3KQPA

Crystal structure of hpnmt in complex adohcy and 6-aminoquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqpA00
2PX5A 1VP9A 3B89A 2IDJA 3BUSA 1FPQA 4Y2HA 4M37A 3HCBA 4FZVA 1V39A 2CKDA 2ZWVA 2NXNA 4L7VA 3G2QA 3CVOA 2OXTA 2IIPA 4GEKA 3R0QA 2QE6A 2NNWB 3GO4A 5JR3A 4PGHA 4R6XA 3SR4A 4AUKA 3HA7A 3EGIA 3MQ2A 2OBFA 3G2PA 4PYIA 4YUVA 2IFTA 1WG8A 2G8NA 2ZIGA 3TFWA 4BLVA 4BP1A 5JUWA 3GNLA 5E1OA 3RW9A 4GOND 5E9QA 4RTJA 5CD1A 3M6VA 5LQCA 2HV9A 4DKJA 1QYRA 3ORHA 5LQUA 5F2NA 2PBFA 3HCFA 3FTFA 2OPBA 1RJEA 2H11A 1I1NA 1JTFA 5CCXA 3KQOA 2AOUA 2QM3A 3QOWA 2VDUE 3R24A 4AZTA 3Q7EA 5HOQA 4B17A 1VQ1A 4KDRA 1R8YA 4QTUB 5EGSA 5BXYA 3HCEA 5EMJA 2GH1A 3AJDA 5FA5A 1N7JA 2G70A 2ONZA 1AF7A 3UJAA 2YVLA 1WZNA 4FGZA 4PONA 2PT6A 3UBTA 2KW5A 1JG1A 1FP1D 2AVNA 5C1IA 3EVEA 1KYZA 3LHDA 3LDFA 3BWMA 5M5BA 3T7SA 2I62A 3GJYA 2NP7A 1YFJA 3I53A 4Z2YA 1N7IA 4QPNA 5FA8A 1DL5A 2NXCA 3FTDA 5EIFA 5E8JA 2OY0A 2HWKA 4M7RA 3TLJA 1D2CA 1WXWA 2EJTA 4KWCA 3R9XB 5FULA 3SVZA 3P8ZA 2JH8A 5GP1A 2C7PA 1TPYA 1Q0SA 2CL5A 3I5UA 4GUAA 2AOUB 4AZVA 4EVIA 4C06A 1KPGA 2HMYB 2P3LA 4YV1A 10MHA 3M6WA 4WXHA 5EMLA 1XDZA 5LQNA 4RTKA 3BGDA 2UZ4A 3MCTA 5FHQA 4ER0A 3LSTA 3SXJA 4CKEA 5FQNA 5ICGA 5C9ZA 3LECA 3L8DA 1KHHA 1N2XA 2P8JA 4YUXA 2DPMA 3ER8A 3B3JA 3EGVA 2JH9A 1SQFA 1TW3A 2BR5A 3BWBA 3GXOA 1RI3A 1T43A 2O05A 5GM1A 5P8WA 4HSGA 4PCLA 2XVAA 3TMAA 5CVDA 3ELYA 2NXEA 3NVKI 2IP2A 3FTCA 3HP7A 2YTZA 3LDUA 2XYVA 4YMHA 5K03A 3ER9A 2PX4A 1EJ6A 3PX3A 3D2LA 3UZUA 4DM3A 1YB2A 1P1CA 2UYOA 1R6AA 4LG1A 5DTQA 3O7WA 5EG5A 3UWPA 3E05A 2JHPA 4KVZA 1SUIA 5HZMA 2Z6QA 2Y1XA 4DA4A 1KXZA 3P71T 3C6MA 3G2MA 2E5WA 2PT9A 5HIJA 1X19A 1XXLA 3KPYA 5CVEA 1EQAA 3PFGA 2FPOA 3GIWA 5BP7A 2FRXA 1RJDA 3C0KA 3IEIA 9MHTA 4X61A 3O4FA 1INLA 5CUQA 4RWZA 1O9GA 5FCDA 3HA5A 1G60A 5CCBA 4X63A 3G2OA 4E2ZA 2XYQA 4QDKA 1ORHA 2ZBQA 3DULA 3F4KA 5H02A 3DTNA 5LQJA 4E2YA 3R6TA 4G56A 3UA3A 5KS2A 4YMGA 1L3CA 2P3OA 5EMKA 5DM2A 3PX2A 1YF3A 4U7PB 1R18A 3IV6A 2G1PA 1XDSA 2ZBRA 4HG2A 1G55A 3H2BA 3OZTA 2EJUA 1XDUA 4HTFA 4PINA 1VE3A 4P58A 1G8SA 1WY7A 1I9GA 4RYLA 2XBMA 1OR8A 4KDCA 4DCMA 1F38A 3A4TA 3B3FA 4E2XA 4LWPA 2BR4A 1QAMA 5BW5A 5LQAA 2H1RA 2OYRA 3OPNA 3G5LA 5EZSA 2IH2A 3OCJA 1P1BA 2IBTA 1NBIA 2FYTA 2ZWAA 3EVCA 1SQGA 2A14A 3P2IA 5E2AA 3GRRA 4E2WA 1P91A 4F85A 5DX0A 5ICEA 2WK1A 1R8XA 2VP3A 2GA9A 5GM2A 2GB4A 3M6XA 3OFJA 1X1BA 1NBHA 5E9WA 4PYNA 4CTKA 4YUWA 3DP7A 1JQ3A 1WXXA 2PVCA 5FADA 1JQDA 3E23A 4GC5A 4HGZA 2I6GA 5EMMA 3A25A 5DRTA 4QQNA 1UFKA 3FPFA 2VDVE 3PB3A 2VDWA 1QZZA 3KQSA 3UJCA 4P7FA 3PVCA 2XYRA 4GF5A 1EJ0A 5CVUA 4AZSA 5GINE 4HGYA 4XUEA 3LDGA 5DPMA 4RSRA 5D1HA 3FUTA 3B5IA 4PYKA 1RI4A 3DUWA 3KPWA 3LCVB 3DXZA 2O07A 1JQEA 5FUBA 3BWCA 1M6YA 3GRZA 2ZLBA 3THRA 3FYDA 3MTIA 5IKMA 2AZTA 5FWAA 4R05A 3BT7A 4LECA 5DRYA 3BXOA 3FRIA 1AQIA 2FK7A 2V7EA 3FTEA 2C7QA 3LPMA 5HEKA 4UOEA 3FZGA 4MQ4A 1Q0TA 1B42A 5E2BA 5GWXA 2Z6UA 4ER5A 4MIKA 1NE2A 2NXJA 3PLAE 2VZ9A 4X41A 2PX8A 3SSNA 5K09A 4FSXA 2FCAA 3KHKA 1JSXA 5EEGA 1O54A 3K6RA 2JJQA 1MJFA 5DX8A 1NW5A 1YZHA 5DM4A 3TM4A 5KYGA 2IGTA 5MHTA 2AR0A 5HILA 4E31A 3LBFA 3KPUA 1JTEA 4WVLA 5DTMA 2PXAA 3TRKA 5KQSA 4C4AA 2B9EA 3SSMA 3ANXA 2P3QA 1FP2A 4RVGA 2ZBPA 2ZFUA 3GRVA 5CVVA 1Z3CA 4YV0A 3THSA 4RTMA 2WA2A 3DR5A 1MHTA 2VS1A 4GC9A 1XCJA 4OQDA 2CMHA 3CJTA 4CKBA 2UYHA 3KPVA 5C0OE 2Q41A 2FK8A 1VBFA 2R6ZA 1YUBA 4O29A 3FUWA 5EHIA 4FT2A 3HVKA 2EX4A 5EHGA 3NWBA 2HNKA 1WS6A 4LWOA 4GQBA 2C7RA 4PCAA 3FPEA 3PS9A 1NV8A 4V0QA 3E7PA 3ELWA 4JXJA 5G02A 1IXKA 1P39A 2BZGA 3NWEA 3P9KA 3PTAA 3P2EA 5T6BA 3OFKA 4POOA 2G72A 3VYWA 1HNNA 5DX1A 1H1DA 2P7HA 3SM3A 3KQYA 3LCCA 1VP3A 3T0IA 1FBNA 3HM2A 5ERGB 1F3LA 1Y8CA 2Y1WA 4CWAA 1AV6A 3ELUA 3OZRA 5K01A 1JG2A 5ICCA 3BKXA 3KPJA 3O31A 5D1NA 5DLYA 4EKGA 3DH0A 2ZZMA 3REOA 1JG4A 4HC4A 3M6UA 1L3IA 3QV2A 3MAGA 4QVKA 2PJDA 3HVHA 3M70A 5K8VA 3KR0A 3DMHA 4X1OA 5K0EA 5FHRA 5LQRA 3EPPA 3EMDA 1L3BA 3LBYA 4P7JA 5DT2A 3UA4A 5LR6A 2BH2A 2NYUA 3I9FA 1JR4A 1RI1A 2DULA 5FWDA 3VC1A 1O9HA 3M33A 