3KQPA

Crystal structure of hpnmt in complex adohcy and 6-aminoquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqpA00
5CVVA 3CJRA 3AXSA 1SQGA 3OFJA 2JHPA 5FA8A 2EJUA 4DCGA 2O07A 4EK9A 1JR4A 2O0LA 4GBED 1U2ZA 3EMBA 3JWJA 5KQRA 2V7EA 3L8DA 4OQEA 4U7TB 2CMGA 3DMGA 4C08A 3JWGA 4FR0A 5HIJA 3GRZA 3NVMB 3U81A 2B3TA 3THRA 3GRVA 4DM3A 4R6XA 5EHGA 2FK7A 4P7JA 5HIMA 3FRHA 3EVBA 3HA3A 3EMDA 3GIWA 3KQSA 5E1MA 1R8YA 5GOZA 3CJQA 4E2WA 1M0EA 2Y1WA 5K05A 1EJ0A 2O57A 3AXTA 3TRKA 1QAMA 3DMHA 2CMHA 3G2PA 3IHTA 4QTUB 4RVDA 4JXJA 4GF5A 5E8JA 3FUUA 2PSSA 3KR1A 4HSGA 2NXNA 5DSXA 3VC1A 1F3LA 3I64A 5FCDA 4EKGA 2PWPA 5KVAA 2FK8A 2C7QA 4MHTA 3KQVA 2A14A 3G8AA 3NTVA 3GU3A 4KVZA 5CIYA 1RI4A 1IY9A 3EEOA 2P8JA 1PRYA 2YTZA 1EQAA 3IYLW 3KPWA 1XDUA 2ZSUA 3P97A 4GUAA 2NP6A 1M6YA 3K6RA 1YFLA 2YQZA 3DXXA 1VP9A 1FJXA 2Q41A 1R00A 3FYCA 3OU2A 1B42A 3QOXA 1M6EX 4PYMA 4RSRA 2P40A 3BWMA 1UIRA 3TR6A 2OKCA 4YUXA 1X1AA 5LQNA 3SSNA 3E7PA 5H02A 5DSTA 3TKAA 4PNEA 4DA4A 4YUYA 1XTPA 3LCCA 5EOVA 3SVZA 3UWPA 5CD1A 1KPGA 5CM2Z 2Z6QA 3LBYA 3ORHA 4CKCA 2AN5A 3B5IA 4P7GA 3UJ6A 2AOUB 5FHRA 3A4TA 4CTJA 4Y30A 9MHTA 5FWDA 5LR6A 3HCCA 3CJTA 3OFKA 3UBTA 1VPTA 4QVKA 4RVGA 3R6TA 3SSOA 4R8RA 4ZTBA 4LECA 4X1OA 3CCFA 2IFTA 1DL5A 2G70A 2IPXA 2H00A 2YXLA 4R8SA 1FBNA 2AOTB 3DH0A 4OBXA 3OE5A 4HTFA 4Y2HA 5ICEA 3LGAA 1WS6A 5JUWA 1YZHA 2PKWA 2AR0A 4KRGA 4KIFA 3DMFA 3GRYA 4YV2A 4RTNA 2IP2A 4OBWA 2ZW9A 2P41A 4IV0A 4QQNA 1D2CA 1R74A 1KHHA 2AOXA 2ZIEA 2ESRA 4G56A 4AZVA 3HNRA 3MTEA 3TQSA 2P7IA 1AQJA 5DTQA 2LD4A 2FHPA 3DTNA 3KQWA 3F4KA 2XYRA 3KR9A 4C07A 4BLVA 2BR4A 2VZ9A 3LKDA 3I9FA 4FSDA 5DXJA 3FTCA 2P7HA 3E23A 2AOVA 4ER0A 1I1NA 2WA1A 3M33A 2YXEA 5FUBA 4A6EA 4F85A 3RIEA 4HRAA 1XJ5A 4GOOD 4V0RA 5C1IA 3NWBA 1D2GA 5LQRA 2I7CA 5HEKA 4GOND 3NDIA 1QANA 3ME5A 2VP3A 1SG9A 1WG8A 1WZNA 2Z6UA 1G55A 3JWIA 5CVDA 3AWIA 3NJRA 1G8SA 4HGZA 5ERGB 3MCZA 4RTOA 1AQIA 1JSXA 3G7UA 3G2OA 4E30A 4XUEA 3OCJA 5HIKA 2E5WA 4AZTA 4BP3A 2NYUA 3G5TA 5FHQA 1ZKDA 3H2BA 1Y8CA 3M6UA 1DCTA 3DUWA 1NE2A 2ZFUA 3GNLA 2JH8A 4ER3A 5KS2A 1XCLA 2PJDA 3NW9A 2ZVJA 1NV8A 2GPYA 3MQ2A 4KWCA 3TFWA 3DR5A 3M4XA 4GC9A 1JG4A 1FPQA 1NBIA 4LWPA 2YX1A 4E2ZA 5K03A 5FULA 1KPHA 1VIDA 3GXOA 1XDSA 2JJQA 1TPYA 3REOA 4E2XA 2Y1XA 3DP7A 5GIOE 5ICFA 5EMLA 1SUIA 2HWKA 2BH2A 3I5UA 4P58A 2KW5A 2FCAA 1SQFA 3P2IA 1G38A 2UYHA 3M6VA 1QAOA 1RJDA 3BKWA 4AZSA 1L3CA 2PX5A 3BZBA 3B89A 2JH9A 3SXJA 2B2CA 3ANXA 1DUSA 3ERCA 3DXZA 7MHTA 3KR2A 2N47A 4PCAA 1ORIA 4GC5A 3SMQA 2ZULA 4RTRA 3M6XA 4F86A 1MJFA 5BP7A 1FP1D 4OX9Y 3A7DA 5EHIA 5FWAA 2K4MA 3OZSA 4AX8A 3KQYA 4CWAA 2EJTA 2ZTHA 1NW7A 2P1DA 2OYRA 5K0CA 2PWYA 3T7RA 5EMJA 3A7EA 3ELWA 3FZGA 3ELDA 1T43A 1VQ1A 4H0NA 1I9GA 5CCXA 1X1BA 1WXWA 3UJBA 2AOUA 3HCBA 1KP9A 2AZTA 3OZRA 3KQTA 4BLWA 3HP7A 5EQJB 4MIKA 1MHTA 4QPNA 5DX1A 1X19A 4PYLA 5EIWA 2G71A 5HFJA 4M36A 2QRVB 3G89A 3MERA 4R6WA 5DTMA 3GWZA 4CXMA 1P1CA 4E32A 3CKKA 1Q0SA 3CGGA 3A27A 5EEHA 3VSEA 2IGTA 1JG2A 3R9XB 3DOUA 4X63A 3P2KA 1ZG3A 2ERCA 2HV9A 2PXAA 1JQDA 2XVMA 3EVEA 4R05A 1VLMA 1L9KA 3KKZA 1X1DA 4QTTB 5DM2A 3GRRA 5IH3A 4CKEA 4PCLA 2CL5A 5BXYA 3E8SA 1NW5A 4ER6A 3P2EA 4WVLA 2ZWAA 1JTEA 3KPYA 2VDUE 1KR5A 2P35A 4PWYA 5MHTA 4PIMA 4PYNA 3T7TA 4YMGA 5EEGA 2BR5A 2WA2A 4OQDA 1KXZA 3TM4A 2P3QA 3KU1A 4XCXA 5M5BA 3TM5A 1KYZA 2OB1A 1KIAA 2R6ZA 2ZIGA 3G2MA 4HGYA 5ICCA 1Q0TA 3KQOA 5C9ZA 3PLAE 5LSAA 4X61A 2FRXA 2R3SA 3HM2A 3P9IA 2YXDA 3HA5A 2H11A 5EG5A 1P1BA 4GOLD 1P39A 3FTDA 5K0NA 5FTWA 3SR4A 2OB2A 4Z2YA 3OU6A 1NT2A 5GWXA 4ER7A 3LBFA 1OR8A 3KHKA 2BM9A 4DZRA 1XVAA 1ZGJA 5EIFA 3O7WA 3RW9A 4LG1A 3FTFA 1YUBA 2G72A 2GH1A 2DULA 3QV2A 3C0KA 4YUWA 3X0DA 1H1DA 5KQSA 4KIGA 1ORHA 3M70A 5HILA 5K0FA 2QY6A 1JG1A 1QYRA 4RV9A 3I53A 2IH4A 1I4WA 1KPIA 1O9GA 2XYVA 1JG3A 5E9QA 3PFHA 5KYGA 5T6BA 5DX0A 5HIIA 2HNKA 2EX4A 3KQMA 3MGGA 3TPZA 3LECA 1V39A 5K09A 1G60A 3E05A 5F2OA 2BR3A 2C7RA 3KPJA 3HEMA 5DM4A 3MHTA 2ZZKA 1L3BA 3EVAA 2H1RA 1BOOA 4RTJA 4L7VA 3NVKI 3PFGA 5FADA 4PYQA 4ER5A 2OZVA 5GM2A 3HCAA 1F38A 2EFJA 3IV6A 4P7KA 3FUWA 3TOSA 5LQCA 4UOEA 2ZLBA 1O54A 4RYLA 5EZQA 2P3LA 4C4AA 5DM1A 2WK1A 3ER8A 5EMKA 5E9WA 2ZBQA 1RJGA 3G88A 2PT9A 2PX2A 3EVCA 2AN3A 3FRIA 3HVJA 4EVIA 4ATNA 1RI1A 3G2QA 3UJ8A 4WXHA 4RTKA 4RTMA 3EGEA 3NDJA 4KDRA 4M7RA 1X1CA 2GAFA 5GM1A 4YV1A 3UJDA 2PLWA 4XUCA 5F2NA 4PYJA 3OE4A 2G1PA 1JQEA 4C06A 3R3HA 4FP9A 5K0JA 3M6WA 1NKVA 2ZBPA 5P8WA 3UA3A 4FT2A 3OPNA 2JHAA 3UFBA 4DMGA 3HTXA 1YFJA 2NP7A 1BHJA 3B3JA 4QQKA 4E70A 3MCTA 2OBFA 3FPGA 3UJ9A 4QDJA 5FQNA 3BWCA 4V0QA 5B1SA 2O06A 4RVFA 3UJCA 2GS9A 5E1OA 1AF7A 4U7PB 5EKUA 8MHTA 3SM3A 3PX2A 3CC8A 2G8NA 5CCBA 5T64A 3B3GA 4HTFB 1EJ6A 2QRVA 3BXOA 2UYOA 4POOA 5LQUA 2ZWVA 3GO4A 2QE6A 2QYOA 4PGGA 2C7PA 3P9CA 3I58A 2BZGA 3BWBA 5HOQA 1RI3A 3FPEA 2OY0A 4X41A 3MTIA 5C0OE 1ZGAA 1XDZA 3FUVA 4M38A 2UZ4A 3LCVB 3LX6A 2YVLA 4PIPA 4XUDA 4BP1A 3R0QA 1N7JA 5BW5A 1NW8A 3A25A 4RX1A 5GP1A 5E1DA 3UA4A 3C3PA 2IIPA 3EEYA 4F84A 2I9KA 10MHA 4KW7A 3P71T 2NXJA 4M37A 3AY0A 1UFKA 2OPBA 3PS9A 4YUZA 5IKMA 3BWYA 2JHCA 3V97A 2I62A 3DXYA 3R24A 5ICGA 