3KQPA

Crystal structure of hpnmt in complex adohcy and 6-aminoquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqpA00
2ZIEA 3LDUA 4QQKA 4YV1A 4PGGA 4RVFA 4PYMA 4RTQA 2HNKA 5K0NA 5EPEA 5LSAA 1X1CA 1X1DA 1VBFA 3NWEA 3NVMB 5EZSA 2I7CA 4PONA 3UBTA 3HCDA 2QM3A 4HTFA 4CKCA 3E05A 2P3OA 1Y8CA 4A6DA 1L3BA 2O57A 3IYLW 3BWBA 4FGZA 3KQQA 4RWZA 3JWHA 3VC2A 3FUUA 3G5LA 4IV8A 2HTEA 4KRGA 5U4XA 5GINE 3UJAA 2YX1A 3B89A 4LECA 3SSOA 3L8DA 3UJDA 3PS9A 2ZVJA 1NV9A 2V74B 2QRVB 4ATNA 3T7RA 1SQFA 3MTIA 2ZIGA 4HSGA 2G1PA 5MHTA 4K6MA 5DT2A 3MTEA 3HVHA 4RTPA 5K0BA 4V0RA 5E1MA 3THSA 4KIGA 4A6EA 1JG3A 3PFGA 4G56A 3I64A 3T7TA 3A25A 1M6EX 1P1CA 1NW5A 4E31A 2H00A 5BXYA 2IH2A 1VL5A 2BR5A 2XVMA 1KPGA 4QDJA 1YZHA 3CKKA 3CVOA 2HWKA 2PV0A 4OA5A 5DM4A 1NT2A 3X0DA 4M36A 1AQIA 2YR0A 1H1DA 3CJQA 5GP1A 1I4WA 2AOUA 1MHTA 2UZ4A 1O9HA 5EZQA 3G2QA 4F86A 4QPPA 3UZUA 2IIPA 3G2PA 5FULA 2PGXA 2YXLA 3DXXA 4C04A 3CC8A 2WA1A 2NNWB 4JXJA 4MTLA 3EGEA 3B3JA 1OR8A 1VQ1A 2JHAA 3MCZA 5EVJA 3A7EA 1R8YA 3ANXA 3HM2A 3BWYA 4FR0A 4UOEA 4RTLA 3I58A 2YQZA 4B17A 3FRIA 3SSNA 4GC5A 1NBIA 2QY6A 3LKZA 4OBXA 3HCFA 1M6YA 3DTNA 1NW3A 2EJUA 3DXYA 5H02A 4ER6A 5HILA 2UYQA 3C6KA 4PIMA 4R8RA 2GS9A 4X1OA 4R6XA 4PYNA 4ER3A 8MHTA 1R00A 3KHKA 1KYWA 5FTWA 1U2ZA 2I62A 1P39A 2Z6UA 3R9XB 3LGAA 4IV0A 1KR5A 4C07A 1QZZA 2ADMA 3KQPA 4QTUB 2G72A 3TRKA 1ZQ9A 4O29A 5ICFA 3TQSA 4R6WA 5DM2A 1G38A 4Y30A 4DZRA 5LQJA 1KXZA 3A26A 3IHTA 3NW9A 5HEKA 1BOOA 2CKDA 1ORHA 3RW9A 4ISCA 3Q87B 4AZWA 1IM8A 2EG5A 1WZNA 3LDGA 1O54A 2FHPA 3LX6A 3BT7A 3UJ6A 3UJ9A 1QAQA 1Q0TA 5JR3A 1KPIA 2VZ9A 1L9KA 3DXZA 1NW6A 2HV9A 2PJDA 3P9NA 5FUBA 3B3GA 1D2CA 1L3IA 5DWQA 5K01A 1NW7A 5GIPE 2PX2A 1QAOA 4AZSA 1JSZA 3FPFA 3GRVA 5E9QA 2AOUB 4DQ0A 1DL5A 1RI2A 5F2OA 4YUXA 1NBHA 2VDVE 4POOA 1D2HA 3G88A 3A27A 2PSSA 3CCFA 2VDWA 4YUZA 2IFTA 5EIFA 2PLWA 2VS1A 3AXTA 3R3HA 5FQNA 3SGLA 5C1IA 4IWNA 2QE6A 3SXJA 5HIJA 1ZHFA 5CIYA 2VP3A 1VP3A 3EVGA 1VLMA 2AVDA 3OZSA 4KIFA 3EEOA 4PYQA 1I9GA 4CXMA 5IKMA 3P2EA 2NXJA 4MIKA 3LBYA 1DCTA 2P35A 3G2MA 3KQYA 5EMKA 2B78A 2JJQA 4YMGA 1FJXA 2P1DA 3HVIA 4PINA 5GM2A 5EG5A 4GF5A 5CUQA 1QYRA 2O05A 2CMHA 3TLJA 5HIMA 1INLA 3BKXA 4DKJA 3EVZA 1R74A 3TFWA 3OU7A 5E9JA 3ER9A 3LBFA 5KQRA 1KP9A 3KQWA 4FP9A 5EEHA 4CKBA 4E2WA 3KPVA 2C7QA 2VDUE 4RV9A 2QYOA 2PKWA 2OZVA 5E1DA 5KVAA 2GPYA 4RTKA 3HNRA 3NDJA 1I1NA 3M6XA 1XJ5A 4C06A 5EQJB 2I9KA 1PRYA 2NXEA 2PY6A 4C08A 5FWDA 2OXTA 3TMAA 5DTQA 3LECA 2Z6AA 4RTOA 4YUWA 4WVLA 3V8VA 3A4TA 5E8JA 5CCXA 3E23A 5E9WA 2Z6QA 1XXLA 3CBGA 3GNLA 3IV6A 3S68A 4BY9E 2UYCA 2AN4A 5ICCA 2OO3A 2F8LA 2PVCA 5LQRA 4DF3A 3TKYA 1VE3A 3ELYA 3M6UA 3LKDA 1XCLA 5EOVA 4EKIA 1KPHA 4DCGA 5HIIA 1B42A 5K03A 3O4FA 2Y1WA 3OE4A 4AUKA 2IBTA 4PYOA 2OBFA 1EJ0A 2PX4A 3K0BA 3ER8A 3MERA 4DCMA 2P40A 3C3YA 3JWJA 3LCUA 5KS2A 4AZVA 2XBMA 3PLAE 2CL5A 3EVEA 4HH4A 1N7IA 1F38A 3NTVA 3T7SA 3UJ7A 5DRTA 5CCBA 3ELWA 3FUXA 3ORHA 4P58A 5EKXA 3DUWA 3SR4A 1YUBA 4BP1A 10MHA 3FPJA 3EVAA 5GM1A 1P1BA 1G60A 1ZGJA 4GOMD 3SX0A 4C05A 4H0NA 4CKEA 3G8AA 3T0IA 3ELUA 2ZCJA 4DMGA 3LSTA 2G71A 3BGIA 2CWWA 2GLUA 5CM2Z 2BR3A 2YXDA 2XYVA 1TPYA 4QPNA 5EHIA 3TR6A 3FPHA 5DX0A 3C3PA 2YXEA 1X19A 4DA4A 1TW3A 1G8SA 3DMFA 5CVVA 5FWAA 4CTJA 1ORIA 3FPGA 5ICEA 2PT9A 5LQCA 1DUSA 4OA8A 5HFJA 2B25A 3LL7A 2FCAA 3B3FA 4ER7A 3C6MA 3HVKA 3LCVB 1XCJA 3KQMA 3KQOA 4M37A 3OPNA 5EHGA 5FA8A 3GWZA 3GRZA 3VC1A 2ZZMA 2IP2A 2IBSA 3KU1A 4KVZA 4FSXA 1EAMA 3TPZA 5E8RA 3UJBA 3BXOA 2P7IA 3LPMA 2IH5A 3NMUF 2H11A 2GB4A 3GRYA 2O07A 4XUEA 4RTRA 1BHJA 1D2GA 3HCAA 3QOXA 5E2BA 5IH3A 1RJFA 2FPOA 2HR1A 1VP9A 1SUIA 2UYHA 3FUTA 3EGIA 5BP7A 5CVJA 5C9ZA 3DH0A 2O0LA 3DR5A 5GOZA 4X61A 5D1NA 4RVGA 3SSMA 3RIEA 2AN5A 4Y2HA 2KW5A 2NXCA 2N47A 2PBFA 2R3SA 2IGTA 5LR6A 3BWMA 3K6RA 4HGYA 1AQJA 4RVHA 5ERGB 3PB3A 5CVDA 4RTMA 2ZSUA 3LCCA 3GO4A 3G7UA 3U81A 4YMHA 2P7HA 4QTTB 5EEGA 2ZW9A 1N2XA 2EX4A 3TOSA 5F2NA 5DSXA 3KKZA 1R6AA 3BWCA 1WXXA 4RSRA 3GU3A 2IDKA 2FYTA 2ONZA 3M33A 2FRXA 1R8XA 3VYWA 4E2YA 3P71T 1AV6A 4U7PB 1V39A 2DPMA 2EJTA 4XCXA 2C7OA 4FT4A 4BLVA 4GUAA 1AF7A 3UJCA 2Y1XA 4EKGA 1M0EA 3EVDA 2JHCA 4EMSA 1F3LA 3P8ZA 2B3TA 3F4KA 3OU2A 2ZWVA 1T43A 2P41A 2BM8A 3EEYA 2IDJA 4E30A 3KPUA 1MJFA 1YZ3A 4FS8A 3SMQA 3PTAA 1NV8A 3KR9A 2H1RA 3M6WA 3M70A 3NVKI 1WXWA 1EQAA 1SQGA 3BZBA 1X1BA 5K8VA 3R6TA 4YV2A 2GAFA 3DP7A 2NXNA 4E32A 3GDHA 3GXOA 3REOA 3C0KA 1RJDA 1FBNA 2ZULA 3EMDA 2E5WA 3AY0A 3KQVA 2Q41A 3B7PA 3QOWA 1RJEA 3OZTA 3M4XA 3SVZA 2YVLA 1FP2A 4PYKA 4AX8A 5CD1A 1WG8A 2PXXA 4PGHA 3EVFA 2PXAA 2AOVA 4GQBA 3HP7A 2NP7A 5DSTA 2BM9A 2HMYB 5G02A 3G89A 1JTEA 4BLUA 1JG1A 2AZTA 5BW4A 5JUWA 3NWBA 5FHRA 3OFKA 3P2KA 1JQEA 3GCZA 4WXHA 2AN3A 3SM3A 1XDZA 5CVEA 3IEIA 4M7RA 2P8JA 1JQ3A 4X60A 3GRUA 3B5IA 3E8SA 1BC5A 4OBWA 3A7DA 5DLYA 4C03A 1XDUA 3H2BA 5EC8A 3PFHA 4PYJA 3LHDA 3O7WA 2B2CA 5EMLA 5DTMA 1JSXA 1KHHA 3DLIA 4L7VA 3MCTA 2YUIA 2PT6A 2ZFUA 4KDCA 3UWPA 4DM3A 4RTSA 3Q7EA 3NDIA 1YFJA 3MQ2A 4EVIA 2ESRA 4C4AA 5EIWA 3PX2A 1VPTA 1HMYA 1HNNA 3BUSA 4FZVA 4YV0A 4RTJA 3UFBA 1JQDA 3GGDA 1JG4A 2AOTB 3HCBA 4HG2A 5LQNA 