4OA8A 2PSSA 1DCTA 3AWIA 2QRVA 1VIDA 1NW3A 4DMGA 2YXLA 7MHTA 2AOWA 4C04A 5K05A 3A7EA 1FJXA 3GGDA 2OB1A 5F2KA 3R3HA 3JWJA 5CM2Z 3UJ6A 1QANA 1RJFA 4X60A 3V8VA 4EQZA 2PWYA 5EVJA 2YUIA 1YFLA 3G8AA 2HTEA 2PX2A 4FP9A 3TOSA 3CJQA 3P9CA 2R3SA 1XCLA 4QPPA 1U2ZA 2YXEA 4BP3A 2ZZNA 4FR0A 4C03A 5K0CA 1EIZA 4CXMA 4PGGA 2AOTB 3PFHA 4DQ0A 4M36A 1D2HA 4QQKA 2K4MA 3P9IA 4PWYA 5ICFA 1UWVA 1NV9A 2YX1A 3TKAA 4C05A 4E32A 4PIPA 1RJGA 3OE5A 4RTNA 2ESRA 3HTXA 5LSAA 4PYMA 1UIRA 2P40A 2BR3A 4P7GA 3EVBA 2ZZKA 3EVGA 3DLCA 3OZSA 5EIWA 3HCDA 3TR6A 5EKUA 5FQOA 4YUYA 1G8AA 3ME5A 4KRGA 2AN5A 2AOVA 4OA5A 3MTEA 3GU3A 2AS0A 4PYQA 5DM0A 5HIMA 4XUDA 3SSOA 5LQKA 4EKIA 3TM5A 2PKWA 3G88A 4EK9A 4HTFB 1G38A 3BGVA 3IHTA 2XVMA 2PXCA 3HA3A 3KR1A 3LCUA 3BWYA 2B3TA 3LKZA 2ADMA 4K6MA 4BY9E 2AOTA 1ZQ9A 2QY6A 3FPHA 2IDKA 3JWIA 3NJRA 4H0NA 5HIIA 4RVHA 4RTQA 2OZVA 4AX8A 3FUXA 3MHTA 3NVMB 2P35A 3V97A 5DXAA 3LX6A 5F2OA 4ER7A 3A27A 4PYOA 1KR5A 3HEMA 4YUZA 1SKMA 5DSXA 3HCAA 2UYQA 4E70A 2AVDA 3LL7A 4RX1A 1HMYA 4IV8A 5EOVA 3EVFA 5GOZA 5K0FA 3AY0A 1XJ5A 3CBGA 3DMGA 5DWQA 1M0EA 2P7IA 3T7TA 1IM8A 3KQWA 4OX9Y 3SX0A 1X1DA 2UYCA 1R00A 1I4WA 3DXXA 4ZTBA 4E33A 5CIYA 3ELDA 3TPZA 1KPHA 2CWWA 1EAMA 2OB2A 1YZ3A 3EGEA 3HVIA 2YR0A 3ERCA 2IBSA 3KQTA 4IV0A 3WSTA 4ATNA 4GOOD 3CKKA 1ZKDA 2GS9A 4MHTA 3EVAA 1R74A 2B2CA 2ERCA 3GCZA 3KR9A 1DUSA 1BHJA 2GPYA 2P41A 1KIAA 1KPIA 3FUUA 3KU1A 3EVZA 4ISCA 5EQJB 3B7PA 3P2KA 3MCZA 3TKYA 3U81A 4PNEA 3GRUA 5K0JA 1NW6A 2CMGA 3G89A 2GLUA 3ID6C 3BGIA 2PWPA 1VLMA 4GBED 4RTOA 1ZHFA 1ZG3A 2YXDA 3MGGA 5HFJA 3C6KA 4MTLA 5EPEA 2ZIEA 3JWGA 2PGXA 2P1DA 5E1DA 2O0LA 5DSTA 4DZRA 1NKVA 4EMSA 1ZGJA 2IPXA 3GWZA 3I64A 8MHTA 3C3YA 4BLWA 4RV9A 1RI5A 3IYLW 3E8SA 1ZGAA 2ZIFA 3KQQA 3UJBA 3M4XA 4RTLA 3BKWA 1D2GA 2PLWA 4NECA 1X1AA 3FYCA 3OU6A 2IH4A 3UJDA 4RTRA 4Y30A 3VC2A 3VSEA 1NW8A 3RODA 2O06A 4M38A 2I9KA 3KQPA 3MB5A 5EC8A 1KYWA 4V0RA 2V74B 3C3PA 3PT9A 2ZW9A 3A7DA 2OKCA 3GRYA 3OU7A 2JHCA 4A6DA 3K0BA 4GOMD 4RVDA 4R8RA 2ONYA 5DTRA 1IY9A 5EEHA 3RIEA 4F84A 3A26A 4ER6A 4OBXA 4AZWA 4QVGA 1EG2A 1L9KA 2EFJA 2GAFA 3EMBA 4DF3A 2PY6A 2C7OA 3G5TA 3HCCA 2AN4A 3FRHA 3HNRA 3CCFA 4PYLA 1SUSA 5E8RA 2N47A 4XUCA 5K0BA 3P97A 3T7RA 2B25A 3FPJA 3QOXA 5BW4A 5KVAA 1X1CA 1BC5A 2ZVJA 1SVUA 2QYOA 5KQRA 3KQVA 3SMQA 2Z6AA 4IKPA 5IH3A 1XTPA 1RI2A 2O57A 2ORED 5DM1A 3X0DA 4E30A 1QAQA 4R6WA 1G6Q1 3FUVA 4F86A 3DMFA 2G71A 2ZTHA 1PJZA 1VPTA 5GIOE 1JSZA 3KR2A 3SGLA 5K0GA 3G8BA 4GOLD 5K0LA 2IH5A 1M6EX 3MERA 4KIFA 2HR1A 4RVFA 2FHPA 4QTTB 3P9NA 3OE4A 4C08A 3UJ8A 5GIPE 1BOOA 2AOXA 3NDJA 3NDIA 3NTVA 4IWNA 2ZCJA 3DOUA 3CGGA 3EVDA 3UJ9A 3KQMA 2PXXA 5B1SA 4RTSA 1L1EA 3JWHA 4OQEA 1ORIA 4BLUA 4P7KA 3AXTA 4ER3A 1XVAA 3KKZA 3CC8A 3UJ7A 3G7UA 4C07A 3CJRA 1VL5A 2BM9A 2H00A 1JG3A 1TW2A 2QRVB 3GDHA 2LD4A 4YV2A 1NW7A 2JHAA 3LKDA 2EG5A 1QAOA 4MWZA 1AQJA 4FT4A 5EZQA 3HVJA 4HRAA 2B78A 3TQSA 4CTJA 4OBWA 5E9JA 4QDJA 4RTPA 1KP9A 2AN3A 2PV0A 2WA1A 4DCGA 4PYJA 2OO3A 2JG3A 4KIGA 3LGAA 2F8LA 3AXSA 3EEYA 3DXYA 1PRYA 3FPGA 5CVJA 4FSDA 5E1MA 3EEOA 5FTWA 2ZSUA 5U4XA 1SG9A 3BZBA 4XCXA 2BM8A 4FS8A 2ZULA 3S68A 4A6EA 3DLIA 3Q87B 4KW7A 1BKYA 4CKCA 4HH4A 2YQZA 5EKXA 3I58A 5K0NA 2I7CA 3OU2A 4R8SA 5E1BA 3UFBA 5T64A 5T67A 3NW9A 4U7TB 5HIKA 3NMUF 3B3GA 1NT2A 4PIMA 5DXJA 2NP6A
chains in the Genus database with same CATH superfamily
3O4JA 4E88A 1GGVA 3VVLA 2ATCA 3SR0A 4DNXA 1XKTA 4M37A 4QUJA 1R0KA 4QJ4A 4RMGA 3IQIX 4RV4A 3UXYA 1NW9B 2BTQA 2IIPA 4XYGA 4F5EA 5KVCA 2R6R1 1MX5A 1Q1EA 4ZV7A 4ZI5A 4AJOA 3WNQA 2C9DA 2GPBA 1H66A 4PHTA 2BVNA 2PBZA 1K7YA 2XXAA 1Y4AE 1S89A 3SSAA 1AS3A 2HLDA 3R5KA 3CVXA 4ZREA 3CG4A 5D6NA 4OFWA 4F6RB 4Q93A 1QWSA 2RGBA 5LVAA 2ONKA 2Q5OA 3RVOA 4CHTA 1RQLA 1PV1A 4PN3A 2ZYVX 2HSWA 1HH4A 3LQ1A 2NYRA 2OGSA 1F4VA 1DO2A 2Y2VA 2ZS7A 2BUAA 3HV2A 5IKXA 3PNSA 2YHIA 3ETJA 3D7KA 4UDNA 1UDXA 4Z1OA 5FJIA 5JRJA 3NHMA 1EMDA 1VQ1A 1D1QA 1JXQA 2RBGA 4JEHA 5KNCD 1U2SA 3OFNA 2NUAB 1H3EA 2OZEA 2KS6A 2B82A 1Y1KE 3HC7A 3LUFA 1S6YA 4JUCA 2HW8A 2OR3A 