3KQLA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
total genus 148
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqlA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqlA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqlA01
3VR4A 1G7RA 1HQYE 1SHKA 1CU1A 4KAXA 1W36B 4YC7A 2QM8A 4GPTA 3H2YA 1FL9A 3NG1A 4TLEA 2ZAOA 4RFVA 4I1VA 2PJRA 1BO6A 1UKVY 1IN7A 4RZUA 4X8LA 4Q1EA 5DE3A 5FOVA 2IWRA 4B32A 2QBYA 4B73A 1XMJA 3D3QA 5F9FA 4LHZA 3PEWA 2ZXUA 1RPZA 1LNZA 1E69A 4A6PA 1CULC 1YZUA 3P20A 1P9RA 4FI3C 2WWFA 2JDIA 1L2TA 5JI2E 2IUTA 1Q20A 1KJYA 2GJAA 4UJ5A 1F60A 1CXZA 3ZVLA 2JJ1A 2FSFA 1G8HA 2OAQ1 2R65A 4NE2A 4URYR 2PT5A 3VAAA 1D9XA 4P0TA 1YR6A 4IOLA 3MGCA 1J8MF 2WV9A 4DRZA 3LY5A 2PMKA 4A8JB 1JXOA 2QGNA 5A5GA 3EX7C 4JL8A 3TE6A 4HLUA 4B71A 1GL7A 2XAUA 3PG5A 2D2FA 2ZRMA 3QIAA 2V55B 3GFPA 4E07A 4EPRA 5GJBA 3C41J 4Q9IA 4RZ3A 1TF2A 2VEDA 4ZI2A 2R6GA 1EG7A 3ASYA 4DLSA 5JJIA 1N6LA 3U3MA 2O8BA 3MJHA 3DOFA 2PZEA 3UXMA 1CR0A 1TX4B 4LGMA 2ZUCA 3PJRA 2Q9CA 4B33A 1SQ5A 1XMIA 2LWIA 2QTHA 5FTNA 1XZPA 3AF1A 4PSVA 1Z2AA 3L0PA 4PZZA 1T0HB 5FOXA 2YVUA 3R9IA 1FTSA 3K0EA 3UMSA 5DI3B 1RFLA 3SQXA 1G19A 4B2IA 1CBUA 2ZUBA 3MLEA 4QL3A 3SFVA 1KTVA 5P21A 4P32A 2N1BA 4X8HA 1KDTA 3QF4A 2ZYWX 1YZQA 4Q7JB 1L7VC 2IF2A 3GLIB 2Z6VA 3EWAA 4NKRA 4KSCA 4NCHA 2AXPA 4KO8A 4WZAE 3GJXC 3KKQA 2J0UA 4TL7A 2ZSEA 4ESHA 1XFAA 3SR0A 3P26A 4B35A 1UDXA 2J1LA 2KI5A 3TSOA 4IDHA 1M7GA 1YR8A 1PLJA 3H84A 3VR1A 5IHPA 4IEIA 1OB5A 2CHQA 3I72A 2RKOA 3AQ4A 1RZ3A 4PQRA 1Q22A 4URWR 3TVDA 1AJEA 2X8AA 1IXSB 4YMVA 2QAGC 1WBDA 1RYFA 4CIDA 2XZOA 2ZRBA 2QORA 1G5PA 2H7VA 5G3ZA 1U81A 1QG2A 2ZYUX 2ZM5A 1E2EA 1Z63A 3LXXA 2FJUA 1GTVA 1EFRD 2ZR0A 2G0NA 4B3CA 2GCOA 1GNRA 2FWRA 4C0QC 1QVAA 1ONBA 4FINA 5BYKA 4KI0A 3AM1A 4PAOA 2XNDA 3WYAA 4JLNA 4US1R 4IRUB 3AVOA 1T6NA 2VHJA 4OI4A 3H4MA 4AC9A 2P6RA 1E2LA 2QTVB 2AFIE 3BGWA 1V5WA 2BVNA 3AH8A 3A4LA 3OE7D 4A8JA 3OAAD 4Q5IA 3QENA 4DDVA 1RRCA 1HEIA 1DE0A 2AWNA 2GETA 4NYJQ 1FOEB 1Z28A 5EP1A 3VQTA 2R6CA 2VF7A 2KJQA 3PR1A 5KDOA 3HPQA 3W6PA 1WXQA 2CNWD 2J41A 4LV8B 3AVXA 1ZINA 2D06A 2OILA 5HE9A 4TYYA 1Z22A 4NYJR 4PPNA 1X8LA 2ZI7A 3MSXA 1F2UB 1FNNA 1RJ9A 2FEOA 4OJQA 2N46A 4FWIB 4HAYA 4HAVA 4JT4A 3SN6A 4M2LA 4TN1A 3KQLA 1NVUQ 2WWYA 2ZROA 3BFKA 3KZ1E 5JJLA 4MRNA 1N6HA 1OXSC 1H65A 1ZM3A 3K09C 1SVWA 5E7IA 1IQPA 3ND9A 3W5IA 2R6DA 5JS7A 1J70A 2X77A 3MG9A 3MCAA 2PBRA 1OB2A 4W5JA 5DN6D 2JLQA 4LOAA 3VX3A 1YE8A 1GSIA 3EZ7A 2EFEB 2ZJAA 5HE8A 3EPKA 1D5CA 1M8PA 3T5DA 3KB2A 4YMWA 4DB2A 5TMPA 3Q3JB 3BRWD 5AJVB 1VECA 3B5JA 1UM8A 1XTQA 2G9NA 1HV8A 2V6JA 4G5SA 4CT4B 5FI0B 1VHTA 4A92A 5JCZA 2ATXA 4CEIB 3PFIA 2ZRKA 1N6RA 3NEYA 2FFAA 4Q66C 4RD1A 1E99A 2ZI6A 1KKLA 3QVVA 5AJXA 3QF4B 1ZNZA 4O2LA 1W0JD 4UXHA 1C9KA 2XOKA 3ADCA 5EE0A 4DDWA 1E32A 1UBGA 4Q18A 1GDDA 5FOUA 5K8UA 3GP8A 4CEHA 2RGXA 4Q1BA 1SKYE 3CF0A 3HR8A 4FWTA 4RJLA 1Q44A 1E9AA 1SXJD 2VP9A 4LX0A 2ODBA 3NH6A 4Q03A 2A2ZA 4A6XA 2PLFA 5H8WA 1EX6A 1N0VC 4RKFA 3RNLA 4Q9LA 1Z83A 3OFNA 5B2ZA 3KQHA 1FP7A 3U3RA 4BFWA 2W6ID 4F4IA 1LS1A 1HH4A 3NKVA 2BMJA 2A5DA 3M1IA 3MWKA 2GJ9A 3QXSA 5TXGA 3QNUA 1ZP6A 1PUIA 2GAAA 1T3SA 5EP2A 2HLDD 4WXRA 3LA6A 3ZH9B 1TQ2A 4TTPA 1KO8A 1W0KA 3SZRA 1S1CA 2D4HA 3MFYA 3EXAA 4D4KA 2F1JA 2PCJA 2VH5R 2WWXA 2BCJQ 1FX0A 4KVAA 1Z2CA 4JLBA 2JGNA 4D4JA 1OT3A 3MWJA 3LFUA 4BZXA 1N5KA 2WSMA 1Q21A 2I1QA 1SXJB 1LB1B 4DLXA 1LF5A 3A37A 1NKTA 4A82A 5AJZA 4NCNA 2LKDA 3KKMA 3AB3A 1N6KA 1X8JA 1QBKC 5IK2D 3WRYC 2P5SA 4P31A 2O8DB 2ONKA 3GJ0A 1JAHA 3WXMA 1G9XA 2Q3FA 2D62A 2YJTD 4TYQA 2XB2A 1VG0B 2WVJA 4M1SA 2HYIC 2CK3D 3OHMA 1E98A 2Q9AA 2ANBA 2QUZA 3NBXX 4D0LB 4Q1AA 2C95A 4N1AA 2CJWB 4Q7MB 5B64A 3DPUA 4Q4JA 3DMNA 2OE2A 2JLYA 3K9GA 4A0FA 5LB2A 2PCLA 4AD8A 4DUGA 2OCBA 4M1YA 2MSCB 3K0CC 1FNMA 1IN6A 4Q19A 1RW4A 1GKUB 3KJEA 4JVSB 4OHZA 1KI2A 1KI6A 3QI2A 3GLFE 3TMKA 3UG7A 3U6BA 2EVWX 4JVNA 4M8NE 4NYIR 1TU4A 2ONJA 4QGFA 3GLHA 4Q1FA 3SJZA 4D4MA 1XCGB 4D25A 2EW1A 621PA 4JJZA 4US0R 3U4QA 2OFWA 4ZIRB 1G5RA 3RRYA 2O8CA 4C7OA 1E79D 4DT1B 4B74A 4XWKA 5SZJA 4PXAA 1R6BX 1ZUHA 4CZ2A 5KPJA 2EFGA 3QXCA 1GL6A 4W9MC 5CYPA 1IN8A 3AVTA 3G0HA 3GLGA 2L0XA 4TSFD 2ZE8A 3E1SA 1O3YA 4M21A 4NP6A 2W2XA 3FMOB 4KHZA 3TW8B 3I5YA 1P62B 1Z29A 3D31A 3H86A 5CK4A 1MO4A 1MR3F 3C8UA 3U5ZB 1Q12A 4G3XA 1NP6A 4BGDA 2FZLA 2C2HA 3M4YA 2W0MA 2ZJZA 2OT3B 2WIBA 3U44B 1G1MA 4PC6A 4OQFA 3FFAA 2CEAA 3WNBA 1RYHA 2JJ2A 2J45A 3WYGA 3TUZC 3AVYA 3DKVA 3DM5A 4IVRA 3L8YA 2ZRHA 3LDAA 5GVSA 4ZDKA 1MH1A 1XEWX 3IGFA 3P27A 1ZJ6A 2FEMA 2GTPA 1YRAA 3BC1A 1D2EA 2MSEB 2CE2X 2ZS7A 2MSDB 2ZAMA 1LW7A 1H8ED 4LZZA 3RS5A 4QFMA 5K8TA 2A3RA 2BHRA 2JATA 4Q9HA 3A36A 2W6JD 3K0SA 2CXXA 4HDQB 1R10A 3CB4A 3WMEA 3LW8A 1N5JA 2QRZA 2C78A 5C4GB 5SZIA 4U00A 1E2HA 2DYKA 3O8DA 5EP4A 3ZQ6A 1XJ0A 4JBYA 5DIFA 4I99A 3ZQJA 1E9BA 1MABB 4LBVA 4YXWA 2QE7A 1Z3IX 4HLCA 3X1DA 3GLIA 2YYZA 4PC2A 1G8FA 3HDTA 1BOFA 1E9EA 2EFHB 4P4SA 4WZ6A 1VCIA 1YZGA 5FL3A 5JWHA 2OCYC 4XWOA 2DWQA 1NN5A 3BXZA 1SVKA 3W3AA 4JJKA 4DHEA 3PUVA 4IHQA 3UMRA 1PVOA 2X19A 3X2SA 2W6JA 3IPXA 5GJVC 4QC2A 1QF9A 5F2EA 