTA 4NZYA 4MKGA 1EFRA 4M2LA 1G21E 2UKDA 1G5RA 2WZQA 1SKYE 2B6HA 3VHLB 1F2TA 5EJEA 2OILA 2R2AA 4Q1BA 1OXVA 3GJ8A 5EXTA 4ZIRB 3VHXA 3PVSA 3ASYA 3SJAA 4LPKA 3NEYA 3A36A 4KXFB 3Q72A 2JIZD 4ZCLA 1G19A 2H1LA 1N6RA 2VHJA 4M9XA 4N0EA 2IYSA 3E70C 3SN6A 2ZS9A 1CR2A 1ZJ6A 2W83A 4JYBA 3SJCA 4HUQB 2BEKA 5G3YA 4LJAA 2FOLA 2GF9A 3IQWA 1P5ZB 1BS1A 1OB5A 1OSNA 3B85A 5CM8B 2MMCA 5L3SA 4OBEA 4O25A 4LV8B 3G5UA 1II0A 2VHCA 3GP8A 2XJ9A 3TSZA 1LS6A 2RGCA 3BH7A 3E5HA 1AS3A 3HU1A 3VR3A 1ZIPA 3VR4A 1C1YA 1W5TA 4Q9HA 3DEFA 3H4MA 1GKUB 1GL7A 3CX7A 2B7CA 3K9GA 1GRQA 1V5WA 1XXHA 4R9UC 1AZTA 4FMDB 4TMTA 1OF1A 3EA0A 5FPTA 3KFVA 3D7MA 1XMVA 1XPRA 2ZRDA 3P27A 1DAHA 4QC2A 1EFHA 1N6IA 2IT1A 4YDSA 2F1JA 4AYXA 3CX8A 3AKYA 3MD0A 4ILEA 1Y63A 3FMOB 2PT5A 4IVQA 5AUNB 3QSYA 2PCJA 3ZVMA 2OFWA 2GCOB 1ZM4A 3LBHA 3ADBA 4Q21A 2W0SA 3MWYW 4XH9B 3TIFA 3I32A 2IA5A 4WBSA 1UFQA 3B60A 3R7WB 1U0LA 1M7BA 1UM8A 2HJGA 3TVTA 2ZJYA 3PEUA 4FD2A 4RFSA 1N5IA 4I99A 3ZQ6A 4LX0A 5H70A 5JHHB 5EE1A 2B8TA 2QRZA 1G7RA 2FU5C 3SOPA 4ON9A 3CM0A 1P3JA 3EWAA 5E7MA 3DZDA 5KSYA 1CIPA 2C99A 2WPDD 1M74A 4Q5IA 4Q1DA 4UXIA 3EC1A 4O2LA 3CW2A 5HCIA 3BFKA 1W5SA 5FTLA 3NWJA 3OFND 4U7DA 1J8MF 2QBYA 1UKYA 4BFSA 4DHEA 2WTUA 3G0HA 3VKHA 2DFNA 1J7KA 5IF9A 1VYTA 5LDDC 5E95A 5EE3A 3THYA 2VP5A 2OEPA 4QOSA 3ZVRA 3QPWA 3ZYCA 4KSCA 5JBQA 5EP3A 3VU9A 2V7QA 1EX6A 3GJ0A 2JLZA 1H8EA 4EPVA 1HQYE 2O8CB 3ND9A 1CJMA 2WKPA 5GVSA 1TEVA 1J99A 4JVNA 4DEYA 2LCFA 5C4GB 3RS2A 2C98A 2JJ1D 1GL6A 1TPZA 2OUKA 3KXKA 3M0EA 5JEEA 1FP7A 4I4LA 1XD2B 2XGJA 4Y0VA 2PLRA 2YOHA 1HE8B 3MCAA 2NIPA 5EXSA 4P32A 3B13B 4S35A 1M6NA 3MGCA 2BMEA 3GPLA 4PR0A 4POAA 2FE4A 2WSSA 3WRYC 3THOA 2JIZA 3W3ZB 2ERXA 3HP1A 2BDTA 2CCJA 4LC0A 4B35A 3K0AA 2Q0HA 4V0MA 1IXZA 3SBEA 3B9PA 1OYYA 4ZKDA 3CO5A 2RAPA 1UJ2A 4F92B 2QTFA 4AURA 4DLXA 2ZI4A 4TT3D 3LLUA 1OFHA 2OLKA 2JDID 4MRNA 3F0TA 1TUEA 1OXSC 3TSWA 3VR2A 3TR5A 2VRWA 2ZJAA 1JJVA 4LGMA 1U9IA 1IN6A 1W2HA 5J4VA 3BB1A 4CEJA 2F3TA 4RZ2A 2ZITA 2O8DB 2EWWA 4GOKA 3WYFA 1SKQA 4QGHA 2QN6A 3IO5A 1G7TA 1NF3A 1SXJC 2O0HA 3MSXA 5DHAA 521PA 1Q57A 3TUIC 4JLKA 3CLVA 3B1YA 1FW6A 2IBMA 4P31A 3HJNA 1BMFD 4LBYA 4KYIB 1NBME 2D7DA 3R8FA 2UZ3A 1DVRA 1MRNA 4CVNA 3QF4A 1FTNA 5AJYA 1T0JB 1DAFA 1N25A 1QDEA 3A4MA 1F60A 3RLFA 3EZ7A 3IIMA 3QI2A 3FTQA 2C2HA 1FX0A 1XBTA 4LBZA 3KKPA 4RSGA 5DSZA 1MO6A 4UKDA 3W8NA 4C0LA 1A7JA 3VMFA 3A58B 4BLSA 2WHXA 4BGDA 4BQSA 2OESA 4C0SA 3OIWA 4LDJA 4CEIA 2HEIA 2YWEA 3GJ7A 3K0FA 3HR7A 4MITA 1LFDB 3D6TB 4IDNA 1DAKA 4BUJA 2WAYA 2WKQA 4N3NA 3KQNA 2A30A 4XWAA 1NJFA 1TU4A 2Q3HA 2GJAA 2OE2A 5CJPA 1OV4A 1MOZA 1T4GA 2FZ4A 2DPXA 4ZDWA 2WPDA 5FOTA 4B3GA 2LKCA 1UBEA 5JJLA 1XPOA 2AK3A 3EZ2A 1E9AA 2VHUA 3GLIA 3EPKA 2ERYA 5FBWB 3NBYC 4JVLA 3LQQA 4FCVA 5IT5A 3NC0C 3H0KA 3UG6A 1RIFA 1IM2A 2EFDB 5KPJA 1Z06A 4NL4H 4TYPA 3BRWD 2GZDA 3M1IA 2QUZA 2BBTA 2ZYTX 3X2SA 4JBXA 4DZZA 1S3SA 2P3SA 2P5TB 4NE2A 4Q4AB 1KI2A 4DSTA 1NN5A 4IHQA 