3A26A 3T0IA 2IDJA 2UYCA 4RWZA 4CTKA 3C6KA 2C7OA 3BGIA 3ER9A 3SSMA 1YF3A 4YMHA 1VL5A 3ID6C 2EG5A 3LCUA 5CVEA 1N2XA 4AZWA 2ZZMA 4FSXA 3OU7A 4MWZA 1UWVA 3LPMA 5E2AA 3CVOA 5T67A 1JTFA 1RI5A 4ISCA 3LDUA 5E8RA 1ZHFA 3AJDA 3Q7EA 4IV8A 4O29A 1G8AA 4B17A 1R6AA 5FA5A 4RTLA 4PYOA 2HTEA 5K0GA 2PV0A 2AOTA 3LL7A 2PY6A 3HCFA 2IH2A 2ZZNA 3FPJA 5EMMA 5CVUA 2IBSA 3FUXA 2UYQA 1KYWA 5FQOA 1RI2A 3HCDA 3TKYA 3GCZA 2B25A 3P9KA 5K0BA 5HZMA 3GRUA 2HR1A 4E2YA 2VS1A 2ZBRA 5DWQA 1WXXA 3LDFA 1QAQA 5LQKA 2ADMA 3LHDA 5CUQA 2AOWA 3HCEA 1VP3A 2ONZA 3G5LA 1XXLA 3BUSA 1SVUA 3EGVA 3EPPA 1QZZA 1NW3A 1Z3CA 5DLYA 2VDVE 4P7FA 1HMYA 3BGDA 4E31A 3PT9A 4EMSA 5K01A 2NNWB 4GQBA 4RVHA 1AV6A 5E9JA 3FPFA 3HVKA 2IH5A 5K0EA 2ZIFA 2XVAA 4PONA 1NW6A 5F2KA 1IM8A 1YB2A 1EG2A 3KQQA 1JSZA 1YZ3A 2OXTA 4KDCA 3ELUA 1BKYA 3P8ZA 4EKIA 5LQAA 5GIPE 2XBMA 5DTRA 1R18A 2YR0A 2ONYA 1NV9A 2IDKA 4OA5A 3GJYA 3MB5A 3TLJA 3C6MA 4C05A 4IKPA 2FPOA 2NXEA 3PTAA 1L3IA 4K6MA 2AS0A 3HVHA 3KPVA 4PYKA 3LSTA 2FYTA 1EIZA 1ZQ9A 3HVIA 3BT7A 3PX3A 3B7PA 4GOMD 4EQZA 3O31A 3PVCA 4FS8A 4HH4A 4DCMA 5D1NA 3SGLA 2OO3A 3TMAA 2ORED 2PX4A 2V74B 4QDKA 3WSTA 2GLUA 4DF3A 2QM3A 1INLA 3EVZA 1N7IA 4MQ4A 2PXCA 2I6GA 2PVCA 3T7SA 3THSA 3DLIA 1O9HA 2GB4A 4BLUA 3NMUF 3ELYA 1G6Q1 3GDHA 3PB3A 1WY7A 4OA8A 3UJ7A 3Q87B 5DRYA 3QOWA 3LDGA 1HNNA 1VE3A 5D1HA 2BM8A 3KR0A 5CVJA 5G02A 5E2BA 4FT4A 5EKXA 5GINE 3B3FA 4RTQA 3NWEA 1RJEA 2B9EA 2O05A 3OZTA 1P91A 3EGIA 3C3YA 3RODA 3G8BA 4FGZA 3KQPA 5EC8A 4FZVA 5DRTA 4MTLA 1L1EA 3BKXA 1R8XA 4PINA 5DT2A 4IWNA 1PJZA 1IXKA 3DLCA 2HMYB 2IBTA 3SX0A 4PYIA 4A6DA 5K8VA 3K0BA 2AVNA 2VDWA 1EAMA 3FUTA 4HC4A 5EVJA 2PX8A 3V8VA 2JG3A 3FPHA 4GEKA 4NECA 4PGHA 2CKDA 3O4FA 5DXAA 1TW2A 2CWWA 3P9NA 3KPUA 2XYQA 3EVDA 2PXXA 4BY9E 3FYDA 2F8LA 4C03A 3DULA 1FP2A 2AVDA 3LKZA 4X60A 3UJAA 4C04A 4RTSA 3EVGA 3JWHA 4DQ0A 1D2HA 3GGDA 4HG2A 5DX8A 5E1BA 4DKJA 3FTEA 4AUKA 2GA9A 2NXCA 4E33A 3HA7A 5U4XA 1SUSA 1JQ3A 2B78A 4RTPA 5EPEA 1VBFA 2ZCJA 4LWOA 5K0LA 4CKBA 5DM0A 3UZUA 4YV0A 3VYWA 3D2LA 5LQJA 2YUIA 3EVFA 2Z6AA 2PT6A 5DPMA 4QPPA 2P3OA 2AN4A 5EZSA 1NBHA 5JR3A 3S68A 5EGSA 4QVGA 1RJFA 3MAGA 1TW3A 1XCJA 3VC2A 1SKMA 1BC5A 4YUVA 3IEIA 2DPMA 5BW4A 3BGVA 2PBFA 2PGXA 3CBGA
chains in the Genus database with same CATH superfamily
4BP9A 4FTWA 2JZNA 3QY0A 3U6KA 3FVVA 4MGKR 3ZY3A 1SQGA 3D7NA 2C3MA 3DHYA 4RM3A 1PGJA 4FXPA 5KOHA 1V0JA 4M6WA 3TW8A 1BA3A 4JP1A 3TDMA 3Q11A 4DR1B 3ZHQA 1U2ZA 4G5HA 1MB4A 2IU3A 2WKRA 3V1LA 1M2FA 2GESA 2OQIA 5JCOA 4CKZA 1CUHA 3PIIA 1TYZA 1EP3B 5JCXA 2WAOA 2BKXA 3GIWA 2A1TS 4E2WA 5GJVC 3FLAA 3VYTB 2VK1A 1VPLA 1EJ0A 3CT6A 1G20A 1LF5A 1KJZA 2X7JA 3JPWA 3RRXA 3WGKA 2V7BA 4M22A 4RVDA 4UKDA 4YIKA 3FUUA 5DWDA 2O2CA 1XZAA 1VKJA 2AD5A 2DF8A 3I64A 4TLEA 2PUAA 5HCNA 5AM0A 4AS2A 1H94A 2BBSA 4IUDS 3A4NA 2ASVA 3M6LA 2CJWA 3DD1A 3HGTA 1CZKA 1ZUIA 1S0UA 2O8NA 3B85A 1PRYA 3HEBA 2P90A 3CB4A 3NNNA 4FXOA 4LE2A 2I6QA 2EFYA 2QSZA 1C7QA 1F2DA 1XDUA 2ABWA 4GECA 4OMDA 3UAXA 4YAGA 2AB0A 2IHYA 1I30A 3RHSA 1VHJA 5E7IA 3IX7A 3O2SB 4P8RA 4Q24A 1BJKA 4HRYA 4II2A 5FBWB 1KH1A 2FVYA 2UVQA 1X7ZB 2VPWA 3BVPA 4WOBA 1AKRA 2HD4A 4QX6A 3TR0A 1Z7GA 5B6IA 1UOOA 1YI0A 5LMZA 1Z5GA 1P3JA 2CFIA 2C1XA 4ZYZA 2HREA 3CHYA 1JZQA 5FRDA 1XA3A 3ZLBA 2UZ1B 4G9BA 3WL8A 4JBGA 1EUZA 4HZGA 4RZ3A 5TC4A 4OUDB 4NOJA 4N65A 1Y4SA 2FW7A 3V7NA 3DEYX 1Z0SA 1EZZA 2BFWA 3LVRE 3QTLA 4MKIA 1EI9A 5TDHA 3ILHA 1V11B 2REQA 3DOCA 3ZS9A 5DGIA 3UHAA 4ALIA 1QK5A 4IIJB 4JLWA 4BO2A 5CITA 2RAVA 1GPMA 4MJLA 2G70A 2QQ5A 4JSRA 1U1CA 4HTFA 2C9YA 1U3TA 1C81A 3L8CA 5CM8B 3RAEC 5A0VA 2PS0A 1W25A 1YQQA 2BFFA 2FWAA 1QLWA 3I8SA 4MV5A 4PYRA 5ECYA 1W52X 3N05A 3JCZA 3UQZA 4B32A 3V32A 4GKVA 3PIDA 2CNOA 4PRYA 4RH0A 1FSZA 2ESRA 2I55A 2XYPA 3MYYA 4LGVA 3I9OA 2O3JA 2RHBA 4Q3OA 4ZVSA 3SOPA 1E69A 2WEKA 1DKOA 1K0FA 5B1HA 2PZ8A 3CPEA 1X1TA 3LC7O 4Q4HB 3LX5A 5FNZA 2V9ZA 3WLRA 2IV2X 2P7HA 2AOVA 4HLCA 1I1NA 3UO8B 2WA1A 1A8PA 3F9IA 1CHDA 1JKIA 1ULSA 1TJ3A 4EUFA 3AF0A 3PSAA 2FU5C 5T7BA 5ALRA 1I32A 3P20A 4F46A 4LJLA 2R1UA 3EXHB 2PE5A 4NCJA 4BFYA 1RZRA 4KYTA 3TJMA 2YOHA 1VHQA 4JBWA 4BE9A 2BM1A 2EOAA 1K7EB 4XASA 1RQGA 2Q1SA 1L5SA 3U48A 2IXAA 4Q37A 3MWDB 4W63A 5IW8A 3SX4A 5AMXA 1J23A 3PC8A 2WD7A 2A5GA 1LF0A 3E9DA 3SBOA 4FKMA 2YMQA 1G5HA 2XZTA 4ZOQI 2WRZA 1LLQA 2WHQA 1Q15A 3FOBA 1G5IA 2P5UA 4H1WA 5J4KA 1JFFA 1JFSA 3ITNA 1I94B 4PZLA 2FF7A 1JA1A 1PGOA 3MT0A 1GPWB 1O94A 2X8JB 4W8HA 1JEOA 5FBRB 2Z1MA 4EMBA 3T34A 4QBFA 1SU8A 4IXDA 3PWSA 2J7PD 1MVLA 4PPQA 1U3FA 3TINA 1SUIA 5JYDA 3VJKA 4YPVA 3SKVA 2R4UA 1ORWA 2ID4A 4BIMA 5A5GA 3G2NA 5TQ2B 2XSZD 5EIBC 2HDWA 1PW7A 1POXA 1ZMBA 2B98A 2XQIA 2Z4SA 5FPTA 2IHZA 2GYUA 3A04A 5T4HA 3E2IA 1WO8A 3T35A 4NEQA 3HXQA 3DXZA 1KEZA 1NM5A 2EBHX 4BNVA 2CKMA 3JQAB 4JDPA 3UWOA 2HBQA 5EHIA 5FWAA 3OZSA 3ZZ1A 2FRDA 4BWYA 1ZOOA 3KQYA 4R8VA 4Y7DA 2Y9PB 3U60B 4ZVOA 4NXNB 1UDBA 1NVGA 4ZXPA 4O0MA 3C4JA 3KCQA 3CNEA 4MVJM 1XD2A 4BMDA 3ZD7A 1WTAA 4AK9A 1G2OA 1PT9A 4HB3A 3ELDA 3K09C 4Q3KA 4ZDJA 3Q72A 4YJHA 2HA2A 5BWNA 3NNDA 2AV6A 1YBHA 4FEGA 5AVKA 1O6ZA 5IXYA 1TKRA 3RVLA 3ZDZB 