2EFJA 3CJTA 4NECA 5T6BA 3WSTA 3FRHA 1WS6A 3DOUA 3FTDA 3R0QA 2PXCA 4EQZA 3JWIA 4GOOD 3TKAA 4RTNA 5KYGA 4KDRA 4PYLA 3KR2A 2V7EA 3THRA 4X63A 1QANA 3CGGA 1UIRA 5E2AA 4PCAA 5C0OE 3VSEA 4V0QA 2G8NA 3GJYA 4IKPA 2ZTHA 3PT9A 5DTRA 4E2ZA 1TW2A 4XUCA 2ZIFA 4HRAA 3OZRA 1L1EA 3OFJA 4GEKA 3G8BA 4ZTBA 2FK7A 4QDKA 1QAMA 2BR4A 5EMMA 1VIDA 3GRRA 2BZGA 3EVBA 3KR0A 1ZGAA 1YFLA 1SKMA 2I6GA 1RI3A 2PX8A 3EVCA 3G5TA 5FA5A 2JG3A 2AOTA 2JH8A 4PCLA 3RODA 1NKVA 3MHTA 2ORED 5HOQA 3AJDA 5BW5A 4X41A 4CTKA 1RJGA 3CJRA 2OB2A 5K09A 5K0LA 5CVUA 3UA3A 5FHQA 2FK8A 1XVAA 5M5BA 1SG9A 3I9FA 3KPYA 5DRYA 3UA4A 1G8AA 5KQSA 4LWPA 1JG2A 4U7TB 4CWAA 4BP3A 3EPPA 1WY7A 2ZBQA 4FSDA 2AR0A 3HTXA 2ZZKA 2XVAA 5GIOE 4YUVA 4P7GA 1EG2A 1L3CA 4P7FA 2ZWAA 4QVKA 1X1AA 5LQUA 4GC9A 3MGGA 5EKUA 2XYRA 3MB5A 3OCJA 5HZMA 1G6Q1 3O31A 1R18A 4XUDA 5F2KA 4OQEA 2AOXA 3AWIA 2JHPA 5DXAA 5B1SA 4BLWA 3HA5A 2IPXA 2ERCA 4MWZA 1PJZA 2OKCA 2OPBA 3OE5A 4FT2A 5ICGA 3BKWA 2PX5A 3LDFA 4ER0A 2AVNA 3P2IA 1IY9A 1RI4A 4QVGA 2O06A 2NYUA 3V97A 2ONYA 2C7RA 2AOWA 2G70A 4GOND 1EJ6A 1UFKA 5K0CA 4LG1A 3BGVA 3HA3A 4GBED 3FUWA 2GH1A 5EGSA 3P9CA 1RI5A 5T67A 5K0GA 1JTFA 4OQDA 1UWVA 5LQKA 2DULA 3EGVA 2R6ZA 3P9KA 5GWXA 3TM4A 2ZZNA 1ZKDA 2JH9A 3I5UA 3ELDA 1NE2A 2OYRA 3FTFA 3DMHA 5EMJA 3FZGA 5FADA 4F84A 3FTCA 4E70A 3HCEA 4KWCA 5K0JA 3FUVA 4R8SA 1Q0SA 2UYOA 2XYQA 4OX9Y 3HCCA 4PNEA 1YB2A 5HIKA 5LQAA 2IH4A 1SVUA 2P3LA 2WK1A 2CMGA 3FTEA 1SUSA 3FPEA 5DPMA 4E33A 1EIZA 9MHTA 4LWOA 1NW8A 3P97A 3QV2A 2LD4A 2BH2A 4EK9A 2ZLBA 1N7JA 2PWYA 2A14A 2QRVA 4AZTA 3KQSA 4RYLA 2ZBPA 3R24A 3KPWA 3I53A 3JWGA 4KW7A 1FPQA 4HGZA 3DULA 3G2OA 3OU6A 1KYZA 2WA2A 3BGDA 4M38A 3NJRA 3GIWA 3HVJA 5DX8A 5E1BA 4PWYA 2PWPA 4PIPA 4R05A 3DLCA 5FCDA 4E2XA 4MHTA 3FYCA 1P91A 4QQNA 3TM5A 1ZG3A 2NP6A 3HA7A 3ERCA 3KQTA 1XDSA 2K4MA 2OB1A 4P7JA 4RVDA 5P8WA 2ZBRA 2OY0A 4F85A 2GA9A 1KIAA 2P3QA 7MHTA 3D2LA 3DMGA 1G55A 2YTZA 1XTPA 1JR4A 3P9IA 2AS0A 4P7KA 4YUYA 4ER5A 3PVCA 4MQ4A 5FQOA 3KPJA 3UJ8A 4HC4A 4HTFB 5DM1A 5K0FA 1Z3CA 1BKYA 3KR1A 5DX1A 3AXSA 4PYIA 4RX1A 5D1HA 3FYDA 5DXJA 5T64A 5K05A 1O9GA 3M6VA 3MAGA 3PX3A 1RI1A 4GOLD 5DM0A 2C7PA 3ID6C 5K0EA 1YF3A 1FP1D 1IXKA 3EMBA 3HEMA 5E1OA 2B9EA 4Z2YA 3ME5A 3E7PA
chains in the Genus database with same CATH superfamily
4NK5A 2ID9A 1UZNA 3HABA 3H2ZA 4NCNA 4XTRA 4KR0A 1KEZA 2HGZA 1J33A 3M2TA 4Z99A 1MG0A 3A4NA 5K0NA 2DEUA 1PYOA 4OGFA 3AR3A 4QJ5A 3UN1A 3T1HB 2R2GA 1OT5A 3Q9LA 3GB9A 4CG1A 4DILA 1YNOA 2VDQB 2GCOA 2C3PA 4A6DA 1VLQA 2ECOA 1S8FA 2Z1DA 4E08A 3VC2A 3PA8A 4LJ5A 3ECAA 3F6BX 3PE4A 5EQFA 4D56A 2XNSA 3OT5A 1F8FA 2B8EA 1EE9A 2G9VA 3UICA 4MUJA 3WB2A 3UJAA 3UM9A 3W4KA 1EMDA 5CT9A 1QG4A 2TMDA 4NCHA 1XRSB 2BTOA 1HLPA 1VJDA 2A4KA 2CN1A 2IU3A 2QRVB 3G82C 4HMQA 4IXWA 1W9MA 4UU8A 1VZ3A 3WL5A 7ABPA 4DUGD 1VMEA 1BQ4A 2BKLA 2G1PA 4K6MA 4Q3BA 2BL4A 5E7QA 1QORA 1RM0A 2GZSA 1HGXA 2W6JA 3EPRA 3Q40A 1Z6XA 4ENTA 3IXLA 2A94A 4CIYA 3UF0A 3BRSA 4UEJA 3UO8B 5BNZA 1DIBA 3ZKAA 5KSYA 1XA4A 3PFCA 1T5LA 1V5EA 5ESRA 4N48A 2YW2A 3GHHA 3HXTA 3ONDA 1I5OA 1MX5A 1PUJA 5ICSA 2OORC 4BGVA 3A58B 4INPA 2M1XA 2A35A 5IDXA 1U4OA 4ZHSA 5AJYA 2V9ZA 3CJQA 1C1DA 4L75A 1J5XA 4PTLA 4Q3DA 4EGJA 1X15A 4O0LA 1RD4A 4F86A 1UADA 4IOJA 4W5TA 4F56A 5I48A 1HZZC 3G0CA 3I2KA 1QNLA 3FNFA 3PICA 4IHJB 4MV0A 1N2IA 4RHFA 4AUEA 1T5OA 4JD5A 2HHHB 3JASA 3R9WA 1PW7A 2I1QA 4RF5A 2VZEA 4PC7A 1KYQA 4H7JA 2JZOA 5D7BA 1S0UA 3NJ8A 4IUBS 1NLZA 4GPEA 1Y48E 2DUUA 2YQZA 5MGNA 4GC5A 2B4YA 3IOYA 1M6WA 3ZHOA 3CEMA 4MQFA 2A5DA 4W1PA 1Y6GA 2RGDA 3L3BA 4LGYA 5J3JA 3O47A 1IHYA 4INZA 3SFVA 5GY7A 4PNHA 4B47A 4FCCA 1G2IA 1NX6A 2UYQA 3MVEA 3O90A 3K4QA 3MUNA 2UDPA 1LH0A 3HDTA 1MVNA 1N2EA 1KYWA 5FTWA 2LXNA 1AVTA 1U2ZA 2G4CA 3KLBA 5AKGA 5D5PA 1DFGA 2NV6A 3COVA 1HRDA 4KAXA 4QAJA 4EL0A 4PAOA 3DDHA 3GLUA 4ND5A 4XI9A 1AC5A 1CJKC 4KTVE 2H16A 3SHOA 2ZS9A 1AX9A 4EO4A 2P6UA 1CIJA 4FGLA 2BTQB 1R8SA 2GGSA 2VJPA 3RRJA 3JS5A 4LXYA 621PA 4TSKA 2XH8A 3RRYA 5A5DA 3AF4A 3QKRA 3DV0B 1QR6A 2ZRMA 5JAZA 3QXJA 3I01A 1P17A 1RZUA 2JLQA 2QR5A 5J2UF 2B8TA 1HC7A 3OLYA 1DBSA 4O08A 4INJA 5IXSA 5KOYA 3LCJA 3RJ5A 3NIBA 1EVJA 1WVMA 4ZYWA 2OC9A 3L06A 2R6FA 5A1JA 3BT7A 4UPDA 1PGPA 4ZCPA 1V3TA 1ZAKA 1R0WA 3ONVA 4UZFA 3O91A 4OQZA 4BUCA 4YIKA 3EAGA 1GNPA 4L5IA 5F9FA 3QKWA 2JIRA 2BEKA 5AT1A 2FZ5A 4GRAA 4UU7A 4XJTA 1JE0A 1VHDA 4GVPA 1RKVA 3TSAA 3GRVA 5E9QA 2DCMA 3SLRA 3COPA 3IMCA 3PUVA 4EKEA 2FPPA 4C4PA 3IAEA 3DDUA 1LJUA 1RBZA 2QW0X 3OP4A 3P4YA 4FQ7A 5G0VA 2PSSA 5K8JB 4NBKA 4OK5A 5CFOA 1RHMA 2WPDD 4ZAXA 4TN5A 4HDQB 1L5GB 4D3YA 1XLVA 1MC8A 3D4PA 4FDMA 1DUIA 1ZD3A 3GP3A 1S3SA 2FQYA 3FVWA 1U6JA 3BORA 3EA5A 3M49A 3P45A 5CW1A 3RJTA 2GQ0A 2A1TS 1P9OA 4QPJC 5CLFA 1V5IA 4J3FA 1E2KA 1QO9A 1Y7TA 2AF3C 2B8NA 2RHBA 2VLIA 4FCVA 4JITA 1DBIA 2JEYA 3L8ZA 4M0FA 4UKDA 1Y8QB 2VWPA 4BO0A 1AKEA 1X3LA 1QYRA 2IXAA 2Q0XA 3LS2A 4E3ZA 1BW9A 5C1BA 4R2JA 2WU8A 1PQYA 1GADO 4OHZA 4FMPA 2R79A 3OJOA 5ICMA 5HM8A 1VLHA 1NIPA 3AI3A 4MW2A 4R01A 5EJMA 4DQUA 2HA3A 1U7WA 1TK2A 3EDYA 3MINB 1IUNA 1A9XA 4PVCA 3C3BA 4N39A 2FRDC 1JA1A 3RAGA 4EG7A 2PQ0A 