2RHWA 3LCJA 1NRJB 3B1FA 5JXHA 4JT4A 1RHRA 5AVUA 3I53A 3CZPA 1I0ZA 1N7IA 1NONA 3AZPA 2BRUC 3L92A 4YB8A 1CIJA 5JPIA 1D2CA 2MJLA 4YPOA 1YFZA 2CBZA 3K70D 1GEEA 8OHMA 3R9XB 2BGMA 4TUYA 3QBDA 4ZT7A 3ZTYA 4BNZA 1MQ9A 4GZMA 4JSYA 4PF1A 3M3HA 5FRDA 2PUJA 1L5NA 4D74A 1BN6A 4IIUA 5JC1A 3SZOA 3MM4A 2CNBA 2ZYRA 3IAS1 4FYHA 5CH5A 3ZVLA 2CC2A 4CM4A 4AJEA 3LSTA 1V5GA 4E6PA 5JIBA 5HGXA 5EKDA 3A31A 4DLZA 2FZEA 1E6CA 3L7NA 1KORA 3PFWO 3JQRA 1N2XA 4ZQGA 4LF6B 4H7PA 1SVSA 3I6IA 3I37X 4KR7A 4RH1A 4G0NA 4B3DA 4TWIA 3V4SA 1GTJ1 4Q1AA 2O05A 3GJ8A 4LPSA 3WL3A 1SA0A 3LT4A 3WYEA 4KHPB 5CVDA 1WX1A 1PSZA 5CK5A 3U4QB 3ZGXA 1E79D 4EG1A 8AT1A 2Q21A 2VAPA 3GJXC 4EELA 4KODA 1DSSG 1GQQA 1WMSA 2VNIA 1TPZA 2VNJA 3TAHA 5C8YB 5KNCH 5IF3A 4V2IA 1X8JA 4DV3B 3AFNA 4IEEA 4MGZR 3ASUA 4UD6A 3H1TA 3QE0A 2NYVA 4G0OA 3LY8A 4I1PA 2PT9A 1XWWA 3AEUA 3QP9A 4XW2A 4MI1A 5THKA 4DWJA 3QX7A 1SJ9A 2CDCA 1JI0A 2VH5R 3QXXA 1PJ4A 4UHBA 1IYZA 4R54A 4LHZA 1TLFA 3C8HA 1GPKA 5HK9A 9MHTA 3W5BA 4A8HA 1FSGA 4JJFA 3HFSA 3HU3A 1G60A 5CCBA 4ZWNA 4NZNA 2INGX 1Q17A 1EXWA 1SQ5A 2V1XA 4FSHA 4Y6LA 3VPDA 3ILSA 4CKCB 3ECAA 1CUXA 2GZMA 1ZGGA 1I2DA 3IQHX 5CH3A 3A0UA 4HYQA 1B41A 4FLMA 3H2ZA 3G0GA 1NATA 1L7PA 2C4KA 2DPXA 1CUDA 1OR8A 1QZUA 1QIEA 2ZYDA 1IB0A 1PS8A 2BR4A 2HA0A 1E6LA 3PSHA 1EA5A 4QU0A 5K3CA 3W8DA 3AFMA 1E3TA 3HGQA 1CDEA 3G5LA 2W5UA 2DHQA 2V4ZA 4AYWA 4EYGA 3ZJTA 4AKTA 3I2KA 1XYYA 2Z58A 1CEEA 1Z6XA 2L19A 4E2WA 5I9BA 2HJRA 2P9EA 2V0NA 5ICEA 1AKVA 4R1LA 3UHFA 1K0UA 1X1EA 5AOAA 1LNSA 4G0PA 4B79A 5I7VA 3D5QA 1RZUA 3ORQA 2QG9A 4DDVA 1Y8ZA 1Y37A 2I8CA 5BNFA 2V7XA 4JB3A 3JCZA 4IO1A 3TZEA 1Z26A 4JVMA 2XGJA 2GZ2A 2QGZA 1MTOA 2DR0A 2E6UX 4KRXA 4X1YB 1SD5A 5C31A 2P9TA 3AKYA 3UUWA 3OESA 4CL3A 4EI8A 4Q7QA 1RXWA 5JNWA 3PVCA 4TLAA 2FWRA 2OYCA 1A9ZA 1PZFA 3BX1A 1M33A 1LCIA 4AZSA 1QZTA 1G8PA 1SVNA 4WVFA 2BKXA 3WADA 1VM6A 3U3KA 2GQ0A 1Z4OA 1COWD 1NYLA 1W5SA 3KWLA 3EY4A 4Q3BA 4LE0A 4NEQA 5EJAA 5G2OA 2D1TA 2VZ0A 1ENPA 4DL9A 4PLPA 2IELA 4FLEA 1KWKA 3BWCA 1FMJA 1GPBA 4EMTA 1LLQA 5ALHA 1US8A 3KIPA 2X5OA 4BPRA 2EQ5A 2Q5EA 5DRYA 2Y27A 2IZ1A 2O6LA 1B2LA 3FPCA 3NWPA 2C7QA 1ZM9A 2B1JA 1N6IA 4LHSA 3AHHA 2ANCA 3JVVA 4IH1A 3NM4A 1O87A 3VI3B 5FOVA 3WGVA 1P4SA 2XB8A 2HMTA 4UFOA 2DY1A 2QNRA 3H9JA 5GONB 1XNQB 3O21A 1EUYA 1UZMA 4MGHA 1Q0HA 2JD1A 4JNKA 5K8IA 1V8DA 4M6WB 4CV1A 4CYMA 3QE9Y 3ONFA 1XAIA 1YQTA 3LI2A 3OQJA 5SYAA 4D3SA 4XTRA 5DVZA 1O3YA 2X2OA 4ZALA 3LM8A 4Q19A 3L4KA 2AR0A 2XGMA 3GARA 2ZRKA 4JP5A 4YACA 2GVNA 2ZTUA 1DX6A 1YQDA 4TS3A 1V1RA 4C4AA 3NYIA 1C9YA 1EWYA 2ZSFA 5CYPA 3MVEA 1CZNA 4NMWA 1QS0B 3V55A 5K0CA 1YJAA 3OZEA 2X0EA 1NQTA 1KMQA 1SOVA 2A1UB 1WNFA 2XNKA 4NFHA 4ABYA 2QD3A 4ETIA 5LJLA 1YOVA 2OT3B 4GYWA 3BM5A 4FGUA 4MR8B 4B31A 4DVGA 4OXRA 5CYGA 2YS7A 1W73A 5JD3A 3QKRB 1JAIA 5BV7A 2JLSA 1G5HA 3K0HA 3Q1KA 1WQ3A 1EYZA 4JR1A 1G4UR 3DOJA 1ZNXA 1JLMA 4UCXA 4CDNA 3HKCA 3C1OA 3DBLA 3IIIA 2XJ9A 3O4RA 4V0QA 3TQQA 2CXOA 3KB2A 3O8OB 3D4LA 2HWXA 4XARA 3EEFA 4AMVA 4OTZA 3NVDA 2F6RA 2WOJA 4N5LA 5AI6A 2DWQA 3GUUA 3PI7A 4JOCA 1SEPA 1BXKA 1UMCA 2F1KA 3CWQA 3JATA 3KZMA 4G86A 1YE5A 1Z6AA 3TTUA 2NAFA 2WC1A 1RLTA 1NJ6A 2WD8A 3DE5X 4PZ9A 4Z9FA 4N6NA 2CLOB 2QGFA 3LQ2A 5CG1A 2BRUA 1RKVA 3OZRA 1PFYA 2WY2D 2YV5A 3W2FA 2NVBA 2DTEA 4II2A 2OP1A 3BYZA 4IMIB 1I14A 2QI9C 2ZZMA 3RF7A 3AVWA 1ZDMA 4D79A 1L3IA 3O6VA 3QV2A 2FH5B 4PU0A 1B93A 2LW7A 5KYYA 3H3XA 3ZE8A 4BYMA 5U1PA 5J2UB 1APBA 1MORA 1PG5A 1WUTA 4P7JA 2Q4TA 3KOOA 4I4NA 4PG5A 2G0NA 3WA7A 4UEOA 3AV0B 3EG9A 2B69A 2J9YB 5F78A 2QS9A 5BN4B 2XD9A 1AQUA 4GBMA 4K9QA 1Q6YA 2Y9PB 4QGFA 4TLLB 4YCDA 4O4IF 3WGNA 3QFCA 4HJRA 4E51A 5DZSA 1VG1A 3EXEA 2B92A 3PC8C 2V7WA 1SCBA 1M2NA 2JVJA 5BT9A 4EB0A 2O7VA 3TIFA 3R8CA 3MK31 4DM7A 2D7JA 4WY5A 4F3NA 4WECA 4CDRA 4TQAA 3TOSA 4WW0A 3CJQA 2R3SA 3AKCA 4Q66C 3W34A 2R7NA 2C95A 4BV8A 4LMPA 2H2DA 4MYUA 1CQWA 4X1YA 1WB9A 5TQ2B 4FFNA 4ZQIA 4ZVLA 2QXTA 5ICFA 2OV8A 1CUVA 4YRBA 2VN8A 4MUYA 4F1WA 4P7GA 4E5NA 4DDUA 1W0CA 1HDGO 1P1KA 2A1IA 1OBFO 3EVGA 4MDYA 