2BJWA 2G9NA 2RGAA 2IHYA 2ZIAA 1W0JD 3IGFA 3WNDA 1S2MA 1AZSC 2BM1A 3AEZA 3AGPA 2VEDA 1DG3A 4D80A 4F7WA 2VHQA 5E3HA 4PSVA 4A2PA 4YLGA 3CBQA 3HYRA 2CJWA 4Z1MD 1MH1A 2GAAA 2JJ1A 3E1SA 1P2TA 2ASEA 3R20A 3AKCA 3SNHA 1TU3A 4L8GA 2NPFA 4HDCA 3OIUA 4BFVA 1P2SA 4NHOA 1P9NA 4RCYA 4Q1CA 5CB6A 1KGDA 4MDFA 3QG1A 3K70B 2A5DA 5KSOA 5EP4A 4E22A 1FUKA 3EG5A 2WOOA 1FQJA 2Z0MA 1X3SA 3CRRA 3DM5A 1UBGA 3DMDA 5ANRB 2CVFA 4FIDA 5CJ2A 3LQRA 3FGNA 3L0OA 4FINA 2O52A 4KFSA 1Q1ZA 3SBDA 5BYKA 3I73A 2XAUA 1RPZA 2OG2A 2VP0A 2JDIA 1TX4B 3SC3A 1W4CA 4LYJA 4JLMA 3IKJA 3PG5A 3A8TA 3WNCA 1NSFA 2P6UA 3QUSA 3TW4A 1KI8A 1G5PA 4TTPA 5B58C 1R8QA 3VKWA 4TMXA 1UEIA 2FH5B 4RD6A 1WXQA 5FI1B 3QXJA 2O8EA 1J70A 1XCMA 2ZU0C 1NJGA 2FFQA 1CS4C 3LBIA 1CJKC 1KSHA 2GJKA 5FTNA 4EFMA 2WJJA 2PZFA 4YONB 2PEZA 3VFDA 1BMFA 3SEAA 4QJ3A 1N6KA 1MABA 3AH8A 3PQCA 4B2LA 1WE2A 1FFHA 4RD1A 5DHFA 1N6NA 2RGNA 3OAAD 1ESMA 2GHIA 4Q48A 4B32A 2UVQA 4WVFA 1FQKA 2G6BA 3U44A 2VF8A 2V9PA 2GEVA 3FKSD 4U5XA 2MMGA 4OQMA 1ANKA 1NMZA 3DL0A 1IQPA 1DELA 1I2DA 2ZROA 1OYWA 1DTSA 2GF0A 4UJ5A 3BD9A 4P4SA 3B1XA 4V03A 2YOFA 3TQCA 1ZM2A 2CLDX 1DAIA 2IF0A 3GJ5A 4YC7A 1B23P 2F7SA 1DG1G 3X1DA 4PAQA 4LHWA 4B3BA 4DWJA 4C7OA 3CRQA 3FFAA 5BWMA 3QKTA 2AFIE 4KFTA 4A92A 1A82A 3BE4A 1W4RA 2X2EA 4ZDKA 2IYUA 1HT1E 4LJ9A 4DT1A 2GWHA 1PLLA 4LHYA 3CNLA 4L9SA 4MYCA 5E4FA 2GJ8A 1EFUA 2QTVB 4XSGA 3BC1A 2DYKA 3ZS9A 5DLQC 1R5OA 3VR1A 2J7PD 4Q7KA 3AF2A 3WBJA 1P4SA 3AM1A 2PJZA 2F9MA 5KYKA 1P75A 1GNPA 2DFLA 3PITA 1Q44A 4QFMA 2G3YA 3IHWA 1W1WA 3AVVA 1AKYA 4R71A 1T5IA 3NTUA 3KQHA 4YDHB 1OIWA 2GJSA 2FN4A 2VYFA 1W0JA 5FBQB 4EFNA 2CCGA 3KUDA 4ITRC 2BOVA 3VR6A 1Z6AA 2ZR0A 4HUQA 5EP2A 5DI3B 4Z1MA 4MRRA 1QBKC 3UATA 3Q9LA 2B8WA 5JRZA 5A0FA 1LF0A 2ZI6A 2GXSA 5FR2A 1DAGA 1UKZA 8OHMA 4NYIR 1RFLA 3BFXA 4IOMA 1GL9B 4L15A 4ZI2A 5DGXA 2IUSA 4US0R 1E6CA 4CT5A 3TR0A 2OM2A 2YYZA 3W3AA 2OBMA 3AVOA 4RFVA 3X1ZA 1E2GA 1G7CA 2W58A 2RHDA 4LY6A 2HLDD 3Q5DA 4GOXA 1E1QD 1JXMA 3GLFA 3C7KA 3MRSA 3MWJA 4WA7A 4I1SA 4YMSA 4JYCA 1JB1A 4GMDA 4BRUA 4G01B 4OK3A 2GCOA 1KDOA 2Z5FA 1M34E 4JBYA 3P4XA 2Q9BA 2A9KA 4LBVA 1G291 4P4UA 1CRPA 1CR0A 1G16A 3R7WA 5JZVA 3C41J 3SYKA 5CIWA 3BFVA 5KNCA 2DY1A 1LY1A 1T8UA 2JLUA 2GDJA 1NVVR 2KB0A 5HR5A 2RGGA 1U2RA 3CRW1 3W90A 5JMTA 3K0SA 4JSTA 4DLYA 2EVWX 1OHHD 1QZXA 5GADl 2IEZA 5HE8A 5SZIA 3L8ZA 1FTSA 4URWR 3C4JA 2ONKA 1KK1A 1KI3A 2X8AA 3OAAA 4M1WA 2X2FA 4PC7A 2CXXA 3I72A 1ZM9A 1Z07A 1E2HA 2BMJA 4A8JB 1PUJA 3NBXX 3U2QA 1KO1A 1OIXA 2EFCB 4HAWA 4LYFA 4BPBA 2QPOA 3TQFA 4PPGA 1S1CA 1AA9A 3AVXA 2IS2A 4CW7A 2QNRA 2QSZA 1L4UA 3EIQA 1XCPA 1R7RA 2OCYC 421PA 1GP2A 2YZ2A 1SKYB 1YZQA 4PQYA 2BCJQ 1JNYA
chains in the Genus database with same CATH superfamily