3JD0A 3LLSA 2ZYAA 4P84A 3TW0A 3OOEA 2AX3A 4H6XA 2IWHA 3ZDXB 5KYVA 4BQSA 5K6TA 3OZWA 4BE7B 4M0KA 4US2R 3MERA 4MWEA 3W8NA 4U6NA 4XLZA 3IEXA 3WL7A 2CD9A 4WDQA 3F90A 4JFAA 3QU9A 5A2GA 2HCRA 3CUYA 1KS9A 2AEMA 2QIPA 2V96A 3UMCA 2H54A 1N2JA 2PT7A 4ZCRA 3CXRA 2RGNC 3BMNA 4IUBS 1FP4A 1ZG3A 2ERCA 3OY2A 4ES6A 3QYJA 2BONA 1DE0A 5KU7A 1X1DA 1NLUA 4YXWA 4HNUA 1X7YB 5JXJA 1S89A 2W2QA 2ZSHA 4TL9A 1C1DA 1KETA 2O7VA 4W6QA 4CKEA 1C0LA 2ZE5A 3P2EA 5L6MB 2JI8A 3OQPA 4RQUA 4GO1A 3KNZA 3CF6R 4F6CA 1FFSA 4NRDA 5K99A 1BWQA 2YVAA 2ZRIA 1T36B 2ZSJA 1YCFA 5J1SB 3BK7A 3H83A 1I3MA 4HGYA 3VI4B 4FMDB 3G2MA 5DNVA 4Z9AA 3UT5B 4AJ9A 5KTPA 2AKEA 3HUFA 4X9XA 2UZAA 4B9AA 2AT1A 1SPBS 4ZOLB 5EG5A 4EAQA 1OBVA 3O8DA 3OECA 1BN7A 2FV8A 3NTLA 4JK3A 3ULKA 4CM4A 4WJLA 1CP2A 1RWXA 4MVWA 4YASA 3QEAZ 1RM0A 3BGOS 4WX2B 1X7GA 4C78A 5EIFA 4BO8A 5TQVA 4HY3A 3QW4B 3IAHA 2J0QA 1EGMB 4MRAA 1SC1A 4B3IA 2JAQA 3A8TA 4B2YA 5D7BA 2IIVA 2YRFA 3F71A 1OC2A 4CF5A 4LBWA 2XYVA 1JIVA 4N3GA 1FMFA 5DX0A 3RK1A 5IDQA 2DERA 1TTTA 3GJ6A 3MGGA 3LECA 1V39A 3T5CA 2JLYA 1X7DA 3BJIC 5LFAA 2NZXA 1ABBA 4G09A 4AY5A 1DCMA 1X92A 2WIBA 4YYZA 1NMYA 2VQ6A 5AJYA 2OTCA 3T54A 2I8AA 2NVOA 1CZUA 4F11A 1DMSA 3GBPA 3NV7A 1ZM3A 1DI0A 1NXTA 2KSQA 4JNKA 4P7KA 5A3QA 5IJ0A 1EUQA 3FUWA 2H4ZA 4RF2A 1MUUA 5DGXA 2HIHA 3U3KA 3AYZB 4C4AA 2JLQA 5E9WA 3M81A 3V2GA 5DHRA 2AN3A 3STUA 4J03A 2B1IA 3ISTA 4GWLA 3EGEA 4IZOA 4U9IS 4KDRA 1FJHA 2PLFA 3JASA 4HAVA 1A9YA 4KK3A 4LEIA 4Y2SA 3TLMA 2WZDA 3FCSB 3PRJA 4ZOEA 5JJ5A 3R3XA 4ESEA 5LDDC 3QYPA 2G1PA 1CRPA 1J4AA 1V37A 5K0JA 2TS1A 1HNXB 3LWDA 3D0OA 4CKCB 1AU9A 5F5NA 3AR5A 3H1PA 1JMVA 5IKPA 3ZU4A 3RK0A 4NONA 1Y80A 2I78A 2YWRA 1X9GA 2ZE7A 2P67A 5AUPB 4FOPA 4RSHA 3AVOA 1BE8A 2VHTA 4W5HA 3S55A 1RWVA 2Q3BA 3UJ9A 5FQNA 2PD6A 4OD0A 4V0QA 1T8SA 4I2VA 4ZI7A 1RS0A 2GTIA 4NU6A 2AQHA 2R6GA 3QFCA 4QBIA 3T15A 3UJCA 2HRCA 2YJZA 5EKUA 1ODSA 3AUJB 3LK6A 4DNQA 3L8MA 2G8NA 1C8KA 3MILA 3DZ8A 5T64A 5GY7A 2VNHA 2B21A 3LUGA 2FOLA 3V4LA 1HE3A 2X14A 3LXXA 2XTJA 1FJ2A 1Y3HA 2HEIA 1QE5A 2W6JA 3FJYA 4QNRA 5SICE 3V4RA 5FX2A 2JJ1D 3IHWA 2PLNA 4F4JA 1U0RA 4XJVA 3HV0A 3UF0A 4PHGA 4JELA 5BNFA 1QKIA 3DCNA 4M9QA 4DTIA 4GDMA 1R0RE 4LHWA 3T94A 2JHFA 2F2TA 1BH2A 4OCZA 3ZV5A 4F84A 4MLZA 5FDFA 2J9RA 3OE7A 3B6ZA 1JWAB 4OJNA 1H2FA 2XBUA 2KM1A 4B4DA 3HACA 4B35A 3KTDA 1Y5RA 3IELA 2UDPA 3T1OA 3QKSB 4TPKA 1J8YF 2VI5A 4AZ3B 1KAEA 3L7CA 2BC9A 1XNGA 1KI8A 3R6GA 4CTKA 2NYAA 1TRKA 3CW9A 2FPMA 3ZNOA 2A4MA 3C3EA 6Q21A 1E5QA 2HTFA 1FY2A 1QHNA 1DRJA 1HK7A 1E2NA 4OPMA 4IIVA 3AONB 4YQEA 4D98A 2C2BA 3LDUA 4HPXB 4KR9A 1AT1A 3LDAA 3A0UA 1QFZA 3ZNQA 3RBZA 2VJMA 4BC1A 1KARA 4U2DA 3FPJA 3UV7A 5J58A 2QR3A 5FQOA 2P2GA 4NTZA 2Y1LA 4E1AA 1A5BB 2CNLA 3H2IA 3EBOA 1T10A 1IATA 4QOGA 4LCJA 3LY5A 4CM9A 2P9ZA 3H4TA 4M9RA 4ZI7F 1ULTA 1K6IA 2VRCA 1C3OA 3LHDA 4E09A 1U94A 1ECBA 2VAPA 4TLDA 4XLLA 4RH1A 1CK4A 1QZZA 4JGGA 2Q3FA 1Z3CA 3PNOA 3VQTA 4XR9A 5CBPA 1AKEA 2NO9A 3MMXA 2WJ4A 3A1SA 3QJYA 3AV0B 3JS5A 4CLDA 2XYHA 1Z4LA 1AGYA 1ZH0A 4HN2A 1DC5A 1ZXLA 2C97A 2WICA 1TQ8A 2JLCA 2OLJA 1HORA 4JB2A 4J3NA 4D9BA 1YOVB 2F59A 1NBEA 1R6XA 2LCQA 4FZ5A 3W90A 3KQQA 3DVLA 2LCIA 1XT6A 2IYVA 4CQMD 3EULA 2YWHA 2EW8A 4CL2A 1UP7A 5E38A 1KRXA 2LRHA 1O97C 1G7TA 2XA1A 3NPAA 2B35A 2JANA 3N2IA 4ZWNA 1LW7A 1AD2A 2BN4A 4UZSA 1C0PA 2N75A 4QGFA 4AYXA 4QUBA 1FS6A 4DNXA 3KEGA 4ZYLA 1KL7A 3RGWS 4DIKA 3EFOB 4ZVKA 3ZTYA 2VRNA 1XELA 2W2MA 2NUPB 4LOIA 4DR4B 1N3IA 3PHHA 5IC5A 3SKYA 3TQCA 4DJAA 4W7IA 4NDZA 2HQSA 3FA2A 2ORED 2VHQA 4PLZA 5LN1A 2GLUA 4KSCA 1TT7A 3A9SA 5C35A 1Q74A 4HKTA 1EA5A 3UUGA 5BT8A 1XMQB 1FTNA 2E2WA 2PXCA 3E9ZA 4P54A 3IMEA 4R1LA 3THSA 1WLYA 3TOVA 5J4YA 5KJCA 4JGBA 3DV0A 4PO3X 4OA8A 4DIBA 1L8XA 4A9AA 2SKCA 2JFBA 3GYGA 3KR0A 1UWKA 3R5XA 5G02A 1U1EA 4MUFA 5HF5A 2B9EA 3QA3E 2O05A 4NYMR 5E9AA 5JY1A 1RHUA 1T1IA 1F5SA 3I28A 1RHQA 4TSKA 4WZAA 2CVPA 3EDOA 3NTXA 1DBPA 2MSWA 4IXNA 2HA7A 5DRTA 4GBJA 1P29A 3BKXA 5CHEA 3COZA 4AIRA 1PJZA 4YV7A 1A7JA 1IMJA 5AW4A 3NX4A 1XZQA 2OGTA 4HC4A 4JA2A 8ABPA 3V8VA 4J16A 5DYYA 3T1VA 5K3DA 2O8CB 3VRHA 3UMRA 1KJNA 3TTXA 1J00A 2JI4A 3W2IA 4AG5A 2WPNA 4BY9E 2RIRA 2O1XA 3QEKA 4UVEA 3C97A 3AFOA 4ZOAA 3DVQX 1Q1QA 3BMXA 4UOZA 5I01A 5GVRA 1UADA 4ZYTA 1L5OA 4HUQA 1E0JA 5E1BA 5FB3A 5LYYA 1H65A 4YAIA 2VT7A 4EI8A 2GPSA 1J0EA 4U2FA 1PGNA 3O8QA 3GLSA 4RTPA 4XFKA 4B43A 2NUTB 2R7NA 4IDEA 1CJMA 5K8UA 2F00A 1Z13A 3OLQA 3C48A 4BQFA 5K0LA 2F9LA 2G8LA 4O4LB 5DM0A 3VR5D 5LQJA 5AYVA 4A73A 4O5OA 2PS9A 2WT9A 2FMKA 1NNEA 4RBNA 2O6HA 2ZYIA 4OLFA 2FN7A 4Q1CA 2ZB8A 5EZSA 4MR9B 5SYAA 3WIDA 1RJFA 3T7JA 3VZPA 4MMYB 4D9HA 1Q16A 3Q3HA 1Y7PA 5ULLA 2ZJ2A 4JI1B 3WB1A 4L27A 3NEPX 4BKUA 1N2SA 4EVSA 3AFMA 3CIOA 3T5PA 3COJA 1EDBA 2P2NA 2GO7A 2W0MA 1NVMB 2GTHA 4RE5A 4AUEA 5KJEA 2QN9A 2DQ4A 2WSIA 2G1UA 3L6RA 1P2DA 4O2BA 1A98A 1WEKA 2IF0A 1I1OA 3I2FA 2ISCA 1SVSA 5KYUB 2ZYWX 4PSDA 1M8FA 3H9UA 1LEHA 2XMPA 2DWCA 2YYYA 1KKUA 2E85A 3A14A 2NV2B 3GRZA 1Q14A 5AJXA 3T95A 3ZE1B 2FK7A 3LUCA 1R9NA 1QRDA 4X7RA 3KFVA 4UE2A 5TR9A 2O2IA 2GK6A 1Y5MA 2D7DA 1GV1A 1Z0DA 4QHTA 4L9RA 