4OAQA 1F14A 3GJRA 5KAPA 3S1AA 3F4LA 3FYSA 1ULUA 1Z7YA 1E63A 1G8AA 2D5LA 3GT0A 3O7MA 4AY6A 4L6CA 1MRZA 4A6PA 1GPDG 3GPBA 4BN5A 3KOXA 3VPHA 4YXWA 3DMDA 4HTFB 2HGZA 3ZCTA 5C51B 4LV8B 2F9LA 2ZRDA 3W2GA 1LXCA 1OV6A 2GD6A 3MN1A 3PXCX 4X84A 5JSUA 2Y1DA 3U4HA 5FUWA 3IQGX 5GVSA 1LBIA 4IL5A 5JSHA 5I9TA 2E89A 1T1EA 1T6ZA 5NLLA 2FR0A 3UMCA 3BMOA 4UTXA 3ZU6A 3OBIA 1C2TA 3UH1A 1SRQA 2BSAA 2D1YA 3NHLA 1KK2A 1L4HA 1UDWA 1E2MA 2CCKA 3G9TA 2JFBA 1JXAA 4KKXB 4P3YA 4EFMA 1L1FA 5J4VA 1XJ5A 4BLPA 1QC5B 1WA5A 4R2XA 4RK7A 3ZJ4A 3VSDA 2I1WA 5HPYB 4HQNA 3T3NA 5FBLB 3W77A 4WEOA 3Q7RA 3CPHA 4UEJA 1ST3A 1Z2EA 2MOKA 3C3DA 3I04A 2EAUA 4MVJF 1L7QA 2HGSA 2F48A 4WADA 3R9IA 2YZNA 1TRKA 1NYRA 1ZNWA 2GN9A 3H8VA 1BWRA 1KEZA 2JVIA 421PA 4D8YA 4OIMA 5H59A 5C8ZA 4N41A 3LX5A 4JUAA 4D9NA 3VDMA 3N8NA 4TUYB 5BVGB 2C9BA 4JLKA 1HQDA 3KUUA 1BHJA 1IY0A 4HGQA 5CDHA 4KEAA 2I4IA 4XVRA 3UN1A 3O3CA 5TMPA 3BGIA 5CDFE 1LKZA 3OG9A 3DKRA 3IUMA 1THTA 4C30A 1XQ6A 5BV2P 1C3OB 5JS8A 1HQYE 3NANA 4RA6B 2VT2A 3ZD6A 5DBFA 3AFIA 3HL4A 2GEDA 2O0LA 1T9ZA 2A35A 5E3IA 1Z5ZA 2PDAA 4BLWA 1KVUA 1Z06A 3IYLW 4HNRA 5BSRA 4KNVA 4TV8A 1JIQA 1SO8A 2FQ1A 2KLBA 1HE8B 4M83A 4ND8A 3K4PA 1O6FA 2WMOB 4YP9A 1GOTA 3F0TA 4UAJA 4G1BA 2VTBB 1MAAA 1JXMA 5AKEA 4Q02A 1M0EA 2VF4X 3DNPA 3KQPA 2M1ZA 3NHWA 2OSVA 4J4BA 1AKNA 1KYWA 2XAUA 4MHSA 1RP7A 3VR6D 1EUDB 3ENNA 3OSZA 1QHXA 3U1BA 1U6KA 2ZJOA 5DH9A 4A6DA 4IQ8A 1FE8A 5JU6A 1YUMA 4I1IA 1Z16A 2QX9A 3WRXA 2YC4C 3F4BA 2YFYA 1AX9A 3ENKA 4C3UA 4LJAA 3HCCA 4TM7A 5FUXA 1KKLA 1P29A 1DMRA 2XNHA 2BFPA 4FQ7A 2N47A 2P9JA 4UZSA 4ZO8A 2K7ZA 3K53A 4EVQA 2IYZA 7YASA 5BW4A 1Q2UA 1Z9BA 4ZOLF 4U2EA 5B3KA 4ESVA 1H1TA 4BNFA 3PDCA 1R8SA 4C7JA 1GR0A 4JYZA 2RJNA 3JRWA 4BGIA 4X3PA 5AJZA 3SICE 3I2HA 5IH3A 1TQDA 3V8BA 2ORED 4W5RA 2O1EA 5PGMA 4AXBA 4ACAA 2FNAA 3KVNA 3N2GA 4EATA 1W2GA 1U3FA 3EE6A 4FC6A 1PJZA 4WA7A 5HMMA 2YWXA 1UFVA 1PQ4A 1Z17A 1JGTA 2DU8A 2HQBA 2QT9A 3VO1A 3FOFC 2PZMA 1Z37A 4Z49A 2R85A 4O1IA 2AD5A 2ZJYA 1KO4A 1OWNA 5GZ6A 3EXFB 2QVBA 2IXAA 4HNGA 2HUNA 1XR3A 2WKQA 3UJ8A 4Q9HA 2ZTMA 2R7LA 3N2YA 3FBTA 1CIVA 4Q3OA 4IDPA 1R9JA 3D4BA 4QAQA 2BSQA 2GBFA 2VPIA 4CU5A 1XMVA 3PD7A 3TLZA 3QEKA 5E7IA 5JXJA 3DLBA 1W36C 4I55A 3UJ7A 2HA7A 4KP7A 1SCJA 1VL5A 1SXGA 2A3RA 2XJ4A 3O8OA 5GVRA 4C07A 4EW6A 2ES4A 5BYAA 2QRVB 1ZICA 1IEVA 2C5EA 3EHEA 2ZDQA 1E96A 2J0UB 2NU7B 3GDOA 2DB3A 2R5NA 2QP3A 5HCNA 1E9CA 3JATB 3DBRB 1UMCB 4WJKB 3GGJA 3NHPA 3TCXB 4IRUB 2EKDA 1K8XB 3DBIA 2WA1A 1KI7A 2HPAA 2YY5A 2ZT7A 2X23A 5HJ2A 1V5FA 3ST7A 3WMRA 3UQYS 3I6MA 3OQMA 2Z5VA 3LVBA 2GA8A 4HH4A 2ZYWX 4Y6GB 4L8WB 2HHHB 1PNTA 5LM3A 2J32A 2WFLB 1YVPA 1WL8A 3H2GA 4OMDA 4NPHA 4H3VA 4NYMQ 2DFNA 2WSSD 3EG9B 3ROPA 5A9SB 3IXQA 3UTCA 1DLJA 2CXSA 2DUNA 3RVRA 4MI9A 3HG7A 1E2PA 2JZOA 2WF9A 2I6TA 3OC0A 3GW8A 4PPQA 3HCBA 5KOHA 1J97A 1W2WB 2P1RA 3OM0A 4M6WA 4JD5A 3UK1A 2AEJA 4XD2A 3R0QA 1CT9A 2FEMA 2XZDA 5JR3A 1LSOA 2X4GA 5BXQC 3L4SO 1SKYB 4DLRA 3JSAA 4PSCA 5JTTA 2QMOA 2VP9A 5EJFA 1Z4JA 4NEGA 3B51X 4Z4GA 3TFWA 3UWDA 2BFBA 2G4CA 4D7AA 2PZBA 5JUWA 1JFTA 1CIPA 1E3WB 1GZ5A 2PGNA 1E5TA 1YDFA 3QVLA 1QQBA 5CA1A 2HV9A 4Q37A 1IHDA 3OZBA 3LH5A 4GU5A 1FDIA 4IXWA 3JPWA 1J07A 3LV8A 4G23A 3VDQA 2EKQA 2WE7A 2XTAA 3CX6A 5EJ9A 1RYFA 3JQEA 3QOWA 3CZAA 3W4KA 1NNSA 1QQTA 1UADA 3NUGA 5AK3A 3WMGA 1GADO 1I36A 2IEAA 3CWCA 1B74A 1N2CB 3ETCA 1OT5A 2B4KA 3AW8A 1G20E 4UVIA 2FWJA 1ZIXA 5IZ4A 3A10A 4J3JA 1NI5A 3P9RA 2X2FA 4CN9A 7ABPA 3KTDA 1E0DA 1OTYA 1GFIA 3HDQA 3OLVA 3WNDA 4JIGA 5KDOA 4YO8A 1PUIA 2PR7A 1ML3A 4GS5A 2O7NA 4LKRA 1EFKA 2YWEA 3OF3A 1CQZA 4A73A 4ZGWA 1YZUA 4MULA 2G09A 1UC8A 3GELA 4L5IA 3H1BA 4XI9A 4OHUA 2ZRGA 1NBEA 4LOAA 3W3AH 2CL5A 4RZUA 4S04A 3EW7A 3GG9A 2VPTA 2HMYB 4V0SA 3RSOA 3KBOA 4H59A 4P8RA 4BL5A 4HGPA 4DDHA 5LQNA 10MHA 1N1DA 1Q0LA 1V35A 3OWXA 2XE7A 3GEIA 4LNAA 4QNMA 4RABA 1ZIPA 5FHQA 1PHRA 1S8OA 2YZKA 3NDBB 3D6MA 2ZJ2A 2C8KA 2NTVA 4XEHA 3RKRA 1E0SA 4YRKA 5BUQA 3S0JA 2C0PA 3TRIA 3LCRA 2Y68A 5DDIP 4ILKA 1C1YA 2RBEA 1JIKA 3IQZA 5DO9A 