3LUAA 4ZVQA 5NLLA 2I76A 3CUEF 3RJ5A 5BR8B 2O8CA 3Q2KA 1O6BA 1X0XA 3L40A 3PC4A 1O8BA 4UMDA 4Y8VA 5C8VA 4REOA 4EJSC 2QZJA 3GJ4A 3IBSA 2VQDA 3WNBA 1CJSA 3KSMA 2C7QA 4DCNA 3VAZA 1ZI6A 2AN1A 3HEAA 4MS4B 5LP6A 3HCEA 5LXTB 1KHHA 4J2OA 2EAUA 1JDBB 2VNHA 1IG0A 3GIDA 2E5WA 2IP1A 4M9ZA 2J7PA 4OGLA 1VC2A 4QGSA 3Q3HA 1BOOA 2VO1A 3DOCA 2YDYA 3COVA 3GEIA 4HLUA 4NI5A 2PS1A 2GASA 4ZOLA 5DRYA 5IJZA 4MEAA 5LOVB 3LKVA 4KNVA 3Q87B 1WCYA 5K3AA 3ROGA 5BSTA 1GARA 3A6FA 1LVUA 5IYZF 4OM7A 2YYAA 3WK7A 1AM4D 1CUFA 1BVHA 1N9GB 1L4BA 3LBYA 5AJUA 2XZOA 1GGHA 1K86A 1NVXQ 1BE8A 2QW1A 1EZ1A 2GVNA 1M7HA 4WESA 1CDZA 3TNFA 1G8GA 4JJKA 2GYWA 3K4PA 4G1FA 5D6NA 3EZ6A 3RAPR 3PPXA 2BGJA 3CVUA 2YFHA 1XE3A 5AICA 2ZYWX 2FMTA 1PJ8A 2J6IA 2QN8A 2OMKA 2LZ0A 4JOBA 3NJRA 1V4VA 4XIGS 5AOCA 4B09A 1KJ8A 2G83A 4ZAVA 4AP6A 1S89A 1Q50A 4RK6A 3VO8A 4I8IA 3G88A 3WJAA 1A5SB 1E9EA 1XDUA 4FE7A 1ORDA 3ZOZA 3AP1A 1PU2A 2NUPA 3IDSA 4DABA 4OHBA 4BOYA 4JV5B 3PJEA 3GFRA 5TMEA 2M6RA 1NBHA 1GTJ1 5DXFA 1JQ5A 3IV6A 3TINA 1GAEO 1WULS 2ZU6A 2HLDA 4ZOBA 4D8YA 4XWKA 3V48A 2Q4TA 9ABPA 5NULA 2PJUA 1E7QA 4F93B 5MFPA 3AEXA 3T5MA 3Q7PA 5JS6A 3U4IA 4EA7A 2ZCJA 1YOVA 4EF4A 4YJGB 3NOVA 1G3QA 3AF3A 4C7VA 1LFAA 2WIKA 3HY4A 2GNOA 3WLLA 1DJOA 1REQA 1VBKA 2VQEB 2AN3A 3PLAE 2NOAA 4G0XA 1H85A 1OZHA 4UU0A 3KCQA 2GLTA 3I92A 4WXPA 2JJQA 1ZIOA 3R77A 4JFAA 2VZ9A 4QUAA 4YHBA 1FYXA 1AZWA 1OTXA 4R69A 2XB8A 3K2IA 4TRRA 3WKCA 1F9EA 5P21A 4C4RA 4LGYA 5C53B 3NWPA 1JA0A 3ASZA 3QXSA 2Y6VA 4M0DA 1UQRA 2HQSA 4I3GA 2CXNA 2AXQA 2NNWB 2ZIXA 4IHAA 1N5MA 2P9TA 1W49A 1H2HA 1K3UB 3PV0A 1XDZA 4LWQA 3FETA 4FJ1A 4ACBA 1QZTA 4IINA 4DA8A 1P8AA 3SCZA 1U2GC 3G7UA 1N2GA 2V0CA 1NMYA 3TE7A 1KAHA 2C5SA 4ZVVA 4BLQA 3JWIA 1FL9A 5CB0A 4IDFA 2FTKE 5LKAA 1X19A 4UJ3A 3USCS 2CLOB 1IB0A 1PLJA 3CKMA 2H1FA 5ALQA 1KERA 5B5SA 5D51S 2A86A 3N0VA 3RVSA 3H1AA 2XCQA 2ZJFA 5JC1A 2EG5A 2XQGA 3NHZA 2F62A 2A5GA 2NO1A 3MMNA 2VSQA 2ZJBA 4NWIA 4ZTUB 2NZJA 3TNDA 2O2YA 1NNSA 3DE0X 2JFZA 4N0MA 2HCRA 4Z4QA 2C9MA 1QFJA 4UBMA 3ODGA 1KNQA 1RJ9B 3PI6A 2EJCA 4JBNA 4IH9A 5FOUA 2BRUA 1EFTA 3RVMA 4QD3A 2RMKA 1BE6A 2BMFA 1GRVA 2HV8A 3C14C 1YT5A 2XCSB 2QL7A 1D6SA 3OF5A 3I2HA 1U81A 2OQIA 2QLBA 3ZJ4A 5K03A 3M4YA 5EMLA 1WXWA 1PYDA 5EFZA 3W8EA 1IPFA 1G9SA 1WMAA 1NAHA 1EVLA 4GRAA 5EZ5A 5FTKA 3STWA 4IH4A 2FSPA 1DCMA 4KL8S 5FUBA 2ZEJA 3U7EB 4KXLA 4Q9LA 2HCBA 3AP2A 3L92A 2P9JA 4IHJA 3L0PA 3EASA 4HPJB 1UDWA 3FZEA 4D46A 4E2WA 4FFDA 4P98A 2XR1A 3UMSA 5IT4A 4JENA 3SHWA 1C2TA 4HP8A 3OJCA 1QK5A 1TD1A 2ZJ3A 3EWNA 3H83A 4UAUA 4UEJA 3VC2A 1AKQA 4MGEA 4BNMA 1ISPA 5F98A 3KKLA 1YMQA 2WUDA 4R05A 1ISJA 4FYWA 4IVNA 2ODQA 3TO5A 1DRJA 4OX9B 5CFQA 2XWSA 3M2TA 4A0SA 5DEOA 4ZJYA 2UZ4A 4M36A 2PZLA 2WZDA 3NHAA 4HEA6 3TW8B 3OEWA 4QFCA 1FDRA 3A1FA 3JX9A 2R6ZA 4GM4A 4DW8A 4RTOA 4BP9A 5IJAA 2HTEA 5A4JA 1Z6XA 4XVRA 1AK1A 1CXZA 1N2BA 2QT1A 3DE7X 2QJWA 3IRVA 3EC2A 3LHIA 3MJTA 1EDEA 4PM4A 4MPPA 4F91B 4NFLA 1P1BA 4HS9A 1OZFA 2LPMA 1XHEA 1J21A 3RVLA 3X2EA 4AROA 2H2FA 3DC7A 4L3OA 5TR9A 2HK9A 4DXAA 1CR1A 1KARA 3VAAA 4L9WA 4BN4A 1GZ6A 4HSEA 4DM7A 2TRSB 4KVGA 3RYTC 3D6MA 2CHVA 1EJ6A 5EA2A 4BASA 4C0XA 3PGMA 