2VP6A 4UUNA 1M8GA 4BHTA 2HNAA 2Y76A 5L40A 3ICVA 3UGJA 1FRVA 1P77A 3I1YA 2XNKA 2JA1A 1J21A 4Y2UA 5KVAA 1R0SA 2ZUWA 3AH8A 4UAVA 2HT6A 3NH9A 1ZSVA 3CX8A 3DF9A 4TKLA 5HS4A 4CVNA 2D2IA 2BFCB 1GUYA 3LVFO 1FX0B 3ZV3A 3GVIA 4BCDA 2P8JA 1XHFA 4NX2A 3DBLA 1HDEA 1MFPA 3UB4A 1U9YA 4GE3A 2R11A 3E22B 3VAYA 4F1WA 2ZB7A 3SC2A 4K5QA 3W6PA 1I9CA 4IJ6A 4XM1A 3ETJA 2D3TA 1KDPA 3G59A 3INRA 5AXDA 2IPNA 5IEBA 3T0FA 4I3HA 2OKCA 5AI9A 2PMCA 1WR8A 1H1LB 5EJMA 1K2VN 4DBLC 1TCUA 2WM9B 3B1VA 3WYFA 2JKYA 2VCHA 2VN8A 3SHWA 3TIFA 2Z43A 3GOQA 4EG0A 2PFGA 9ABPA 1S1CA 1PK9A 3EA0A 3N8KA 5LBIA 2FZKA 3C8HA 4UMDA 4R3NA 1OTHA 4GEGA 4CJXA 1WBDA 1F20A 3IPLA 5KYWA 2WMOB 4WUTA 2RC6A 5AIAA 3A4TA 1AHNA 4KXUA 4AF6A 4EB6B 1WE2A 2C7GA 3CJTA 1PL7A 2WNIA 5B53A 4KGDA 1C9KA 2GWHA 4O2BF 1Z0IA 2F62A 1R4ZA 3SQNA 3SHTA 1GL9B 5F76A 5SY9A 1QQ5A 1SHZA 2IFTA 4P5PA 4JX9A 4BFUA 5J40A 2VAWA 4GMKA 3GLGE 3C8MA 3HL4A 2QZSA 2NNLD 2NTYC 3JARB 4Q1VA 4R54A 4EX7A 4BX3A 4YV2A 1QDEA 5KO2A 3IAAA 3ZDDA 1QR2A 4YRMA 5IP5A 2QUIA 1Z4MA 4HGPA 2IIBA 2FE1A 3O92A 2GZMA 4MKHA 4DUPA 3FAZA 4QOEA 3ZX5A 4DR3B 2GF9A 4WNCA 1QHIA 3AVPA 1C7EA 1H8HA 3PI7A 3DUFB 3BXPA 3LKDA 3MMPA 4NCAA 3PA6A 4TT3A 1ADYA 3EIFA 1QJ4A 1DB3A 2R1ZA 4HDMB 1JLRA 4U8GA 4D0LB 4DBLE 1KDRA 1JG6A 5PNTA 4AAYA 2OHGA 2BD0A 4ENRA 1D2GA 4KVGA 1AUQA 1SQ6A 1HYEA 4XB6B 5A5VA 5CG2A 1YGYA 1XTTA 3O8RA 1VE7A 3ESRA 3KBBA 3R41A 3AWIA 3KOMA 1CUAA 3F6RA 4JZKA 3C7AA 3FDJA 3M0EA 4OQMA 4QDUA 1E20A 3RE1A 2WFAA 1F7UA 4Z2AA 1IZZA 1E3WB 2DPGA 2I3DA 2XV1A 1L7MA 3L7IA 5DMXA 3FWKA 1DKQA 4B2LA 2YYZA 1DCTA 5M04A 5K3AA 1C9DB 1N32B 1MQ8B 4FGUA 2QHXA 5KNBH 4KBFA 1P0MA 2WUGA 2Z09A 3L92A 1A7KA 1U28C 2HLHA 1E1QA 2CNWD 2DT8A 2GNPA 4AIIA 4NU0A 5D3ZA 2J0EA 3AT1A 2R62A 3U44A 1KA9H 1EFAA 3PPYA 2ZT7A 3I8XA 2XGGA 3PVZA 1EDOA 3DA8A 3UIEA 1KIFA 1ZMOA 5HA5A 4LXUA 4DVGA 1TQ2A 2NO6A 3A2NA 1D6JA 4Q9AA 3ZLVA 2J85A 1E9AA 4QD3A 3NVDA 4HNQA 1FDWA 3GRPA 5L95A 2V9CA 1JQJC 1N36B 4Q7EA 1L5FA 1J7JA 5I5EA 2GZ3A 3BTSA 3EH1A 4YN3A 4YRFA 2NM0A 5CXUA 5JFTA 4WSOA 2JFPA 3SVTA 4IQ4A 1DUSA 5DN9A 2O8BA 2VNSA 2B4KA 4OKNA 2DR0A 3WLQA 3AUYA 4C4ZA 5LOVA 1G5RA 3WGHA 3FZYA 3Q8LA 2G4CA 4TXMA 2WJIA 1GFZA 3NANA 3OZEA 1W85A 3Q3CA 2QL7A 1RMQA 5AJUA 4ABYA 5EIXA 3WP1B 4OKSA 1GL3A 1ZXBA 2N1MA 4RQBA 5DMHA 1YRLA 4A10A 1Y89A 4ZAGA 1XPRA 3ZDAA 3PHCA 4UPVA 5DGTA 3D8HA 2JGDA 2R1VB 4K81B 3I6YA 1WZCA 3MLAA 3PF8A 5IVPA 2CJYA 3RSGA 4X65B 2QAGC 3GVXA 3LQ4A 2DGDA 1EVZA 1WXWA 2KPOA 3H18A 4G5FA 4O33A 3KAKA 5HHTA 1OLXB 1U65A 2FMTA 4JV5B 1ODKA 1E0AA 1ZHOA 1PIWA 1BD3A 1VCMA 1YK1A 2WSMA 2XGSA 4OGLA 3IUMA 3SS8A 1V4VA 4NENA 1SNYA 1QYVA 4GICA 3TLBA 4TRMA 1ZNQO 3AZQA 2GHTA 2UYYA 2VUUA 3CRZA 2KS6A 4JVLA 3OY7A 3IP7A 3MTBA 2EW2A 4JKOA 3Q10A 1JHUA 1W0CA 2BMFA 1ZBQA 2EFDB 1CC1S 3AEUA 4UFOA 1HWYA 3C7CB 2O7SA 1X77A 1OXUA 3KXIA 3M83A 3ZZTA 3ECAA 5FR1A 4DJFC 2F1HA 5DM2A 1HYHA 1X1EA 4QNMA 3U4GA 3NT2A 4M9SA 4CEJA 4LZJA 1W0KA 1JTEA 2HQRA 1KR5A 1HLDA 1DAEA 4ZJPA 1LTKA 5IFLA 3SZRA 1Y1PA 2IQ5A 3RS3A 3EFHA 1QIKA 4MWCA 1UBJS 2ZJ8A 4MWGA 4ODIA 3GELA 2PM8A 3QHQA 2C78A 2MR5A 2VATA 1TDJA 1C41A 1RYMA 1U8XX 3CPSA 3U0VA 4WLFA 5F73A 1UM9B 1ISIA 1M2JA 2GZ1A 2XEDA 4PR3A 1KR2A 2C04A 2OB2A 2PX6A 2XT6A 4I36A 4OHFA 2ZWOA 4DGSA 1PJBA 5CFMA 1UPXA 3JD1A 5CBKA 5LOVF 2ZAOA 3BJZA 1ENOA 1AX9A 2YV2A 1ZGJA 3B8EA 4FHZA 2AKYA 3AESA 4MV8A 4BRWA 2BUCA 3UMYA 4RABA 4LPSA 4AXBA 3GFFA 3X0DA 1A8SA 4TKVA 1TJNA 3NHUA 3OZVA 2BRUA 2O5VA 1WNTA 4FOLA 3COWA 5C1PA 4BBJA 2IH4A 5E9QA 2GAJA 2CY0A 5CRIA 5JTTA 1I8TA 2HL6A 2IUUA 4QEDA 2QGNA 5FI0B 4BKPA 2HXSA 2ZE6A 4LY3A 4I4IA 4WACA 3R6LA 3TUJC 3KPJA 3Q5GA 3K35A 1LPMA 1L3BA 2GSWA 1YZNA 2H1RA 1HQDA 4JLSA 4YPFA 3NVKI 4G1CA 5CFNA 4PZEA 1ESDA 2D2FA 3AR8A 3EW7A 3FAKA 3H5VA 3W6ZA 4CT4B 1OFHA 1SCJA 3L06A 1RYFA 1YQEA 1OXBB 3DXFA 5AUQA 4EENA 2D1QA 2HK6A 3EPHA 1M2NA 3P0RA 4YRAA 5FXMA 2FCRA 2EYUA 1BRTA 4GI7A 2CXQA 3G88A 3EG5A 4XIGS 4GSKA 2AEEA 2B7CA 2WJ6A 2WIFA 3E7WA 4PSVA 3FHTA 1UK7A 1UBSB 2J5XA 2OEPA 3NT5A 2FVXA 4M7RA 2GAFA 5TNXA 3B6IA 2XCSB 2WIDA 3U4HA 2ZYRA 4Q21A 5JANA 2AD1A 1LV8A 1AVTA 5H9WA 1VPVA 1NXWA 2XUFA 2ETXA 1T8TA 3KAPA 2JGAA 1F12A 1TA9A 1HEYA 1F2UA 4PGMA 4WVFA 3TZLA 1KE2A 1L5HB 4NMMA 1EHYA 4XM0A 1IVYA 5ITWA 1SD1A 3LZDA 2E55A 1R0XA 1BKDR 3I52A 4G5QA 1RRCA 4CU5A 2V7QA 2GS9A 2J8ZA 2UV8A 2C9CA 1AQYA 3CC8A 4OQZA 3SYKA 2Z9BA 1TJ4A 4O3MA 3VPSA 3JYHA 3E53A 3K16A 1P0CA 1N0VC 3NOVA 2KQUA 1MQ9A 4KE6A 2WG2A 2PKRA 4PGGA 3WB0A 4C6RA 4J0FA 4DDUA 2WJ3A 3BWBA 1RI3A 3OTGA 2OY0A 4X41A 1DAOA 3NB0A 2JFWA 1P4GA 3IIEA 2Q3JA 3IBFA 4IINA 1RKBA 3NASA 4EGCB 3QFHA 5IK2A 2EV9A 1JKFA 3H11B 2RHDA 4CCYB 2NADA 3W2HA 4S12A 5KTOA 3X2FA 3C3PA 4I1VA 2QRJA 2GBCA 2RHTA 4YUZA 1J07A 1FP6A 2VUIB 2D8MA 1OY1A 3TX2A 2CFTA 2DFVA 4QUDA 1QO7A 1OD6A 1PJSA 2C1ZA 5FA6A 2R2GA 4YJGA 3R0IA 4FE7A 4CBVA 4L8VA 3QBJA 4BQNA 1Z6QA 4B81A 5KYYA 1R6DA 2V7WA 1DWUA 3LC2O 5TVKA 3TXAA 4WCFA 1FF9A 3ESAA 2CUZA 2XWSA 2XCOA 1R4MA 2QL9A 2QJWA 3OQ6A 3PUWA 5TXGA 4D8UA 2VHJA 4G4SP 4NOKA 4C6HA 4EYOA 2ZZMA 2WJPA 3H86A 3IOMA 3IP3A 3NIGB 5E2AA 3NONA 3IXQA 5H80A 1EVEA 2AN9A 4DMLA 