3Q8KA 5AD1A 4M86A 3O2NA 5CM9C 1RAFA 3T5CA 2RD2A 621PA 3EDMA 3WQHA 5E3HA 1ODCA 2W2KB 3ER9A 4K2HA 4IGEA 4Y9RA 2R6HA 3UKDA 2G9VA 1QH8A 3D2LA 2QM7A 3UZUA 1N6HA 3DOIA 4OLAA 1VKHA 4LCJA 2B7CA 3K9QO 5I47A 4FNMA 4LJSA 3TL3A 1DTWA 1TJ5A 3GRAA 1BGXT 2YJZA 2VO1A 4R31A 1YIDA 4YDHB 1IWBB 1EA7A 1FNMA 1G3UA 4MQ6A 2YRWA 2J9GA 4IFEA 4ETNA 1M7HA 5DNWA 2VSFA 2A58A 4O4JB 3BIWA 2WU4A 1QHEA 2R8YA 1CC1S 4PWZA 4B5LA 4QWMA 1PKXA 1RYEA 2C9ZA 3PKZA 3RB8A 5JXIA 1NXXA 4KX5A 3U3MA 4UUPA 2DCMA 2GKOA 1CZKA 3KQNA 4AJNA 4HAIA 1ZPDA 4NJMB 3EXG2 3DTNA 3MWFA 4L0MA 4D4IA 2W00A 5EHXA 3CZ9A 2QF7A 2HREA 3AUJB 1C0LA 1ANKA 3L79A 3M9XA 2QHXA 4M22A 5KI6A 5LB4A 4NHOA 1L5VA 1NNLA 1EWVA 2PZKA 4HB4A 4AUNA 3H2BA 4IH9A 2FEPA 2TRSB 4QZVA 4JI4B 1NTRA 2R8BA 3O8CA 4I50F 1WBDA 1TAUA 2IW1A 3QZUA 5TS3A 1F2UB 4JBXA 3C1TA 2QORA 3E70C 4KN6A 5AW6A 4LDZA 4H9GA 3T7JA 4YMUA 1RFLA 2O14A 5GY7A 3NJ4A 1IZ9A 2B8NA 1P1BA 4C4SA 2JRCA 2Y76A 1I6KA 3FMVA 2ZRIA 1GZ7A 1CR1A 1QNLA 3G7SA 4Q1EA 1QUFA 3O94A 1SC9A 1URPA 2I3GA 5DX0A 1IDOA 4F3KA 5AQ1A 4FKZA 3H5LA 4LHEA 3H1GA 1TLTA 1I7SB 4BFSA 3KTAA 1NBHA 1JMVA 1GNPA 1R2QA 2X8LA 4W9NA 3CNBA 2ZUFA 4V3CA 4WY2A 2BI8A 2PVPA 3UMRA 3F47A 1U9ZA 4CIAA 4YI5A 4R0NA 2R25B 3BFJA 4B8WA 1IE3A 3CN7A 1UOQA 4P5PA 4NOMA 4IZOA 2EP8A 4OK5A 4DCOA 5CFQA 4IQ4A 5IBQA 3OOYA 2H2AA 4B2PA 5JATA 4HLUC 4OFZA 1PAUA 2O7QA 1T3LA 1LRKA 3FUTA 2EXXA 3H8WA 3M5DA 4L27A 4RKWA 3KPWA 3V00A 4Z1MD 2PH5A 3LCVB 3NM5A 4EARA 5I3CA 4BMCA 1ZM3A 1BD4A 1E3JA 1ICEA 2BEKA 1EP9A 3RSFA 2CGEA 1G2IA 4DR3B 4L8VA 3EJ6A 3JQAB 4LY0A 1CP3A 3ET5A 3VPCA 1P2SA 2AHRA 2FUNB 3GEPA 4W82A 5BMVA 1UPCA 1DKRA 2CNWD 3FCEA 2ZDGA 1NNEA 4BO9A 4O4LB 1E6KA 1GJRA 3K70C 5E7MA 1FJHA 1CK4A 3MLAA 3AVVA 4ENPA 3PJFA 4OSPA 2GO7A 5E6UB 3KHKA 5FEUA 3L0IB 3DUFB 3BQ9A 5JJIA 2OCKA 4DGQA 2PX0A 2JJQA 2Y1GA 3FHOA 4Y2QA 1FXUA 3UNXA 4QEZA 3I23A 3WTBA 5LA6F 1Y81A 2XGSA 4U39A 4E31A 2FETA 5KOJA 5DTMA 4W5QA 3FLMA 1GNVA 2OBNA 2B9EA 3SAJA 3GLKA 4NE2A 4KUEA 5H3LA 3L7OA 5KYWA 4GKBA 4RVGA 4MPTA 4MV7A 1J2JA 1Z0AA 2WFLA 4ZT2A 4XQCA 3R3XA 4KWTA 3CW8X 4LJLA 1YWGO 1PF7E 2OCLA 3THSA 5KTKA 4NYJQ 4QYTA 3S40A 3EN0A 3OWHA 3WB1A 1AB5A 2YJ3A 3ZQKA 4XPIA 2WWIA 5JD5A 4BE7B 3LNTA 3D8RA 4DS3A 2DUJA 5F35A 3WYGA 4C2UA 2CW5A 2PYZA 3HVKA 3L7IA 4GLFA 4HLUA 2EX4A 5H3HA 1ZR4A 4B0OA 1GPUA 2CHUA 1WS6A 2GSDA 4TS4A 2NT4A 2Q5JA 2QZZA 1PZHA 3IOBA 1Z12A 4FXPA 4KMMA 5JPDA 3A1SA 1KGSA 4KLNA 1HZJA 2ZCUA 4UBIA 4YGXB 4ALNA 1XK6A 3W5DA 2XWQA 2O50A 2R9VA 5EWJB 4Z5XA 1L7AA 2R68A 3LCCA 6Q21A 5HRAA 2X9NA 1LSJA 3ETGA 5ARCA 3ZY2A 1IATA 5JYBA 2DFVA 1D0SA 3FCAA 3HL0A 4EKGA 2JB9A 2HA4A 2KM1A 3E5MA 3DH0A 4S1NA 4XDGA 5D7BA 1P62B 5DLYA 5DHRA 3WWDA 2JA1A 4RETA 2WRZA 1VHJA 2WT4A 4FZJA 3A37A 2X3YA 5K8VA 4B3RB 1RU3A 3OUZA 5C3UA 3W4IA 5JWOA 3L0BA 3MC1A 3DZDA 4AF8A 4UHKA 2DEUA 4LGMA 5JLAA 3ESQA 4BO5A 1COZA 2DULA 3UUFA 4XVCA 5IU6A 1KY4A 5AVXA 3AWIA 3KSUA 3FIJA 1WMDA 1UBFA 4N39A 1SULA 4Q1FA 1FYVA 4IGKA 2WJPA 2OOKA 3A2LA 3GJ5A 3I1FA 4ID3A 3ZGYA 4KDFA 2V4MA 3IEXA 3RC1A 4J90A 2HCJB 2XCUA 4NPAA 4QO7A 4ZV4A 4NZYA 4EQZA 5JBIA 5K4HA 3L8YA 4P82A 4AMZA 2C3PA 4RENA 1LK5A 3MMZA 1W46A 4R84A 4TS1A 1SIWA 3H87A 4KQWA 2FFHA 1T3HA 1C8LA 5BN3B 3IULA 4WOPA 3H5IA 2RCNA 5FBKA 3ZY5A 4WCVA 2H16A 2ZZNA 1QFZA 2AOTB 3GCWA 2EFHB 1D2HA 2FQXA 2ZQYA 1DJQA 2HOQA 3C8MA 3JR7A 5F64A 1CZLA 1RACA 1T34A 1IOLA 3DT6A 4PIPA 1Q57A 3DAYA 4ID9A 4PYMA 1HFEL 4D0SA 1SWWA 3JD3A 2IUSA 2NOAA 4OHKA 3MJEA 1YTUA 1WPRA 2AIRA 2GDJA 2CZQA 2JGDB 3EIXA 4YDSA 3ANSA 4B47A 3MUFA 4M1YA 4MEJA 4RBNA 2PTGA 2YOHA 2O8NA 3KJZA 3OM9A 4ESOA 3W6OA 5HIMA 2AS0A 2J5QA 2R5FA 1HK7A 1EZ1A 3W06A 4UNSA 1WR8A 3M6FA 5FOQA 2AF4C 4NNOA 4AN4A 2BE9A 5C1DA 3H75A 3FPHA 1UXIA 3LLSA 2XCLA 1VMKA 3IAFA 1NQOA 1J56A 3NJRA 2AL7A 2HH9A 3PFIA 1GGFA 4U2KA 5IBCA 3QKIA 4RMNA 4ENRA 1Y1RA 3EBPA 2ZJ1A 3HB5X 4JLUA 5DN9A 1YDWA 1UAGA 1YU6A 3CUYA 4DY6A 5A1TA 5JMWA 1OU0A 3ZEAA 1OAAA 2UKDA 2WZQA 4CV3A 1T9KA 3EY9A 3DWFA 4YR7A 3TGWA 3QFHA 4MYDA 1Q15A 4RIHA 1JBQA 1U8AA 2Q2NA 4GNRA 1R88A 4NIMA 4YK7A 1XMIA 