2NMVA 4Q03A 1OH6A 1P0PA 3D3NA 2VJAA 1JQLB 1COWA 2I1WA 2EQAA 1E79D 3BGIA 2G07A 3ANYB 4DC9A 5ER9A 2XCTB 2BZGA 1XEWY 4TL6A 3ENQA 2Y1XA 1FS6A 2H59A 5EPUA 3T3DA 4F9TA 1QUEA 2ORWA 1SHTX 5BQ5A 1SCIA 1Q12A 3HKDB 1L7EA 4IAOA 4FNGA 4U6SA 3R0XA 2Q3LA 5LZ5A 1ZM7A 2I2WA 5M5BA 3ZVNA 2IYEA 4C0WA 4BU1A 5E6SB 2PUDA 3EVTA 4ZWNA 4TLMB 1PR2A 4YTEA 3SZOA 3ZWPA 2H5LA 1C1DA 3PDUA 4JVOA 3DLAA 4F0JA 5KCMA 4FMPA 3E7DA 4EAAA 2GUWA 1PG0A 5CX1B 2AI3A 3HXPA 4LK3A 4MVJD 5AKGA 2CLHB 4F8EA 4DV5B 3NTQA 3KYCB 3FCYA 1T8RA 2JBAA 3BWBA 4AL4A 3O4IA 2Q9CA 3DJYA 1ODCA 2AWNA 3EF0A 3ECCA 3ONVA 1P1JA 1TEHA 1SG0A 4I1RA 3BL8A 2H4FA 3FB1A 1W46A 4B48A 1GTVA 3HLTA 4QJ5A 2OO7A 2Q5QA 3TLJA 1ZU5A 4F1KA 1Z37A 1ZOOA 2OWEA 3FNRA 3H2KA 2XE4A 3KR0A 3ZZTA 3O1IC 2QL5A 2Z57A 3QE4A 5TEWA 4B6JA 4PTYA 2HIGA 2R7NA 4DMLA 4LYEA 5DTRA 1NLMA 1OZ0A 2BJVA 4RY2A 4LZJA 4NP6A 2D59A 4U0KA 5FO0A 4BNYA 4J3JA 1TADA 5FBHA 3T7DA 3KJNA 1WHTB 1EZ4A 1J06A 3QXGA 1GNRA 1MJGA 3C6QA 4TQUS 3VYSB 4K3VA 2DVMA 1XTKA 3H3FA 4H60A 2GCIA 4KB5A 1F48A 1C9EA 1XYYA 3TECE 1H0KA 4JR1A 4KTTE 3T7SA 1BW9A 2HBZA 3R9XB 4OXQA 4UNPA 3CKYA 4LYYA 2ZRCA 4B71A 1J00A 4WQMA 1ELOA 1QP0A 4LCJA 4NTZA 2XT9A 3EAFA 2B3TA 3I5XA 2X0JA 3DBHA 4TROA 4ADSG 2QLFA 2J46A 1VRCA 2O3QA 4RXUA 4J16A 3TXXA 2PWZA 3FKQA 3E35A 3H2BA 1D2HA 4FXPA 5DIZA 2ZQ5A 4GSYA 3W77A 4EKIA 1T36A 2Z1DA 1EH5A 2O5CA 2CL5A 2E4YA 4A0FA 2JAPA 5IJ9A 2NXCA 4G0PA 5TMBA 3RBXA 4ALNA 4PICA 1FC0A 4YV1A 1G5FA 2O54A 5FCDA 1PQYA 2BPOA 2OLJA 2GBCA 3QEKA 3QVSA 1KQFA 3DUFA 1VI5A 3QEJA 3DTYA 1YOBA 3G5MA 1YR6A 2UUCB 1EUCB 1UP4A 3PRYA 4ZOAA 4XQ9A 3RFUA 1KDTA 2DSNA 1SOAA 1G41A 1LUAA 1NYRA 1U04A 2A0KA 3AJEA 3B53X 1QS0A 3HPQA 1D0SA 3ZCXA 5ADVA 2EF1A 1UZUA 2ZIEA 3JV7A 5GJVC 1AMOA 4PYJA 1JR3D 2HZ7A 2JGAA 4GXTA 1I14A 4DLNA 1TKCA 4EUEA 3QX9A 1S8OA 1DWOA 3U4DA 4E4YA 3BQ9A 4QLBA 5H9WA 1SZPA 1MJNA 4BWYA 3GV0A 1D6JA 1T8SA 2FPRA 1EB8A 1WF6A 2I03A 2RIRA 3K1YA 5G53C 1HLFA 2WP8J 4H31A 2NADA 3MWKA 1W59A 4FKZA 5AKEA 2GZHA 5IZ4A 3IMFA 2A1TR 4X7MA 4B6GA 4D98A 3ZE7A 3WLRA 4DS3A 2FN3A 4WEQA 1XTQA 2KM1A 1QJ4A 1UFKA 3O4VA 1E0SA 2XBLA 2FJ0A 2Q7DA 4IXDA 3NWBA 1XZJA 1IU9A 3G9XA 1GPLA 1DHRA 3W9UA 1ONOA 1E79A 1OFGA 2MYUA 3HWWA 3PA6A 3RUHA 1R6TA 4EYOA 3B3AA 4YP5A 2RGXA 4Y6RA 5AM3A 1L8OA 5HK9A 4Y6LA 2QLLA 3A6DA 2CUNA 3BL5A 3QK7A 3Q7RA 4XUEA 2OGSA 2VTKA 3AR4A 3I42A 2C9OA 2OFPA 2FE1A 1YTUA 2ZJ2A 1O8CA 2AVNA 5T64A 2D13A 2PU7A 1UOOA 3DD1A 3V1KA 3IBGA 4GOMD 1ARZA 4AJ2A 1QXSA 1O4WA 2Q1YA 3OCUA 1OH8A 3PNPA 4X5OA 1UBSB 1ID8A 2AFIB 1P61B 3U4GA 3BT7A 2C8VA 2GZ1A 1H42A 4EY8A 4MVJA 2OXRA 3WVNA 4QUIA 1ZGGA 2GJ4A 1M6YA 3ZKWB 4B7UA 3OLZA 3D6HA 3CIFA 1SXJB 5AQEA 3AOEA 4CTOA 3L49A 1E5XA 5J5AA 2VT6A 5AMXA 2JKZA 2LVBA 3LIPA 1VLJA 3AWDA 1SHJA 3CCCA 1DC5A 3K72B 4KDFA 5AXCA 2HR1A 2FUNB 4AO6A 3RT9A 1JI0A 4JKIA 5EE0A 3QVOA 5BN4B 4H7KA 1T4CB 1UKBA 4XEHA 3C4VA 3SC4A 4QLOA 2JKYA 5B2ZA 3T9BA 1E2EA 4Z4FA 1P18A 1W76A 2PGJA 5LYJF 1L4YA 4ZO9A 