4ML3A 4OLBA 1TEVA 1CZNA 1G8AA 1H6DA 1U7OA 4YBRA 1RWKA 1BMFD 1HF3A 4EJ2A 3F6SA 4OSEA 3PNMA 2QQ0A 4AZ0A 1G8HA 5KWIA 1F0YA 1KY5A 4NQRA 3W9UA 3EODA 3SVLA 1QM5A 2HO5A 5IMBA 5K0TA 3TKYA 1U04A 4RJJA 3UXYA 3B6JA 1C0KA 3FHOA 4RVNA 2PN1A 1Q92A 1UDRA 2QY9A 2VS1A 4KRYA 4ZO8A 3LUDA 4F9TA 3J81k 1Y7LA 2VYCA 2YNMC 1ZD8A 1A9TA 2PZMA 3KKKA 4NV1A 3WLMA 2QUKA 5CH3A 4OU4A 3HCEA 4MRRA 1VP3A 3VR2D 4G8JA 4LXHA 4M9CA 1ZH6A 5IKEA 3CO5A 1AG9A 4P7FA 1XKLA 5JAHA 5CXSA 1C3XA 1NJ2A 4I50A 4M1QA 3UK0A 3MF4A 4QU9A 5IZCA 3MVEA 3P9ZA 4HJXA 3QNWA 2JGIA 3F1KA 2A67A 2RB4A 3AP1A 4CTOA 2N3ZA 2WTEA 2H4JA 4L75A 1UK9A 4NI5A 1C30B 5EP4A 2R2AA 4BN0A 5F2KA 4B0OA 1YZ3A 2W2LD 2Q1WA 3T9EA 1ACJA 3RAFC 3ELUA 3N07A 2F8MA 2XRYA 2FN8A 2A9RA 3OICA 2WKPA 3FNIA 3QGMA 2QSJA 4FW9A 3G8CA 3RJMA 3O9VA 3H99A 2NU6A 1P31A 3PTAA 5EE3A 1HO3A 1JJBA 1NFRA 2GVDC 2YZ7A 1K4KA 3ZH9B 1FA9A 4QJ3A 1S8AA 3HR4A 3PK0A 4A0SA 1T3TA 4MUKA 2R60A 4UDNA 5AI8A 4WZ6A 1MORA 4EZIA 1U6KA 2I4LA 1HT0A 3I72A 1DIOB 1ENPA 3OSUA 1Z0AA 3MQFA 4HATA 4QDKA 4F4IA 3GPBA 1SWWA 2BEUB 4XCQA 4BQOA 4DF3A 1B0ZA 1M34E 3COPA 2J3DA 2GXQA 4LVNA 1Z5VA 4M3NA 3DLIA 4NG5A 3ELYA 5CYPA 5FJJA 1BX0A 1N2HA 3FNQA 1A1VA 5BRJA 2LPMA 1IQPA 4GRAA 3ZE2B 4NJOA 1SBQA 4Z4GA 3OX4A 2AHRA 3F0TA 1DQZA 3IPRA 1BMDA 3R5SA 4NEGA 3WYBA 3IQWA 4BUJA 4WQMA 2O59A 2J31A 1HZZC 4GLLA 1K6MA 4HLNA 3C3YA 3K9QO 4D4JA 1R66A 4ZHQA 3K71B 1KZGB 3FLEA 4N3NA 1VBKA 4RK7A 5AHKA 4UQLA 2RGRA 1L1EA 1R8XA 3NRBA 2NX2A 4I50F 2XDWA 5SZHB 4OFBA 2NT3A 2XKKA 1L9XA 1MPXA 1E3IA 1NBMD 1XU4A 1U9IC 2EGHA 3TDNA 4F1JA 1RLJA 2X76A 1LSOA 4JLAA 4NBWA 2X2OA 3UV3A 2BKUA 4BNNA 2I7TA 5DXAA 1Y1SA 3LS2A 2CLMB 3GN2A 2QUJA 3EVDA 2PXXA 3EZ9A 3PYXA 4IS3A 3FF1A 1DEKA 4DDKA 1GPBA 2WBLC 5AKIA 2G09A 1LFDB 3ZS8A 4NC9A 1G0NA 4JKYA 1MAWA 5A7FA 1QF7A 2Q5EA 5CXQA 1YZKA 2HV8A 2DXIA 1EMDA 2XUOA 3RRMA 5LBUA 3F5QA 1PEAA 3EF0A 1L7RA 4FFPA 2R6HA 1IUKA 3A0RB 4K9OA 4M0FA 4Q16A 6GPBA 2ZCJA 3RJ5A 1H4SA 5H5JA 2RH5A 1U1GA 2VXBA 4EY7A 1HGXA 2ISQA 3MCUA 1KYTA 1QO0A 3NETA 3L01A 4QELA 5JALA 5KEIA 4J0GA 3I2YX 1KAMA 2PH3A 5ETJA 5BV2P 1NQWA 3K6SB 1AKMA 4YRDA 5E3HA 3IJRA 2CDCA 2EERA 3NWOA 1N5MA 2O9JA 5DWVA 4BX2A 3IEIA 3PG5A 4CNQA 1J8QA 4IDFA 2JIRA 1SB9A 3UPTA 2NU7B 2PWZA 3EE6A 5ABPA 4OREX 3ANNA 2WPDD 5JSKA 4TS9A 2IA5A 4ITVA 2G07A 2BUAA 4FI3C 4TTRA 1GITA 2JIBA 5B2FA 2DKNA 2IYYA 4G01B 5KQRA 4DRXA 1Z12A 3HB1A 3PC7A 5HKLA 4ZHQF 5AM3A 2PBLA 2YIMA 2C58A 4K9QA 1D2NA 3D7RA 4P7JA 3TQFA 2VBIA 4RHYA 3EMDA 3PQ8A 1KMHA 2Y8EA 4DFDA 4E4RA 4RHCA 3RJTA 5IAAA 2QGFA 1CZLA 1QAMA 2X3UA 3GYBA 3GLQA 3W3AH 3DMHA 2O19A 2IEDA 2WWIA 3I23A 5JE8A 4NJEA 1VI6A 4AP5A 5LUAA 4YMUA 2Q27A 4PBSA 1Z4PX 3YASA 2J67A 4CL3A 4EKYA 1P9NA 1ELOA 3O26A 1KSFX 3AETA 4KE9A 3FVRA 1I4EB 2JFQA 1X39A 2YN4A 4B7AA 5IXSA 2ZJ3A 5CLFA 3ZBTA 5KJFA 4FILA 3E9NA 4DADA 5M34A 1AGRA 2H2IA 3X2EA 2C84A 3P97A 4GUAA 1UDAA 4D6PA 4KLNA 3FFXA 3KZ1E 4K6OA 4M76B 4YGYA 1SKBA 1WUJS 2HJRA 3CLUD 1ZICA 2PFKA 3NKLA 1R00A 3PHGA 4JEMA 4MULA 4RQAA 3DTYA 4TUYF 4WY8A 1THMA 3IEVA 3CUVA 4KE8A 1R6TA 2FP4A 1TYBE 3ZGNA 3U4IA 1J90A 5BOSB 4CFZA 4K3VA 1LH0A 1W1WA 3Q40A 1T4DA 4HO1X 3C1OA 3OCUA 1R10A 3PXBA 3ORHA 3EXEA 5FOQA 3FNFA 3H1TA 5D5HA 4ND6A 1V7QA 1EVKA 3ADOA 1RKQA 2R87A 1BYIA 2GKOA 3MINB 3SQMA 2WW8A 5TE9A 5I47A 2SICE 3UOGA 1JMYA 4KUEA 3WNVA 5U1PA 1Y3CE 1Y4ZA 1YJQA 3E5MA 4UTVA 2WUVA 1Q7TA 1DX6A 4JLVA 2TYSB 4RK4A 5BN5A 1CEEA 1WB6A 1JEAA 1VOTA 1OPXA 2FZCA 2G5GX 1K5GA 1Z33A 2AOTB 2ZITA 3ZE0B 3EPJA 2JFGA 2O2DA 5KCZA 3QI7A 5TVGA 3M1YA 1ZIXA 4LZNA 4MB2A 3K30A 3OJ0A 2AR0A 1P19A 4P3NA 1QGED 3QA9A 1TE2A 1EPUA 4MYUA 1C9NA 4NBLA 1BXZA 5DT9A 2HCJB 3JTEA 4FDMA 1OT3A 1SN7A 4PO8A 5IYZB 3PZRA 1WHSA 3SJAA 3VKVA 2AWOA 4X6UA 5EIAA 4ZVQA 1IBCA 4KMRA 2QP3A 1PWEA 2A0FA 1KY3A 1Y8ZA 4O8ZA 2YMPA 4JJKA 1W19A 3F4KA 2HC9A 3IMKA 5JXWA 1R5BA 3A6LA 2OVFA 5GONF 1A9PA 2X9GA 4HAZA 4A6EA 3MTDA 1A5SB 2Q4BA 2GOYA 2VC2B 4MUBA 3QEBZ 1Z0JA 3HYCA 2Y0CA 3E6AA 1B2LA 1HLFA 2QB5A 2GO1A 3L4SO 2I54A 1F8UA 3EEFA 1SG9A 4RLHA 1J9EA 1MW9X 3WYEA 5HTOA 2ECOA 4NAUA 5C8YA 4B31A 3O4RA 3C15C 4URUR 2PUJA 3GMTA 4EGJA 1OU0A 2LUOA 3BS4A 4H7KA 3ROQA 5AD1A 1JU4A 3RS0A 1PZMA 2XNJA 3GFQA 3B13B 4NOLA 4QTXA 4TTTS 3SS7X 1MO2A 5ED4A 4CM3A 5J59A 1UBMS 3KU4A 5TB5A 4YJ2B 3RSSA 4OEHA 5KHLB 3BA1A 3MQ2A 1RXUA 2A0XA 2IW1A 2X9LA 1KAHA 4Q3NA 3EDQA 1Z18A 1XX6A 4HDKA 3VZCA 4CMKA 5TT1A 1E2FA 2WWFA 2FEWB 4JROA 1Z37A 4TVKA 3MW8A 4RD1A 3H2JA 4ZICA 1ILEA 1PF7E 1R1DA 5HZHA 3D6VA 3ZHRA 1AURA 5LLDA 1ZL2A 3WK9A 5GPBA 1XNHA 3TQIA 2O8DA 1RVV1 4W9MC 4K9NA 2YIDA 3D7MA 3DGEC 1PR1A 1FS5A 2WU0A 3OP1A 4ZT6A 4C7JA 1SHTX 3K0AA 3Q6IA 4TSFD 3MEQA 4EW6A 3OQVA 3AVXA 2WWYA 5MGBA 1SUBA 4EO4A 3C3BA 4QZVA 1G42A 2AEJA 3WGJA 2ZXUA 2H0RA 3BN3A 4DBVO 2ETVA 3OZGA 2HLDA 3PZBA 3BWXA 2D1TA 721PA 5IWAB 4Z3OA 1OWLA 3IPCA 1RQRA 4NICA 3RFUA 4Q93A 4A5OA 1XNJA 2DZDA 1CYEA 3MOSA 4TZTA 2VPPA 2GHIA 4QASA 5DP2A 2A0KA 1ZSNA 2JCSA 3EAGA 2FI1A 1OV4A 3WE7A 4C2BA 4C7VA 1EDDA 5L9AA 1UQTA 4CM1A 4Y9TA 5JASA 1RKVA 5DV9A 1KP9A 2DH6A 4D5EA 5C8YF 2IGBA 1R4NB 4BLWA 1HL3A 1NULA 1ID8A 3GGCA 4MQLA 3O5AA 4Q9NA 3C7KA 