2C9YA 2HYDA 1W1WA 5FL7D 5LB4A 3CH5A 4F92B 1N6PA 2XTZA 1T8UA 4L5BA 2QPOA 3NC1C 3QKTA 3BWDD 3N2EA 4WVFA 4BLTA 3GQBA 1JPNA 4A2QA 2WJJA 3ND8A 4BZPA 4JVLA 1QZXA 4R2IA 2YC2C 2DB3A 4RKEA 3W8NA 4F4CA 4BUJA 3T1TA 3DMDA 2ZJOA 3U7GA 3FMFA 1S8FA 4BECA 4NDZA 4C2TA 1DAEA 3C5CA 2GEDA 4JLOA 4TQ9A 2DR3A 2NG1A 4Q4LA 3PEVA 3U60B 1Z0AA 4ERNA 2FPMA 3W6NA 4NYMR 3BAFA 1P72A 1YZNA 3KTAB 1US8A 2F1IA 1DPFA 1GRNA 3QKSA 3OFND 1BYIA 2FZ4A 2JEOA 1Z8FA 2ODWA 4EPTA 3K0CA 4JL5A 1TAGA 3CWQA 4LCBA 3VKWA 4PO9A 3KX2A 4UQOA 3QOFA 3T5GA 3NBYC 1F3OA 2XNSA 1R5NA 2NGRA 3KKNA 3NIBA 4HAZA 3AKEA 3K70C 1U9IA 3L8ZA 3PVSA 4I81A 4BLSA 4L15A 4JL6A 4FMCB 3R7WB 1J7KA 2HCBA 2AK2A 3QY0A 3UPUA 4LDJA 2ZSBA 2H1LA 4V0LA 1Y63A 3CZPA 5DGXA 4MGZR 4B3XA 2QP9X 1TEVA 3EZ2A 1XD2B 1PUJA 5CJ2A 4TL8A 1G41A 2J9RA 3KKPA 1QDEA 4UNPA 4QHSA 4B6EA 2IX3A 5FBWB 2A5YB 3K1JA 1MKYA 1M6NA 4PTLA 5JSZA 1P9NA 1EWQA 3SJBA 2AD5A 4ZO4A 1DAKA 2B8WA 2UZIR 2FFBA 3B2EA 4HAXA 1GM5A 1JECA 4GRAA 4EPXA 3EZFA 1OSNA 2JIZD 4GMXA 3CX6A 2XZPA 3ZIAA 3EASA 1I2DA 1XTJA 2QMUA 3QPWA 1JAIA 4HZUA 2A30A 3GJ8A 1XPUA 5HTKA 5DI9A 5KYKA 1G18A 3OF5A 2A5JA 1T91A 3K9HA 3FGNA 3TNFA 1DARA 4NYIQ 2DPXA 2Z4SA 2JLSA 3CRVA 2D2EA 3THXA 3GLHE 1ZW6A 2JASA 4LWZA 5L3VA 4F91B 1TTTA 2ZR7A 3IQWA 2ODEA 1P7CA 1EX7A 1AIPA 2DFKB 1N5IA 1EFRA 4KFUA 5GJCA 3NDBB 3SYLA 2GK6A 3A4NA 4BZQA 4UNQA 3GEIA 2FG5A 3GJ5A 1NLFA 4FCWA 4XH9B 1SULA 1UKYA 3SYKA 1EK0A 2ZRFA 3GFTA 4EJSC 5A4JA 4GDFA 1ZIPA 2FFHA 2P3SA 2RH5A 3CIOA 1AS2A 3SDZA 3CBQA 1Z0FA 1Z47A 5FUYA 2BJVA 1YR7A 1QRAA 3RYTC 2H92A 3CPEA 2AL7A 3S1AB 4EAQA 3GLFA 4CVNA 2C98A 3T1VA 5JI3E 1W4RA 4AURA 2FA9A 2RGGA 5BYJA 3R9WA 3MJRA 5EP3A 4Q00A 4F7WA 2EQBA 3U3OA 3IHLA 3EG5A 1XXHA 3B8HA 4OK3A 5KHOC 2A78A 2XXAB 1GRRA 4PC7A 5CLQA 4IDPA 3IO3A 3K9LA 2ZSDA 1U8AA 4QJ3A 3KJHA 3AKDA 5J4KA 2VHQA 3B82A 2FFQA 1UFQA 1G8PA 2ZE7A 3GEHA 4AKEA 1N2CE 1LVGA 2IEYA 2WWWA 4JKIA 1GWNA 3KQUA 1LTQA 1HY3A 2NZJA 5BW8A 1VKJA 4QNMA 1CS4C 2IYWA 1E2GA 4BFXA 1H8HA 2AWOA 4IOJA 3CRRA 4Q01A 2GBLA 1W36D 3P32A 2BMDA 1NBMA 3AEZA 1WE2A 2P5TB 1WA5A 3NEJA 1M34E 5D3QA 5DYIA 1GITA 4D6PA 1NI3A 1FQJA 4BE7B 3TAHA 3BFXA 4OKSA 1JR3E 2J0QA 2GRJA 3L2OB 1KO5A 2QEQA 2F7SA 1S96A 5KSPA 1COWA 1CF4A 2O8FB 2C96A 2QAGA 2P6UA 3MUFA 4LBZA 4JLKA 4KCGA 4LJ9A 4M0LA 1WBBA 3KXKA 1A4RA 4DZZA 2BOVA 3W6OA 1S1MA 1TU3A 3QKSB 4HLDA 4L9WA 1LY1A 2FX3A 2GXUA 5EE3A 4RY2A 3Q5EA 1M7BA 4Q4JB 1CJVC 2HUPA 4DSTA 4C3ZA 1NMYA 1CJMA 1MT0A 2Z4RA 3LD9A 1KI4A 5DH9A 4DC9A 2IYYA 1UDWA 3LRPA 2G1JA 3OEEA 4DCUA 4PPGA 5JCPA 4RD2A 4FW9A 4KLNA 5TVKA 3FMIA 2NO9A 1GNPA 1P2SA 4K8OA 721PA 4WAUA 5JECA 4IEEA 4NONA 3SHFA 5F3WB 1W2GA 2IXEA 2I3BA 1JR3A 2OHFA 3I8SA 3QKRA 4POAA 1G4UR 1XEXA 3N5CA 3EIEA 4I4LA 5HKKA 2GEVA 2YC4C 1YR9A 2X2FA 3SE0A 2QGZA 3T35A 5L3RA 2OXCA 5EUQB 3TK1A 2G0TA 4R71A 1FMJA 1RRGA 4CEHB 5EXTA 1OV4A 2CHVA 5BN3A 4B2PA 4TLAA 1UAAA 4B34A 3J81k 1Q3TA 4CEJB 4PQYA 2BMFA 1E1RA 4UXJA 2PX0A 1P6XA 3QJYA 1Q1ZA 1UBFA 2FN4A 4M9SA 4NU0A 1XJQA 4GOXA 3SOPA 2GZDA 1G7TA 1XPRA 1ZNXA 3JVVA 1DG1G 4QG7A 5IF9A 3T1QA 2F3RA 3B6EA 3BB1A 4C4PA 1E94E 1GUAA 3K0AA 4BRWA 1NLZA 4HDCA 2QY9A 5B30A 3U4QB 3EARA 4Q4HA 4LBWA 4E03A 2A5FA 2CL6X 4TLBA 2VP5A 3FOZA 2R9VA 5SZHB 1E9RA 2C04A 2WMOB 4Q4HB 1I4LD 2IYZA 1XF9A 1VCNA 5AR1A 1XB2A 3PV0A 2CDNA 2RB4A 1G7SA 3ZDQA 2B92A 1OIXA 2EYUA 1ZD9A 2VYFA 1W47A 1WCV1 3CRQA 1RVDA 3LWNA 5FPTA 1DOAA 3VR3A 1N5LA 3HU2A 3IBGA 1NF3A 2AR7A 4P4TA 3AUYA 1WF3A 2XSZA 1R0WA 1N6IA 4OK6A 1QHGA 2GBLC 4KJZA 4P4UA 2IBMA 4A0RA 2O8CB 4R2HA 2X1VA 4HZIA 5CYOA 2EFDB 2J7KA 4QGHA 4JZKA 2QA5A 1HT2E 3VR5A 2ZVPX 3BS4A 5JFGA 1E2FA 1YQTA 2RGNC 1L4UA 1DO2A 4KFSA 2YHSA 1KI3A 1BKDR 4RZ2A 3WNCA 4C2UA 1J99A 4OQNA 3TJZA 2D3WA 2FGKA 1X86B 2G3YA 1LV7A 2J7PA 1UKZA 3BH7A 3V4FA 1J8YF 3EC2A 1XEWY 1MOZA 3C14C 1P73A 4DCVA 4JSTA 3EPHA 4BPBA 1DAHA 4OQXA 4RVCA 1E2IA 1D6JA 2XX3A 1SHZA 1GRQA 1G8YA 1TNDA 5FPSA 1DAGA 1Z6YA 1NVVR 2HDNB 2ZRGA 5FUVA 5AWFC 1Q1BA 1G3QA 3IUYA 3Q5DA 2O0JA 4OBEA 3WYFA 2ZITA 3H1TA 1D8TA 1NIPA 2CVFA 1KI1A 1WMSA 2R6AA 2W2VA 2ZJYA 5C4MA 3ZD6A 1KSGA 1E9SA 3KUCA 1OPXA 4CYMA 4LJ7A 3HYRA 1GAJA 2IHYA 1P75A 2IS4A 4MQBA 2ZE6A 4E09A 4UXIA 2WJGA 1N6OA 3VKHA 1BMFD 5LDDC 3O47A 2ZANA 4JYCA 4HI0E 1TEXA 4ZCLA 4BRUA 3AKYA 2D74A 3SC3A 1U90A 4DSUA 1OE0A 1TPZA 3L43A 121PA 5EUMA 3RWMB 3SS8A 5AUNB 3SFZA 1E9FA 2ZI9A 4URUR 3LLUA 1H8EA 3TH5A 1CKEA 4RCYA 3ZVRA 4IXNA 1FX0B 2HEIA 4E5UA 4QJ4A 4NL4H 2FPLA 3AF2A 5DO9A 2W6IA 4IFEA 2CCJA 5DISB 2E9SA 4ABYA 4AYTA 4BLPA 1OLOA 1TUIA 3KXLA 4PHGA 5JMTA 1A5TA 1E6CA 4ARZB 3THWB 2DBYA 4F4JA 1IAQA 3W9YA 4WOPA 4YMSA 5A0FA 3ZJYA 5CB6A 1IHUA 2QENA 2Y8EA 4A2PA 1U8ZA 4UNRA 4A4DA 4TT3D 1XX6A 2AHOA 2KWIA 3IHWA 3LQQA 4I1UA 4L9SA 2J0SA 1F2UA 1RJ9B 2IYQA 1E2NA 1IJEA 3QXXA 1R8QA 2IK8A 5L3QB 1DADA 2OLKA 2ZJ2A 4PZLA 1ZM7A 2B21A 2JA1A 4EFNA 3WP0A 1JEDA 3GCGA 2JAQA 3QXHA 2ZI5A 1YJ5A 3FHOA 3A1UA 5L8VA 4DLUA 3DM9B 3M6AA 2IS6A 3BERA 1NNEA 2OO7A 1G3RA 4DKXA 3IBYA 3AVPA 4M53A 2Z5FA 1JI0A 2OFXA 3R8FA 2J87A 3X1YA 1E1QD 1P60A 2P0EA 2YINC 4DVGA 5FPKA 5JRJA 2ZJ5A 3AVUA 4TZ6A 2Q3MA 4AKHA 3I32A 4Q7LA 5EXPA 4FMDB 4RZXA 