4TYMA 5E6SB 2XD4A 5IYZF 4H7IA 4DCCA 5JNRA 2BFEA 5F98A 2R1UA 3Q7SA 4QNRA 4OL0A 3C6YA 4ZQHA 3ZW9A 8ADHA 4ZQEA 5A6SB 3C2QA 1QK4A 2GMWA 2C78A 4NE7A 4OJNA 1WSAA 1I4TD 3VOAA 1QHFA 1N8NA 4ZYZA 4UU8A 5KJ6A 2O59A 1GGJA 1MX3A 3EVZA 2ZI4A 3GYGA 1J5PA 1DVRA 1Y1QA 4ISCA 1PFWA 2E9SA 4K87A 1DCKA 1USVA 3D0RA 1MJNA 2CMGA 2ZUSA 3DE6X 3EGCA 4XX0A 5ALXA 4R0VA 3RRZA 3FYUA 2ZM5A 4B43A 1X1RA 3OOEA 5TX7A 4FZ5A 2Z9DA 4PC1A 3WLIA 4B6OA 2IJGX 2WV9A 4R1SA 2AK2A 2LBPA 2ON6A 3IQFA 1PWEA 5DWDA 5TT0A 1NY6A 1J23A 4V1CA 2HMVA 1F0NA 2ZIEA 4RZ3A 3V2IA 2P1DA 5D3ZA 3KKPA 4QWWA 2XDAA 1MW9X 1GTZA 3GROA 5DBIA 5DB4A 3BD8A 2FZGA 2IPXA 1CY8A 2QN1A 3I64A 1H1LB 3D7LA 3E8SA 3LPCA 3QMWA 2ZIFA 3BSSA 1CQXA 3MWJA 1BVRA 3Q12A 4FGWA 2XB4A 4MVJD 4UM9D 1R4MB 2PFGA 2Z8ZA 3DGEC 4HDRB 4QPCA 4EKDA 4X7BA 1LA2A 4YT5A 4IVRA 1E2EA 1QONA 2C2WA 3RK1A 1JAHA 1TT7A 3D6JA 4N1AA 1B43A 3Q6NA 4FC7A 2ZRLA 1HURA 1KJWA 1AXEA 4H1HA 4UM5A 1SOWA 2HNBA 4N8EA 3VAAA 3PT9A 4TVKA 4GL4A 1LW6E 2EQBA 2AUMA 2G8LA 3BC1A 3DVRX 4DUPA 5IVHA 3D1JA 1M8FA 4UKDA 4RZIA 2QOEA 5H80A 1IUKA 3RS9A 3L4JA 4BIMA 4MQ5A 1P2VA 2VBIA 4NMXB 5IJ0B 1UBGA 5L45A 2OZKA 3EXIA 1DJMA 2C4MA 3N86A 2E48A 3OIDA 3FRJA 4HQ0A 3K35A 4FE7A 3ECCA 5FFFA 3CBQA 3SVTA 1V6CA 3NKVA 2BTEA 4PZYA 1VL0A 2EHJA 3HYSA 2Q2OA 3N0TA 4N9WA 5BR4A 3K1AB 3Q8MA 4P84A 3ZHCA 5IXJA 1SXIA 3D3QA 5L3SB 1RYZA 3DGFC 4LYAA 5LQDA 3K9FC 2AJCA 1PJ2A 4Z99A 1ZOSA 2HF2A 4A91A 4NCHA 1SKBA 3UFXA 4E30A 1G21E 4DPLA 2O0KA 2V6JA 4DY4A 2O8DA 1G5TA 3SYMA 2ZTHA 4C1NA 4V0LA 1VJTA 4G85A 4QKQA 3K9HA 5A4KA 3B3AA 2CVPA 2HRZA 3EQ7A 1MJHA 1OA0A 2R6CA 3AM5A 4S1TA 4ZOLB 4EB8A 2WAOA 1DRJA 3OI7A 5AUPB 4QATA 1IHOA 4HHEA 1KDVA 2PS3A 1M2KA 3C6XA 3IP3A 2RHJA 4GICA 2JF0A 3TNDA 3KOUA 1NJ8A 2WDPA 2QR5A 2C0QA 3PNOA 2HU2A 3ORYA 4UBOA 1VMDA 1F2VA 1Q74A 2DPHA 2P65A 3ADBA 1NBMD 2C9MA 5FOSA 4J0GA 2BOVA 1PLKA 3A6KA 1E2HA 4HQKA 4NARA 3TDMA 4CHGA 4P3PA 3AOGA 3U56A 5KYUA 1RZRA 2GZ3A 1F8UA 4AMYA 1LY1A 3FGPA 3H11A 1TJNA 3E81A 2UV8A 3GZ4A 1KMHB 3QNMA 7MDHA 4J2HA 4C88A 3AY3A 4H7FA 3WLKX 5EZQA 3ZK7A 3TQSA 1LLDA 3BICA 3DE4X 1PR2A 3N2LA 4MUAA 4WKGA 3R9XA 3PT5A 3BJZA 1OU4A 3BXHA 2BCEA 2GESA 3MTJA 4GGOA 5JMTA 3CG0A 3HB7A 2JG3A 2WYOA 4FNAA 3QA3E 5ITSA 2MU1A 1T35A 2MYTA 3OA0A 4EPYA 1B8VA 2EATA 4KFRA 2BM8A 4DJEC 3WSVA 1ODSA 2RGWA 1X39A 1KEUA 3F9IA 5A62A 1FQWA 3ONEA 4Q4JB 3M6MD 3Q8XB 3UQZA 4WNAA 4AMBA 5BW6B 3EF0A 1UFOA 3NMUF 2Q5LA 4Q3KA 1GY8A 3OWOA 4RADA 3IPLA 3VPSA 4E94A 4LZZA 1DWUA 3B89A 5FV7A 2NSYA 4JIMA 1BHQ1 4I5GA 1W75A 2EWWA 3LWBA 3T7DA 1VCMA 4TUYF 4WOJA 1J24A 5HE8A 1K92A 4YI3A 1SC4A 3RHFA 4GGPA 4ZVPA 2SCUB 3DJFA 2BGTA 1PEYA 2X1VA 4UAGA 1XO1A 2ZT6A 2QU7A 2VT7A 4V1CB 5IUNC 2PAFA 2ZRAA 2F59A 1ESEA 3G79A 1UPTA 3FH0A 4CMCA 3FDFA 1NQAO 4F60A 1W0JD 1RPAA 1SCAA 2QJWA 4MRSA 5CD1A 2YIJA 5HKKA 3WDLA 1PGOA 2Q2VA 3HCRA 3OT4A 4OF4A 1SU7A 4HDCA 3DWEX 4ZAWA 3TVDA 3UYKA 9GPBA 3WLTA 5FLXA 4OSOA 3CUEF 2BDEA 4IUDS 1F20A 4DYHA 5CCXA 3OHMA 3GLTA 5TARA 3Q7EA 1P1IA 2NNLD 4U6SA 4TVBA 2IPAB 4XGIA 4B17A 2ZJ6A 3GFRA 1T8UA 1JAXA 2FQYA 2O3RA 5EMJA 5FA5A 1UBRS 3Q4GA 4YDQA 3FGNA 3UBTA 2FWBA 1KI4A 5LOVA 4EY5A 4CT5A 1KYZA 3BWMA 4RLSA 3AG5A 4ZJPA 1M2HA 4PHHA 1J9GA 4EI7A 5B1YA 4EGQA 3TE6A 3KAKA 5E0OA 5DI9A 2XCQA 3WMXA 4OHCA 1NVFA 1Z2CA 2PT7A 3CWZA 2HWKA 1NMYA 4FJ1A 2JAHA 2DBRA 2H1VA 2EJTA 1GCOA 1YDHA 2JLRA 2Y1KA 5DK4A 2R47A 2WICA 3DAPA 3ZX4A 5FULA 5IBPA 4E6EA 2IDMA 2O2YA 3VO8A 2JH8A 3C87A 3O4GA 3MSCA 5MFPA 4HMQA 4QUDA 4FGSA 3QHPA 4I55F 3EEBA 5C1PA 3R9WA 2QIOA 3PK0A 2GUGA 3TH5A 3ZI7A 1XU9A 4YV1A 4Q4LA 5U9CA 4RTKA 4LSGA 1EFHA 3PUJA 1M8KA 1U28A 4P83A 3B53X 3PGJA 1OIWA 2FMXA 4TLDA 1L4KA 5JCJA 2ACKA 1D7OA 1T3SA 1Z13A 5BUCA 1YMQA 1SQFA 2IUYA 1I3LA 2R66A 3PTZA 3RC7A 1CZOA 3ZDEA 1TQHA 4LRXA 5CW1A 2AFVA 5GM1A 1DC3A 2DH5A 1I24A 1SA0B 2XVXA 5D51S 3WKDA 3ZYCA 4BZXA 3EXG1 2YTZA 5AJTA 3G0IA 3E18A 1T13A 5KTPA 2YUTA 1TTTA 4B8YA 3IR6A 2BFFB 5J4LA 2BGLA 2QQGA 3R23A 2PYIA 3ZDFA 1IXYA 1P2TA 2OV2A 1DX9A 1M1NB 2GBGA 1JFVA 3BSWA 1N1MA 1WVIA 3O2JA 1P7PA 3UM9A 