1RQGA 4M46A 2OHIA 4FP9A 3T1HB 3JARA 1YR7A 3SX2A 3M82A 3OJLA 1Y7LA 5FL3A 2BYTA 3O2JA 2FKNA 3DBLB 1ZGBA 5PGMA 1ZNXA 2WMOB 5BOVA 5IABA 3L4JA 4QTXA 2WWYA 1MR3F 4J0FA 2ESRA 1WU8A 3K05A 5M29A 2PS9A 1MNAA 2ZTSA 1M2VB 2ZVDA 2ZDGA 3F49S 4WK6A 1X7ZB 3WLHA 3EA4A 3BXGA 4E2XA 3G79A 3LCRA 4W7IA 4GZ5A 2B35A 4UUNA 3QA3E 4JJ6A 2CHQA 4X6XA 4M7OA 1Z08A 5LLDA 3CF0A 2AMFA 4PLGA 5D3MA 4ZRMA 1E2QA 3IV7A 3IAM6 2R84A 2EEZA 1KL7A 2GEDA 2QNIA 3KZOA 1AF7A 2WILA 2CE7A 4FI3C 3GLFE 1GAJA 2ODWA 2MSDB 3BG5A 3HYSA 4BIMA 3CLSC 3P71T 4N1AA 1QG2A 4A0HA 4BMOB 4DV0B 3H9EO 1VSVA 4MYHA 4MKHA 5CA1B 5K0TA 2VQ3A 3KOYA 1CF9A 3I52A 1XAJA 4E2FA 3TPZA 1G4HA 4MMZB 3RHSA 5E1DA 3ER6A 4HB0A 1B6GA 1GN8A 3QVTA 1JR3A 3R6WA 3NZEA 1NG1A 1VIMA 4IQ0A 4LMBA 4QPNA 1C8LA 1WW8A 4EMUA 1JFSA 2VBCA 3WK6A 3ETJA 2YMQA 2RH8A 1IY2A 3KSDO 2JIDA 4WY2A 4KR7A 1SIWA 4B3JA 1GR1A 1QLJA 3MCZA 1CBUA 2Z2ZA 3CUYA 4LSWA 3SS8A 3ZV7A 2EATA 1T8WA 3NKFA 1AGYA 4D9EA 2QDXA 1DQYA 2QHXA 3D31A 4E1BA 3Q3IA 2W11A 4YRCA 6AT1A 5L3VA 4YY3B 5IHXA 1I4EB 3FDFA 1ACMA 4C29A 3B1JA 4DIDA 1PEAA 4JQCA 3G6KA 3SF8A 1HY3A 3U7QB 3J80A 1X77A 5HF5A 1I7SB 1XK6A 3MAGA 2EKPA 3LXXA 3RVOA 2FFJA 3FWKA 2JEYA 5MGBA 4RY8A 5HKOA 3IKLA 4QQKA 1RM3A 4JQSA 2EBWA 1C7FA 2A88A 1PWXA 4CMKA 3O9ZA 2ZSDA 1YUBA 1NAIA 1EVYA 1X13A 2BUCA 3IEUA 4WKCA 4Y9RA 3DGEC 5KNCD 4C5AA 4BB9A 4MUGA 4JP5A 4TKVB 1UH5A 4IICA 1BC5A 1LBHA 4AYWA 3T5GA 1LPPA 3GRKA 4LVCA 1F8YA 5IASA 3R5FA 1G55A 2ZVJA 3BSFA 2FKAA 3G0OA 1OJLA 1WQ1R 1MB2A 4FQ7A 1P44A 1UMDA 1XALA 3A14A 1FYVA 1N2CA 3H1FA 3QKRB 4YIKA 2BEJA 2DHDA 5FLKA 3SLRA 1LEHA 3AEUB 1Q0UA 1WB4A 4NYJQ 5CAEB 4MV5A 2FEPA 1R4NA 1YSCA 4NMWA 3GCWA 2ZYHA 3TQSA 4BLPA 2GF2A 1EX7A 2GRAA 1NI3A 1CLUA 2R79A 5BSRA 2FEOA 2B8NA 2ZSKA 1PEYA 2XEDA 3UENA 4F85A 3QNMA 2XLCA 2VJMB 2UUOA 2AOTA 4O3MA 4R2LA 2NQ2C 5JWOA 2BTQA 1R9MA 3NUZA 4H2DA 1JPVA 4J76A 4EBFA 3T1TA 1XVVA 4ZO7A 1T5LA 1NJ5A 3T5BA 3VPGA 1CX9B 1ZVKA 3IIJA 3SP1A 3AIMA 4GQIA 4E5PA 3OFVA 3L4BC 5BT9A 4BECA 3UUGA 4EYEA 1FFAA 3GAAA 4CT4B 1ZM3A 1DO2A 4M0FA 1NN1A 4HNVA 5J5VA 2K5UA 1EWYA 1MAUA 1SRRA 1Y1LA 1ZIXA 1TYBE 1DC4A 2J8ZA 2JBWA 1O6GA 3PGLA 4YFYA 5ER6A 2OPHA 3S7TA 3SMQA 1JKMA 3HEBA 3L8DA 3QOXA 4ZIRA 1DO0A 1SD2A 2BHRA 2FEWB 3W4IA 2XOKD 2Z95A 3L0IB 3R5XA 2UYQA 2ZS7A 4WMLA 4ZZ2A 5AW7A 5L3QB 4QGFA 4RORA 1WJGA 4JI0B 4TQAA 2FLKA 7AT1A 2J9RA 4BWGA 2ODBA 4K8RB 4IIVA 2CXPA 3BKWA 1UINA 2A78A 3ANTA 3IMEA 4KE6A 4XLLA 1UWCA 1XCGB 4XSHA 2JGDA 1JEYA 2QG6A 3ZIAD 3HHEA 5FADA 2Q3CA 2VCHA 3K73O 3PPYA 1WCIA 4WXRA 1W94A 1K8ZB 3PFBA 5GM2A 3FFXA 3GPIA 5T4HA 2QWXA 3I0NA 1G2PA 2ANBA 4EHAA 4DDWA 4QPZA 4AS1A 1I33A 3WRXC 1WUKS 2G04A 3GA0A 2F67A 4GBMA 4AXXA 2YINC 4AZVA 4OHYA 5AW4A 1P3DA 2OZEA 4NH0A 4H35A 1Q7CA 4FLMA 2GRUA 1YBHA 3KEQA 4ARSA 1SN7A 2O9JA 4OVKA 3PD7A 3UWSA 3LT0A 5JR3A 1A5ZA 3TEJA 2V3CC 4ZCMA 1IJFA 2PL1A 1UWLA 4WFIA 4P0PB 4AU1A 1W9HA 4E6PA 1OFUA 3WMFA 4ZODA 4IFBA 3FRJA 4IW3B 1H0RA 1T3HA 3BTSA 3T7JA 3W2EA 