2BOVA 1PR0A 1AO3A 2J3MA 4V3BA 4PG4A 3NRCA 5G0UA 5HFJA 4M36A 2QRVB 4XYGA 3B5EA 4J1SA 3R7WB 1U8AA 4KRFA 2Y0DA 5EEHA 4DMKA 1BMQA 3A27A 3HPQA 3IOYA 4MLDA 5IKOA 2JKZA 4WKBA 5KNCD 5CIQA 2PRYA 4EP1A 5FBHA 2FZWA 4JXZA 5I8WA 3SFVA 1B14A 2D1SA 1T6YA 3DOHA 4KQKA 4MVJG 1AQNA 2CK3D 5HMLA 2ZIAA 1MCZA 1NXXA 3IO3A 3DEKA 5AI6A 3AR2A 4P4SB 2BGMA 2AE2A 3BOSA 3KSAC 1R15A 4O2RA 2XMGA 2IVFA 2X41A 4DLLA 4MP8A 5MF6A 3CZ9A 4C0QC 3EXFA 2QTZA 3ZHVA 4XD2A 1XDGA 4JQYA 1F1JA 1W59A 2CF6A 2WJWA 5JNWA 2CE2X 3VHXB 4Q03A 3VX3A 2I7DA 4MVJI 3FXAA 3BBLA 1M2GA 1O57A 3IR5A 1GGHA 5KNBA 2R5FA 2R1TA 4DTCA 5KOHB 3GEBA 1UAYA 2G83A 4GOLD 1PAUA 4M6WB 4PVCA 1L5NA 3RNOA 3QPBA 4H6PA 3IPXA 3VNRA 5GVSA 5HKBA 3A4VA 4UTZA 1N1DA 3KQUA 3WGQA 4HH1A 3EIHA 2A58A 2HBZA 4ENPA 1Z47A 5D5PA 2I8CA 3K1AB 2JEZA 1NR7A 4HX5A 5K6AC 2ZTMA 4UUOA 2G72A 2I1WA 2Q2NA 2Y2UA 3PXEA 2X23A 4N12A 4U6QA 4BAUA 3PSHA 4ILEA 4ZVUA 4XVCA 4DHWA 3KKMA 1M67A 2BSAA 4WY2A 2HHHB 1G20B 3BMOA 1E66A 4G1FA 4B4UA 5KYGA 4GU5A 3GDFA 2ZIUB 3BAZA 4DV1B 5I7VA 5CEFA 5L6LB 1GKUB 4JI4B 4EAAA 5EZYA 1UPUA 1F0PA 1IZ0A 2Q3CA 4M2LA 5FKJA 4BZWA 2VG8A 2Q8PA 3PFGA 4FBGA 2P9CA 1IN8A 2R96A 1CR1A 2CJWB 2JDIA 2PSJA 4EH1A 5JEEA 2CFCA 2A78A 2HQ1A 1AHPA 5IARA 1GDDA 1U02A 1HBJA 1O54A 5E6RB 1IOWA 1QPBA 2YC2C 1PDWA 4NJMA 2DFDA 3VR3D 1OH6A 2J9XB 2OBLA 2PX2A 3FRIA 1QFJA 3NDPA 2GZAA 3F96A 2R8YA 3U3DA 1V3UA 3B70A 3G2QA 2GKSA 2JIDA 3L05A 2QTBA 1RVDA 2IV7A 3ZXUB 4BTEA 2XLBA 2JIOA 2RI1A 5GM1A 1BOFA 2C4UA 3UJDA 3MLBA 4E2FA 4PYJA 2GD0A 4ND2A 3T8YA 4LHYA 4OXIA 5I4IA 1ZJZA 4LVCA 3W6NA 4HVCA 3KV1A 1Q7RA 3GT7A 4QLBA 4BGEA 1DT5A 4ZCQA 2IS4A 4NCBA 4ZJUA 1FFHA 4KCGA 7ABPA 1XCGB 3GLHE 1TCVA 2WHRA 2DSTA 1LVGA 2RHRA 3D7SA 5SV2A 4ZVRA 3WHKA 4CLHA 4DT1A 1FL9A 4IGIA 3CF0A 1FRFS 4HUJA 1QYCA 4U7PB 4AO6A 3INNA 1PJLA 4LI3X 4LRQA 4BMOB 1UXIA 2R00C 4HTFB 2KLBA 3U7JA 1P5RA 2Q0XA 3IVMA 2FW8A 2UKDA 1OX6A 2V0NA 1QIJA 2NIPA 3CEPB 3IUJA 1T5IA 4AKHA 1E2GA 4MV0A 2GN2A 3QI2A 1ZGAA 3EIUA 1RC0A 2GZHA 5D2CA 2NO0A 2E87A 2EKPA 1JVSA 3SU8A 5BW5A 1JAZA 4RA6B 5EZYF 2ZI7A 5HQJA 3GN1A 3RWMB 2P9YA 3MUOA 1NKSA 4RZXA 4FQ7A 4JUBA 3W1EA 5CT4A 5JS7A 4F6RB 3H5WA 4I1YA 5HDQA 5IKMA 4A15A 2FLKA 4G07A 1E4OA 1QNLA 1H6CA 2NU9B 5GJCA 4IJVA 1F06A 4ZCLA 2YL2A 1L4EA 4JFRA 3V3KA 3EIOA 4UMFA 5LKAA 1I7SB 4LRTB 4NBKA 1N2XA 1JJ7A 2LWIA 2VF7A 4ARIA 3GRFA 4OQYA 4FSXA 1SHLA 2XWBF 1T35A 2TMKA 3MN1A 1KAGA 4MWZA 3UCFA 2QBYA 1J22A 1SOWA 4IX1A 2NLOA 1ZM7A 2EW1A 3EQ7A 2WD7B 1B2RA 5GMOA 3AJDA 2BFEA 3FSJX 3FNEA 4RENA 2PAAA 4FEAA 3CT4A 3SBDA 4LDQA 1LSJA 3PIRA 4B47A 3RYCA 4NZ9A 1C9MA 2O1SA 4AO8A 3N8HA 2VF4X 3ZXYA 1JFFB 4MUGA 4B5KA 4F8EA 1UZLA 2XB4A 3QU2A 3U56A 1Q3TA 4YRIA 1E3SA 4BQPA 3C5WP 2I4TA 4BU1A 5HZMA 4HUTA 1JQ5A 5K8LA 1GGFA 1AGPA 1FTGA 3LUPA 5IJ9A 4CLXA 1WXXA 2WHEA 2ZOSA 3W5JA 4FFLA 1BEZA 2AOWA 2C2GA 1ZN9A 3CCBA 3C3DA 5JAQA 3UMMA 3NUZA 3A28A 3IB6A 3I3OA 3S70A 4DILA 5A3JA 5JMWA 1Z15A 4HLQB 5DLYA 4GPTA 4RACA 4BPBA 4FBLA 4YMLA 4X3PA 1UJBA 2JVKA 4IMJB 3HH8A 1XO1A 2GEFA 3KJEA 3PFIA 4RZQA 2FPKA 3B9PA 1G59A 4K0KB 3ZQJA 4NFYA 5EJEA 3TLZA 1BGXT 1NHGA 3DDHA 1QP4A 1ZJ4A 4PONA 1NW6A 3WICA 2JIQA 3OTHA 3OUUA 3SF0A 5CB6A 1TEZA 1L7DA 1XTQA 3GRAA 4MVJH 5UKDA 1ZONA 2HOQA 4PX2A 4DC0A 1Y63A 4O5AA 5CT6A 1GGJA 2R6R1 1QIHA 4YVFA 3W5AA 3LBNA 4JR1A 1S3FA 4PC6A 4EJ6A 4MYCA 2ODQA 3TNFA 2VP0A 3SYLA 4DIOA 3D3JA 1NSYA 4CG0A 2O8FB 4RJTA 3ZY5A 1EQUA 3OVMA 4WA7A 1WDTA 3OQJA 4S35A 2GRJA 1HKHA 1IUOA 4QU8A 3LNCA 2E49A 2VEDA 3ZCPA 1OXTA 2LXNA 1YE5A 4HQOA 1PG5A 3PDIA 4I8XA 4FS8A 1QNFA 2I7XA 3RB8A 1E2EA 1COWA 1GILA 1T2FA 2D5CA 4MPDA 1CDEA 4UFPA 1JA0A 3RQIA 4C0WA 2Q6VA 3QWFA 4K05A 2FW0A 1YUMA 1NIPA 4OYLA 2CGEA 2QORA 1RZRD 4GI1A 2K6GA 1L5KA 5KAPA 3T7SA 4BTVA 1WEHA 4DQKA 4R8KA 3PB3A 3GWGA 2HBYA 1KYXA 3KV3O 1Y3AA 4N8DA 1C1DB 1GCGA 3GNQA 1M3SA 4CLRA 2ZYVX 3I9MA 4DLNA 1KORA 3GP3A 3NAQA 2DY1A 1OHHA 4RD3A 2FSVC 4OSOA 1PO7A 1JHMA 3GLUA 2H5IA 4E88A 5HP4A 3EGIA 3SS9X 2EP8A 2H1SA 4OXXA 4JUFA 4BTLA 1FVXA 4HPJB 3TBKA 5ARBA 3DM5A 4DLVA 3C3XA 1O94D 3NIBA 1ESNA 4LAFA 4UVIA 4D46A 4O4IB 3AOGA 5CNIA 5JPDA 2AZXA 2FFQA 3OI7A 4J43A 3V46A 2WQZA 2QNIA 1RCTE 1CR4A 3DWGA 3O4FA 1JHAA 1E7YA 2OV2A 2P5SA 1UP6A 4FDAA 2FH5B 2G1JA 4C04A 3P5BA 3NHFA 5KOYA 1PLJA 1Q0UA 2HEGA 4PXSA 1D1QA 2X4GA 3HDTA 3KEOA 4Y0VA 3RYTC 2X1VA 1R16A 3MB8A 1P0FA 3O9MA 4QFDA 5CAEB 3R9XA 2VDKB 3UW3A 5EESA 2PGAA 5BSFA 2RJNA 1M1YA 3FWHA 3K92A 1DBQA 2XTMA 3S3TA 2HF9A 3F4LA 4GAEA 2JATA 3HYNA 4MV1A 4YI5A 1QV9A 1Z6AA 4LX8A 5A9SA 3RWOA 3GR6A 3ADBA 2BKLA 4DLSA 2BGWA 4ZI3A 4FUTA 3V55A 2AN4A 4D4MA 2PH7A 4DV7B 2QLJA 3D0RA 2AF3C 1ADJA 3WBKA 2C83A 4X45A 3WYNA 1IOZA 3CUSA 4YCAA 3OIDA 4QLAA 1W46A 2YDXA 3ISVA 2GYWA 3L43A 2VTKA 4R51A 3DONA 1NVVQ 3ZCTA 4LV5B 1SM4A 3D5QA 2H4YA 1IXYA 5TX7A 3R9IA 1HM5A 1EK0A 1I4OA 2CMDA 1TUBB 3TLGA 4DS3A 1Q95A 3E9QA 3OPXA 1TYDE 4C08A 1VC2A 5AM2A 5KBYA 2ACVA 2R44A 4FR0A 1JHOA 2A6PA 2X2PA 5TLSA 2B3TA 3TNYA 5LMUB 4MUEA 2GGSA 3HA3A 4PC1A 3E0QA 3KKOA 4YRQA 2C8JA 2OV1A 3OM0A 3TYXA 5H8WA 5TQ0A 3KOOA 1TXGA 1YR1A 3O82A 4LTNA 5AW3A 4WINA 4MCAA 1PQYA 3CSDA 1G6KA 1IPHA 