3FMPB 3K0AB 1KJWA 1HE8B 2QAJA 2FV8A 5KTYA 5E7JA 5J47A 3TRFA 1FP6A 3AVWA 2VQSA 3CH4B 3BORA 5EE9A 1ZM4A 4ZKEA 4GP7A 4EQ6B 2C9CA 4Z51A 2QMEA 4MUBA 4RCZA 1E2DA 2Q21A 5E3HA 4TMKA 5FBQB 2J5XA 4ZIRA 1G21E 4C9BA 1SXJE 3RC8A 2H5EA 3EWSA 2YZ2A 2QTFA 2YNMA 1CRQA 2HF9A 2YWHA 2RMKA 3TUJC 821PA 1KHTA 4EKDA 2NZ8A 1DELA 2ZRLA 1E3MA 3NC0C 5CIQA 4EJSB 1R5OA 4OI2A 3B1ZA 4MA4A 3QKRB 3P1JA 2GA8A 2ODNA 4TTQA 1XBTA 2V6IA 3UWOA 3A1WA 4G5OA 4DIEA 3PCRB 3DO6A 3PENA 1Q1EA 1W46A 1CRPA 1EESA 4CRWB 3SJCA 2F9LA 4PX9A 1KY2A 3OZXA 3BBPA 3KFXA 4H1VA 5AJYA 5FUWA 3AP2A 3GJ6A 4PPQA 4TYPA 1XWIA 4GOJA 1OKKD 1ZM2A 3QG5A 4GMDA 4QOSA 1ZCAA 1JR3D 2HV8A 2BKEA 2XZLA 1US8B 2RHDA 4HB0A 4FIDA 1R0ZA 2QL6A 1XEXB 1OXXK 2ZU0C 4RD3A 1TL7C 1XDBA 5KSOA 3DKPA 2J59A 4IW3B 4HUQB 2ZRDA 3Q9LA 2GVZC 1AK2A 1E2PA 2AX4A 3P4XA 5E7MA 3RVBA 3IQXA 2NO6A 4LHVA 3IIKA 5EE5B 3ZZTA 4C0KA 5B57C 3CX7A 4DCTA 1R5BA 2AKYA 5DYGA 4TMTA 4TYWA 2OBLA 4MRSA 4DLRA 4BFZA 2AXNA 4B75A 4GFDA 1R0XA 3EA5A 1QHNA 4K81B 4N0EA 1KMHB 2A5GA 4MUAA 2EU8A 3U6KA 3MAAC 1G16A 5TB5A 1BYUA 4D81A 4LYAA 3CF6R 2H57A 3W3ZB 5KNCA 4LC0A 1Z6XA 3C5HA 2QNRA 2OBMA 4LJYA 2FSIA 2AN9A 3SBDA 3CRW1 4OQLA 1G3UA 1TQ4A 2QT1A 3OE7A 3K70B 4TTRA 4G5QA 2ZI4A 1Z6AA 4A0GA 2YOHA 2B7BA 4HLQB 1UJ2A 1ZC4A 2VSFA 4Q02A 2IS1A 1SXJA 5EXXA 4XVUA 2D7CA 3ZYCA 1H8HD 3TUIC 1ZIOA 2W00A 2HJGA 5FPHA 1GP2A 1X1SA 1VG9B 1XD9A 4DEYA 2OZEA 3HWSA 1G4AE 3K0FA 4DXAA 1FMLA 4DLTA 2PL3A 1XP8A 2C99A 2GILA 2OEPA 3LQRA 2XTNA 5FBLB 1NY6A 1NY5A 3ECCA 4HAUA 2F43B 2VSXA 3TIFA 2ZETA 4DCSA 4CW7A 4KBFA 3REFA 4WXPA 4IVQA 2IYLD 4DDTA 3SI7A 1F6BA 3EZ6A 3N70A 3ZVNA 3AGPA 1XZQA 3AV0B 2PX3A 2J46A 2ZS8A 3LVRE 2GEUA 5DSZA 4IDOA 3EIQA 1AKYA 1NRJB 1Q1QA 2ZRNA 2ERYA 4P33A 2IS2A 1PV4A 4QBIA 4BFYA 3UMFA 1AGPA 1OFUX 3MRSA 3R20A 4NBSA 4W7SA 3KL4A 2REXB 3RS0A 1IJFA 4KITB 2NO0A 4PHHA 1EFTA 4L8GA 3BB4A 4C30A 1II8B 2C03A 1Y3AA 4V0MA 3RSOA 1M2OB 2GNOA 3OEHD 4HUQA 4DEXA 2JLUA 1HE1C 3DL0A 1D2MA 2MMGA 3CF2A 3IIMA 1XTKA 2CLDX 2GAOA 2ZSFA 3KJIA 1JR6A 2ZR9A 2XITA 4ZCMA 2VP0A 4QBFA 3SYNA 4TYNA 1NIJA 1FFHA 2JLVA 4M9ZA 3RC3A 3K70D 2B6HA 1JQJC 2IT1A 1IXRC 2DWOA 2NIPA 3CNLA 3B1WA 2JLWA 3PUXA 4PC1A 2D7DA 2V1UA 2IXFA 1C1YA 3CWZA 1PLKA 4PANA 4AK9A 1WP9A 1ZYUA 4QBGB 1YRBA 2RGEA 4QGGA 3WY9A 1T8TA 5JWRA 2RHMA 1P2TA 4JLAA 4J0QA 1KMQA 2GCPA 4B43A 1N0UA 4ZV4A 5DHAA 2BBTA 2GHIA 2WJHA 4HB3A 3RRNA 3B78A 1Z6GA 4M9XA 3U3JA 1II8A 5LPNA 2Q3HA 4DBLC 4DLYA 4PSKA 1QHYA 5J4VA 4F93B 3S1AA 1GZSA 4LYHA 2O8DA 1JBKA 1ZBDA 2BBWA 1GFIA 1E1QA 1UPTA 1CEEA 1EFHA 5FPYA 1G291 2GF9A 2V9PA 5JBQA 1HA3A 1HUQA 3NVAA 521PA 2W83A 3O8CA 3RANA 4AG5A 3D6TB 2DCUA 2IL1A 1K5DA 1QHXA 1JXMA 4C0HA 1OXVA 1Z0DA 3ETLA 3GMTA 5FBRB 3RS4A 1II0A 3ZZUA 1E4VA 2GK7A 4IOMA 2WKRA 4LY6A 3T1OA 4D0GA 1RKBA 2O8FA 4YMUA 2UZ3A 4PQFA 1N25A 1NKSA 2BBSA 4X8MA 1E79A 4PHTA 3SJAA 4WW0A 1FUUA 4CDGA 3X1ZA 1KY3A 5BQ5A 3T12A 2RGCA 2YOGA 4XOIA 2OFOA 3VU9A 3R7WA 1HTWA 2IUUA 3KJGA 5FL7A 2HCJB 2SHKA 1KK3A 4BFVA 1CR4A 1NLYA 4S35A 1XD8A 4AWXA 3FWYA 4A2WA 4FXPA 4PFSA 3WP1B 4FMBB 5B58C 5KNBA 1LF0A 1X1RA 1COWD 1G20E 2KBFA 3VMFA 3Q7PA 4YXWD 5BWMA 2WAXA 5DI3A 4PO8A 2AKAB 4Q1DA 1RC8A 3CPHA 4KXFB 4ASUA 2QZ4A 1UKEA 4MGKR 1ZUNB 3IKJA 3VHLB 4YONB 5ANRB 1X8KA 4HEJA 1EFCA 3LLMA 1NL3A 4JBXA 4GL2A 1TF7A 3CZQA 2PMDA 5BN5A 4EPYA 2GXAA 3W34A 1OHHD 1KAOA 2J0UB 5JZVA 2REBA 2NOAA 2RAPA 4LJ4A 4DLZA 1MRNA 3VU9B 1XRJA 2RGDA 4TL9A 4A15A 1VCOA 1QHIA 3QF7A 1HQCA 2R44A 4W5WA 5CM8B 3I62A 4RFSA 4XSGA 3BH6A 4V0OA 3E2IA 2OXRA 4G01B 4C0BA 3U7FB 4PZYA 2WWIA 1E0JA 2HXSA 2WOJA 2WSSA 5CLLA 4B47A 1KI9A 2BJWA 3AGQA 2G77B 3OIVA 5FR2A 3VX4A 2O8EA 4KV9A 4AYXA 1MO5A 2REOA 4TMWA 3AF3A 4FMDF 1T4GA 2QMOA 2F6RA 2VSOA 2QAGB 4LI0A 4LJ5A 4UNNA 2CCGA 1JPJA 3EIHA 4BLRA 4Q47A 4KU4A 2XJ4A 4XVRA 4EJSA 5JEDA 4KFTA 1U9IC 3F3YA 2QMHA 4IKEA 2JDID 3OIYA 1SVSA 3QG1A 1OH5A 3A1VA 4ON9A 2BBOA 2Z43A 3E70C 3LH5A 3OIWA 3U44A 3UK6A 3FTQA 2WIAA 1T3LA 2P6NA 4JT2A 2EFCB 4YQFA 2VHUA 3KFVA 1T3HA 2HJVA 4A1FA 1OYYA 2XOKD 3CRMA 1XNJA 5DLQC 2IHBA 5KDDA 3CR8A 1IY0A 2Z0MA 4XJXA 2CJWA 2IW3A 4LJ6A 4OHXA 221PA 4YDSA 1ZU4A 2R6FA 2EWWA 4ZCIA 3T06B 3LX8A 2ORWA 4IDNA 2CK3A 1E0KA 5AUOB 1WDTA 3GJ4A 2Q9BA 2WKQA 3AVQA 3NBZC 2QSYA 1QHSA 1KKMA 5FTLA 3PXGA 3GLIE 1R2QA 4O3MA 1Z08A 2LCFA 5JHGB 4BWYA 2C8VA 2P2LA 4LV5B 4KBGA 4OL0A 1AS0A 1IN4A 2VTKA 2DFNA 3HJNA 3P4YA 3OIUA 2P65A 2WBLC 4OHVA 4Z54A 1E1RD 2A7QA 3FE2A 2OV2A 1VG1A 4MYHA 5HR5A 1KDRA 5HCIA 2JLZA 1JJVA 1QG4A 5ELXA 2W58A 5JRZA 2CLSA 4O0MA 1K6MA 1NMXA 2H18A 1D2NA 1M1YE 1SVMA 2F1RA 5J4LA 1TF5A 3W90A 3KTAA 1G5TA 4C0SA 3PUZA 2QG6A 4M1MA 5GJWC 1Z6TA 3CNNA 2ATVA 1W49A 3GPLA 2CVHA 2F9MA 2QN6A 3A1TA 2O8EB 3V00A 2FU5C 1AQYA 1SVOA 3EW9A 3G82C 3W8RA 1OFTA 1CP2A 2W0SA 5KSYA 2ZS9A 2IYTA 3VHXA 3IO5A 3QE0A 1T5IA 3SBEA 3UWKA 4YMTA 2H8KA 3UKDA 2X2EA 2DHRA 3GLHB 3ADBA 3FHCB 3FKSA 1E2QA 3I73A 1DAIA 2ORVA 1EWRA 1W5SA 1NG9A 5F98A 2BIFA 2QPAA 3D7MA 2F55A 2NQ2C 3BIFA 2XB4A 1ZNYA 5K8IA 1G17A 4CT5A 5CM9C 3FHTA 2QPTA 3L0SA 2OUKA 4TQUS 3ADDA 1XXHE 5L3QA 2EWVA 2XGJA 4N0DA 3PEUA 3GFOA 3TLXA 1N3BA 1AM4D 3Q72A 1E2JA 4G5RA 