4F6CA 4G1FA 4M21A 1FYFA 1E6UA 1XZEA 5EXDA 2LNDA 1JWLA 5EQJB 1LQ2A 4OB6A 4DUZB 1QKKA 1QG0A 5DTQA 3T0GA 2XCTB 1ODSA 1ZRHA 3W3AD 4K40A 1YR6A 3AEZA 5IS2A 5EWJB 3THWB 3ICPA 3T5BA 1Z16A 2CD7A 3ZDYB 5BN4B 2K2WA 1F20A 4BNDB 1UWKA 2G07A 1MO3A 2EYQA 3IAM1 3E22B 1NOIA 4UMVA 1CIPA 5D01A 2H63A 4X44A 1VCNA 4Z3KA 2WKSA 1T0UA 1LDEA 3GCGA 2ZGVA 3GFQA 4UU0A 5FO0A 2JAUA 5DJ5A 1FSPA 5FIUA 3OFND 1Z5PA 1UANA 2I2XB 1ZD5A 2XZDA 5IW8A 1XJ0A 2AC7A 4TQ9A 2F4VB 1VKJA 3L4JA 3OECA 4AZVA 4FOSA 3BF8A 1V26A 1UMCA 4BO8A 1HI9A 1U5CA 3D6HA 5HZKA 4F9FA 3FSRA 1PDWA 1OYVA 2BGJA 3OZWA 4L4ZA 3PXAA 2IY7A 5CDSA 1PSZA 4K3UA 4TYQA 3FDZA 1O4VA 1C0IA 2K7ZA 2F2TA 3OM0A 3BGIA 4D0NA 4D4JA 4OLAA 1AF4A 4DMKA 4IWYA 5KINB 2H48A 2XYVA 3SBDA 3GLIB 2OP0A 3GG2A 3GRPA 3WDMA 3DQZA 1XN4A 1NNLA 1MF7A 1PFYA 1I3OA 4LOHA 3WLNA 1W4RA 5COQA 1NMQA 3WXMA 3ZN2A 2MSCB 1JHPA 1HT2E 2BFMA 1BCRA 3VRHA 5LDDC 4ZQFA 3Q0IA 1ECCA 1H4TA 3F49S 4OVKA 1NSTA 1X77A 2VTBB 1THGA 1Y8RB 3HYLA 1NUQA 3CPSA 4EQ6B 3LTEA 3LPMA 4ARUA 4B8ZA 5LXTA 4Q3KA 5DBHX 1QQAA 2BJVA 4GYWA 4V0OA 1MQSA 2SCUB 1XKLA 4OYRA 1CFJA 3KVRA 4H7HA 2XQJA 4Q19A 2GESA 2BCGY 2I6SA 3ZW9A 4C2AA 1N6HA 4KXVA 1XWFA 1N2OA 2EF0A 2V59A 2X0IA 4M98A 1SOUA 4CM9A 1YMUA 2N47A 3KKKA 3AHDA 5FUXA 3K6RA 4F93B 1RQPA 1CZHA 1Z2PX 4HI0E 5ERGB 5F5LA 4ZU3A 5C34B 1X38A 3KUKA 5GJVC 5CDTA 1L5HA 4Q93A 2FXIA 4V38A 3N28A 2IS1A 2W43A 5FOSA 3R0XA 5CA0B 4NH4A 3CEJA 3FMGA 4I8IA 4L57A 4MYRA 1E8NA 1VKNA 1RBQA 2C42A 3OQ6A 4TZKA 2JGDA 2IX3A 2QJRA 1E0AA 1IN5A 4POAA 1DELA 4YVFA 3OSUA 1KDOA 2C7OA 3CXUA 2XMDA 4BJ1A 2IYNA 1XNHA 3A6GA 1RCUA 5JS2A 4JKOA 3UATA 4P7BA 2OCGA 1V96A 1FE8A 4B6RA 3MEQA 2D5CA 4JYCA 4IGIA 2ZUCA 1TT5A 3RYIB 3VO2A 4DBVO 2IQ5A 4F2DA 5IN4A 4PQGA 2DERA 1N3BA 4PY2A 3DBRB 1NMYA 5FPSA 3SMQA 3ZQJA 4L3OA 4Z4QA 2H1RA 3IAUA 3M6WA 3TW0A 3QELB 4BE4A 3RAFC 2H0AA 3K6SB 4M4SA 4RZIA 4XDYA 4A92A 5HBGA 3WGQA 5HPYB 1OOEA 3VO1A 5M7EA 2E85A 3GFPA 3LM8A 4HGRA 4O1IA 1OWOA 1U2GC 2OGWA 4K9RA 2ZM5A 2AZXA 1JJ7A 1XK6A 3FSGA 3OZTA 2HU5A 2KQUA 1H8EA 3KZNA 1W0KA 2Q0QA 3WKEA 3OE7A 1F0KA 4LPKA 4C7VA 3EVFA 1MDFA 4L5YA 3P52A 2KBEA 5GJBA 3RV4A 5EJ9A 2F43A 1N0HA 3R5TA 2G7MC 5IT4A 1UPFA 4MWDA 1DO0A 4MIOA 5LOVB 2FN3A 4FJ0A 3P2KA 1FX1A 4FNOA 3GCZA 5FWYB 2R8XA 4LFAB 3MOGA 4HSEA 4MW9A 1Y4SA 5AI6A 1TECE 3B1JA 2O3SA 5EJGA 3GLGE 3WQBA 4MV6A 1ISPA 4W5JA 1BS1A 1FLAA 5CG2A 4RPJA 3RWMB 4M86A 3QJ5A 5K1ZA 4GE0A 3REFA 3RC3A 4BX9A 4F2GA 2WB4A 2WJIA 3D1VA 3TLXA 2QVBA 3IRVA 4RTSA 2A67A 1XRLA 4EZBA 1K6XA 2DUJA 4RKFA 4EVIA 2WW8A 3BFVA 1GCGA 3N8DA 1C4WA 1PR6A 4LDJA 3TAXA 1R4MA 4RADA 3LYUA 2EFJA 4Q1AA 5T6BA 3U0VA 1U98A 2WPNA 2QROA 4IUYA 4FI3F 3HB5X 3THRA 1QO7A 4E4TA 4R7ZA 4ALMA 1IG0A 4Q82A 2UV8A 4JLOA 1I3NA 4ZJPA 3N8KA 1QB8A 4V0LA 1TW2A 3QNMA 1T5BA 3QI7A 2B0CA 4O59O 4WOJA 5LDHA 1F2UA 4ZTBA 4DQDA 3EOZA 3UVEA 4Q24A 4ENWA 3JD4A 1XDBA 2BZGA 2NO4A 1X9IA 4Y18A 3EC2A 2ZRCA 1K7YA 2B7BA 3CZCA 4OJTA 4JT8A 4TN1A 1FUIA 5G1PA 3ZNQA 4J0FA 3DG9A 2D5IA 4H60A 1KMNA 3T9CA 4F96A 5BYBA 1QTQA 1ATIA 1YR8A 2HM7A 4CTKA 2JA2A 2A9QA 3EGWA 2R7LA 4GYJA 4J07A 4OHUA 4ZO9A 4ZTZB 5JSYA 2X5OA 3QLEA 1ATZA 1B15A 1U3DA 2XODA 2G3YA 4AYXA 5IDWA 1G8AA 6LDHA 4LWPA 1JG2A 3GLFE 2OCYC 2Z04A 2D2FA 4K9SA 1WW8A 4RDIA 1DTSA 1NZJA 4NF2A 3ICEA 5F12A 4TYMA 2P2SA 2Z5FA 2NPIA 4FXOA 4P4LA 1PR1A 3KUDA 4P7GA 2HDHA 2O2JA 3ANNA 4QUHA 4E51A 4F2HA 4E03A 1DCMA 1XEXB 1SVKA 3AYXB 1Q7GA 5DLQC 3TNYA 3A4MA 5KX5B 1Q6ZA 3GAAA 5DHTA 1K7SN 3VBEA 1U7PA 5JDCA 1PVOA 2BGRA 3ILHA 3TL3A 5TVGA 1Z8NA 3BIJA 1T9HA 2OKCA 4LZZA 4CKYA 3ZWOA 3TMKA 1GTMA 3BKWA 4BLRA 5ICGA 2B3DA 4I1SA 1BOFA 2Z5VA 1IZ9A 3A0UA 3M5WA 4QDXA 3U37A 4OFBA 2J5KA 4ZVPA 3TZEA 3U80A 1NHGA 1JQAA 3SCZA 4IQ0A 4WY8A 4ZK6A 4GAEA 3VJKA 1E1QD 2ZQ5A 5AI5A 4DNQA 3MC1A 4KWHA 1Z4JA 2J3EA 4HEA6 5L9AA 2ODQA 2ZJOA 3WK7A 1Y6ZA 1TGVA 2WF7A 3V2IA 3IGFA 5J58A 3MB8A 3SOPA 2ONKA 3OPMA 4HAZA 1QH1A 1VDMA 1C0KA 3Q10A 4Q9AA 5A4JA 3OFVA 1LS1A 3FTFA 3KNZA 3MILA 4BVFA 3L6UA 4YJ2F 4MIEA 1JZTA 4PU0A 1JJBA 1JKJA 3I9V6 4ZALA 2RAFA 5KOHA 2IPNA 1NKSA 4KPGA 2CF5A 4S1PA 1YB2A 1H0SA 3CG4A 1E7SA 1GQRA 1C30B 1IE3A 2P3LA 4JUDX 4ASUA 2FPWA 3JALA 4YCJA 1AKYA 4OI0A 2VWGA 4FBMA 3RRBA 3I2IA 4CQMA 4GD3Q 4M54A 4RGVA 4ZYVA 3AUXA 4R9UC 5CXXA 3QXHA 5ALMA 1KI9A 1NVVR 2HSGA 4TZ6A 1GQFA 2WU1A 2YJTD 3BMCB 1K86A 3B8EA 4HQ6A 3TD9A 1XZNA 1D6MA 4UOZA 5TPWB 4X0EA 2IWRA 2IZ1A 1EVZA 3DCIA 3CF2A 4KYVA 3D2AA 3CMCO 4RGBA 4YRPA 2XYGA 2Z9DA 1PAUA 3FCOA 5IF9A 2Q27A 2XY4A 4EUKA 4MUFA 3TJZA 1RAFA 2ZJ4A 2P3QA 7MHTA 1JN0A 1U3FA 4IDOA 3TTWA 5DK4A 4BB5A 1K9SA 4P7KA 3GDFA 3TLBA 1P2TA 3SR0A 1NBMD 1S2OA 3RU2A 3BMCA 1WHSA 1AIPA 1EH5A 3EXIB 3H4TA 3PZRA 2XIJA 3E5HA 4LZOA 4Q15A 3OQNA 1TF7A 4GUDA 1UF9A 5K2MA 4P3OA 3U4QB 3TOCA 1WMDA 1DKLA 1PWHA 2I0FA 3CZMA 3GEMA 2HPVA 5AI9A 5EWLB 3UANA 3DZIA 5LP6B 4PQRA 2WV9A 4F3RA 5B4UA 3DMNA 1CT9A 3KZXA 4RVFA 5FV7A 3UV6A 4BQOA 5LSAA 5F35A 4MPDA 2O7VA 3NWEA 4D8VA 3OFNA 4BNLA 4OLJA 4YJ3F 4L7QA 2VDKB 3E9NA 4DV1B 1Y8CA 3CUTA 1A2QA 1CUGA 2FPIA 2OHGA 4TMYA 5B2EA 4U2GA 2G6BA 3FZQA 3D6TB 5DTIA 3G5LA 2AQKA 5U4XA 5JYCA 5GINE 1GARA 3RUIA 2YX1A 