4U6QA 3WHPA 2H59A 4CCSA 2QPTA 3OPYA 2VJYA 3NV9A 1BFUA 3RRBA 3V1YA 4WD3A 4KQ1A 1RLMA 4TYNA 3DBOB 4BVLA 1P4HA 5JADA 1V4BA 1SKQA 2G83A 2OZPA 1WHSA 3PFGA 4L15A 1FFGA 1FRFS 5HS6A 3HPQA 3NXSA 1PW7A 1INLA 4C6RA 2CNDA 3L43A 2QVZX 3HNOA 3MJRA 4PHFA 1CY1A 1ORHA 2P0YA 1N1EA 2RKWA 2ZBQA 3SYLA 4Z8XA 1WUYA 4RYDA 4QASA 1YS1X 3TZCA 1WSDA 3A9UA 1GU7A 5EMKA 1NL3A 3ZJYA 3ZVRA 4EJ0A 1J42A 1K9SA 2ST1A 3EQ2A 5EXTA 3T4PA 1RRVA 3IHWA 2EJUA 1XDUA 4MP8A 1EDDA 1EEXB 1G8SA 3WLAA 1C4KA 2NUAA 3BSYA 4RYLA 1RADA 3X1YA 3PVZA 1LBHA 2FSFA 3HO6A 1NBMA 1RNLA 2XCTB 8GPBA 1T9GR 4RKQA 4A4DA 4HCJA 4KYUA 3N05A 1L5HB 3N8DA 3VGJA 3OD1A 5AKIA 3WL5A 4EHDA 1NBIA 3DAGA 1FNNA 3DT8A 2E18A 2WYHA 4HB3A 1X80B 2IS1A 3SEFA 5CG2A 1XD8A 2AW3A 4ZPJA 1EQ2A 4NZ9A 2QX8A 3OPVA 4URFA 2FP4A 1YT5A 4CTKA 1K5HA 5JY6A 2HRBA 1IZ7A 1UIMA 1J8FA 1RTTA 3ZNOA 5BN5B 3JRNA 3KKNA 4KITB 3MMNA 5KKCA 1IN6A 3RRNA 1HFWA 2KB0A 1V4VA 3FPFA 2VDVE 5HFAA 5IWAB 1BVHA 2VDWA 1QZZA 1LBEA 4FDUA 1LVUA 1YB1A 5HSGA 1OLXA 1DU4A 3EXAA 3OQNA 3JWEA 4X94A 5I9SA 3FCCA 3E9CA 4Q1CA 4K46A 2IHTA 3UXEA 3B9RA 3TECE 3I39X 1T0JB 4RFSA 1KY3A 5GONF 1A96A 1NM5A 2Y1FA 1JSRA 2GTPA 1DV2A 1U2TA 1F0KA 3DHNA 3ZCUA 4UE6A 1MAHA 4I4IA 3TJMA 1I1QB 4F4HA 3K2QA 1PR5A 4AJIA 2C5GA 1H8ED 2VDPB 2AZMA 3P4XA 1GG2A 4RD0A 3RYIA 2BH9A 1TUBA 2XMCA 3FPKA 1ZH0A 4L9WA 1CVRA 4S1OA 1MH1A 3UPTA 5KU1A 1UFRA 1T5OA 3U9LA 4CQJA 1ZH2A 2HRQA 3TOZA 1JEAA 3N58A 5BSUA 3N2GB 4OAPA 2VZ9A 1Z2DA 2Q0HA 3FWKA 3U3DA 1K9VF 3VZDA 3T5AA 1USWA 3A9CA 3GRFA 3HRIA 3QU7A 4MQMA 4EHBA 5EJ5A 3AP2A 5I4IA 4JI2B 3A9SA 3OJEA 2CV2A 1RLUA 2AKAB 4KGDA 5LYJB 2KHZA 3PPVA 4AM8A 5B6JA 3HBAA 4NAHA 3DEZA 1YVDA 3IVGA 1ZD8A 3FWZA 1KQPA 2O52A 3MJVA 3NBFA 3VISA 3LBFA 3ZE6A 4Z9BA 3H4TA 4WVLA 3TRKA 1FDTA 1LC3A 5D5PA 1PYDA 5EVCA 4U4AA 4DEVA 2PMDA 4LWQA 1JPUA 4RLHA 4LSZA 3SEZA 4D96A 4PAOA 1YB5A 2PL5A 2G1AA 4O1HA 1MOQA 2B3DA 3L4BA 4NTZA 4ZZ2A 2BE7A 1BTOA 4ZAXA 3IE1A 4TMKA 1NNUA 2ZB3A 1MRSA 1VKOA 2QVXX 2VPQA 3LF2A 5LDDC 4OQMA 1Y9DA 5AI4A 5FTLA 1HTTA 4ZQBA 1ODIA 3UJ3X 1J2EA 4WUVA 2HQOA 3EAGA 4WCFB 4GZ5A 4P98A 1F3OA 1U8CB 1HDIA 2HNKA 1ZUNB 2P9CA 2VG8A 2I3BA 2QVLA 2WM8A 1KJIA 3DFMA 3FKSD 3H2JA 4DIEA 4L57A 1SHLA 1O57A 3K9BA 4PAWA 4ZEVA 2HK6A 4JJZA 5DNAA 2QMYA 4OGKA 5TE9A 4NR0A 2CLHB 5AJXA 4M1TA 3PTAA 4LA4A 3FMFA 2WKRA 2G72A 5T6MA 1PNQA 1O58A 1Z5PA 5AOBA 2P7HA 4RD3A 1GQSA 3UXHA 2HLHA 3DLAA 3VZPA 4G0WA 1EP2B 1U0TA 2X8JB 2AXEA 1PSDA 3FBGA 3N87A 3NXKA 3ELUA 2FMHA 1L5FA 3AERA 3ETLA 7REQB 3JQ7A 2QDKA 1CF4A 3OLQA 2SECE 4IV5A 5IVDA 2OV3A 4J7XA 5LA6A 2WIAA 4QVKA 2XZOA 5ALWA 2G08A 2O0JA 2O2GA 1N0UA 1TA0A 1NQ5A 2D5IA 1PK8A 2ZYUX 3A1DA 2ZUVA 1JUDA 3EF3A 3K4HA 3WDMA 3TFOA 2E49A 1J8YF 3ZXYA 3I9FA 5KTMA 2Z04A 3E2PA 4OO3A 1PJBA 2XZTA 4OA8A 2YH2A 1DBPA 5CVTA 3HWWA 3COYA 4IIGA 1ATZA 4W8OA 5COQA 1DCTA 4MO2A 1A71A 1XCBA 3PFNA 2V58A 4Q9NA 2QTTA 2QLNA 3SDZA 4P2BA 2WFAA 4YMSA 3SFZA 2VQSA 4A8JB 5KOHB 4QUGA 1X7HA 5K05A 2FMUA 3IR5A 2EERA 2WTBA 4UHFA 5J1TB 3UJ6A 5AVZA 5IKEA 4UUOA 4X60A 4C6TA 5IUJC 3GOHA 2PWYA 4EUNA 4LTMA 4AT1A 3HXOA 2IUEA 3KZCA 4X93A 2PX2A 1JP7A 4FP9A 2FW8A 2HF7A 1ZIOA 5T4FA 1CS4C 3P9CA 1C9EA 4NWIA 5HKLA 4MS3B 3GWGA 4C03A 3SS7X 3UAXA 4Z2AA 2BFAA 2ZBGA 1N6RA 4B75A 4M36A 3LPLA 2NV6A 1FVHA 2HRCA 2VPXA 1EFTA 3EGXB 2OAEA 3E27A 2F43A 3VTAA 3RS0A 3T7EA 1P3JA 1R5OA 3VZRA 3WRVA 1J1UA 4ODIA 2D1FA 4UMEA 3R8XA 1GLNA 5CFMA 1P6QA 3TLEA 3ANTA 5ER6A 2F9MA 4LY9A 2B5OA 5T4HA 1X7YA 2BTQB 4C3ZA 4LS3A 1THZA 3KEQA 3PGLA 3TCKA 4JBIA 1DAKA 1YBHA 3PBKA 1OZAA 2CT8A 3RROA 2ID8A 4GPTA 2IYUA 3MEQA 1C30B 3H5AA 4F6LA 2EARA 2CXUA 1E69A 4A0QA 1BEUB 4TLCA 3TGPA 4MRMB 2PZEA 3I09A 3TSCA 3PNVA 5TNXA 5IASA 1M3SA 1DTSA 3ZVKA 1HYQA 1UPXA 2CXRA 1LLUA 3PUKA 1PT9A 3DVAA 5THQA 4QTYA 1MU0A 3F8TA 1RM4A 4H0NA 4AWBA 4NXNB 4D0RA 2PLRA 3KETA 1QRSA 1A4IA 2C7BA 1NFQA 1UQTA 2QRNA 1TO1E 3ENVA 4ER7A 2W98A 3AETA 4FEGA 3HBFA 3MWEA 4LJYA 4NU6A 3HCAA 3EPKA 1GXSA 2ZE8A 1BAPA 2AVDA 3LL7A 2JA2A 1H2YA 5GOZA 3AY0A 3FB1A 1JDJA 1IM8A 3B2NA 5KKAA 2IW3A 1NXVA 3AIKA 