3WBKA 2O0HA 1HYQA 4TL6A 4QHYA 4U02A 4B3GA 1T0JB 4GI7A 4NCIA 1R8SA 1EGAA 2WWGA 3CNOA 3L82B 5JJKA 4ZPXA 3WRXC 4KODA 5GADl 1FW6A 1FPMA 4MGYR 5H70A 5TY0A 2GVDC 1OH8A 3LBNA 4QGAA 4Z1MD 2BKUA 4LUCA 2BWJA 3MWLA 2JLXA 1ZCBA 2ZYTX 4YLGA 3RS3A 5C2JB 3KXIA 1JQLB 3SNHA 1PLLA 4L4UA 1M7HA 3C15C 2C5LA 3TAUA 1GL9B 2QE7D 2YOFA 3EAQA 5C46F 1JJ7A 1V43A 4DLVA 1ELOA 1Z5ZA 1J90A 1XJCA 2ZRAA 3JZMA 2ZUDA 4XSHA 4ZDIA 1TADA 3TR5A 3AUXA 4S2EA 3HU1A 5HZHA 1CTQA 5LD2C 4XTRA 1AA9A 1AGRA 4FCVA 5IRCD 2OCPA 5CDFA 1O87A 1KIMA 1ANKA 3TGPA 1L8QA 2YWEA 1KI8A 2ZRJA 3EA0A 3B9PA 1OKKA 3PQCA 2ZJ8A 2J3EA 4KVGA 2V4ZA 2QSZA 1AKEA 1YVDA 5JEEA 3LAWA 2GF0A 2GJSA 3THYB 2ZTSA 4EQ6A 4D2IA 4DSOA 1GOTA 2XTMA 1DEKA 4RSGA 1NN1A 5IDVA 3TQFA 1G6HA 2F1HA 1P61B 4LYFA 1W44A 5G53C 4MRPA 1S3SA 3A8TA 4FMCF 2C9OA 3RHFA 4EFMA 1R7RA 4URZR 3PITA 4LHWA 3V9PA 4EFLA 4QM7A 4JYBA 5H68A 3X1XA 1E9CA 4FD2A 4HB4A 3IPYA 4XD7A 2WM9B 1VHLA 3I8XA 3U7EB 1X3SA 2DFTA 5IT5A 1KAGA 3NWJA 1G3MA 4JLVA 3T34A 1ZAKA 3PIRA 2VA8A 4RD6A 4X8OA 3QBTA 1QVRA 4AI6A 1SVIA 1ZD8A 2VF8A 4U7DA 4NCKA 1ZUIA 3LNCA 4OYHA 4WA7A 5BXQC 3OESA 1ZVQA 4B6FA 4ACAA 2GJKA 1YU9A 1R4AA 1Z0JA 5H1YA 4BFTA 1VPLA 1E0AA 5HZKA 3ZZ0A 4R98A 2IWHA 4MGIR 1UEIA 2OAP1 2WJIA 4QXAA 3QEOA 2VP6A 1E9DA 4M1OA 4QKQA 3RS7A 3VR2A 2YWGA 2VIIA 3VNUA 1NSFA 5M04A 2GZHA 3U3KA 4OI0A 4HATA 5AK0A 1CIPA 4EPVA 2IEZA 1HT1E 4MYUA 4QNRA 4NH0A 2HLDA 4TQAA 1GVNB 3FKQA 2JIZA 3ZIAD 4QBHA 4LHXA 4MKFA 2KSQA 2IYSA 4NZYA 4XTCS 4IOKA 3GLGB 2BM1A 2PLRA 5CK5A 3NHAA 5JHHB 5FTMA 4HUTA 3CPJB 3LXRA 1B23P 2VP4A 4Y0AA 2ASEA 2ZYVX 4JVMA 2P67A 2UKDA 1XPOA 5CDFE 3HR7A 2E1RA 2I1VB 2V7QD 2XJ9A 4IXMA 3UATA 4MDEA 1SGWA 3T61A 3BH0A 3PUYA 4TMVA 3FB4A 3I4LA 4JMPA 2CHGA 2GCNA 4V0NA 3VR6A 3THYA 2OESA 1NBME 4ARZA 3THWA 3ZGXA 1J2JA 2PT7A 1W4AA 2ZREA 3K53A 3Q8XB 4M1TA 3SQWA 1W36C 2V3CC 1P2VA 4OHYA 2ZRIA 1SVLA 3QPVA 4DLWA 3ZVMA 3NH9A 1VYUA 5EZ5A 5J4HA 1GKIA 2O0KA 5FBVB 4JIMA 2IA5A 3RWOA 2IYVA 2QP4A 3LVQE 4OHWA 4ZKDA 2JCSA 4IVPA 4DIDA 3PEYA 1Z0IA 1XD2A 2G1KA 4DUGD 2TMKA 2VRWA 2AFHE 1TQDA 3AP1A 3U7HB 4KLZA 2YV5A 2ORIA 5CITA 4LBYA 3B1XA 4C0AC 2Z83A 3U61B 3PUWA 2GESA 1DAMA 1ODFA 1YKSA 1A1VA 4V03A 2V8OA 4K46A 1RRFA 4CEIA 4IDQA 2OSBA 3LBIA 1II9A 2FSGA 2GJ8A 2G88A 4E22A 1KNQA 1ZRHA 3JVUA 2HF8A 2B7CA 2NTYC 3EZ9A 2IF0A 4US2R 2J7PD 1P2UA 3B60A 2QRNA 3Q85A 1F2TA 3B1VA 3L0OA 4WIAA 1KZ7B 1U99A 2GZAA 1IXZA 3LO5A 3QQ5A 4G5GA 2NPFA 3DEFA 2BC9A 2VBCA 4JS0A 1A2KC 2FSHA 3IILA 1IN5A 4OJKA 1KK1A 3AKCA 3GJ3A 5AUQA 1K8RA 3IEUA 4M1WA 3A4MA 1GKYA 2K5UA 1M74A 3Q7QA 2G83A 3SEAA 2WHXA 4NPHA 3ZS9A 2GXQA 3EC1A 1VMAA 4LPSA 1KDPA 5CJPA 3RDPA 4LPKA 3NTUA 2WPDD 1CR1A 2AK3A 2R2AA 3SHWA 1OYWA 4XD7D 1GIAA 5FOWA 2OCAA 4DCNA 3N2IA 2QU8A 1KO1A 2QP3A 3KUDA 3R8CA 2WPDA 4D80A 1NSTA 2IXGA 4LHYA 1OFIA 5DNYB 2XSZD 3DHWC 1GNQA 4B3FX 4Z8XA 1XMSA 1AZTA 1NVWQ 1XCMA 2QT0A 4MYCA 4DDUA 4Y0VA 1NJGA 2FDCA 3X1WA 3O8BA 4UJ3A 3EPLA 2QQEA 2H17A 3QUSA 1NN0A 4URXR 2O52A 1S4QA 1KO7A 2DFLA 2MMCA 2R8RA 1MABA 4LYJA 1EFUA 3BK7A 3ONWA 1W48A 1CJTC 1XTIA 3KQKA 1FUKA 1DTSA 4O25A 3LV8A 1G64A 1G8GA 2LKCA 1YZLA 3CKLA 2VP2A 5J5CA 3B7GA 4LK2A 4OI1A 4B76A 1GG2A 5KDLA 4EDHA 3FPAA 3NHBA 2XXAA 4Z8YA 3DZ8A 4HAWA 2ZU6A 1XXHB 4W5HA 1Z06A 4YDHB 3VFDA 4BASA 2V54A 1TUEA 3H0KA 2PEYA 1F48A 2IYUA 4PC3A 1SKYB 4OQMA 1NVXQ 4LJ8A 2HT1A 4B3DA 1OXTA 3K8YA 4BQSA 1NN3A 2ZRPA 2CE7A 5SZKB 3GD7A 2F3TA 2WTUA 4BLQA 4ILEA 1IM2A 1KOFA 5FFMA 4AKIA 2YWFA 3QXJA 1OXUA 2QQ0A 5G41A 3UANA 2RCNA 4HB2A 3I61A 4LV6A 2PH1A 1ZNWA 3QBVA 4I1SA 2FH5B 1A82A 5FR1A 2KBEA 3TQCA 1YZTA 2KB0A 3OEHA 4GSYA 1KYIA 3DOEA 5E4FA 5EJEA 2UVQA 4H1UA 3ZS8A 3HYTA 1U0JA 2QROA 4AG6A 5DHFA 2VPPA 4NHOA 1VTKA 3WNDA 2CBZA 2WAYA 3DVLA 1W2HA 4G1UC 4KSBA 1Q0UA 2BMEA 2RGBA 2N42A 1GILA 5TV2A 1I4TD 4HYYA 1QHHA 2WJVA 1OH6A 2QM7A 3IEVA 1Q57A 4GT1A 4D26A 1U8YA 1IOZA 2CCKA 1IY1A 4ESVA 2GDJA 1KI6B 4EIWA 1RIFA 4BEJA 4D4LA 2W2TA 5HKKD 1E2MA 2FNAA 1KJZA 2ZRCA 1NVVQ 1ZMXA 4QJ5A 3HPRA 3AVVA 4AY2A 3IDQA 4II7A 1W0JA 4MRRA 4ZDWA 3WMGA 4RD4A 1NJFA 4ZDJA 4XVQA 1S0UA 2ZI3A 3T15A 2IYXA 1KGDA 2NPIA 5IK2A 2ZIAA 4LC1A 3UIEA 3TKLA 1B0UA 5EE1A 4QRHA 1OIWA 1IONA 2R62A 5LBIA 2BV3A 3RRMA 3RAPR 4BFUA 2CLCX 1K5GA 2V7QA 1LS6A 3GJ7A 3JZAA 3K09A 2BCGY 5FH9A 3TW4A 4PHFA 4OK5A 2FF7A 2GKSA 3EPJA 4TLDA 1KI7A 2FMXA 4JBWA 4DWJA 3VKGA 1OF1A 4RFSB 1EXMA 1Q3HA 1OW3B 3QEJA 2ZEJA 1OIVA 1DVRA 1P9WA 2XNDD 3LBHA 4V0ME 1CLUA 3I5XA 2BEJA 2ZSAA 5DN6A 3DZDA 2C77A 2ANCA 2PZGA 5E95A 4GP6A 3WBJA 4GBMA 2BEKA 3WHKA 2FGJA 2IUSA 1G6OA 2FPKA 2ERXA 4A0HA 3KQNA 2EYQA 1SXJC 2OBNA 2PJZA 2BM0A 1R0YA 4Q48A 2BDTA 3I3SR 2VHCA 1SZPA 4EPWA 4Q4AA 1E96A 1RE0A 1XCPA 1MRSA 2E87A 5G3YA 3CO5A 4TMXA 3CX8A 2H16A 3CLVA 3BOSA 4DSNA 2CL0X 2OLJA 5LD2B 2FOLA 3MWYW 4JLPA 2VL7A 2OM2A 6Q21A 2A9KA 2ECKA 2GXSA 3W5JA 3RRZA 1WRBA 2J0VA 1XTSA 4TWZA 3TVTA 3NDPA 5K8LA 1BIFA 2NMVA 4PAQA 2WKPA 3LX5A 1D9ZA 1XMVA 1T5LA 3BD9A 4D82A 5AUPB 3O8RA 1ZD1A 4P3YA 2OG2A 4DJTA 2PZFA 2ZE5A 4PSAA 1CJKC 1KSJA 4B2LA 4M4SA 1DS6A 3KDSE 4XIGS 421PA 3VTKA 3GLFB 4R9UC 2GWHA 3TR0A 1WB9A 2WMNB 1NBMD 3ADKA 4IFBA 1AN0A 4P4SB 4AIIA 