3AM5A 5B7PA 2OO5A 4BGUA 2RGUA 5BQXA 1UM8A 2FN4A 2UVQA 1ADYA 3L1VA 2CHGA 4N76A 4RJKA 2RC6A 4AI6A 2B4AA 4EZEA 2D4HA 3S6JA 2ZIGA 2W7TA 1FMTA 1AA9A 1ZY2A 2AFRA 2VP5A 3G9QA 2CUNA 3KDSE 4QFDA 1GSOA 3AIIA 3LBAA 3QVJA 3LYLA 5C81A 3NWJA 1F17A 5J4HA 3DFKA 2IYZA 3RV3A 2XQKA 3GI1A 4DYHA 1AK1A 2EX0A 4M22A 5CB6A 1QOQB 4DJ5X 5JZOA 3Q4GA 1HV8A 3F6YA 1J24A 4XYMA 4N9WA 4Q3OA 1U2PA 1ULUA 2LDXA 1YZHA 3B2EA 3CVOA 3NBXX 4JFAA 4LKRA 1NA5A 2AMYA 2H3EA 1VHLA 1UBTS 1WTAA 5JXGA 5ADUS 1S1CA 1FXWF 3DEKA 2VCYA 1YULA 2JLZA 1HO3A 3LO5A 4QDOA 4HAWA 3RJMA 3GEGA 3VAZA 1MVOA 2OM6A 3P9PA 4NIMA 3ZOKA 1LEHA 2JFZA 3T7CA 1OR8A 4CM9D 2UUPA 1PHRA 3HBLA 4US0R 5DV9A 5LZ5A 4CZ2A 3F6CA 4I4LA 3BWYA 1XZGA 4FR0A 1QVWA 3EEBA 4U6QA 1I6LA 3V00A 3CONA 4GQIA 3TEJA 2DWCA 4QXAA 2QY6A 4H3VA 4NATA 3TTUA 2NT3A 5FJJA 3BICA 3PTZA 4HAXA 1G3MA 1N3LA 1M6YA 2W22A 3E3OA 2EJUA 4J0CA 1QIMA 5H02A 4PANA 4CDRA 4UASA 5HX7A 1XZJA 2DUNA 2O2EA 4BPBA 3T38A 5JVDA 1PFVA 4IFIA 4KYIB 3IAFA 4MS1B 1VKZA 3DDCA 3C70A 2G9NA 1KZHA 4Z3OA 2I91A 2PZGA 4PX3A 4D0SA 3VZSA 3N58A 4MV4A 3ORSA 5JTTA 2CBXA 1BAPA 2O1SA 2CZGA 5LA6B 4ZGGA 1D5WA 2H7XA 3G9ZA 4MDEA 2I8CA 2X77A 5EMHA 4ITUA 1KDZA 1XQXA 4RVCA 1RMTA 3K2IA 4TXNA 3RBXA 3IEPA 2P9ZA 3SNKA 2HADA 3PC8A 4LEIA 2W2VA 3TQSA 3DZHA 4UD2A 3T9AA 4O4HB 1BOOA 5BN5B 5CDHA 3H3JA 4MEBA 2LRHA 4OP1A 4MS4A 1V8BA 2FX5A 4I4NA 4D9FA 1UWCA 2P9JA 2CDCA 1OU0A 2KYRA 4HP8A 1TT5B 3G0OA 4GI3A 1SUCA 3LDGA 4KSBA 5DISB 4BNHA 4D9CA 3T1YB 5FPKA 4A0RA 3V6MA 9LDBA 3DE1X 1C1XA 5F9HA 1GPAA 1JDJA 2HJGA 2HV9A 4UBIA 4YI3A 3HS3A 3NI2A 1T8WA 1TCVA 1EGMB 1N0VC 3FPFA 3I52A 3I8SA 2VIIA 2XTAA 3LQQA 2ODNA 1S96A 1JLSA 4IF4A 3ASYA 4RO0A 4DQ0A 1J8QA 3OX2A 2OGSA 4D81A 3RFUA 1D2HA 3VZBA 4LJLA 3QSYA 3RE1A 1P0QA 2BF4A 2NUPA 3GPDG 3SXJA 1PK9A 4J9VA 2F43B 4LF6B 1NJ5A 1SQ0A 1VOTA 3ZD7A 3MTJA 5F33A 2AG8A 1IONA 1NVEA 4YMTA 5B3KA 3I0ZA 4ZYYA 4HX2A 5H3HA 5A4IS 1QVAA 4MIKA 4D92A 2FSVC 3NB0A 5ALVA 1M1XB 1DCTA 1L4FA 1PUXA 2AE2A 4EBFA 2IHUA 5KVCA 3O8QB 5L6LB 1DAMA 1Z25A 5JBIA 3LG2A 1ZUNB 4DW8A 1WULS 2YV2A 3BCRA 4HOYA 2CVHA 1LLFA 4PPYA 4JR0A 3BKXA 3JQRA 1PZHA 2HREA 2QD1A 3K8YA 3WLRA 1ZRNA 1JPVA 1NP7A 2F48A 1A9TA 2YQ5A 4FIDA 2GR9A 3RSGA 3U16A 4CN8A 1W5EA 3QUBA 5KNBA 4TWAA 3Q3VA 4J0QA 2VDUE 2QYOA 5AHKA 5K3EA 1PQUA 1DWQA 4GO1A 5DE3A 2ZU0C 2PZMA 2ST1A 3EFHA 1I14A 1BFKA 1FNBA 1MA0A 3KAPA 4GHWA 4MR9B 2BT4A 4GMFA 4C08A 2BDEA 1E1YA 1K4MA 3DEFA 1M1NA 4HBGA 5DBOA 3D6UA 5DMHA 2QL9A 2ZRDA 1Z0UA 3I5MA 1EX1A 4LHEA 4BIIA 5CCXA 2Z6QA 3R5FA 2QVZX 4ENSA 3OQHA 3MJEA 3SNHA 4D42A 1BEZA 9GPBA 1A7AA 1GCOA 4TXMA 3EGDB 1ZMOA 2KI5A 4Q1VA 1V2GA 2IYXA 3CURA 3R4VA 4O2AF 2GDJA 2EX1A 3DMYA 2GNAA 2WWHA 4W9RA 1C7JA 3H13A 5DK6A 4KPFC 1SQ5A 1XTIA 4K9MA 4X6LA 1Z73A 3IESA 3EFBA 3EQ7A 2IS2A 1MAUA 5F73A 3LCUA 1N6OA 3BK2A 5JXWA 3NTVA 4FI3C 2Q4RA 4QDZA 3AV3A 3WBKA 3QKUA 2BRUC 3K3PA 2VBFA 2J9YB 1LLDA 2VJNA 3AUAA 3GLHB 3KAQA 3K53A 1W85B 4L50A 2V7UA 5DBGA 1J5PA 2AFHE 4FMCB 4TRMA 1XMVA 1YR7A 3AHHA 3L7MA 4BO4A 4FX2A 2ZCJA 4BFUA 5CM2Z 3B6EA 1T1SA 1KI3A 4S2EA 4XASA 3UV7A 2QLFA 3D3WA 2CJPA 1YDHA 4MKIA 3LBNA 4LF7B 4J3JA 1SKYE 4NS4A 4CTJA 2WF9A 4RMNA 4F45A 2PT9A 4BO6A 1B2RA 4DDUA 3U13A 4EPWA 4R8KA 4KAAA 3WLPA 1RJ9A 2I67A 3IT0A 1PS8A 4RPKA 3O1IC 3O3NB 2X3YA 3CS3A 4DARA 2WF8A 2XZOA 4AM8A 4XM2A 3TF5A 2ZSBA 1TQDA 2P7IA 5HSGA 4UHDA 1O6GA 1TUGA 3C7DB 1KJNA 1K08A 4IO1A 1GZHB 2CL0X 1P3JA 4ZJUA 1WTCA 2VWQA 4LF4B 1TC2A 3DJYA 1JMKC 2B0JA 5KREA 2WNSA 5AJHA 4UTPA 1G7RA 2GWHA 4JCOA 3ND6A 4HK4A 3S1AB 2D5LA 2WOOA 1W93A 4RVHA 4EJ2A 1BXRA 1E59A 1QPGA 4JI2B 2C20A 1KRWA 1ENYA 3BE4A 3MGCA 3THXB 2P7HA 1FNCA 1WPXA 3K0CA 1ZHOA 3GN2A 3VH3A 3KEMA 4O2AB 1GT6A 4LZWA 3IUSA 4KSCA 4MVJP 1CF4A 4C0LA 1B23P 2VK1A 1PX2A 2ZSDA 2VZLA 4HXGA 1V6AA 2EWVA 2C1ZA 2R6GA 5D3KA 5ALHA 5K6AA 2QTWB 3CZ9A 5K6RA 3ADDA 4U7PB 2GYYA 4G5OA 4G5SA 1HSZA 2CUKA 2P1ZA 4HMPA 1O87A 3TUJC 3VISA 1E96A 4DWWA 4K1XA 4ZCRA 1R0RE 3R7DA 2B3TA 2BPOA 3DAYA 2J0VA 3F1LA 4OI2A 2FUG1 3HZHA 4WKPA 4EKYA 4TV9F 1P7YA 3KPUA 4HBZA 3NS7A 4JBLA 1NV8A 2FUCA 1USIA 1A1SA 2NSDA 4ARSA 1FA9A 2G0TA 4MQLA 5LZ2A 1E2QA 4LMRA 2WWGA 4M9QA 5GAJA 1QH9A 1TIPA 3KWMA 2BFNA 5G4KA 5M04A 4CT0A 1PZXA 1ZK4A 3GFSA 2CHFA 2P75A 1DDIA 1G20E 1U31A 3S8YA 3E7FA 4WFKA 2G7ZA 5H59A 4EM6A 2PBZA 2I2WA 2JIZD 5IXYA 1YOVB 3H8WA 4EA6A 1CZLA 3V4ZA 1H93A 4MLDA 5C32A 5F98A 1QP8A 3R7LA 3AVTA 1GLVA 1S7GA 4GQBA 1DAPA 4J16C 3HV0A 4U02A 5GMOA 3MT0A 5ITWA 1ZC4A 5KOJA 4J7CA 3WGZA 1QYXA 5G02A 3F2IA 3HDGA 1GQQA 1JTEA 3AONB 3CT6A 4PRYA 5LB2A 3DLHA 4QT0A 3AHGA 2YV5A 3DD1A 3EULA 2Z2YA 1ZEMA 2IEBA 4M7RA 1ZN8A 3SYLA 1SOMA 2V6JA 4OBWA 2Q4EA 4PPFA 3MLBA 4N82A 3LZ6A 3FB4A 4HQFA 3PFHA 1GLNA 2QTLA 2P0AA 1L5OA 3L05A 1XAJA 3QEKA 2ZAIA 4O33A 4PSAA 3AESB 1J0CA 3QQPA 4DM3A 5HBRA 1S3FA 4UC0A 2W8BA 4PTZA 3BM5A 4P82A 2P9QA 1W73A 3WYNA 2ZIAA 5HUQA 1JR6A 4KCGA 1NVAA 1RIFA 4C21A 3WC4A 4KWEA 4RFLA 4P32A 1OTXA 4ONEA 3TSOA 3NRCA 2W6ZA 5J5VA 1TU3A 3KB2A 2Z2XA 3WMXA 1K9VF 4C5CA 2QV7A 4JP5A 4MOWA 3VPAA 1RACA 2HPAA 1LW7A 2Q4OA 3DM5A 2XYHA 4DREA 1IEQA 3RVPA 3K35A 4EW3A 3PT9A 3RUHA 2AD1A 