4CN9A 4P7GA 1OH5A 4UD6A 4XGNA 1EP9A 4GDFA 3KYBA 3BILA 3OOYA 4L73A 1IZ0A 4FHEA 4LECA 4LX8A 1C7IA 4OPMA 1QVAA 1Y3AA 3CVOA 2FSVC 4HDRB 3RUDA 2JA2A 4S1PA 2X1LA 5AOAA 1E9CA 1R6DA 1FDUA 2AJDA 1ECLA 2OB2A 4Z7OB 3ZJVA 1RWWA 4KQHA 4M1YA 4CIBA 3OI7A 4FE3A 1V48A 2TSYB 4HYQA 1NG9A 4B33A 1S2IA 5CFLA 1DEXA 2I8CA 3MINA 4KBGA 4RQBA 1HYBA 1DL5A 2KPOA 4UTXA 4LVUA 4NAHA 1MX5A 1EG2A 3HKBA 3P32A 4WNCA 3QLUC 4NF2A 5E3IA 5A62A 4UCXA 3BUSA 3Q8MA 3P2JA 1G2OA 3P45A 4XGKA 3DKVA 2A1IA 3HS3A 1R27A 1QP8A 2G1KA 4HWGA 1TK9A 4RKQA 2I4MA 3I28A 3TPCA 3LWBA 1MO3A 2D5CA 2VOEA 1JECA 3A6ZA 3WJ7A 3Q7TA 1N2XA 2O2ZA 4LHVA 4MI1A 4MI9A 3VNSA 3V2HA 3GJ3A 4EY7A 4URVR 2FZVA 2PCLA 3H9BA 2DBZA 2MSLA 3KHSA 4KIWA 4R2XA 5K5EA 2WVHA 5EJ9A 3K8QA 3QVVA 1XEXB 1Y0BA 2FW1A 2OM6A 1T3LA 3U3JA 5CDYA 3BERA 4NQRA 5JROA 5DDIP 1D3AA 1ZHOA 1PNTA 2W48A 1GFWA 4GH5A 4HEA1 4WZZA 1SC6A 4S2UA 3UM9A 1HFEL 1FFWA 1HDYA 1KEEB 1U2DA 3IHKA 2FJUA 2R8XA 2Y93A 3T5CA 2OD9A 1KJIA 5GONB 4BNUA 4XR4A 1SXPA 2IZ5A 4BKPA 1CZRA 1EXNA 1USVA 1XELA 3Q5GA 4IKPA 2JZCA 2WVJA 4LS3A 5ICFA 2JD1A 4RKYA 4UHFA 2GJ9A 4JLPA 4US1R 3I62A 1DWPA 1IAVA 3RG8A 3FYCA 3ND8A 5IVIA 4JH0A 5DBOA 1WPGA 4RWZA 3M2PA 2FG5A 3FJYA 3A1WA 5AKIA 2C84A 1FFSA 2GD2A 2DUWA 2VFAA 1JDNA 2HJHA 4ZMSA 1TAHA 2OAEA 1NP7A 4I2VA 3F47A 4MZXA 1BA3A 4P5PA 1XMIA 3GFPA 2FG6C 3QITA 1FP6A 5SICE 1NBAA 3WB1A 2HF2A 3AU9A 3FLEA 2X23A 3LAWA 4KAXA 4DIEA 4MVJH 1XYGA 2XOKA 1G20E 2H52A 3GL9A 3RIEA 4B3IA 1OX5A 1UAYA 4I66A 5ARDA 3WGKA 1HUQA 1ZNZA 1VHLA 4S2EA 1NVDA 4JI2B 4KLZA 4ZKEA 5TGDA 3L1JA 2OV1A 3L77A 2PQ6A 4CM4B 2D06A 4JYPA 4LJSA 5DNUA 1NGSA 2J0UA 5JNVA 4MGIR 2QY9A 5L51A 4H6VA 2I4NA 3GD7A 3NBUA 4KACA 1Z17A 2ZTLA 3HN2A 4WH0A 1U4OA 3DLIA 1Z74A 5FD8A 2OCBA 4DUGD 5BUZA 4DY4A 3E3NA 4RV5A 1K6MA 3B7GA 5LXTF 5KYUB 3GA5A 4GDMA 4UCFA 5KKNB 2X77A 1XXHE 1U7XA 3A1NA 4N54A 4PR3A 2IEBA 2Y4NA 1U8YA 1IC6A 4M49A 4OO3A 5CT5A 3WLKX 5CDHA 4JC0A 4FSDA 1XLUA 2QSJA 2PMCA 1W48A 1ZRHA 2X2OA 3DZGA 1PUIA 3I8SA 4EATA 4PYKA 5J4KA 5LOVF 4OH7A 5CX4A 5IJXA 5K3SA 3E82A 4EELA 3MK31 1CTQA 5CTAA 5ITZA 2HL6A 2XE7A 3DWGA 4OHZA 1K5PA 2XTNA 5BOSB 3PFWO 3U49A 5KSPA 2HJRA 1EYZA 5AOVA 1M5RA 5BQOA 4B43A 3MIIA 2R4QA 1Z13A 4OB7A 3U13A 2VHVA 1R18A 3H2SA 3E58A 4MQLA 4X8LA 1TVCA 2O2CA 4UDNA 1MIOA 1N5LA 4CNQA 4NNPA 4Q1FA 4F86A 3IT1A 1ETHA 1G1AA 1MAAA 1UT6A 1XLTC 2P0YA 4IX9A 4JT9A 4HNAA 5ESDA 4B2PA 1NU8A 4DIMA 5AW6A 1FVOA 4RA6A 3D81A 4Q66C 4D4HA 4H9GA 5LIRA 4REMA 4PRYA 2Y27A 2DWOA 4L2IA 3L3BA 1JFRA 2AZDA 4GOOD 1L7BA 4DRZA 3PFIA 3BWVA 1JUDA 4XX0B 1DPGA 1K5HA 2D0DA 2FZEA 2O5VA 1E1YA 2ZWIA 3D7RA 4RJ2A 5CXXA 2R8BA 1HX7A 4Q7MB 1V8OA 3TLAA 4WLFA 1I2AA 1NP3A 1Z0DA 4GP7A 1ZD2P 2W8BB 1ZIYA 2J5RA 2X13A 5EHZA 3TFOA 2B20A 1OZAA 2O3SA 2PSFA 5LDGA 2J9GA 3SZRA 4FOLA 4ZU6X 1CIVA 4DJFC 1W5FA 3PICA 5I9TA 1TUBB 2JGFA 3FOEC 3C8DA 4H6XA 3RS8A 1R0YA 3U48A 3KQQA 3IBYA 1KKUA 4HYTA 2R6DA 1E3WB 1T9GR 1U3CA 3H97A 1TJ3A 1K8YB 1S2NA 1VG8A 5GJBA 