3M0EA 5KO2A 3QPUA 4CEJA 1DG3A 4FN5A 1KNXA 4G0NA 4A8JC 1MV5A 1AS3A 2WJYA 1P3JA 1Z0KA 5JLJA 3B85A 5KU1A 2B8TA 4TT3A 3A6PC 5J40A 4DT1A 4MDFA 3GEEA 1JEEA 1OFHA 2F43A 5UKDA 1OJLA 4URVR 2HT6A 2VO1A 5HCNA 4O2RA 4Q9KA 3TBKA 4PPFA 1S2MA 5FOTA 4TMZA 3G5UA 3THXB 4AKGA 2DWPA 3FVQA 1FTNA 5BN4A 4B3BA 5C1BA 3K0FB 1NG1A 4HSEA 1ETUA 1BS1A 5JSZB 4U5XA 1YHNA 4LJAA 5L3SA 3VNVA 3CR7A 4LSGA 3TSZA 2ZVQX 4PAMA 4BLOA 4CF7A 1N0WA 1ESNA 1S9DA 4ACBA 1MO6A 2G6BA 1KO4A 4D0NA 3FYHA 4XWAA 2CNWA 3MD0A 1E4YA 5KUTA 3CW2A 3WHLA 1VYTA 1N6NA 2XEXA 4Q21A 4M9QA 3TSWA 1UEJA 2ZJBA 1KK0A 5EXSA 1AQUA 4HZUB 2NO7A 1G7CA 1TMKA 4Z1MA 3D8BA 5CIWA 4A9AA 4UNSA 4KYUA 1L4YA 1KK2A 1ZM9A 1KSFX 1XTRA 5TARA 1U2RA 3RSLA 1IY2A 1G3IA 2IYRA 1VIYA 3U2QA 4MKGA 1FZQA 4HLUC 3WMFA 3RLFA 4GZLA 1A7JA 1VYVA 4L16A 4KYIB 4MITA 4C7OB 1CR2A 1JALA 1PJRA 3A58B 4NCJA 2O8BB 1AZSC 1DAFA 1A2BA 1KDOA 3I1FA 3MMPA 1JNYA 4NMMA 4GOKA 2JJ8A 3OEED 3UG6A 3QSYA 4N3NA 5J4YA 3NBFA 4GZMA 5EQTA 1UADA 1W4CA 4JLMA 4TLCA 4JSYA 2O5VA 4UKDA 4QHTA 3KKOA 4MRVA 5FI1B 4C0JA 3ICQB 4Q4AB 3B13B 3ICEA 5D3MA 3I92A 4I1OA 1VDZA 3AP3A 1I4DD 3DDCA 1F2TB 1UF9A 2GCOB 2IC5A 4RD0A 5D3MB 3RABA 3C4JA 2JJ1D 2PEZA 1U0LA 5F9HA 3HU3A 2CL7X 4BEBA 3HP1A 2HXYA 1P4SA 3NXSA 3B1YA 2Q6TA 2ZQ5A 1UBEA 2WOOA 3C16C 3BJIC 3AF0A 3C7KA 1BH2A 5KOYA 1W4BA 5FOSA 1UBCA 4MKHA 1I2MA 4AYWA 5JS8A 2WWHA 4WZBE 5KSZA 3BFVA 4A36A 4B44A 3R9XA 2WICA 1PZNA 5HPYB 2NO1A 1WQ1R 4JLJA 2YKGA 2RGNA 4NTZA 5FTKA 4ITRC 1SKQA 1MO3A 1FQKA 4FCTA 4ZI3A 4JLDA 5EZ6B 3B9QA 3ZD7A 1XU4A 4Q9JA 1P5ZB 5FTJA 3FDIA 4PR0A 5FUXA 3IIJA 2RGAA 5KNDA 3REGA 5JWOA 3BB3A 4F38A 2VLIA 1Z07A 4WBSA 4KFRA 3E5HA 4H9GA 1ZU5A 1YZKA 4ASUD 3FKSD 3CM0A 4M1KA 4V02A 2KE5A 2Q0HA 1C4OA 4TZ0A 3V4RA 1F5NA 4DB4A 4MKIA 5TDHA 1DO0A 1E2KA 4Q7KA 3K9NA 3KB1A 5L3SB 1U98A 1VG8A 3ASZA 3QVUA 3THOA 8OHMA 4M22A 2WZQA 4EUNA 1OHHA 2AD1A 1S9HA 4CGZA 1TQ6A 1XEFA 3F8TA 3GLGE 3F0TA 2JJ2D 4QM6A 1BMFA 2QI9C 4V0KA 4B48A 4C0LA 1E0SA 3F5FA 4NYMQ 1OH7A 3CUEF 4TSFA 1HURA 3SU8A 2VHTA 1T9HA 1ZC3A 3AF4A 2DY1A 1ESMA 3ZLJA 3QKUA 4BFSA 2V1XA 4MYTA 3BE4A 3OAAA 5KPDA 4LRWA 1VIAA 1KZGB 3LW7A 1KMHA 1W5TA 5GVRA 1X6VA 3CONA 2FE4A 2I4IA 1IBRA 1VCMA 1S3GA 5CB8A 1W7AA 5AJWA 1RRPA 4HDOB 4R7ZA 1CJUC 2JLRA 4MH0R 5C18A 4GNKA 1KSHA 2CMKA 1JB1A 3A1SA 1LFDB 1W0KD 1U0HC 1DBSA 2ZPTX 3FFBA 1QHHB 3L0IB 1U94A 4IJMA 4JKYA 5G40A 2QBYB 4PO1A 3RS2A 2WSSD 1NMZA 4Q1CA
chains in the Genus database with same CATH superfamily
1G7RA 3FPGA 3AEQA 4RTSA 3R9XB 3T3IA 3P0EA 1VKNA 2YWDA 3GRRA 5L40A 5JYCA 3H4TA 4UEQA 4I9GA 5ELLA 2PFGA 3A6JA 4PO3X 1Q6YA 4OXYA 4LF4B 3GFFA 4YAIA 3H2YA 2BZSA 2QRGA 3NG1A 5ECYA 5BOVA 1UKVY 2PD6A 3GCZA 4LMAA 4Q1EA 1YDMA 1OBCA 2FN3A 4B73A 1BGWA 3D3QA 4HGNA 1NGSA 4JA2A 4DQUA 3SC6A 2Z5VA 3EGIA 3ZWPA 4MUYA 4MDEA 2A0XA 4DREA 3I04M 1NPDA 4D5GA 4C43A 1X92A 4FI3C 3C8ZA 2DFPA 2J09A 2WWFA 2HA4A 1YO6A 1IK6A 4KWIA 5JI2E 2IZ5A 3IT2A 2WM2A 4DYVA 2X0IA 1AF7A 3TRKA 5KHAA 1PGQA 1TFUA 3OECA 5TQ2B 3CNBA 3H16A 4HVLA 1HRKA 2OAQ1 3LDHA 1H0RA 3S28A 2QGFA 4URYR 1DKQA 1D9XA 5E9JA 4LF6B 4E4RA 1XVVA 2GEFA 2I03A 4IOLA 4JWKA 1J8MF 2IVFA 4FYKA 1YB2A 3GLQA 4LOLA 5G1NA 3KEQA 4FM9A 1TAUA 1X13A 3W2IA 4G23A 3UAOA 1JXOA 5EKDA 3HG7A 2ZYGA 2C42A 2UZ1B 1LK0A 5IJZA 1D6SA 4EPRA 3QIAA 1GZUA 5LU8A 1S2IA 5IBQA 4Q9IA 1MC4A 1TF2A 3U26A 3BJRA 1Q7CA 5JJIA 1MG0A 2VPYA 3OQIB 4DLSA 3U1TA 5H80A 5GPBA 1DDGA 5CFZA 2VTBA 4LGMA 4YJ2B 2F9FA 2YNMC 1XMIA 2QTHA 3SGLA 2CJFA 4DXHA 4ZEVA 5LMZA 2Y93A 3BFJA 3D3JA 5BVGA 4FWBA 3ZCSA 4PZ0A 1GN9A 3GB9A 4YWHA 3IBSA 1A8SA 1J1IA 4P3NA 1KETA 2YVUA 4KE8A 1ETHA 4XEHA 3RYFA 3JPYA 3WMRA 1QQ6A 3A6ZA 4FI3F 2YQ5A 4EKNB 1MFPA 4BC0A 3T41A 2FMFA 3AUSA 2ZUBA 3S8EA 1SK9A 4D9BA 2V3WA 3RYHB 5C5CA 2B1QA 2WAOA 3GMSA 4X3CA 1J0CA 3M6MD 5HIKA 6NULA 5IASA 2IX9A 4KO8A 5JT1A 3GJXC 4ZAGA 1SUCA 1AQIA 3K73O 4TL7A 4ESHA 3LY9A 4FZVA 5DNWA 1XFAA 4ECAA 4UBKA 5JMPA 3UXHA 2PS3A 2NXNA 4LCEA 1UDXA 5DTEA 4CQMD 2J3MA 4Y2JA 4DM4A 2H7YA 5GWXA 3NHUA 4RK0A 3O4RA 3QV1A 3HYLA 1NYLA 3H84A 5F1YA 4NBVA 3NNDA 5HNKA 2I2FA 2Q2VA 4IEIA 2PGAA 1BCSB 2CHQA 3RK4A 2WTMA 3ADOA 5FNVA 1VSVA 4ARSA 5LP6A 4URWR 4D8VA 4F2DA 1AJEA 4DFDA 3JQQA 1M6EX 4ZP1A 3FNHA 3YASA 1JTFA 1IXSB 1F06A 3ZDRA 4YMVA 3F5MA 4ZOQI 5CFNA 1KC3A 1O0BA 5IUNC 3LF1A 4CIDA 2ZFUA 4HGOA 5G3ZA 2QORA 1LK5A 3KXDA 3TM4A 2ZYUX 3UJ9A 3KHTA 5T7BA 4FKMA 1SKAA 1X80A 3B9RA 3VHRA 4LI3X 3SHQA 2QN8A 2VT3A 4MCAA 1GTVA 1K9SA 3ICWA 2ZR0A 2PKYX 4RLFA 1BVYF 2GLXA 3RODA 1GNRA 1PR5A 1DCMA 2GRUA 4C0QC 1QVAA 4ZEMA 4MJ7A 5BYKA 2QMZA 1A69A 2PGDA 5B58T 4AZ0B 2XNDA 4CKWB 3WYAA 5LMCA 2EBWA 2W2LD 1EIWA 4X6XA 2VHJA 4OI4A 4LXHA 3T7EA 3WMXA 1MB2A 1QGYA 1V5WA 4A8JA 4B7CA 1M5RA 3DL7A 4RE6A 1SOWA 3Q2KA 1UPUA 3A4VA 1HDGO 1NF9A 1P17A 2ISCA 5LN1A 3GRVA 1NUSA 1A5AB 1VGRA 3CLTC 1DE0A 2AWNA 1R0BA 1EBBA 3PNMA 4C6SA 4P2BA 3C3AA 3VQTA 2C2GA 1RWOA 1T3ZA 2I71A 1FRNA 2IE8A 3P97A 4FFVA 4RVSA 3U4MA 1SRRA 4ZYVA 4TKMA 4P92A 4WLUA 5JZ9A 5J23A 3PWTA 1GSHA 4L78A 2WB2A 2Y1KA 3F7OA 4LXUA 4YPFA 3AVXA 3D6HA 2D06A 2OILA 1SPBS 2P4HX 4FC6A 4H7KA 2X1LA 4HK4A 1MXHA 1RPJA 4KQIA 4X7BA 5IYZA 5JQGB 