1RZVA 5CT4A 1NVXQ 3WP0A 3KB8A 4MHOA 3N05A 1ADBA 1XZCA 5EIHA 3QTBA 1BROA 3JYHA 3N0XA 3HBFA 4IIHA 3KE8A 4TVKA 5IX8A 3KK0A 3T5AA 2X0NA 4KREA 2GK7A 4FX5A 1QP4A 4EWLA 1DKOA 2KPOA 4G8JA 5FOQA 3AEQB 2PFSA 3PYLA 4BVLA 3FZYA 5DSZA 4EFLA 3AJDA 4EKDA 3H2HA 3BQMB 4QE3A 5AHOA 3NFRA 1JJAA 3DO8A 5GONF 5LOVF 4WY2A 1C3JA 5BV2P 4K2AA 4WZBB 3IUYA 2PRKA 5ALKA 5JMWA 1W47A 2OL4A 2WZBA 4AS2A 5DNVA 4UVHA 1J70A 4KLAA 2RGRA 5JWHA 2VNKA 1IY8A 2GVNA 4TWRA 3E03A 2QZPA 2J07A 2XB4A 4AMUA 2GTPA 1M8KA 1I2CA 2I7XA 3BTVA 3CISA 4QG7A 4Q21A 5GGYA 3A9WA 2DQYA 4EB6A 4FOTA 1OYYA 3O31A 3NP9A 4ES6A 5F2KA 5B12A 3PUWA 2O8CB 1QHFA 2VL7A 2QI9C 1WP4A 1PZMA 1XEFA 2YXPX 4DJFC 3IUEA 4JKIA 1SZPA 5FOWA 2IPXA 1TO1E 4CMIA 4N3AA 1IWPB 2Q3JA 1PJZA 3AVXA 3R3WA 1MAAA 3A28A 1FMFA 1FL9A 1I33A 3LQKA 2PX5A 3PKIA 4KV9A 3UK0A 5BN4A 3HLKA 5M2QA 1E0SA 3PI6A 4EAQA 4CNBA 4X7RA 2GN2A 5SY4A 4AQ7A 3PXXA 5T67A 1L7NA 1UWVA 5CDYA 1ZUIA 2J9ZB 2JCXA 2O7NA 4I3FA 4Y9UA 3BHIA 2VTDA 1ZKDA 4PG5A 1KE2A 3X43A 1MW9X 1W76A 1ZWLA 2IOFK 3OVMA 4B7AA 5FD8A 5BSGA 4DDVA 1GA4A 3FZGA 4MKXA 3F73A 1U3GA 1P81A 2F7SA 2I3ZA 3A9CA 5CA0F 3RWBA 1RWQA 5DN9A 4WACA 1SUBA 1YRYE 2UYOA 4N6NA 1TMYA 1FEZA 1SUAA 2PV7A 3FNQA 2N9UA 3QW2A 4JMLA 4B8WA 4C1NA 4D82A 5K3OA 4WCDA 5TS2A 3PGKA 4F3YA 4IF6A 5DCWA 2Y1CA 5FTLA 2HK6A 2Y27A 2XXAB 1AK9A 2P65A 3QV2A 2FG5A 2NW6A 1UP4A 1KC1A 3OOWA 1KIMA 1CR1A 1C7RA 2FWJA 5L3RA 3TSCA 4PXYA 5AVYA 2WYWA 3BMOA 4NI5A 3U56A 1XGKA 1BCRB 1E5TA 4MW4A 1B0PA 1M2HA 3OQVA 5KTOA 1C9KA 1PU2A 2CE7A 2M6RA 2ZYVX 3NJRA 4L22A 3WLAA 2PJRA 4G5GA 3AMVA 3LA6A 1BEUB 3RIGA 3VKFA 4IH1A 1NVDA 4BNGA 3OIGA 1J8VA 2G80A 1UBKS 3HDYA 4AJ1A 4GBJA 1SXPA 4MUIA 2QN7A 3C14C 4KAFA 4F85A 1SCUA 4DC9A 3EZGA 2B6HA 1EVLA 1LDGA 4WESB 4NNPA 3VSBA 1ZNXA 1YDMA 3ZR4B 2ZJBA 2GPSA 2POCA 1JEYA 1EXVA 1MAHA 1A4XA 3L7NA 1YQQA 2RK6A 1QM5A 3D8HA 3ZDDA 1E0KA 1ABBA 3LC7O 2FLVA 4ZQEA 4RGYA 3KR1A 3MUOA 5T64A 3FYUC 3PJDA 1O9GA 3C8DA 5C7OO 3MAGA 1EE2A 4YCAA 4LHZA 4CCSA 1Y1KE 2FWRA 4MWSA 4OXNA 3K31A 1OLOA 4PG4A 3JQEA 3S2EA 4C0HA 5JSHA 1YF3A 3L8DA 3BC1A 2VLBA 1AB6A 4O4IB 1XK7A 1JYFA 2IIQA 3E3AA 3LDUA 3P0IA 4GOKA 4JMPA 4K5QA 3JWPA 1UK8A 4X95A 1KJQA 5IKEA 1D1PA 1RAGA 3ADKA 1KO8A 2X2EA 4J6FA 1EINA 2NPOA 2TMKA 1LNZA 4H9GA 3L6DA 1U94A 4KMMA 4KX3A 4KUGA 3ICVA 2P3OA 2X58A 3DT6A 3HB7A 3NHFA 4MS1A 4FD3A 3QX8A 1JZSA 3OT1B 4JLPA 4B87A 4E46A 4HGQA 3AU9A 4R1TA 4M89A 1R0LA 3H83A 3KDAA 4XIIA 3KRTA 3PS9A 1YWGO 1JAHA 2FEOA 1OFVA 1QIFA 1ZOIA 1PLKA 4ALIA 3PWTA 3WHPA 5IT5A 1MV8A 2ZXFA 1PJTA 3WB1A 4UNQA 3WNDA 3HVHA 3ZBPA 1DTEA 4XR4A 2VRBA 5E1MA 2Q2NA 2QENA 3IA7A 3LQYA 4R2KA 4MWEA 3CEAA 3ZU3A 4R5HA 4D4KA 1SC9A 4P80A 1ZAYA 3SZOA 1FYDA 1QONA 3BYZA 1NLUA 3I64A 3IJPA 2C83A 3VXKA 4ZRDA 1KORA 1VCHA 2H00A 3UK7A 3W79A 1KAQA 3UOGA 1MOQA 3NBUA 1XDGA 4FFPA 1LRJA 2XVMA 4DSNA 4ZN6A 2X5JO 4Z5XA 5I7EA 2Q2WA 5JSZA 5L40A 4J0HA 3PIRA 2FN9A 1Y7HA 3LX4A 4BGEA 1DFHA 1BVHA 4YI5A 4GP6A 4G85A 1H4VB 5CFMA 4XSGA 1U7OA 5L7WA 1A9ZA 5GP1A 3ZDFA 1KYVA 4LJ6A 4CFZA 2PZLA 3M0EA 5LP6F 4CF3A 3QI2A 3ABQB 1W5BA 5L6MB 5CAEB 1SBCA 2PGXA 3D43A 1J56A 2I7DA 1UC4B 5DH9A 3SF8B 2FZWA 3BEOA 3D2CA 2EP5A 4MX8A 5EJIA 1R8YA 2I8LA 1ZK2A 4FFVA 4LRYA 3U7GA 1UBLS 3K6SA 2Q29A 4HNAA 1SPXA 3FDJA 5C52B 4RPGA 2C07A 5SICE 3IDAA 1D2AA 3TS1A 3J7AC 1FTNA 4ZT4A 1NM5C 3OPXA 1F8UA 1U02A 3UTCA 1IM5A 1FYVA 3HUTA 1P72A 2ECFA 4PX9A 3PX7A 4JNCA 3VNAA 5KDLA 1ZNZA 3ZGLA 4Z4CA 5CX1B 2FKNA 1SCAA 3S70A 2X6QA 5BMVA 4ZK2A 3LBHA 1NT4A 3ZZUA 3VU1A 2Z6UA 4WNAB 4XW2A 4HWPA 5HMMA 4IV0A 3G3EA 3OP1A 4GPAA 5LLDA 5JH7B 1BJRE 2ADMA 2HMAA 2JS7A 3CVWA 1EWTA 3RB8A 1WMSA 3DZDA 1DFIA 1X7XA 3O03A 4URHA 1Z35A 4KNWA 5JNLA 1B26A 3Q0EA 1O95D 1N1DA 2PUHA 1WSAA 2QUHA 4QD3A 3OO0A 3IHTA 1HQKA 1Z4QA 5E7JA 3I1FA 2JI8A 4YAWA 5JVDB 4BQIA 4ISCA 5C5IA 1JHZA 3SZRA 5IDVA 1P33A 3BMNA 3OY7A 2OYSA 4NEGA 4UE3S 1QGDA 1WXGA 1FZTA 5G2OA 1EXWA 2XUIA 3FBGA 4LCBA 5TMBA 1L5FA 3TIIA 4DV4B 3T15A 1MH1A 1VBKA 3MJDA 2PGOA 4LKOA 4P4NA 3DAPA 4Q16A 2BE9A 4A8JB 2BFCB 1DTWA 1T6ZA 2FV8A 1CW2B 4K0KB 3BGOS 4PRKA 4YRLA 5TEVA 4MV3A 1JSZA 1LLCA 1O97D 2OCPA 1T4BA 4JIGA 4L4RA 4P38A 4QRHA 4DEXA 2QX6A 4WCVA 1RVV1 1Q7EA 4BMPB 5A2GA 5DM70 3ZJYA 1IULA 2V7TA 1DAEA 1RRMA 4RESA 4Z4GA 2R5FA 2PGDA 3T4EA 3A6HA 4DR4B 3C6ZA 5FI0B 4D5GA 3N2NA 1DX9A 1OWMA 1ONPA 1QB7A 3PJGA 5HIJA 3V46A 2B82A 5DLDA 2GHQA 4CG2A 5C3UA 5ITSA 1X7YA 3AY7A 1VDZA 3JQQA 4WBNB 2W37A 4MQBA 1EKXA 1RTTA 1Y4ZA 4TROA 1C8KA 3TRIA 1BX1A 2GEDA 1XMQB 2YFQA 1TAUA 1Z6YA 4MP6A 4X9XA 4B46A 3B60A 5EXXA 5LDGA 1GRVA 3T3PB 1UBHS 4CIBA 2PMKA 1BYUA 1P6XA 2CF6A 3K6KA 3GT4A 4K7JA 3HE3A 5HJEA 3K70B 1INLA 3HGMA 3FKSD 1JUDA 3S2SA 1R74A 5LZ9A 2LPMA 3ECCA 3MTQA 3LBFA 5JXJA 4IPTA 4TMVA 4G01B 3RFVA 3SIWA 2HU8A 5KQRA 1Y89A 1WU8A 5L7TA 1W5FA 4FEAA 3WGLA 1E1KA 2OXEA 2GBCA 4HYEA 2OENG 5D8DA 4C06A 1XFDA 2CNNA 2EARA 3I5AA 5C4IA 3GFRA 1G5HA 2IL1A 2J6CA 2CD9A 2XT6A 3KYCB 4C1BA 2CJWB 3S2YA 4WVLA 2Y4NA 3KM0A 1G7TA 3J80A 1RDFA 3C6QA 2DUWA 5G0TA 4MCAA 1GKKA 1N8TA 2YRWA 1EUYA 1EBFA 2B5OA 1A4UA 2MSLA 1EFRD 1CY1A 4C4OA 4CYMA 4DF3A 1GU0A 1U80A 5ULLA 2PSEA 2A9JA 