4UZEA 5CIWA 4YWJA 4BLPA 6LDHA 4GF5A 4ZI7B 3C8DA 3GJSA 3E58A 4QHSA 3U16A 1F3LA 4R1MA 5FCDA 1SXHA 2GJKA 3I9KA 2ZBEA 4HDNA 1QU2A 1AUPA 3KQVA 2YH2A 2L18A 3PUIA 1IHOA 2DHQA 4RSMA 3OX3A 3O1IC 3G8AA 4KXYA 4OG2A 3U3XA 4MAMA 3G79A 2ICAA 3NM6B 4PLTA 1NJFA 5DP1A 4E5YA 1VE1A 2WIKA 3BFVA 2OKGA 3FOWA 4GPBA 1CNMA 1QVVA 1TZBA 3JW8A 5CG1A 4X7PA 3DXXA 1S3GA 4F2GA 3H42B 1UM8A 1J49A 4NG4A 2QV7A 2DOKA 5AHOA 4R8MA 3ETLA 2G4VA 2W8BB 3JSXA 4F3NA 2JFOA 4OK5A 1WZUA 1GUAA 4MR7A 4DA4A 3RUPA 3AG6A 3IE0A 3MWKA 4OATA 3IQHX 3A3YA 4FSHA 3D6TB 3FWYA 3KUDA 4OL9A 2O8EA 4K9PA 4LQDA 5F3RA 1J33A 3ASZA 4Y1RA 1XU9A 4ROSA 2B30A 2C1EA 5EJIA 5CLIA 2EIXA 4MW9A 1GCOA 4CTJA 1Z08A 3TJZA 2AFHE 2M9MA 1K5HA 1Q21A 3O3MB 3GEEA 1U8FO 2CZQA 4IEIA 3ABSB 4QIHA 2ERYA 1WY5A 3AL0C 4ZTBA 5ALWA 4JX8A 4XXHA 3CRNA 5LB4A 3CCFA 3DL2A 3W7BA 1N34B 2X77A 4KSYA 1KFKB 3OJXA 2VJMB 3DH0A 4DCSA 1EUYA 3N28A 3AHGA 2GSDA 2R7KA 1NP6A 4LXYA 4R2WA 2XR1A 1VSBA 1TO2E 3KOWA 1XXHE 4MMXB 5F5XA 4MXDA 4ZANA 3TPCA 3ZDQA 3PJGA 3NYQA 3PV0A 3L8YA 2RHWA 4PXAA 4YAEA 4RF3A 4ZI5A 1WW3A 3H0EA 2Z3WA 1F9EA 4URYR 4X6LA 4FFDA 1ZH4A 1UFVA 3E0XA 4BO0A 2MT9A 3KQWA 3F8TA 3BHNA 1WDWB 2XKBA 2VZ9A 3ER6A 1JZTA 1PNOA 1QH1B 1S02A 1YKFA 2PLRA 3JY6A 3DEFA 3OC0A 4RYDA 2FN3A 2YXEA 1N33B 4P0QB 3DGFC 2I4MA 2JFXA 1GAWA 4IHJA 1NW9B 2I3AA 3NVAA 4DQUA 4QFBA 1E9FA 1OH8A 1QG0A 1M73E 1BS2A 3X1XA 1V5EA 1SK9A 3MBIA 4L22A 3FGNA 3NJRA 1OI2A 4HFJA 4MGYR 4PEVA 4C22A 1Z2CA 1JSXA 2DYKA 3KE8A 1QIIA 2Q3HA 3W3AA 3ZVLA 1TU4A 4KQHA 1BJTA 2J09A 3TLKA 1SC9A 4Z5XA 3PDUA 521PA 1YNOA 5LZ7A 3OD5A 5CFPA 4C21A 1ICEA 5K0SA 2RGBA 1EVLA 1RP7A 2W6JD 1CF2O 2ZDGA 4JOSA 3U7GA 1D2RA 3LYHA 4JSTA 4M55A 4NK5A 4IFIA 4L1KA 4ER3A 4ZDIA 4NYJQ 2X13A 1PD0A 4TGLA 5E6UA 2VQDA 1Y5LA 4CI9A 1KQFA 2A1UA 3L0CA 4UU0A 4FWTA 3ZKAA 1NVEA 4GP6A 4B7XA 3CB2A 3BA6A 2SKEA 3GH3A 3OE7D 5ENDA 3QVXA 4BP8A 2GTPA 2H7VA 3BE5A 4R0MA 3TE7A 4URHA 2IUFA 4JS0A 5D6OA 4EY8A 4KH0A 5EJ8A 1M0SA 5ARDA 4J49A 2C2MA 3CVYA 1T2NA 3JYPA 3ZWAA 2Q0QA 1VTKA 2C3OA 1VHWA 1H4TA 1KI3A 1YS9A 4RS4A 5FJIA 2CUNA 4N0QA 4AZSA 3U37A 2V6GA 3IE2A 3MXOA 3DV0B 3K15A 1D0IA 1UKCA 4PXYA 2A35A 2N47A 4FFBB 1P3Y1 5DBEX 4DWVA 1TQHA 4IBOA 4CUKA 5U4QA 4JODA 1RM4A 1U2DC 1CDDA 3DWEX 4TWBA 4KNWA 1YL7A 3JQ8A 3H16A 4WZAB 4W5QA 1PR5A 4RKFA 2WSSA 3K31A 4UAGA 5JV5A 5K0CA 1HYGA 2FFJA 5EQTA 4D80A 1UFOA 2BBTA 4AJHA 3RUDA 3N9IA 1KGDA 3WK4A 4G0MA 1OFGA 2XNDA 3HCWA 3I9LA 4IHJF 3RUCA 4LDJA 5EL0A 4BMYA 4CM9D 4YEDA 4NARA 1MGPA 1QYXA 1NVFA 4TVBA 2HAEA 2AOUA 2B0JA 1MXFA 2VRCD 4NH0A 1EEHA 1P6QA 4ZVTA 1QH9A 2CXHA 3CVXA 4UASA 2AK2A 5EIWA 4OU5A 2Q3EA 2FEOA 4HYYA 3GWZA 3DP9A 1QMGA 1G3RA 4Y2GA 5MN5A 4HUQB 4BECA 4G9EA 1Q0SA 1CU1A 2IGTA 2QMQA 1TZCA 3HYTA 2FPWA 3UCEA 3P2KA 3A3KA 1NN0A 1K7FB 1EAYA 3WMWA 3P45A 2M1ZA 4YCSA 4G4SO 3M4ZA 5T4EA 3PPXA 3PCRB 3KKZA 4XX1A 3O91A 3NP7A 1M2VA 4BJ3A 1J5PA 5F12A 1NATA 3QELA 1RYBA 5DK6A 4AMUA 3ESDA 4KV7A 1ETUA 2WIGA 4L74A 3PGXA 5ESWA 3CRQA 1YB7A 4M7PA 3RQSA 3RS5A 5F2EA 1O0BA 4Y2PA 3EGWA 3DDSA 3THYB 3HKBA 1L7BA 4OGGA 5DHTA 3NIDB 4FOSA 4Z7JA 1B8NA 4PV7A 4LZPA 3DCIA 3CN7A 2FRXA 1S3IA 2DKFA 2WM8A 3PJFA 4BVJA 1V6SA 1WXHA 3HA5A 3IVCA 4RDCA 1P1BA 3QX3A 4V1CA 1I01A 4M1EA 1ULUA 2ZI6A 2YWFA 3WO1A 4KR3A 1TC2A 1BO6A 1WVGA 4PE5B 5EMNA 4BPRA 1U0EA 3ZWYA 5JISA 5HKOA 3GGSA 1QRSA 1DIRA 2HMTA 3RASA 1ZU4A 1D8TA 2G0AA 1B23P 4EMUA 2X9NA 1HRKA 4DSUA 1B0AA 4C88A 2YV4A 3O1JC 2VPQA 1SA0A 1U1DA 1YVUA 2B2NA 4IOKA 3GEIA 5HILA 5CA0A 2FMUA 1C1XA 4M1WA 5SZIA 5ITSA 3PFHA 3SOZA 1DKPA 1F5NA 1I5EA 1QYIA 1UDWA 2A0UA 1SVOA 4BN5A 3B1XA 2OENG 4JJIA 3KQMA 4HZIA 4MA4A 3Q2KA 1U9JA 4P53A 1KO1A 1QOQB 1U63A 1J1UA 2NYRA 2OFOA 1TYAE 3HEMA 2ZZKA 3W2TA 1NI3A 1BOOA 2QN2A 3EUAA 3MC1A 2QJOA 4TLAA 2OZVA 2OK7A 3BFXA 4FZRA 2R79A 5DTJA 3SF8A 2HRDA 1VFNA 3IV6A 3N53A 1CR2A 1IEXA 3OAAA 2ZRQA 2GASA 2HJSA 2VTEA 4PFKA 5LQCA 1AA6A 4OHBA 1ISJA 2P3LA 1VL2A 3I6IA 4P34A 3SC2B 5JNSA 3OF3A 1G3QA 1FSGA 4AJ1A 1Z6GA 2PT9A 1L7OA 4PHFA 3RM3A 1QQ6A 4BZPA 5IM4F 4JB3A 5THQA 1RWNA 2Q4RA 1T4MA 5BURA 1XPUA 3NJ8A 3WIVA 3VKGA 3HC7A 3VJMA 1PZNA 3ZD6A 4FGKA 2PRJA 4W6ZA 1K75A 1FFAA 4D8XA 1NX9A 4KZKA 3UYKA 4BDSA 4BFVA 4J0CA 1Z4KA 1K4MA 2KX7A 2BZ1A 3OOWA 4JC5A 2Z1NA 3ONDA 2B4YA 3DQZA 1KEVA 3Q5DA 3UA3A 2IOHA 2XB6A 1RFGE 4MNTA 2VAMA 3A3PA 1TCBA 3I2JA 4QQKA 3UWMA 1ZK1A 4HX9A 4BNWA 3MCTA 1NTOA 4RFLA 4Y7CA 4G63A 4ND8A 1IRIA 1RU3A 5BWLA 1SBZA 3JYOA 5EGNA 1WB9A 4KAJA 4REOA 5LC1A 2G1KA 4ZT5A 3NPMA 4D6XA 4F3KA 1AF7A 4WL0A 2I6TA 3IEPA 4WZZA 3H0CA 2UYOA 5HRCA 4RV5A 1VJTA 2A1IA 3RSFA 4C3ZA 1IH8A 4EHHA 3ZJUA 2G28A 1RLMA 4KUGA 5CA0F 1Z83A 3H1BA 1DX9A 2VJYA 1Z5ZA 4NK4A 4UFNA 2AH5A 4OGFA 1YU6A 1DC4A 5T6MA 4DABA 2IYQA 1EU1A 4KR6A 2NSLA 3PKZA 2XPCA 1FE8A 3BFPA 3CPHA 3NATA 1SIOA 1ML4A 2FSPA 3OQIB 3OKCA 4IG4A 3VO8A 5CDGA 3TKLA 2RGWA 5H70A 4LRSB 3RREA 2AK3A 3UN1A 2OVBA 4PHCA 1K0UA 2FKAA 3N70A 1RAFA 1DO2A 1SC6A 4UM8B 1ST3A 1KYQA 5FUYA 1AGNA 4RWZA 1V3QE 3ER9A 3GF4A 3KD3A 2F8SA 3EDCA 3LCUA 4AZWA 4BFSA 2WYWA 2POQX 4BN4A 5DGCA 3ODGA 5BWBA 1P75A 1WOMA 1Z5PA 3OWXA 4OB6A 2IHNA 2R4QA 1JP7A 3MWEB 5F7JA 2DMRA 