1EJBA 1M6VA 1XCLA 1C8VB 1P9LA 2X6TA 2YN4A 3G9UA 4MB2A 3ELUA 4BNZA 3S40A 3K8OE 1WQ4A 2TMKA 5H16A 4KFRA 1D07A 3HBLA 3OT5A 3CKLA 1XGKA 3JQ7B 4JOCA 1JAXA 1HQDA 1WB9A 5FYQA 4LN1A 1TEXA 4DUYB 2XGSA 1H9CA 1KI6A 3F97A 3FA2A 3LHKA 4FFBA 4HTFB 4KQFA 4RO0A 2PZMA 1O9BA 4PZDA 3TLGB 5EUQB 3RRXA 3UXEA 2QD3A 4DLTA 3HQ4O 1XX6A 1DG9A 2OXFA 4MR8B 2W2LA 5K8LA 2J6HA 1TUIA 4MK4A 3GLRA 3L41A 1KK0A 2HMTA 4JEIA 4LEIA 2J48A 2Q41A 4U7FA 4NH4A 4CETA 4L76A 1NQAO 2JASA 5EMMA 1QF7A 2VJLA 1A8UA 4RY9A 1IZYA 3AYZB 9GPBA 2PZAA 1X80B 1CUWA 4PZCA 1T25A 2C4KA 2NU6B 4UBIA 2JFUA 1L5MA 5BMVB 2ZUDA 4GXRA 1L5RA 1Y6ZA 4I5GA 3V80A 4KSBA 4WOKA 5DCUA 2X8JA 1P31A 1ZW6A 5G1NA 1QVRA 3VUFA 2Z98A 2YHBA 3PYXA 4FBMA 4IIYA 5JY1A 2Z2KA 2Y0BA 3QKIA 3VPHA 4BZZA 2YYSA 1UMBA 2RGEA 5T7BA 3IEKA 1WBBA 3U7HB 3H84A 5I3ZA 2MJLA 1TO6A 2P9FA 4N0PA 1BMQA 2ODNA 1R2QA 1GZSA 2P6RA 1NR1A 1TJPB 2BONA 2DLNA 3I58A 1MV8A 4L74A 3RCBA 4B40A 4C03A 3U4QB 3P9SA 3R7FA 1ZWKA 2VHZA 3EDOA 3T4UA 2GAOA 2A67A 2QLJA 3EWSA 3OECA 3T41A 3AV0B 4MHSA 3OJ0A 4DUGA 4OA8A 3NHUA 1Z39A 4NX2A 1EK2A 1WUHS 3DE5X 2B2XA 1SCJA 3AV3A 3I9OA 4XWOA 4PLWA 1EXWA 3AETA 4BMSA 3KR2A 2IYZA 4PZZA 5CMLA 5EZSA 4QARA 3UMRA 5IS2A 2A2ZA 5CNKA 4KVZA 3KSUA 3EF3A 4ZQEA 4IDDA 1S2DA 2JFOA 4BBZA 3COPA 4CWAA 1EDDA 4QYSA 1JDPA 4YNBA 5IW8A 1U5BB 3DP7A 2YICA 4AIRA 3RFXA 2E18A 2X9VA 4G67A 2JCYA 1P1HA 2L42A 4C5BA 4P0QB 1IYZA 1FXWF 3TAUA 3PXEA 4D41A 1D4ZA 2F1HA 4B76A 1LVGA 5L9AA 3EIEA 2QP9X 1Z4QA 3ZGVA 1W88B 5KX5A 4FNAA 1JEEA 3IDAA 5F3DA 1EIZA 1TCAA 1FDIA 3MWDA 4HTAA 2QTBA 2RGDA 3W9SA 5IVPA 1P1IA 3VJRA 3JPWA 2PWAA 2W2KB 4K81B 5B7NA 3HJBA 2EC5A 4YPFA 2OKCA 3GEHA 1R4MB 3QUTA 2JLXA 3EODA 2JFNA 3BJIC 4Z2AA 3OU2A 1EAMA 1RWPA 2R8PA 3JAKB 4MW2A 2VF2A 4G8BA 3PWZA 4P3XA 2VH5R 3OTOB 3N5CA 3THWB 4KWIA 1W5EA 2C31A 3ZHYA 2F43B 5J40A 2PANA 4Z3KA 3SXUA 3UEOA 2VYQA 3EFOA 1DT3A 1DQPA 2X5KO 1QPGA 1SVNA 2B78A 1N2JA 3KYDA 3IYLW 3FD8A 4BMCA 5HBRA 4CKBB 1LWOA 1V9CA 4GBGA 4MLCA 3L7DA 4TRMA 3IAM1 4F1WA 2RAFA 4Y2XA 2QM3A 2CVPA 2JGRA 2UYOA 3GFTA 3PXXA 4ZVPA 2FP4B 4Q0MA 4Y6OA 1URPA 2VRNA 4F72A 2Q6KA 1L7AA 4V24A 1QIDA 2CDAA 4ZVOA 4OLBA 5ALNA 2C0QA 3SZUA 4ZYTA 3L4EA 4P7KA 3GNSA 4LXYA 3RV3A 4DSUA 2LTAA 1DIGA 2OFFA 3AKZA 1YQQA 2VL7A 3LVFO 3UG7A 2DH6A 2H5EA 3MTJA 4MYUA 4QHTA 5I4BA 1R5NA 1UBHS 4U3JB 3GLFB 4B75A 4HZIA 4AICA 1KY4A 2D6FA 3PHJA 4HK4A 3W8RA 3DGFC 1TAGA 1GA6A 4E33A 3A4IA 4IEEA 4EYSA 1OLXB 2QDKA 4UXHA 4X44A 5FWDA 2FR8C 1H4VB 5G41A 2PR7A 3WGOA 2CN1A 3FYUC 3FNIA 4YRBA 4AY6A 3NHRA 2AMLA 4QRIA 3T9DA 5ERYA 1W2GA 4XCQA 3VNQA 5A3JA 3IAS6 2W43A 4AY2A 3O26A 5KNCH 1EFPB 2YFKA 4NU5A 1ZWLA 2Q21A 3D6JA 2CL7X 2I6GA 1UJCA 2H4WA 4H15A 4YECA 4ZT3A 3JQBC 3GZJA 1DRUA 1V3VA 1THGA 3GEMA 2AFHA 4PFSA 4AYTA 2IE0A 3ETNA 1AZLA 3B6IA 4I1IA 1XA4A 1PZXA 5D84A 2BY4A 1OWPA 2QN2A 4K87A 4RVDA 4E5UA 1IWPB 4YQEA 3USZA 3ZHOA 1QHFA 3LGSA 3NDIA 5HILA 1RT9A 4QFBA 3L8HA 1IQ0A 1S4QA 1V41E 1CV2A 1WOMA 4Q19A 