4BB6A 1XNGA 1DPGA 1QYCA 3P94A 2VT6A 4H1TA 2Q7OE 5FUMA 5K8LA 2H2DA 3UMRA 2WINI 2Y1WA 1GA6A 2BELA 3RVOA 1EJ0A 2XWJI 1X94A 2GM3A 3EWNA 5FBVB 2R8YA 1FSGA 4MHSA 1UJ2A 4XJSA 1KU0A 1IJEA 2Q0SA 1SCBA 4YAKA 5EKTA 1N7IA 3AL2A 5CM8B 5E4YA 1LJ8A 3CRVA 3UJ7A 3ZWXA 4X90A 5HRAA 2ODBA 4ZV4A 4MARA 1JLKA 5LYJB 5FPHA 1QF7A 2RSLA 3EVAA 4ARCA 1M1YA 1BE0A 2CFIA 3SX0A 5AK5A 5D6NA 3ZWVA 5CH5A 2HMTA 3F5SA 4ZYZA 3OQIA 3UIEA 5LP6C 1GGKA 1VXRA 1J0EA 2R9VA 2CNKA 2DR0A 5AK4A 1SC6A 2C5GA 4LWQA 4HVCA 1NQVA 3I37X 1C3VA 3LT4A 2YXEA 4M49A 1NBEA 3IURA 2JF0A 5INTA 1MBZA 1IBCA 4DMHA 2OORA 2XOEA 1ORIA 2DWUA 3L6CA 1BFUA 2AL7A 4UEOA 2WJVA 2QG9A 2GF9A 2WHRA 4PZDA 1IVNA 2C0CA 3VPXA 2WWYA 3OIFA 4K86A 4PFSA 1AQNA 1P29A 1XXHA 1YBMA 4R68A 1C1HA 2JCYA 3LOPA 4QXMA 4TS1A 3VR6D 1OVMA 1MB0A 3NYQA 4QA9A 2GJ8A 2QR2A 2R6CA 4EA7A 1M34E 3PEUA 4KGVA 2ACKA 2YC4C 4AIIA 4F6LA 1XRMA 3Q5GA 1ZGZA 3GLTA 4YV7A 1UBRS 4HDNA 4QICA 1I7PA 4ECAA 4Z7OB 3FJYA 2PIDA 3HO6A 5CAEA 5HOEA 1LK0A 3RIEA 2AN5A 3VU9B 5I4KA 1M6VA 2P9HA 2YDYA 3T5GA 2F1RA 3TVTA 3JR3A 1ELOA 3LDHA 1X2BA 3K96A 4BCDA 2FG6C 4F3NA 1VBMA 2JRLA 2BMWA 2Y05A 5K6AC 2WT8A 2Z57A 3M34A 4YMHA 2JAQA 4KK4A 2O6LA 4DM7A 3SICE 3MD0A 2PG3A 3RYIA 3WKAA 4BNXA 1U6IA 4Q1FA 1QRDA 4DJJA 4EX6A 5F2NA 3AJEA 4L9AA 4DMRA 1NJSA 4HDRA 2VF4X 2IUSA 4FYIA 1SXJE 3ZBUA 5FJIA 2YW9A 3S7ZA 1E2FA 1I2MA 1P5JA 2WM3A 5IBPA 4E88A 5CIQA 1GLGA 2DPMA 3IIMA 3MCUA 4OBEA 5AW9A 1WMFA 2EHDA 3A14A 3DPUA 2WJZB 4FYPA 2XUAA 1SZCA 2I8AA 4AAYA 5AXCA 1EZ4A 3PRYA 3IPXA 2P41A 3EEYA 3NOQA 1JGTA 2QN6A 1J0BA 4FS8A 4H16A 1DIHA 3AL3A 5KVQA 521PA 2Q0HA 3AIOA 2XKJE 4CGZA 1ZCAA 5TGZA 9LDTA 1GAEO 3KJNA 4FGSA 3PR2B 1DNPA 2GAFA 1QOZA 2NVBA 3LU1A 1VRWA 3LHKA 5KU7A 2IY8A 3E27A 1DIGA 3GAFA 4P34A 2P2CA 1PWZA 4NRDA 4QJBA 2PVSA 5L8VA 4OOEA 2MCFA 3AY0A 1YDGA 4O5OA 3S2ZA 3UC9A 1TCUA 3DNFA 5A5FA 4AXXA 1XTRA 2ZTSA 2XDQB 3A3YA 4MGIR 4CHGA 1WG8A 3DTVA 3TEFA 1T9ZA 3H3XA 1Y3FE 5C35A 1XZLA 1JL3A 1KZYC 1ZOPA 4DIUA 1HH4A 4KHZA 4EHHA 3WO0A 2V45A 1E5DA 2G82A 4B2LA 3RASA 1V6SA 4LRSB 1DAGA 2IHJA 3UGJA 1QV9A 5AOCA 5FOUA 2E2WA 4WXHA 3SP1A 2A84A 3Q72A 1G41A 4KQXA 4FNGA 4QLAA 3DKVA 3L8GA 2G08A 3QYFA 4X45A 5FPQA 5EC8A 1G17A 4JT4A 5BQOA 4BV3A 5DW0A 3O7WA 4OHVA 3SJ7A 2FPSA 1M2KA 4RK1A 4RQUA 5DTMA 3DOHA 3WMGA 5TRTA 5JJ5A 1UWLA 2ZFUA 4K9QA 2ILVA 1KAMA 3OG9A 1AB5A 1KETA 2A3NA 2DWPA 4CMJA 5J5AA 5B36A 3O82A 1J49A 2E3JA 5EJ4A 1VPTA 4DZTA 1O96A 4LDZA 4HNVA 1NJ2A 3O9ZA 1WD5A 2GHRA 3TQRA 3UMJA 3WL7A 4BO5A 3FRHA 1QR2A 3WZ2A 4YT8A 2CCKA 4OFZA 4HTAA 4QOHA 1JMYA 2V7EA 3IH5A 1VGRA 2BKEA 2ILTA 2QPAA 3M9WA 4FLEA 4I6GA 2ZT6A 4B48A 1UIRA 4H7KA 1NF9A 2ZTHA 3BULA 3NPAA 4YRCA 4I3HA 4C6TA 4ZQGA 3RGGA 1WEKA 3OZRA 3GFTA 4M0MA 3TB4A 4TV8A 3EQ8A 2AC2A 4P4TA 3HBMA 1VIDA 4EY8A 2QI9F 2OQ2A 3GMIA 1SKYB 4JLWA 3DE7X 3M3DA 3RYTC 4D57A 4D7AA 4G5HA 4OHOA 1E5QA 3V42A 1J1ZA 1N6IA 3RFTA 1JQLB 2B94A 1WF3A 2EFGA 1LQTA 1SWVA 1S3IA 2CLMB 2ZJ8A 3AERA 5BW5A 3WAGA 1WCV1 1COWA 3IBCA 4FMCF 3M5PA 4B4VA 3ZS8A 1VJ1A 5EHQA 4ARZB 1GNTA 3BJMA 1XEWY 2NQ8A 2H4XA 1LDNA 1GKYA 1T6YA 3DDOA 3UA4A 3MT8A 3FDZB 2FOXA 5GQSA 3E2IA 2ZZKA 3KZOA 1EG2A 3DPSA 1XU7A 1LV8A 1X1AA 4NCAA 4GC9A 2QMQA 1U3WA 2F59A 3E0QA 3IUQA 4LUCA 5TSDA 3VDXA 8ADHA 4KE6A 5I7RA 3BB3A 4UCWA 3KZVA 3HGTA 2BDTA 3K5PA 4Y6LA 5AHXA 4WD3A 3WTCA 2Z2JA 5BR1A 3JSXA 3GVCA 3IKVA 3PC4A 1ZLYA 4NMXB 4ZKEA 1QMPA 4ARZA 1KJZA 4EEZA 2BFWA 1WPQA 4MVWA 3CIOA 1IY9A 3E9EA 5IRCD 1U0OC 2QX8A 2NAFA 2ZUWA 4UFOA 3USES 3WQHA 4LK2A 4FEYA 3FPKA 4MI1A 2C7RA 2LKDA 1EJ6A 1HL3A 1SVWA 3GDOA 2HBZA 3MN1A 1KYXA 1CXZA 3QUQA 2COKA 1E9AA 2WY2D 4N3CA 3MS2A 4AJIA 3VMMA 2OKGA 3E9CA 3EGVA 5B1YA 3QUTA 1JR3A 3WGMA 1EEHA 3J7TA 1OSNA 2BMEA 3P9KA 1T0JB 4B5KA 3M4YA 4QGBA 1W85A 3EA0A 3PD0A 3WRYA 4PZCA 5AK0A 5FADA 5FUWA 1T2NA 4UFPA 2X7XA 2Z9CA 5IYZF 3H2SA 1GDTA 2ZRHA 4M88A 4ZEMA 3E8XA 2XUFA 1HXHA 1ODJA 5IDYA 4DLWA 4MGZR 3HCCA 2PAFA 1YVPA 3HL0A 5KWVA 4ZJZA 1WQ4A 3EH1A 5TVKA 4HFRA 4N0QA 1DQRA 4HY3A 5EL0A 4E33A 2AI3A 1AZTA 2QTMA 4UW9A 4JI3B 3EPLA 1MKYA 4L02A 3OF3A 4X8HA 3GDGA 2QRHA 2PWYA 4Q3CA 4XPZA 4LSMA 2N75A 1Z6QA 4OH7A 5BV0A 2P4SA 1E8DA 1K3FA 4I6EA 1UKEA 3FI9A 3IDZA 3FOZA 4QM7A 3CNNA 3LQ4A 1WCIA 2JBHA 2W2OA 1UK6A 2LCIA 2YJ3A 3HVJA 4KTTE 5JQGB 1HA3A 5KKAA 2FDRA 5FCDA 4LN1A 2JJ2A 3ZV7A 2I6QA 2EGHA 3H9EO 4NYJQ 5DULA 3ZVNA 3FOBA 2B2XA 4Q7KA 1BEEA 5JQWA 1XDSA 3GFGA 4KQWA 2NSLA 1E3WB 5JS8A 3OLCX 4DABA 2GA9A 2NQ2C 3QTTA 3RC8A 4M87A 4KXYA 3UK6A 2YTZA 1MOZA 2XZTA 5DCLA 4G5FA 1Y9DA 3UUFA 3ISTA 1V25A 1GPBA 3QJGA 4CI0B 2J6HA 4UBNA 4KFSA 4D43A 4HTFB 1FDSA 1VM6A 3O4JA 5K45A 1KEKA 3K5HA 4QXQA 5CK5A 221PA 3CLSC 1RR6A 4PYIA 1IZ7A 4PN3A 4RPHA 4CM3A 4HS4A 1BJKA 4LV5B 1SPBS 5AM2A 1NPDA 4GM1A 5DM0A 4QODA 3BD6A 2GBLC 3IR5A 4RKWA 5K0EA 2DPLA 3HEMA 4M0UA 4C0QC 2B9EA 1AKQA 5AJUA 4I5GA 4ERXA 1DAIA 2A5FA 4GH5A 4UUBA 4X1KB 3UHOA 1SBIA 4DNFA 2G5GX 3Q15C 1ODTC 3BL6A 4M0DA 2VJOA 2O7QA 4HTFA 1UM9A 4HDKA 4JB8A 1ORRA 4KLNA 1NUSA 4WEQA 3PXGA 5IPFA 3L8CA 1ECFA 1I7LA 2ATCA 4KJXA 1N6NA 1I7QB 3KQQA 1U2TA 2ZUVA 3GYBA 1VYTA 2VQFB 3FH0A 3H9BA 5LMUB 4CQJA 3BFPA 3D4LA 