2MSNA 5E3IA 2EQAA 2FEOA 1W6RA 2N46A 2O3TA 3MSXA 4HAYA 4J75A 1F0KA 4LS3A 4UFNA 4ALJA 4P3KA 4E7PA 1A9PA 1Z17A 4MV9A 5SY9A 4TN1A 1K92A 2WWYA 1K8XB 2EOAA 3OQOA 2FKNA 4BX9A 1NR7A 2G8LA 2NU9A 1E5QA 3HO1A 2ZROA 5LIPA 5JJLA 4OAOA 1GDHA 1U4SA 5EIOA 3W05A 3LVBA 2B5OA 1RYMA 3M6LA 3TTXA 3J7AC 1QZ3A 3I9V1 1K66A 1XA0A 3HDHA 3DKRA 5JS7A 2R6DA 3ISTA 1JIJA 3IAM6 4JI7B 1R6AA 3H9GA 4WXMA 3MG9A 4NZOA 2G7MC 3QE4A 3S1SA 1K63A 4W5JA 1B1CA 1OB2A 2ODTX 4AJHA 3HA2A 4L6AA 3DVAA 3M5DA 1WZEA 1QNLA 2X8JB 2ZJAA 4HJRA 4Y1RB 5DCYA 5HE8A 3SZMA 4BAZA 3EPKA 4NV0A 1M8PA 4I19A 3IH5A 1TJPB 3G59A 4M0PA 4YMWA 1QKJA 1W8IA 3SXJA 5TMPA 1H6CA 2CFRA 3Q3JB 1H9AA 5AJVB 4ZZIA 1AQJA 1VECA 1QQTA 1XTQA 1EP2B 2VKQA 1R18A 2ECFA 3RI3A 3E8SA 3EGVA 3TM5A 1Y8QB 2ZSHA 1OFGA 3B3FA 4G56A 4EG0A 1V7QA 3FMVA 3AW8A 4BV8A 3KTOA 1DOZA 2HQ1A 3W5HA 1EAYA 2WVAA 1QTQA 3EOBI 4PPYA 2G8NA 2FFAA 4Q66C 1CQJB 2ZI6A 3O21A 3G9XA 1WXXA 1E1MA 5KYYB 1U8UA 4QYWA 2FPRA 2W2QA 3QKWA 3M2TA 4D4GA 5AJXA 3QF4B 4KR2A 4C04A 5IWCA 1ZNZA 3ROGA 3N7AA 3RSHA 2X7JA 4CIYA 5CLFA 3D7KA 1VHDA 4CEHA 1J0DA 1GDDA 1EJ6A 1P0IA 3KE8A 3G3EA 5D3ZA 3D4BA 1P2DA 1E9AA 1SXJD 2BI4A 2VP9A 4IUYA 1KYXA 1YD7A 2Q27A 3HWX1 4IXTA 1NDQA 1W35A 4YAOA 3PQ5A 4UMVA 3ROFA 3AFHA 1N0VC 2ZIGA 3IT0A 4P58A 2J6IA 2IEGA 3K1TA 3VI4B 5JSHA 1FNSA 4HWOA 4BFWA 2PRYA 1LS1A 4KMMA 2J5BA 1HH4A 2CMFA 3RIGA 3T7JA 1J21A 3OC0A 3V46A 4KO1S 2BMJA 3QXSA 5ECGC 2RKWA 3PNLA 2WNSA 4O5OA 3E3NA 2Q1SA 4MVJE 3QNUA 4QWMA 3LT1A 2PQ2A 5DBEX 5CH5A 1YCFA 1PUIA 3R5KA 5AESA 1IEQA 5EP2A 1Z7BA 3PGJA 5IBRA 2E4WA 2R8OA 2EP7A 2I9PA 3JQBC 4N8SA 4YRQA 1TQ2A 2B25A 4REMA 3RRXA 2JJQA 4RWZA 3NBKA 4F4DA 2D4HA 2E82A 3UQZA 3H65A 1FMCA 2VH5R 2HADA 5EFZA 1NDHA 1OT3A 4UMFA 4D79A 1CFZA 2G4VA 2NU8B 2G08A 2Q4OA 2AUTA 3S2FA 1I3OA 4DMHA 1WULS 5AHOA 5BMVB 5JSFA 1J4AA 4NCNA 1NX6A 3UEOA 4PRYA 1RZVA 4BNLA 1C3OA 5IK2D 3LYUA 3LIIA 1U31A 3WRYC 2IITA 2P5SA 4MCIA 3UGKA 2ONKA 3NRJA 1G2OA 1JAHA 1WPXA 3GJ0A 1FFDA 4WLFA 4UASA 5EJFA 3EGXA 1CF2O 1G9XA 3VOTA 1FJGB 4O1MA 2QUJA 3DO5A 4TYQA 4DR4B 1MG5A 2A86A 1BE1A 4M1SA 4RWEA 2A94A 3OEYA 3OHMA 4NNOA 2P9JA 4X71A 3TQSA 4D5EA 4MRMA 3ETNA 1T4DA 5HQTA 2PGIA 1BWQA 1ECLA 2KLBA 2P6MA 2C95A 1J2UA 3N53A 1IPEA 2JF0A 1CE8A 3L7AA 1DU4A 1Z0UA 4Q7MB 3AM4A 2CV1A 4Q4JA 3DMNA 3TDNA 2GPYA 5DGHA 1JQBA 1Q7RA 1JS1X 4ZRDA 3ZEIA 7REQB 3FOAA 1QVZA 2QTNA 4NEGA 3I23A 3U81A 1PN3A 2PCLA 3IB3A 1YBAA 4RHCA 3TVYA 2QRVA 4JI3B 3PI6A 4HH3C 3K0CC 3GJQA 3ZWAA 4B3MB 4B6SA 3DEYX 4P22A 5AOCA 3WNQA 3MCWA 3F5DA 1I4OA 3PD7A 4FK8A 1MVLA 1YUNA 5CGZA 3EVGA 1YQUA 3GLFE 3TMKA 3UK0A 3BGIA 3EEIA 2JGJA 1LZLA 1KJQA 2B2CA 3D3EA 2OHHA 2MSWA 2JGMA 5GZ1A 4RJ2A 3QEAZ 1P19A 2QQGA 4N6GA 2ONJA 3OMXA 3GLHA 4Q1FA 3ZU2A 3M70A 4QYIA 3T7RA 1I94B 2QV7A 4HCJA 2Z6UA 1A27A 1K6EA 2JS7A 4BKQA 1RCTE 4KO3S 3U4QA 1O0SA 2PT6A 2XECA 1JDTA 1V41E 2ZBQA 3G2PA 4G65A 4X20A 3ODGA 5ALZA 1I2AA 2ODQA 3WS7A 4DJAA 1ZOSA 3H2SA 5JE8A 3PWSA 3GGJA 2DPYA 3LCMA 4PXAA 3UNXA 1R6BX 1DHRA 5KPJA 3G2QA 2EFGA 3QXCA 4I1YA 1RRVA 4RACA 1GL6A 1QLHA 1AQNA 4W9MC 2W2KB 3AVTA 1K8ZB 3AESB 1DC4A 1EE9A 1BMDA 2XGOA 5CPFA 3FMOB 3V8MA 4KHZA 3TW8B 1JDPA 3H86A 3D31A 3LC0A 3I5YA 1MR3F 1GV1A 2W11A 2LCQA 3UYKA 1Q12A 3F4LA 1XMQB 1NP6A 3LL7A 5CCDA 5BSHA 3WWEA 4D9KA 2IXAA 2C2HA 2ZYRA 3M4YA 1ZK0A 3H0EA 3QX8A 3ZDFA 1KTIA 3L06A 3GVIA 2OT3B 2WIBA 4M9CA 3ZGVA 4BQRA 4C22A 2GS9A 1YFLA 2XLBA 1QOZA 1KQPA 3G13A 3JAWB 2XQVA 3BJZA 1G5IA 4MV6A 4WH0A 4EUFA 4S1WA 4UM5A 1AHIA 4P82A 3LWDA 4DIUA 1XEWX 1R6XA 1N2EA 4ZYZA 1F3LA 4YI5A 1ZJ6A 3GJ6A 4EPYA 3B89A 4QE3A 16PKA 4LZZA 1V96A 1MEJA 3LUBA 1ZMTA 3N8NA 1N75A 1ZR4A 1KIFA 1JWBB 5DTIA 2GZ3A 2PZJA 1MIHA 2RKBA 2CXXA 4HDQB 2WG1A 3CB4A 3WMEA 4JUAA 1FLAA 3DE2X 3LW8A 3U5TA 2C78A 5C4GB 1CUSA 4INPA 3UK1A 5C8YB 4Z4QA 4DGSA 1JMVA 1MVOA 2CKMA 1XJ0A 2PUAA 4I99A 4R9NA 3ZHYA 5F7XA 2DBRA 4Y1FA 4D3SA 3DL2A 1OLUB 1SK8A 3HDTA 2HNKA 2H9IA 1A97A 3L8GA 2GBIA 3QWFA 1ORRA 5AHWA 4Z4HA 3V2GA 3KOWA 2OVFA 1NN5A 1YFZA 3BXZA 5F76A 5IN5A 4KBYA 3TLAA 4AB1A 4EG5A 4JJKA 4EB8A 5IT0A 1N0HA 4IHQA 2PPLA 2W6JA 2AVDA 4G84A 4QU0A 4ZCPA 2Z8XA 5LB4A 5KQPA 4MNTA 1RZRD 4MUFA 5CNKA 1QXSA 1TZJA 1T8UA 2QX4A 4IDBA 3RKRA 2QPOA 3ST7A 2BFPA 2H6EA 3IOMA 1JPNA 1IHPA 3LT0A 4LXYA 1FTWA 4IQ0A 2QRMA 5KWEA 4BZPA 3CJRA 4FFLA 3ZXUB 1SKMA 5L7YA 4TWBA 3W8NA 4BKUA 1KVQA 1L4FA 4F4CA 1A3CA 3DMDA 1C9DB 3DZHA 4KE6A 3MOGA 4MOWA 3N0RA 1ZKDA 1HT3A 1RWKA 1ZUD1 1I6KA 3NPMA 1F6WA 3C5CA 4KDEA 4D6XA 1SO8A 2DR3A 4Q4LA 3PEVA 1JU4A 2R00C 3ZE2B 4WNIA 4C88A 4PS0A 3U0BA 1RRKA 3FNEA 3KTAB 4NNPA 4YRCA 3OU7A 4UNIA 1GRNA 3ETJA 4J0CA 2PBZA 1TYDE 2I6TA 3OUZA 5K4AA 3T9CA 4B84A 4I5GA 3DDNA 1NV9A 3ROKA 4EPTA 3D2BA 2A9PA 4PRZA 2ZATA 1HDCA 1UIMA 4WLNA 3NIBA 3KKNA 1U8EA 3VO1A 4MQ5A 1FXSA 2VDQB 3VM6A 2XY4A 3K70C 1DLJA 2UXDB 4B79A 3TDKA 1LLCA 3GZ4A 3L8ZA 3UFXB 3D5TA 5C8ZA 3FR8A 3SVTA 2UUCB 3C6QA 4JQSA 4UD6A 3ENZA 4UFOA 4C7KA 2HCRA 3R7WB 1PWXA 1V2GA 1J7KA 3N07A 2AK2A 3P0FA 4WCFB 1O96B 4LDJA 2P4EA 2X41A 4GWKA 5FBKA 1MZVA 5EZQA 3DTYA 4BXOA 4FDTA 2QP9X 1GCUA 1T1GA 4IS3A 3TKYA 3UWPA 1YL7A 1PUJA 2HOQA 3HACA 3P2JA 4YAWA 4XWWA 