3CYFA 4FC7A 4I19A 3DOHA 4EMTA 1LBSA 4GU5A 1E3DA 1BJTA 2SKDA 2XF2A 4JCOA 2DFTA 3VRHA 3ZI4A 4B8WA 3A9WA 2WD9A 4C4PA 2OHHA 2C82A 4B3CA 3NKVA 5HJ7A 5JTUA 4WE3A 2QMUA 4C0JA 2AF4C 2LXNA 5B3LA 4JZYA 2V5VA 4WZBE 1ZY2A 4NMXB 3QV1A 2HDNB 4YJKA 2YIJA 3EGIA 1DDOA 1T9HA 3K9WA 3OZXA 5K8JB 4KPEC 3FBTA 3AHIA 5BN3A 3NTLA 1H2WA 1PL7A 1YQTA 2WSYB 1NQTA 5BRJA 2BI4A 3PUWA 5C18A 4JR2A 4WA8A 4KZKA 5ALRA 4C30A 4BTEA 4PLZA 2CZCA 4Y98A 5ED0A 1YRLA 2FR0A 2DPYA 1GPYA 3ZXUB 1QO7A 3ILVA 1WEHA 4OXKA 1LLUA 3LWNA 3DV0A 4PLHA 5A9TA 3ND6A 5LLSA 3STXA 1QHEA 2P27A 3OLYA 3TAXA 4A10A 2IHNA 2FW7A 2X22A 1FTGA 4NV0A 4JJFA 4ONEA 3ZDRA 3EVDA 1CZOA 2F3QA 4D0RA 1QZUA 2DAPA 2GPSA 4JX9A 3PXBA 2DKNA 2JATA 2Y71A 3D2AA 4UREA 5T5QA 4EABA 5JNWA 3L7KA 3PDIA 1R9GA 4KK4A 4DCOA 1NV9A 3IQGX 2R44A 3HDHA 3NBQA 5MFZA 2BGUA 1AXGA 4D6XA 3IRUA 3RS5A 3AIKA 2G67A 2ACKA 2HX1A 4QUHA 3KKOA 5FUXA 3DV2A 1GGMA 3MMPA 3AUTA 4UMFA 4D26A 3WKDA 4ZYLA 5B58T 4NECA 4CMGA 4YH1A 3P52A 3I76A 1OAKA 3TOXA 2CUTA 1RQ7A 4MQ6A 4OQPA 5A03A 4FGJA 4MR9B 1JA1A 3NCHA 3IUQA 1BGVA 4WCFA 121PA 3ZK8A 1QVZA 1NVVQ 2Q4EA 3E0XA 1D4AA 3S28A 4B82A 5LMUB 2IW3A 3VH2A 2WF7A 1Y5MA 4RMHA 3CCFA 2JFBA 4BJ6A 5DMXA 1P2UA 1I4WA 3FSEA 1YZLA 1WDWB 4H18A 1YWGO 1E4YA 1R10A 1HEYA 3AL2A 4KQ9A 1KIMA 1UBOS 2HWXA 3UKDA 3WGJA 4Q4CA 5H81A 1UEJA 2WOJA 4I14A 1PCXA 1K8RA 3ZGOA 4ARZA 3DEYX 3GC6A 3R5SA 4OBBA 5L53A 3ZJUA 3TQTA 1FMTA 3DOUA 3KZKA 1XD9A 1ZD4A 4AF8A 4KH0A 5HJ5A 3TLBA 5AR1A 1U28C 2QMQA 2ZRNA 4MWGA 4G5OA 3KVOA 1FSGA 3E9MA 4Y7DA 5EXPA 5KQPA 1U5AA 4PLVA 4ZALA 2HSDA 1IB6A 3OH8A 3RRMA 1YJAA 1QO0D 1CY8A 1QDLB 2PSHA 2Z6VA 3OTGA 3Q85A 3I64A 1SUSA 1T4BA 1I24A 1Q11A 1T2UA 2XMDA 3O3OB 3DTNA 4I1YA 2G4VA 5JCJD 1HV8A 5CLHA 2AIRA 4WI1A 1KYXA 1VG0B 2Q1UA 4DJAA 3ES9A 4LI3X 1WZUA 3BIWA 4WCVA 4HAYA 2PX3A 3AI1A 4ZREA 3NBZC 1WMSA 4KOEC 4C0QC 4EWLA 3STYA 1DO8A 4PS1A 4Y2JA 2B2CA 2SICE 1GPH1 3I3OA 3V2UA 5C37A 1UDAA 1CEEA 2CV2A 1NR7A 4LQLA 5DVZA 5GQSA 5GV8A 4B7AA 1OR8A 1YR9A 2AR9A 3LZCA 4XD7D 3DLCA 4HMQA 4MIEA 3PE3A 3E6AA 1XJ5A 1NBMD 4PGMA 1F1BA 3PC6A 3H9JA 4LJ7A 2MYNA 4V3BA 4HAUA 3RO7A 1DV1A 3A4YA 3GT7A 1UADA 2Q6LA 1FFYA 2FW0A 2HCJB 2JD0A 3KKQA 4PSAA 2V7EA 3EXFA 3GIWA 1LBEA 5CYGA 5IJ0A 3C3MA 3I2YX 1Y3CE 4D6YA 4JLBA 3T9CA 2O06A 2VUSA 5DNVA 5IKEA 2EL7A 4A0RA 4CL0A 3QQ5A 2PFSA 3AHGA 3HV0A 4MUEA 3VR0A 3R7BA 1CFJA 1WZ2A 3UMGA 2ZJ1A 1VKNA 2JLRA 3K70C 3UV6A 4JK3A 3KQOA 5HGXA 1NJ2A 5CA1F 4PGFA 2AI2A 3O4FA 3ZWXA 3KVNA 1P1KA 4HLQB 4HRXA 1U8EA 3AIIA 4OAOA 1FIUA 1JDTA 3H75A 4G41A 2OHOA 4LJ4A 4FNOA 4WKPA 4XTCS 3W5AA 4RVCA 3W05A 2J6CA 4D42A 2ZAOA 4RMNA 1OXXK 1W73A 1IEVA 2O8VA 3IUNA 3ACDA 3Q7QA 4A5OA 2YKGA 2C9DA 1YVPA 3RVNA 3P2OA 1G42A 3DH0A 3LLVA 4H6PA 4PO1A 4COKA 4DWVA 3R1IA 4POOA 4OMDA 4XDHA 2V58A 4G26A 5KIAA 2AH5A 1UKVY 2QK4A 4QA9A 2BSXA 5DWVA 1UBNA 3DLHA 5KOHA 5ITVA 1WZIA 2A7QA 2RG1A 3JD1A 4EHLA 1K5DA 2Y0CA 2ZIWB 4GZ6A 5DNYB 4JIGA 2D0IA 4GVLA 2ZXUA 2OV8A 5CDFE 2V96A