4HATA 3SSOA 1H9CA 2G83A 1H22A 3TZCA 3JZDA 3ITEA 2VRCD 1AN9A 1IHUA 3HJRA 3K9GA 3OJEA 1TZKA 4TM7A 5I7SA 3LUKA 1BCSA 4OKNA 3OJFA 4TL6A 2ZRGA 3K5IA 4ZO4A 4ZMBA 1C9DB 1SOWA 1USWA 1T1RA 1N9KA 3KJFA 3ZI0A 3BK1A 4X6UA 4M83A 1RP1A 3AY3A 2PMBA 4IXMA 1T4DA 3THXA 1GUAA 1QBKC 1REQA 1DRVA 1UQUA 2R6R1 4ZDWA 5BO5A 1U2RA 4Z9XA 4N5HX 2IYUA 2J85A 1KU6A 1L5SA 4RA6B 2VXOA 1D8TA 2N0SA 3SN6A 2HSDA 5GONB 3CRRA 4MQ6A 4PNPA 3VFDA 5CB4A 3KP1A 4BKMA 3MMXA 3DVAB 3UJNA 2YH2A 2CLCX 2IS6A 1ZM2A 1DBRA 2PTHA 1I4WA 1RAHA 1KO7A 1UJ5A 3M6FA 3PCTA 3A6JA 4A2PA 3CA8A 3TL2A 3G2PA 3DXXA 2JDID 4N1AA 4PLFA 4R2MA 4W5QA 1SUDA 1VI6A 3SC6A 5IJ9B 2GFIA 2FZ4A 2C99A 1VQ1A 1BWQA 4U2EA 5CTAA 4YASA 3V7FA 1JW9B 3A7EA 1NRWA 1Y3AA 2QMYA 2ZYRA 3L4KA 2HMUA 3FOFC 4F4FA 3ACDA 3KQKA 5C1DA 1QX3A 2NU9A 3WGVA 1ADJA 1B8OA 1QPBA 2QV0A 3VR5H 1GQ2A 1RBYA 5HCUA 1WUHS 2BTEA 4YMLA 2R8RA 4R1MA 1CYEA 1LJLA 2FY8A 4BMOB 1AKTA 4XD2A 4S1VA 3ZJTA 1HT3A 1DG1G 2RJOA 1GKIA 3EMVA 4US1R 1MG5A 3E48A 3RYCA 4RF2A 1U99A 2I62A 3C3EA 3T9EA 1P39A 1P73A 4EUHA 1JI3A 2LDBA 2JFPA 2VJDA 3K0AA 3MZ0A 4QNNA 5AKJA 2ZVPX 3D0OA 1USKA 4OXXA 2NO9A 3LQ1A 5AHRA 5DHSA 4QTUB 4B17A 2HO4A 5B6IA 3KYIB 1WABA 2IZ6A 2A33A 1L5KA 2BYTA 1DEHA 1U9YA 2WR8A 4Q1CA 4OI4A 1OLUA 2IE0A 4QEDA 5MN4A 2DAPA 1WF6A 1U0JA 1NIJA 3GPBA 4HR7A 4JQOA 4MR7B 4U7HA 4WTOA 2IQIA 1IM8A 3IOMA 3P2JA 4QSHA 1DHRA 4XRRA 1XYGA 1P4SA 1KDRA 1H6AA 2IOYA 1MO6A 4U5XA 2F4NA 1G4AE 1ICIA 1PFWA 1QAQA 3ENZA 1JKIA 3O92A 1LRLA 1L9KA 4G81A 4ZXPA 4PNZA 2C97A 5JAHA 1RAEA 2R5NA 2FR8C 1Q15A 3U7IA 3EA4A 4ILEA 2IUFA 2XR1A 3OA2A 3DTVD 3DVQX 2CUTA 1CUSA 5A3VA 4W5RA 1F5NA 1V37A 4XD7A 1JWAB 1Q14A 4X7MA 5HQJA 2ZBFA 5TQ2A 4ALNA 2JD0A 1XC7A 3K6JA 3CZAA 2NYVA 2BLLA 3DJFA 3DKRA 5BR8B 3G0IA 3O8NA 3CNBA 1G59A 5AW3A 3CCFA 4KE8A 4Z9FA 2G5PA 2P78A 4WUVA 2GK6A 3SGLA 4ZHQB 2XOXA 1R0KA 5KWSA 4I46A 1L7DA 1T1EA 1DG3A 2PN1A 2XA2A 1MGOA 3NHUA 3QY9A 1WMBA 3H5WA 1EZZA 1JHVA 4KODA 1KK3A 1CLUA 3PEFA 4OV6B 5F51A 4WN9B 4OJYA 5KYVA 3MNFA 2ZM6B 4YHHB 4OQQA 5JH7F 3R6LA 1P2SA 1SXIA 3AR7A 2R7KA 4H4DA 2BBSA 4N49A 3FTNA 4JJGA 2EATA 1WDKA 1KVQA 3DL2A 4ILKA 3IBFA 5IJWA 3MMSA 1IPFA 3GZNA 3UAVA 5ECYA 4QQRA 5EWMA 4YAUA 2ISQA 3GP5A 3SLKA 2GTIA 4O4IF 3VC7A 1IEXA 4A0SA 4XCVA 2E49A 2V6FA 3MYRA 4QGFA 1FQJA 1CUEA 3PGMA 4TKMA 1O7JA 2MR5A 3D5EA 5H16A 2RHTA 1SC3A 1SUFA 4X5OA 4QGSA 1WO8A 4JJ8A 3AUSA 3R7AA 1XPJA 5JI2E 3PCXA 2VBCA 3IV6A 4O4LF 4F5YA 1RXWA 3FWZA 5FKJA 2V7GA 3NASA 1I6MA 3O8BA 5E0OA 1OHHD 3TECE 1IUOA 1R0CA 2PVCA 3SC2A 4DSAA 1UBJS 2J31A 2AXPA 2QLJA 4JL5A 2Z4SA 3I01M 1KMIY 4PR3A 3CR8A 3RGWS 1X0VA 2P4HX 1J4AA 1W44A 2BBOA 1KH2A 1FSSA 2W2PA 4MQFB 4PQFA 5IEJA 1GPUA 5A7FA 1Z0IA 2VT7A 1KDVA 3B53X 3I34X 5HK9A 2PGJA 2VBIA 1A98A 3C1UA 2Z8ZA 3HBJA 3IQDB 4CMEA 3S81A 3PLAE 2IEGA 4MO2A 2BLNA 1BDIA 5JDIA 3U3KA 3WGGA 4B7XA 4K9KA 1WCWA 5ECDA 3PNVA 4GXQA 5DLEA 2ETXA 4D4HA 4IX1A 1XI2A 4RYDA 1Q2UA 4EABA 5J40A 4BQPA 5A0FA 4CKEA 3NZEA 3JD3A 3VYUB 2XCUA 2D1QA 3T3NA 4ZHQF 3IVAA 4Y0AA 4BNYA 4E14A 4CUZA 3AFMA 2IEAA 3JALB 5FBLB 1SUEA 4L8VA 4QLOA 2GEBA 1RHRA 1HFWA 4TTPA 4NZYA 4XAQA 5KVSA 3IQEA 3C39A 4N18A 4QJ3A 2H5IA 3C3KA 1QK3A 4MO9A 5HFJA 1V1JA 2Q1SA 1D1TA 1NTOA 2WYOA 1U3CA 1SB8A 3TW8A 4DC0A 4WLUA 5EQTA 3PEVA 1ZD1A 4Y6QA 4BVJA 4CTNA 1FQKA 3GRZA 1CUUA 1RYZA 1S9HA 1YNSA 2GXQA 5BQFA 1HF3A 3FD8A 4G1VA 4KIJA 2PKRA 4IJKA 1YDEA 4Q4AB 4R71A 2W2XA 4PSCA 4UTVA 3B52X 2GB4A 4ABYA 3RM3A 4WQMA 1EK5A 1XCGB 2BGUA 4XUEA 1N3YA 2EV9A 1EG7A 1M66A 1X7WA 3UMSA 4J76A 4K9LA 1Y9AA 2MJLA 4XGQA 4D9EA 1SUIA 5IK2D 1RABA 2VHXA 4NYMQ 3DH0A 1N9GB 4TMTA 4KQKA 2OUKA 4KUEA 4C2TA 4WCFB 2VHUA 2MIIA 4C43A 2ACWA 2MDTA 2WU0A 1S2GA 1YU6A 4GWLA 2IHNA 3WMRA 3BWMA 2O7RA 4MEJA 3WIBA 3VR6H 3GJRA 3Q7QA 4A4DA 2PX0A 1UPCA 4I1PA 1TNDA 4XFJA 3DR3A 3EZXA 2CFSA 1GSIA 3GW8A 5IM4A 4MRNA 1SGWA 1FDUA 1CU1A 4RMJA 3QJYA 1ZUHA 3WRWA 3B6ZA 2ABWA 2VT2A 3E3MA 4HZUB 4DSTA 1N9GA 4F5ZA 4Q37A 1JFFB 2C94A 4MWBA 3LWZA 2J9FA 2RIRA 2C58A 3KSBC 1F48A 3HCNA 1U4NA 1QF6A 2M98A 2J7PD 3LVBA 4LVCA 2ISCA 3FFBA 2Q9CA 2QL5A 2CL7X 4MR8A 4P8RA 2J6BA 4IIVA 2B2NA 1M0EA 2I54A 4F60A 2YUTA 5FBZA 1T43A 2FETA 1GUBA 1Y1QA 5FEMA 4ZYXA 4FYWA 4ZV7A 5GTDA 1GZ7A 1YZ3A 4BNTA 4D97A 3AFIA 3GJ8A 1A2BA 3SLGA 3EZNA 4GFDA 5E3IA 1ADGA 3BZBA 4ANFA 5K8VA 3KCNA 5KYNA 3DP7A 5G0WA 2Q5IA 3O0DA 2JLBA 3DZKA 2GA8A 4GECA 4OTZA 1BO6A 1W8IA 3ENVA 3MJTA 5IVIA 2MSDB 4M2LA 1C14A 1YC2A 4NU0A 3U19A 3STUA 5LQDA 1V8DA 1RJEA 1FP7A 2HBQA 3DT9A 3FUCA 3KFXA 4TS4A 3SVZA 1KWKA 1ZU5A 1D4FA 1OV4A 2G76A 1H2YA 2H7VA 5TX7A 2ECKA 3LP5A 3V5NA 3V4VB 1IJFA 1II8B 2PXAA 4WBNF 2H59A 3RREA 2NQTA 3U7FB 5J63A 4IIGA 1NZDA 3KALA 1ACMA 1EDBA 3M5DA 3LPAA 3FNEA 1TVKA 4YAJA 4AO8A 4YACA 3R74A 5TLSA 1MAVA 3X1JA 2EIXA 4ND1A 2E1PA 2HCJB 2JJMA 3VJMA 1CUFA 1RYMA 2P8JA 3ENWA 3H5IA 3MRXA 3OCZA 4P5EA 3H2BA 2C04A 2SBTA 4RPIA 2B2CA 2I3BA 3A37A 1U2EA 3PHBE 5AYVA 3EW7A 4U9HS 1FS4A 1CEYA 3SE0A 4LI0A 2WD8A 4ZAGA 3IAHA 1Y0BA 5A03A 4P08A 2WSMA 4ZO8A 2B92A 1W1IA 3U9LA 4G9EA 2IHBA 2MYPA 4YV0A 3KYDA 1EEXB 1JQDA 2WU3A 3KZCA 2Q3FA 3BD8A 2F3SA 1RC1A 2QMHA 4V0KA 1EFVB 4FFRA 