3MOSA 5JO9A 4UNPA 2BM8A 1TT7A 4GC5A 2QTTA 5AKEA 3MINA 1Z68A 3C1UA 2A5YB 3AQIA 4KQKA 1JRLA 1TGYA 3I53A 3TRDA 5JSZA 5CHYA 2O5EA 2IQIA 2COUA 3SJBA 1FLDA 3K5IA 1LDBA 4ZO4A 1DAKA 2B8WA 2IEDA 5BQPA 3ZY4A 1G1AA 3CHYA 2HD4A 5T6BA 4WGGA 4EPXA 3IESA 4Q6WA 1CUUA 2JIZD 1QU2A 1ESCA 3KVRA 1BD4A 2UYCA 2Q46A 1I2DA 3QPWA 4HZUA 4YECA 1D4AA 5GOTA 3NHPA 3G0DA 1U1DA 2R8XA 1XPUA 2PZKA 2QAIA 3PQEA 1JHZA 1EK6A 5KYKA 3NVMB 1QPZA 1GG5A 4UDXX 4B8WA 4RF3A 4D43A 3BHIA 3OF5A 3RIXA 1E9VA 1GQOA 1P33A 2CD9A 3PDUA 1CC1S 3OMWA 3T0GA 3ZKWB 2GCEA 2HLPA 2QPLA 3COPA 2OFPA 3K9HA 4LNAA 4YGXB 5DBOA 4UZSA 3FGNA 3OLVA 4L7VA 1DARA 4NYIQ 5EWLB 2HA5A 1AC5A 1HF3A 3D8HA 3HB9A 4HXFB 3WFZA 5AI9A 1QWSA 2FWIA 3P4UA 3R4VA 3VYWA 1GADO 1MF7A 4BQNA 4Q6BA 5DT2A 1TTTA 2PS0A 2ZR7A 2ODEA 4YCNA 1AIPA 1JX6A 2ZB4A 3NDBB 4BLVA 1GJRA 4IXWA 2C4MA 3PI7A 3SYLA 2WUGA 4BNHA 1TYCA 3PHCA 2X0EA 1NLFA 2QRKA 1R9NA 4IIJA 3RF6A 3SF0A 1SULA 1UKYA 4RK1A 3AR5A 2DUNA 4P98A 3Q6MA 1NVMB 1XQ9A 2JGRA 5HGJA 4GDFA 3O0TA 4RMIA 2ZJ6A 3CIOA 3KDAA 4RDIA 3SDZA 5HBGA 2X2OA 3FY4A 2BJVA 1UOPA 1QRAA 4I6GA 5ENZA 3SXUA 2AL7A 2G67A 4MP6A 2B9EA 3S1AB 2X7HA 1D2CA 3EGWA 4GVXA 3KE9A 4FB5A 1BMQA 2GN1A 1KFBB 3T1VA 4EUKA 4WKBA 2VJMA 4UHEA 1JIQA 4AURA 5ARBA 4ZYXA 1SA0A 1XRNA 5KI6A 1TJ5A 2C2KA 4FNOA 2HWXA 1L5HA 3K05A 1CVIA 1SU6A 3GAFA 2XXAB 1SHLA 3ZVKA 1JMYA 1GGFA 3L4SO 2RJ3A 3K9LA 4R5MA 2WC1A 1RP7A 3Q1LA 3S70A 1P3DA 1WXWA 3KJHA 3UZUA 4R6WA 4EB3A 4YV7A 5BWLA 5J4KA 1X77A 2LDXA 3B82A 2FFQA 1UAYA 2AH5A 4BMXA 1FP4A 5IJ0A 3HKBB 1OVMA 2ASVA 3QSGA 2ZE7A 1CCWA 4MINA 2F3QA 1L5KA 3AFOA 3GEHA 5EMLA 8ADHA 2DT8A 2WWWA 4CIBA 1VMEA 2AEMA 1ZI6A 4XQ9A 3TNLA 4RTOA 4X97A 4P38A 5C1PA 3L5OA 3WTCA 3SEFA 4BJ6A 4BFXA 5AM0A 3OZFA 4S1OA 1W36D 4TUYB 3LUCA 4JI6B 1RT9A 2BMDA 1YS7A 4I8XA 3BN3A 5H4HA 3GVCA 3BXOA 3LCRA 1QHEA 2AC2A 2ADMA 3HN6A 4Q12A 4OHRA 3H9QA 1ZSNA 1GITA 1NI3A 4DMLA 2XRMA 3E7DA 4ND4A 4OKSA 3HC7A 1JR3E 1Z6PA 3QMMA 4IIYA 1AVTA 1K08A 1BWRA 3L2OB 2A88A 3AM5A 4BNVA 4WNAB 4FFDA 3PCXA 3FWPA 3A3NA 3RK1A 4MYSA 2HL6A 2VWQA 4H4EA 3E27A 2C07A 3V8NA 3EIOA 4LJ9A 1C9JA 4RUKA 2GNAA 4KIGA 2HQOA 1REQA 3R6TA 4HLDA 4QO7A 2GXUA 3PEFA 5EE3A 1TUBA 1R64A 3Q5EA 1CJVC 4BC1A 2ID9A 1V1MB 2GM5A 2HUPA 1MT0A 1A9ZA 1I1QB 2Z4RA 3TB6A 4BJ3A 3IPAA 5M29A 5A5EA 1EUZA 3UBTA 2XXBA 3GH3A 2IYYA 1CUXA 3LRPA 4W5OA 2P68A 3OZDA 4FDLA 3QVTA 2DP4E 5I3ZA 1EVYA 3SMVA 2PXCA 3N39C 5TVKA 1SFRA 3RGGA 2Q6KA 2NO9A 4EYKA 2XAAA 3U9TA 1DQSA 1YR3A 1GNPA 4KNVA 1T34A 2GA9A 5FWXB 1D7OA 4WAUA 4TKVA 2XYRA 3SK0A 1HYHA 5ALRA 4IEEA 4NONA 4BVAA 3IP8A 1W2GA 2ZUSA 4MB6A 1RHJA 3AT1A 2I3BA 3L8HA 2F48A 4W63A 1PJCA 2AYYA 3RIYA 4HX2A 4POAA 1Y3FE 2XDAA 3N5CA 2O4UX 3EIEA 1U02A 5H59A 3TS1A 3VJLA 5CEJA 4RTPA 4TSKA 1Z4OA 4NJEB 3O1IC 2EIHA 1HMYA 4IRXA 1AHNA 3HUTA 2G0TA 5EUQB 3RVKA 1JE0A 1I6LA 4RMJA 3S7ZA 4R71A 1O5TA 5AVQA 1RRGA 1YU6A 4CEHB 1G2PA 2PSFA 1OV4A 1TTHA 2UYOA 4X66B 1XLTC 4B34A 1A8HA 3DA8A 4Z99A 4O2AB 1JHAA 1IYZA 4MROA 1CUCA 2BMFA 4OGGA 4PIMA 3UENA 4CMEA 1YDWA 1JLMA 2PLNA 5IEJA 4CN8A 4LYEA 2FN4A 2PK3A 4NU0A 1MMFB 3B52X 1TAQA 3GD5A 2F2TA 1XPRA 1GR0A 4MKRA 1NR5A 1L7XA 5FXMA 3HEMA 3TXXA 3L05A 4Q3CA 1EB9A 1Y1KE 3T1QA 2F3RA 3B6EA 3BB1A 3E7WA 4ZPJA 5BWBA 3BREA 1GUAA 3T3NA 4EB6A 1ZBQA 1TC1A 4HKTA 4U3JA 3CZ9A 1NLZA 4GXTA 4RORA 1U8XX 4EI8A 1B0PA 1BN6A 1K5HA 2PZ8A 3N74A 1D03A 2J32A 3ET5A 4FR2A 4LBWA 1SC6A 3LIPA 2VP5A 1A8QA 3FOZA 1WHTB 5SZHB 2C04A 4XYBA 3WKBA 1IWPB 2X8JA 1AB6A 2OCGA 2WFMA 5K0TA 3EUEA 3E4DA 2NVWA 1XF9A 1VCNA 5AR1A 3PPIA 3DDOA 3UOGA 1O6BA 1PIWA 3OZ7A 4LZOA 3ETDA 3ZDQA 1G0OA 3TW8A 2EYUA 4MIKA 5AQ1A 1WCV1 3ZLVA 1M67A 1JHRA 3VR3A 1U1FA 3WL5A 3HU2A 4AMUA 1PZEA 1L6RA 2D1RA 2JCGA 5MDHA 4WECA 1O6ZA 1T1IA 1V9CA 3ZV6A 3W5DA 4RHTA 3DAPA 1R0WA 1N6IA 3K2EA 4KJZA 3BKWA 3KCNA 1PJZA 2AW5A 3VRHA 2WTEA 3TPFA 5L4LA 5CYOA 1T2UA 1R6TA 2DSNA 4R54A 3T3DA 5ALNA 1BXGB 4QX6A 4G0WA 3VR5A 2VDWA 1X1TA 3AL2A 3ZK8A 3BULA 1T9GR 2BT4A 1BKDR 4C2UA 1J99A 2H5IA 1XZMA 2D13A 2PMBA 4NSNA 2BFBB 1JT2A 1NLUA 1X7XA 3R0QA 3ZHVA 2H0RA 4DAEA 2G3YA 3KQOA 1E5XA 1ZA1A 1UKZA 3BH7A 3DFFA 2BP7B 1PFWA 3HBNA 4M54A 4ZT4A 4EYEA 1EWKA 3ETCA 3O7WA 2PFKA 4J16A 1XEWY 2BTQB 3C14C 5E4YA 4WZAB 3RYIA 4EG7A 2JANA 3A2LA 3C1AA 2GWRA 3DS8A 3PKJA 2NTVA 1HNZB 2XQGA 1SC3A 1NI4B 4K5QA 4PG6A 4RESA 4PBRA 1SHZA 4RIGA 5IC5A 1G8YA 1TNDA 2D1QA 5FPSA 2X23A 3HB5X 3JVDA 3HBJA 1LD3A 2PVCA 2QKYA 3G8CA 4J0GA 4PZAA 1VQ1A 4YMIA 4N5MA 4AZ0A 3ERCA 1XT6A 1Q1BA 5AWFC 1UZUA 3IUYA 3Q5DA 1O94C 4NBTA 1NW9B 3OX4A 4DNFA 3DNMA 1YCDA 1NXSA 3PX3A 3ZXYA 3S29A 3WYFA 5K0SA 5GVSA 1UMCA 1NIPA 4WD3A 3ZD6A 5AKYA 3A26A 2EBFX 4KW7A 1Y3HA 3W6UA 1E9SA 4GPD1 4EEKA 1VMDA 2IEAA 2G40A 2XE8A 1OPXA 4J4TA 2XADA 2W2MA 5KTKA 1P9OA 3HCFA 4IM7A 1UWCA 1P75A 2I3ZA 1UBNA 5A05A 4MQBA 3ZOKA 3VKHA 4IX9A 1N6OA 1Q16A 1PO7A 1Q11A 1JN0A 3IDOA 4JYCA 4LW8A 4PLFA 3AKYA 3SC3A 1FDIA 1U90A 1O89A 3LHSA 4OJNA 4J7UA 1T4MA 1J22A 5EUMA 1QR6A 1WMFA 4NC9A 5AUNB 5BUCA 4EAAA 3EXHC 4M1EA 1A2QA 3LLUA 1LBSA 1H8EA 3PUJA 4YV1A 1H1LA 3SF8B 3IOYA 2BF4A 3PQ2A 3VVLA 3AF2A 5BWNA 2J48A 2CSXA 2EC5A 5HP4A 3PYLA 1J0XO 4LJLA 