3E81A 2PYZA 2QTTA 3CZ5A 4K8RB 5K0GA 2EJCA 2G77B 4II7A 3D3WB 2B3DA 3DE1X 1YVDA 2OBNA 1CUBA 2IIQA 3IAFA 3KYCA 1P60A 1GG5A 2QTNA 1POWA 1Q1ZA 2O5RA 4H18A 5LLSA 4URVR 1KOJA 2XTAA 1U80A 2YASA 3KJIA 1NRJB 1FRZA 1EWVA 1KMCA 1K8RA 1MJNA 1RE1A 1R7RA 1UL1X 2GCIA 4ZQCB 3QENA 3ZGLA 1GPAA 1ZGGA 2BEJA 4QULA 2V1UA 4PC2A 4EJSC 1EEXB 4EL5A 3BCRA 3TOXA 3V48A 1AHHA 1LK0A 1WB4A 4QUGA 2QT0A 4L5BA 2BUBA 1KZ6A 4XRRA 4BU0A 1P2UA 3ZCQA 1M54A 4ZAVA 4F3RA 3BK1A 1L4FA 3O8LA 2FB9A 4JIMA 3ZHZA 3FOZA 3LMKA 3D2BA 4WZBE 4E13A 5A7GA 2ZSAA 1SXJC 3HVKA 1UMDA 1PZGA 1GVHA 1DQRA 1JXAA 2XVAA 2JAXA 2XQGA 1GVNB 1NXOA 4E5SA 1F2TA 3OQBA 4OJKA 4KB5A 4OVKA 1W85B 2F43B 5KQLA 1W1UA 2BTQA 1XSEA 2AX4A 1TA4A 5BSTA 1GRNA 1YR9A 2SNIE 4WXRA 2H8KA 2FAXA 4LHEA 4ZEVA 1ZUHA 2JGDB 2Q1TA 1E1CB 5AH0A 3RU9A 3I76A 4F4HA 5AM5A 3NHYA 2ZWPA 5IF9A 1UBHS 1SZJG 2PEZA 3PYMA 2FYTA 2B4AA 1DARA 2QM8A 4HAYA 3UFXA 5ALFA 1M6WA 4YCBA 1H8HD 1R8JA 5DK4A 4H4CA 5JYEA 1GHTA 3B7PA 3SP1A 1UWCA 3MNFA 1REQA 4L6CA 2OV3A 4TT3D 5HK8A 1JLMA 1ORVA 1A9OA 5D1NA 1T1JA 3SQOA 3KT3A 2X8LA 3KJZA 5LZ4A 4HX2A 2VJBA 3AP2A 4ZYWA 3A37A 5EWLA 8ATCA 5I6DA 3EVZA 3COSA 2N42A 3DLHA 2PVCA 5LQMA 1UBCA 1GTSA 1FYFA 1E6WA 4I2NA 2DFNA 3EXIA 2BP7A 3KT0A 5ERXA 1C3EA 3CISA 4AX4A 3REFA 4Z4FA 3QOWA 3HL0A 3GEMA 5EFZA 4X85A 1W36C 2D0DA 3IP9A 2E4ZA 3M9WA 4XQGA 4XJXA 4MW1A 4TMFA 1GA6A 1R3DA 2GCGA 2HWXA 5M2QA 4IPTA 5JQGA 1KO8A 3QHAA 2V7UA 1ZGCA 3GUVA 3V2UA 1EX9A 2IUEA 3LQ1A 3W06A 1E1QD 1DAKA 1VHTA 4R2KA 5J5VA 4N5DA 4D6YA 2DPHA 1GNTA 4RZHA 3QKWA 1I4TD 3DLCA 2C88A 2WFZA 3H05A 4CQLA 1A8IA 3QJGA 5ELLA 4BFWA 2IBTA 1ISGA 3ND5A 3RFXA 2VK4A 4MV4A 2ZRPA 3KLPX 4GEKA 1K7CA 4P5EA 5F21A 3PA8A 2C9BA 1N5OX 4PGHA 1TW2A 2QQFA 3KTAA 5FOTA 4B0PA 1DKUA 2Z8YA 1YHYA 3DLAA 3U7QA 3DULA 2MDTA 4Y1FA 3R44A 5DHAA 3FGOA 3HBAA 4TKVB 5ILGA 5A6SA 4J1TC 2D7CA 5CDHA 2CLOB 1PFQA 2WP8J 3AJEA 5F9MA 1OH7A 2XKAA 1CDOA 4EI2A 1N2CA 4GPAA 5EPEA 1ZISA 3GL9A 4YX9A 3JAKA 1T4CA 4GXNA 4HEA6 5LXTA 4ZV7A 4L4XA 1JPVA 2QENA 5KSWB 4FVTA 3M4YA 3V8EA 2PT6A 1LA2A 4HR7A 1U2GA 2GR9A 5JMTA 3BTOA 1K6JA 1DBSA 2G4LA 4B4OA 2M6KA 4MVJA 3A9UA 1XL0A 2GRUA 3QKRA 2HFJA 5LWQA 1YJXA 5E1OA 5C5IA 3CBGA 1WKCA 4JR2A 5HUHA 2ZIXA 1PW5A 3OFJA 4EUHA 2P6RA 1P2SA 3CG4A 4MAFA 3ZWVA 2D3WA 4Y0NA 4KFSA 2PRZA 4LYYA 2WU3A 1KDTA 3T0GA 5JHGB 1G8PA 2YYAA 5KVSA 3N8NA 1XTJA 1TM1E 3D4PA 3IO5A 3BRSA 2FPGA 3L8DA 1Q1AA 5CT8A 5JQGF 1PUJA 4QGAA 3SDZA 3EARA 3V1YA 1E8DA 1R9JA 2OLEA 1BDIA 2CXNA 1YRQA 1W44A 1F2UB 1S9HA 2IUSA 2Q9BA 2XOKA 1CPYA 3BL6A 3I32A 1Q22A 2Z58A 3VKHA 1U3VA 2C3YA 7ADHA 5TF4A 3UAWA 1CFZA 2B0CA 5K05A 1M0EA 1AGXA 2EKZA 3WYCA 4GKAA 4CMEC 1V96A 3UUWA 1W0KD 3FYUB 4B3HA 1Y6ZA 3VZRA 3WIUA 3DB1A 3VKFA 1G7CA 4EHIA 2VLBA 2GEJA 4HWPA 5IU6A 2PWPA 2QUBA 3TH5A 2G67A 1JX6A 3QG1A 1C9EA 1FZTA 1KJYA 3QLTA 5DI3A 3HE3A 1GPH1 2EYQA 4JJ4A 4RGVA 3JXEA 4W5RA 1EWKA 3PQ7A 3SYNA 4A26A 3GZNA 2A9JA 1A97A 1GG9A 2CB0A 2X9QA 1GGKA 1MC8A 2WT4A 5DW0A 4C5AA 4DLYA 1EM8A 1GZ5A 4P92A 4CEHA 2XMQA 4LFBB 5LXTF 3FNRA 1G98A 1LGYA 2P40A 3QF7A 3WK6A 4KLZA 3AZPA 1X1AA 3CLRC 4L8WB 4HV4A 4YUXA 1ZD9A 1SCKA 4LGCA 4PNEA 1GTL1 3F9RA 4UTNA 1TZJA 1XTPA 5EOVA 1N0UA 4NBUA 1LPBB 5I51A 1FUIA 1JLLA 4CMAA 1RPJA 2OFXA 2QL5A 2R48A 2V65A 3OO1A 4MVJF 4QXRA 5CM2Z 4OFZA 3GLIA 2ZJ7A 1QGUB 1XALA 4GKBA 1UMBB 4WCFB 5IS2A 5FHRA 4HHEA 1QP0A 1R4MB 3R8CA 3BORA 2QMHA 5CLGA 5A62A 1NBOA 4PG5A 4MWTA 5JVDA 3OLYA 1PVDA 1YJBA 5TSDA 1D2AA 1XWWA 4R8RA 3ZIUA 2JIMA 1DSSG 2OCXA 3AUTA 3NHSA 4Z1MA 1FQWA 2ORWA 5HM6A 1N78A 4NFSA 4JLBA 1OAOA 4O0LA 1WHTA 4PLWA 2H1VA 4R8SA 2NSDA 1PHPA 4AZ0B 1C7IA 1XZDA 3UXEA 3H9QA 3NHAA 4JVMA 3LF2A 1VXRA 3VMMA 1KFBB 1ZQ1A 3DMFA 4LRUA 4ZU6X 3B5JA 4RTNA 3F7NA 3OWOA 2AOXA 3WRYC 2OHJA 2O4UX 2VJAA 3ND8A 2J5BA 3KKEA 4UU7A 4EHJA 1LDGA 2XAAA 4LOLA 4JKIA 2QM0A 2WF9A 3RFFA 1ZD2P 2XHEA 1LB1B 4Q4AA 3VPFA 1FPMA 3ZGVA 2WDZA 1PK8A 1MENA 1FOEB 2BR4A 2EEZA 1AY0A 3C4VA 1HMPA 3C6QA 3FRJA 3HGMA 3C7TA 5F7ZA 5K3CA 4EDFA 2AXNA 4H17A 4F0JA 5CK4A 1RCUA 4I50B 1Y6GA 1V3VA 4JCOA 2AG6A 2B8TA 4KH1A 3K8QA 1AQ6A 1GNRA 4WK6A 2ZWIA 2Z5GA 1K3TA 2EKDA 1PK7A 1H42A 1I10A 2YRWA 3PHBE 3QNUA 2V7QD 4XI9A 1V8DA 5ENZA 4C87A 1HTWA 1YXMA 2E21A 3LKVA 1KFEB 2P78A 3HABA 3V9PA 4DLWA 1F2VA 3RV4A 1BYUA 4ID9A 3ETEA 1XN1A 2B7BA 1JAXA 3EZ6A 2G88A 1DTWB 1U7XA 3BCHA 1NE2A 3DUWA 5DLDA 1W35A 4E5PA 1J09A 2C8LA 2WAMA 3ANLA 3KX2A 4HQNA 3AGQA 4RD0A 4B75A 3U7HB 4CT5A 1A2KC 2O3RA 1H4VB 4L9WA 5IK2D 4Q39A 2I91A 3HO6A 1Q50A 1JDBB 1YS2X 3BXFA 3BH0A 3U40A 2VHYA 1T1SA 4BV9A 1RLUA 1Z25A 2VBFA 2VK2A 3FVWA 4GC9A 3Q3EA 3AHHA 4WDRA 5G1PA 5JVDF 1H1TA 4U00A 5AJTA 3P0IA 4JOBA 1DEAA 2JCXA 5FYQA 5TQJA 1ATZA 1IDN1 1K9VF 1XJWA 3FN4A 4JYCA 1TQDA 2D7JA 2IPMA 4P58A 1CS4C 1JQLB 2XUPA 2YOFA 1V9LA 4R31A 1K8YB 1RJDA 1J1IA 4PQGA 2OBYA 2LZ0A 3B89A 4B1FA 1MD9A 5FTKA 1L0BA 5HK9A 1Y1RA 3G2KA 4W7HA 2GN6A 4H1HA 2GI4A 2FMHA 4GC5A 4P35A 3MJ4A 3A4LA 1OYOA 4KTTE 5BP7A 1XFDA 2GD1O 3G0CA 4P32A 5DGDA 2K4MA 2OYSA 3L0DA 5BPFA 2L82A 2ZT6A 5CEEA 1WRBA 4BWGA 1X7ZA 3IKLA 2OYRA 5JU6A 3IHKA 5JNRA 1U7TA 2GPBA 4ZRNA 4PTLA 4O1MA 4KOEC 2IK8A 8AT1A