2JBWA 2ORIA 4OQLA 4V2IA 1TE2A 4QIHA 4I1OA 5E2IA 1GQSA 3OOYA 4BVGA 4BXOB 3FPLA 2EL9A 1L1EA 2ZQYA 3OFJA 3VR4H 3ZHSA 1UDBA 2ON6A 4N03A 4LK3A 3P9YA 1LDMA 2GAAA 1KK2A 4N40A 2HA7A 3H0KA 3MJCA 3F3KA 3W7BA 1SKMA 3AF3A 3WZMA 2Q6OA 1IL0A 1WBJB 2OO7A 5H1YA 3L77A 1B8PA 2DBQA 3LA8A 4L2IA 3H11A 4KXMA 1E98A 2H52A 3I6IA 2WFLA 3ILYA 3LBIA 2QWXA 2C2HA 4X41A 2XOKD 5BN3A 3UT6A 1TYBE 1YJBA 2QUBA 5I9IA 5LBTA 3KJQA 4FHFA 4YPVA 3UA3A 4R8MA 2H4ZA 1IOLA 5F3RA 3QLUC 1NOJA 3L92A 3PC3A 5CXSA 5CNIA 1QH0A 2SICE 2MMGA 2W93A 4FUTA 2I1WA 2GKOA 2ZBQA 1QO0A 2AR0A 2O2IA 1B7GO 4I4CA 3R3XA 4B4DA 1A9XB 2FG7C 3WQRA 3PQEA 2OHFA 4PYRA 4XSHA 4LCJA 1EVKA 3UWKA 1PDVA 2O4CA 4WK6A 3PKJA 3M83A 5BUZA 4UOQA 3GXBA 1C8LA 1NC3A 3H0EA 1RQ2A 1D2NA 3MWEB 3U4CA 1PG5A 1SU4A 4RZSA 2VP6A 2PUAA 1E3LA 4TMKA 1FC0A 3GD5A 2XD9A 3IJEB 5AESA 3QVLA 1E5LA 2GZ3A 1T24A 4LF9B 4ME6A 4U2DA 1SJ9A 5DBFA 3GP8A 1HNZB 4CIVA 5ITZA 2ZJ0A 5C51B 5CNJA 2DUMA 1J8DA 3A1CA 1YMQA 2WD7B 4X62B 4QYWA 3CVJA 1ISMA 2JHGA 2IIVA 1NPTO 3URKA 2OSBA 1R5NA 5LQKA 4R31A 3FCSB 5C8VA 1OV6A 5D3QA 1SU6A 2JA1A 4TT8A 4M9ZA 4G2TA 2O2CA 4MB6A 2ZUUA 3EWAA 1UFVA 2XUKA 4RD4A 1E7MA 3F2VA 5E3HA 3DAHA 4KH1A 1ULTA 4WK0B 1QYIA 1T0PA 4V0ME 5LOVA 2KWIA 2FA9A 3B9RA 5EIAA 1JH8A 2WIJA 4Y6GB 3KJHA 1J0DA 5EXSA 2QUIA 3NKFA 5B1HA 2FMHA 3UMMA 1YQGA 1M2EA 1YQEA 1ZI9A 2QQFA 3IMKA 4OQYA 3FTEA 2PKYX 2A0UA 2LKCA 1OLXB 1RM4A 3CCBA 3IO3A 3KKQA 4QASA 1W2HA 4LXIA 2PRJA 5KVVA 2WVHA 2QRVA 3K0KA 3EWSA 3FETA 4UUMA 5ALGA 2OHHA 3TO5A 4AZTA 2B34A 3SZLA 3EDRA 4L9WA 1SK8A 1XELA 5JARA 5KYXA 3LHFA 1AHPA 2RK4A 1FPQA 4BVAA 1U8YA 1AUXA 3DS8A 1BMFD 2G9UA 2WDZA 4JQZA 4AO7A 1S6YA 2VWHA 4RSHA 5HCNA 3WK9A 2PWPA 4C7KA 2ZSAA 1QSGA 3FYCA 1RFLA 3GJXC 2X1VA 4JI1B 3ZWCA 1UXHA 4B2YA 1SZDA 3HBNA 3PLRA 3DBRA 4OM7A 4RLHA 4RVDA 1BGWA 4P7JA 3S28A 4Q18A 4WL0A 1JLLA 2DY0A 1MB3A 2R97A 2Z1MA 5JPDA 2EOAA 1DB3A 3B6IA 4I4TB 1P44A 1BG6A 3IR6A 4XDHA 5SYAA 5ALQA 3SBXA 2AS0A 3Q2IA 3BXFA 1O8BA 4IEIA 5G1NA 5IC6A 1U28C 3MJFA 1ZCFA 2RHHA 3SC3A 1AOXA 3F98A 1RPJA 4K6FA 5CT5A 1JKXA 1KI6B 1R8QA 5G0SA 3WK5A 2WJHA 1Y7PA 2HCFA 4DG8A 2PRSA 3AXSA 4RM2A 3VPSA 1WPGA 2UU9B 4AMVA 1HKUA 3L4SO 4EUFA 4YNBA 1RI1A 1H9AA 4XVUA 4P4SA 2P6NA 5HJ5A 1QIKA 1TLTA 5ALTA 2QOEA 4D9HA 4EG3A 1RAAA 4PCVA 4RTQA 3T9DA 2AEJA 2Y6VA 5DP1A 1L5YA 5I7VA 1E3EA 2AGVA 1Z63A 1FFCA 3UWMA 1HETA 1WL8A 4N65A 3BSFA 1VE6A 2J9GA 2ACEA 2RH8A 4MRVA 1OB2A 2OT3B 2QTRA 1AGNA 4IILA 1HDCA 3E84A 1IATA 2A7QA 2GXSA 2IUTA 2OLJA 3EZFA 3I2JA 1WUKS 4MXDA 2JCSA 3E9QA 2PKCA 2BMJA 1IHDA 3LH5A 4YPOA 2BEVA 3C5CA 3HKEA 3PUYA 3RROA 4PLCA 4MAAA 3K8ZA 3PENA 1DJOA 3T7RA 4RD1A 5BWBA 2HXYA 3VU0A 1ZXXA 2PA3A 1N5IA 1MCZA 2DQ4A 2VXYA 1LPMA 4YCBA 2B99A 3HH8A 4M1OA 4IQFA 2E9SA 4UHEA 5BOSB 1NVGA 2AIRA 2F3RA 2VSXA 1V16A 2E6UX 2H7CA 3R0JA 4IH9A 4X85A 5DBEX 1U0NA 4HLNA 3WWEA 2QX4A 1G3RA 1IG3A 2YWFA 2H65A 3IILA 4FZRA 1BQ3A 1HDIA 3JQAD 3EY4A 1ML4A 3GA7A 4DR7B 2IEDA 1DE0A 1ZR2A 2H5JA 4KIWA 1MU0A 3AK4A 3L6BA 1VJ0A 3AFGA 4O8ZA 2MT9A 2NTNA 4P36A 4Z4FA 4TKVB 5KAPA 3DEIA 1WBBA 1T4CA 2IZ7A 3JR7A 1MHTA 4F38A 4RH0A 2NZYA 3GJ0A 4BB9A 3HB4X 1HNXB 2QVYX 5BPHA 1XMSA 3NEPX 3UZUA 1XVTA 7ADHA 3WSWA 5NLLA 2AFHB 3T7AA 5HR5A 5EJEA 2FQXA 4BRSA 5J4LA 4KOEC 5DNEA 2IEZA 5AMXA 2AJCA 4Q3LA 4KQJA 4O2LA 5HUHA 4UOEA 3UB4A 4MJ7A 2FUG6 3NJ4A 4FCWA 1AG9A 4NMLA 4PG7A 5FWXB 4NEQA 4BRWA 5THKA 1RHJA 2O8EA 3PFIA 4Y6OA 3TUIC 3WICA 3L41A 2WRZA 4K9OA 3DMDA 4K9NA 1NP3A 1M34B 5BN5A 4N3GA 4YRJA 1YO6A 4EW6A 4PIMA 3ZTYA 4YP0A 4KRXA 3B2NA 3WA7A 2OESA 4JOSA 4ZVRA 5KYTA 1G1MA 2CXHA 4GSLA 2XSZD 2UZAA 1K7EB 1T91A 1JG7A 3LUCA 4NG5A 4BBAA 1FP6A 1H2XA 2PM8A 3FGPA 4LNUB 1B43A 2Y3IA 5AUQA 1P0CA 1V1RB 3TR0A 3GMSA 3A2MA 3RVQA 4RELA 2WAYA 3EODA 4IJ5A 5DM2A 3I23A 3RHZA 4BNIA 2O8BB 5H3LA 5LQJA 2FN7A 2VUTA 3NTQA 4U9IS 4ED9A 3AHEA 3DDNA 5T57A 1LI5A 4YQYA 4A23A 4M0PA 5C7LO 1J25A 5HTKA 4ZOLB 3DB1A 2QW1A 4AZWA 1NNI1 2EG5A 3CF0A 3KAJA 4HDOB 4R8VA 2OFFA 4Z0HO 3GH3A 1R12A 2VP9A 4X3PA 4OHKA 5JYEA 3F8TA 3N2KB 3NHZA 2C3OA 2K7FA 1E4EA 1K6MA 1YCDA 1D4ZA 3MWFA 4FZJA 4QBGB 5HGJA 3KVYA 3ZHZA 1FSFA 1HM5A 2PX2A 3MYYA 6Q21A 3PF8A 2I2FA 4HDSA 1X2EA 2HBYA 2EEZA 2PNFA 5C8YA 1YKGA 4I9NA 4RCYA 3T35A 4MUYA 1RI2A 4EEXA 1Z07A 2OZKA 1DOAA 1PR5A 2F90A 1L4UA 1UMCB 1A5SB 3A27A 4ASUD 2VDWA 2R1UA 3AEKA 3LXUX 3R3HA 3PI7A 4RY0A 1TB4A 4IMPA 2GM4A 3GLHE 3BFJA 5BXQC 1YOBA 1GV0A 3BA6A 4QWMA 1CY0A 3SR3A 1RBMA 1XQVA 2R1TA 4AJKA 1TM7E 1JPUA 3MAAC 4EUEA 1NXPA 3KJZA 4G4IA 2J46A 1NVVQ 3TBKA 1BMFA 1LA2A 3TSZA 2UXDB 1LC3A 2HA0A 4ZODA 4FLMA 4EYGA 5HCIA 1KBOA 2OCKA 3ZE6A 2WV7A 3D0RA 3B1KA 4ZU1X 5AKLA 3P19A 1GU1A 1KFBB 1U11A 2HTFA 5JYDA 5KNDD 4NH0A 3W5CA 3X1KA 4KVFA 1N5KA 4E1VA 1G8KA 2K6GA 3G8DA 3ER9A 2H0RA 4FP9A 3ROKA 4CKBA 4TTRA 4ZVLA 1XDDA 3L8FA 3FVQA 4OJQA 4OYHA 3TKLA 4BGIA 5C1PA 2AC4A 1HFEL 4LOAA 3ILSA 1LTQA 3CM0A 2JFQA 3PV0A 2VTVA 2OXTA 3TMAA 1ISIA 2ZWIA 3HO8A 3LECA 5B1IA 1AMOA 2WTXA 1AKVA 3OEWA 2FEMA 1V43A 2FCRA 3RUCA 1YUNA 3GMDA 1XXLA 3Q7IA 3QHQA 2C96A 3K9HA 1M76A 2P91A 3H99A 1WSBA 4M1TA 4V2UA 5KX5F 4HLCA 1LC0A 2WHPA 5AKEA 1T26A 3PE6A 1TC1A