1YT5A 2WJAA 2HFJA 4OB7A 3ECSA 4Y7DA 3ZPXA 1DIOB 2HAEA 2BZ0A 4U8GA 4RF2A 3WLQA 3THWB 1Q2UA 3NIWA 4F4JA 3U4CA 1IAQA 3IQGX 4L7QA 5F51A 1U8ZA 1P1HA 2G80A 4OP1A 1XPJA 4A4DA 4TVSA 3IHWA 1YB6A 4I1UA 3K1AA 4CLHA 3K71B 1F2UA 1RJ9B 2IYQA 1R8QA 1G98A 2IK8A 2QV0A 2QNBA 4OEHA 4QDJA 4OKIA 4PYQA 2B1RA 3I2GA 3N6VA 2ZTUA 2H59A 2JA1A 1Y9ZA 1D04A 4IMPA 4C5BA 2QRPA 2Y71A 3BL8A 1JEDA 3GCGA 3QXHA 5E6UA 1O6CA 4DAOA 3CYFA 3GWGA 3DEIA 3FHOA 3IA2A 3QP9A 1PYOA 4EZBA 4Y6RA 2ACKA 5L8VA 4DLUA 4OLAA 5DF1A 5B1DA 3ZEAA 1Z16A 2WUVA 2BFBA 3BERA 3NYQA 3TEMA 5JNSA 3MWGA 1I3CA 1QRUA 4M53A 1T9BA 1N77A 5KYYA 3EAGA 3ETEA 3Q7SA 2J87A 3LC7O 1P60A 4LXQA 1GQRA 1IB0A 2P0EA 4FXOA 5LYYA 1DJNA 5JRJA 3AVUA 1L5SA 4TRMA 4TV8F 4GWGA 4NABA 3K0AB 3K9FC 2HTEA 1KJWA 3ZI0A 3BWVA 5JU6A 3MYYA 5E4JA 5G0UA 4I9FA 2FV8A 1A0OA 4ME6A 5ELMA 5KTYA 2YX1A 2COEA 4OQEA 2PD4A 2VPXA 2IXBA 1DAOA 2QD3A 4YV2A 4V2UA 3G17A 2VQSA 2QSJA 5D01A 2CN1A 4CPDA 1QGUB 3ZWVA 5K6AC 3WJ7A 2BFWA 3MRTA 4XFJA 3AR6A 4Z51A 1I7DA 2QMEA 1Y8CA 4MUBA 3MJEA 4WK6A 3U9LA 4TMKA 4OLJA 4CM8A 4IV5A 4WZAA 2AF3C 5C7IO 1EDZA 2A8YA 3R74A 5CFLA 4NXMB 4FQ5A 4KXYA 1QO7A 3UQYS 2GCIA 3DVRX 2RMKA 1VGQA 2GN9A 1JBEA 4GVLA 4CHTA 4EHDA 4EKDA 1YBMA 3IP5A 2PUBA 1ZL0A 3DAGA 2AG8A 1Z8NA 1VKZA 3NC0C 5EWMA 5TEWA 5CIQA 3UHPA 4MJXA 1EFVA 5F5NA 3B1ZA 1Y1RA 4Y2VA 4FOTA 3TL6A 2H48A 4GXQA 1ZD2P 2ODNA 4M87A 2QR2A 1GARA 2V6IA 3H04A 4F2PA 1XAIA 3CEHA 1CJCA 1JKJA 2NUTB 4RVDA 2FWJA 2UYYA 4DIEA 1RXVA 3R7SA 1J09A 3N9IA 1R8XA 5C31A 2F64A 3DV2A 4M8LA 4INOA 4RTLA 4EFKA 4JJ4A 4CRWB 3VTFA 4AZSA 4RULA 3L1VA 3BBPA 4WERA 2XDYA 1HZZC 3CLHA 1N7HA 5AJYA 2Z2IA 3FDZB 3N2GB 4MV7A 4XB1A 1BXKA 3ZHXA 5MF6A 1ZM2A 1QU3A 4PY2A 4QOSA 4DWVA 1ZCAA 3SLGA 1EM8B 1TUGA 5DULA 4FX5A 3C3KA 5A4KA 3NIGB 5JD5A 3WKEA 1ILEA 2UDPA 2ZU0C 4F4FA 4TXHA 2BKAA 5LBUA 2XT0A 3COVA 4WKNA 4ZOEA 2OYRA 1CZLA 2IH4A 5HQJA 2GAIA 1V6CA 2VZEA 1ZMOA 1DMRA 1E2PA 1K8YB 3BZUA 4OD0A 4TKVB 5E7MA 1P7VA 4ZO9A 1USWA 2NVBA 2WMDA 5J5AA 5EE5B 3OZUA 3IJRA 4DUYB 3OKCA 3UJ7A 2C00A 2JFXA 1ULSA 3CX7A 1FLVA 3DOHA 4PQGA 4OXQA 3R3JA 1XZJA 4FHDA 1F8YA 5JD4A 3GO4A 4G89A 4TMTA 3VHQA 4CF5A 1Q0LA 1G8JA 2O3QA 5AI6A 3F7MA 5I7UA 4C76A 3CRNA 1B7GO 1OI4A 1PD0A 2CB0A 4UE3S 4DIMA 1QHNA 3QMVA 4K81B 2A5GA 4CTOA 3QE9Y 1H05A 2Z6QA 4G8JA 2QLJA 3KOUA 1BYUA 4G2NA 1EFAA 2WINI 1HORA 4GLOA 4LC0A 4B81A 2OP0A 2B20A 3C5HA 4HYEA 1OJ7A 1ENPA 4TLMB 4LJYA 4B9AA 5K0EA 3F6BX 5TGTA 1KPHA 1UPAA 3HS3A 1J06A 2JRCA 4NBKA 5HMLA 3OE7A 3K70B 3DW3X 4G5QA 3TLGA 4UOEA 3HTXA 1FW8A 2PLAA 5ILQA 1M0TA 1XAGA 2YOHA 3EUWA 2B7BA 3GRKA 3IMEA 3ORRA 1RLIA 3GZNA 3KT8A 4FGSA 4Q02A 2Y0DA 1HZZA 1SXJA 5FDFA 1V3UA 4XVUA 2D7CA 3DMTC 5LOVF 1ZIOA 3KYCA 3C6YA 4D3YA 4G0ZA 4W8HA 1VG9B 2JJMA 3QJ5A 2VUTA 3AF6A 3EPPA 4H3HB 2OZEA 2VZ9A 2NPOA 3WB2A 4D74A 3SVLA 1NU6A 4EUEA 1RPAA 1VJGA 2V6GA 3A3YA 1IOWA 3H2ZA 4NZZA 3FBTA 3I4CA 4M6WA 2GILA 3LQRA 4BMYA 2XTNA 3RH0A 2B4AA 4LF8B 1YJQA 4YCBA 5EFOA 2VSXA 2YXPX 5M7EA 2ZETA 4DCSA 5BSWA 3CUWA 4KBFA 4WXPA 1USVA 2QTMA 2IYLD 3ISVA 3TMAA 1B76A 5EMKA 1OGJA 4CKCB 1XVUA 4GC9A 3HB0A 1F6BA 3ZHSA 2I78A 3DCJA 3H75A 1UK8A 1X2EA 5CVCA 5T6MA 4FX2A 3SS9X 1W1UA 1F17A 3WBFA 2J46A 4UDNA 3E4CA 4WESB 2W6PA 5KS2A 5LSAA 5DSZA 4IDOA 2IZZA 2AT1A 4QXRA 1Q1QA 3RAJA 1L5FA 4NXNB 4WASA 3WGVA 2IU3A 3H1FA 3W2EA 4N0QA 1OFUX 2D59A 1V5FA 4TXNA 3RSGA 1RABA 2REXB 1IJFA 4DW8A 5BSFA 4KITB 4G4SO 1L5HB 4V0MA 3ZWBA 3OEHD 1KYTA 4IV0A 5HOQA 3QMPA 4G1BA 5CH8A 1M2HA 1LJLA 4DEXA 5TQ0B 3RM3A 2M9MA 4FOOA 5AKHA 4IGKA 3V42A 4ENWA 3PDJA 3PTZA 3ZHCA 2PXHA 3DFZA 2B83A 3W5BA 4YJ2F 1DAPA 1U3DA 3NHWA 3KJIA 3VC3A 3S81A 5LJIA 3SYNA 2FEXA 4HBZA 4YACA 1NIJA 4D02A 1M1YA 2JLVA 1OAOA 4UCFA 2WR8A 3RC3A 1Q2XA 2B6HA 1SVUA 1RHKA 2J6HA 3K70D 2HN9A 1IXRC 1E64A 1LDGA 1P45A 2NIPA 4NS1A 3CNLA 4HFNA 4V1CI 5IH7A 4B5LA 3PUXA 2D7DA 2P4QA 5BQXA 4L57A 5FLYA 1O7JA 2IXFA 3G23A 1EVQA 2BR4A 5FEMA 1C1YA 4ENPA 5IULC 4HN9A 4QEKA 3JYPA 2V58A 3R6DA 1U04A 4NMXB 1O95C 3W5UA 4KPFC 4WK4B 4CI9A 4P1ZA 3VO8A 5I7WA 2BFNA 4J0QA 4B43A 4ZV4A 4N48A 1U3CA 1CNFA 1EIZA 2WJHA 4LYYA 5I7OA 2GEBA 4FSXA 4LYGA 3GGDA 1II8A 2B2NA 5GQSA 3F6YA 4OMDA 5LPNA 3M7IA 5FA5A 3W06A 2IZOA 4FT4A 2J9FA 4DLYA 1ST2A 2QMYA 4ZQEA 1EVJA 5J4VA 2JA2A 3S1AA 1GZSA 3ZI4A 3K8QA 2E18A 3KEFA 1P3Y1 4P5DA 1GFIA 5H82A 4H1WA 1CEEA 4O2BF 5BRJA 1LXCA 3AYXB 1G291 2WP0A 1V2HE 3KZXA 4Q3KA 5AH0A 2HHLA 2SKDA 3NVAA 2H06A 521PA 3AIOA 2W83A 3UGTA 1SEPA 1U1EA 3RANA 3CTMA 3G2LA 5JISA 4TOIA 3V3KA 1K5DA 2GMWA 4ARAA 4MVJP 1KWGA 4C0HA 1OXVA 5FBRB 1PQPA 2Q3CA 3I1JA 3OHPA 1M6HA 4AJ9A 2GK7A 4D0GA 4IOMA 1IPHA 1XQWA 4Z7OB 4HLNA 3BF8A 3ROEA 3DVSX 3VYTB 1A96A 2CXPA 3V1KA 4PHTA 3CEAA 1K2VN 4EYSA 1R27A 1YULA 4L50A 2QSUA 2YVKA 3BRCA 1RWWA 3T12A 5ITWA 3ZE1B 3BBLA 2FPOA 2B1JA 1MEOA 4YAFA 5IDYA 3G02A 3R7WA 1UJBA 1U6JA 3GLRA 1NXTA 3KJGA 5DRYA 3STVA 4ZALA 2HCJB 2OORA 4Q3BA 1U7TA 1KK3A 4FNMA 2NU7B 1PFGA 4R1SA 3W8DA 1XD8A 2WE7A 3OKFA 1HDYA 2O5RA 3GRZA 4FMBB 5KNBA 1XSEA 2HMAA 2QG4A 2QUBA 4QT4A 1W5FA 2PXXA 3FVWA 3NHJA 1G20E 5HQ3A 1JLSA 1OWPA 3JQGA 5FBHA 1OZHA 1Q1NA 4S04A 4X94A 1ZS9A 3DONA 1TK3A 3AHEA