3R5HA 2QUBA 3ZV7A 5JTUA 1UBHS 1ZCBA 2GPNA 3ROQA 3DXXA 5AW0A 4J3NA 1IRIA 3WAJA 3WRXC 3ZJ5A 5LQMA 3UUEA 5AI9A 4G1MB 1Y3BE 2VXCA 3VVMA 2IBSA 1WU7A 1UK7A 3RNOA 4ATNA 1NOKA 3K6KA 2AJ8A 3MWDA 1PT8A 4GOOD 5E0KB 5EN4A 3TSWA 3DBHA 3GCZA 4J2TA 1I7QB 1TB4A 1KIAA 3O8RA 3HO1A 1XF1A 2VHTA 1IEQA 1EK2A 1XBTA 2BPOA 1W4ZA 3SQMA 2BMJA 4AULA 5GQSA 4ZZIA 1W6RA 1ZCAA 3H05A 1VLMA 4RTOA 2JFNA 1ZSVA 2Q5CA 4DARA 2NO5A 1Y7HA 1DELA 2E21A 4ZEXA 4DLVA 4KBFA 1G6OA 2GKSA 5J9FA 2YJ5A 3CPSA 2YINC 2LZ0A 4D4GA 1R9MA 1OFGA 3F6PA 3TQHA 1SCUA 5FPTA 2R8OA 4DZRA 1JILA 5KOYA 4TSRA 3HVUA 4FYJA 1T6BY 1L4YA 3KQQA 2A9KA 4I1UA 2E1RA 3AEQB 2J6HA 4P2GA 5DF1A 2RCYA 2W6JD 3FYCA 1Q83A 4GYYA 3KJXA 3UJDA 4RTRA 4Y30A 3PGMA 3RODA 4JMLA 1YJXA 4UU7A 1TDJA 1U0OC 1NULA 2VSOA 3QUAA 4A1OA 3AF4A 3D1LA 1DIBA 1W52X 2V74B 2DQSA 3NC1C 1ZMXA 3ZDZB 2YVAA 2ZW9A 1GPH1 4FDTA 4KQCA 4MDHA 4RJTA 2DJ5A 3IT0A 4TZ6A 2BAGA 3A26A 3SYTA 3ICCA 3PFKA 5BSTA 5BQ5A 3UOWA 3K8YA 2ALJA 4IIDA 2G76A 5AJVB 1GUBA 5K8UA 4H60A 1N2HA 4DLKA 2CFSA 1PJLA 3OP1A 2CDAA 1C9MA 1C7QA 5T7BA 4B85A 2EIHA 3OTIA 2Q7DA 5H5JA 2XA1A 1Y1PA 1ISJA 4RLFA 3TZBA 2J9FA 2P2DA 4G9BA 3AP3A 5KQRA 3EPHA 4RY2A 1BX3A 3A9TA 1AE1A 2PZFA 4TRRA 4ZOQI 2XRMA 1GGMA 4XQ9A 4YRRA 1BMFA 4G5HA 2LCFA 4LC9A 4DW8A 2A9FA 3EIHA 5GIOE 1KKUA 2FXVA 2R00A 4N9QA 1FZQA 1R66A 1WQ4A 2GZRA 2W2KA 2XA9A 1JDBC 4MLZA 3LZDA 2HR1A 1BW9B 4C08A 4Y1EA 3BH7A 1Z6GA 3EXFA 2RK4A 4HAYA 4PICA 1DAEA 1TEHA 2HBZA 1EVIA 1W5EA 4ZGGA 1X2EA 4RK1A 4PG8A 2GZHA 3KSMA 1A97A 1DDOA 2O4CA 5BRNA 1T0BA 3PDHA 3LJKA 4NKRA 4N12A 4E2ZA 4JHXA 4RTSA 2BEWA 4EZEA 1DBSA 1N6KA 2CXPA 3HSKA 4ENSA 1CRPA 3MGBA 4G0UA 4DIBA 2R86A 3FPSA 3O95A 3ORSA 3CMMA 1EDBA 4DLTA 4CVNA 1CUZA 1KMCA 1Z0SA 2NU7A 3DTTA 4RORA 4D42A 3L5KA 3PCTA 5FP0A 4ZCPA 3FSGA 4N3GA 4CTJA 1SZPA 2R0QC 3MWKA 3DEKA 2QZ9A 2GRUA 2R62A 2JAXA 3LGAA 2HBQA 3F6BX 4AJHA 5E1MA 3L5OA 4XGRA 4WAUA 4XJXA 3N7TA 4BLQA 3BZBA 4MGYR 4FS8A 2WTUA 3J7AC 4LCBA 5TJHA 5HCUA 3W7AA 1E9DA 2ID9A 4E12A 3DBVO 4EECA 1WDTA 3GZNA 4XTCS 1U8FO 4H7DA 1D6MA 2A3NA 5EINA 4JI3B 4ZYLA 1OYVA 2F3UA 4E08A 4EKYA 5D3MA 3AR6A 4KE6A 3VHXB 5F73A 5AVQA 5FOUA 1L8AA 2NSLA 1HG1A 2Z1MA 3PXGA 4QM6A 4JJ8A 1F7VA 1JHAA 1GPJA 2E3JA 3FMIA 1VMEA 4O33A 1X1SA 1K66A 1T2UA 1PGPA 2JFFA 1XLUA 4NFYA 5EXXA 5AVOA 3RJ5A 2OXTA 3EFHA 4GEKA 1ZK2A 1XRRA 4QYXA 4RDIA 4AUKA 2V7TA 3RD5A 2Q4BA 1Y4DE 3NHJA 3R3SA 1K0FA 2B4TO 3GEHA 3R0ZA 3GFVA 4RPHA 1Z6PA 1D0IA 4F9GA 1CZUA 2DETA 2NACA 4ZQCB 3R6LA 2JI9A 2HQSA 4I8XA 1QDLB 4IIJB 3ABQB 4MPDA 1XLVA 3AI3A 4GAEA 4PY2A 1YC5A 4CMKA 4F7WA 5LQUA 5F2NA 4P86A 4MNTA 3O0DA 1EVLA 3HUEA 4WOBA 2I7VA 1U1EA 7AT1A 4Y2RA 3UYLA 1TIBA 3IR7A 3FNBA 2VDUE 4ER3A 4NJEA 1SCIA 1LU9A 3GEDA 3NUZA 3V8MA 1BS1A 3KHUA 4WCFC 3AJDA 1UBUS 1Y7LA 2XUOA 2PKEA 4PRYA 1G18A 4ZK6A 2XSZA 5F2EA 4Q3AA 4URHA 3U4QA 4L4ZA 4JELA 1G41A 1M67A 1IPFA 3BERA 3UUGA 2Q0QA 2QN2A 2VUIB 2XQJA 2R4QA 5CYOA 3IH5A 5LBIA 2I2DA 4DQDA 4E5DA 3RHTA 1SIOA 4B4WA 1R0BA 1TD9A 2XLBA 3UK0A 2B61A 2X41A 3QUTA 5A3VA 1S2NA 4OBBA 3GHHA 1NLMA 3QVVA 1EUDA 4JEIA 1DUIA 3UIEA 3I0ZA 1QVVA 4Z4IA 3IHKA 4TYQA 4OEHA 4DR2B 3GX1A 3HR8A 1HY3A 2C4NA 2C5LA 3FNEA 1TQ4A 2QL6A 4WINA 1GN9A 2D2XA 2W48A 3D31A 3NHRA 2FFRA 1SUFA 3OZVA 2TMKA 5F23A 1L4MA 2L18A 2WTEA 1AV7A 4YH1A 4IIEA 3S2GA 4EH1A 3HKEA 1G8YA 2XKJE 3KZ1E 1I3KA 1C41A 4EENA 3AR9A 5F1YA 3KK0A 4QUEA 5WRFA 1G20B 1JVSA 2IHBA 4R8LA 3SHTA 5BSHA 5C9ZA 1EWQA 3ZW8A 2GN6A 3T95A 5B3JC 2CFRA 2PPVA 3C3XA 1T2AA 3QELA 2C9YA 2X5NA 3H5TA 1XJCA 1AN9A 4OUDB 1W35A 3NGLA 4UXIA 3Q98A 3VR2D 1R3DA 4FI3F 1XMQB 4ZK2A 1EWRA 1X94A 2QY9A 4JBGA 4ROTA 5P8WA 3RVSA 2Z08A 2BZSA 4UTPA 3HXQA 4GT1A 1EP1B 1ZJ5A 2V6MA 3EC7A 2V7GA 3LVQE 4MS4B 2JFHA 1JPNA 3CINA 2NAPA 1M5TA 3PXBA 1B0PA 1ZBQA 3PHBE 4J8PA 4KH1A 3UC5A 4QG3A 1W93A 1YB2A 4YLGA 3T7AA 5HCIA 2AG8A 1HI9A 3QPBA 3IP1A 1LK7A 2QQ0A 2YV1A 1U5BB 4QJ5A 3SHFA 2VOEA 3LGSA 4J94A 4IOKA 3WAKA 4BEVA 3DHYA 2WJHA 3NAZA 1QIDA 3GLIB 1B00A 3AZOA 3FFWA 4ETWA 1SY7A 1L4LA 2FPOA 1NY5A 4MX8A 3FUCA 5CCEA 1WNTA 2C3UA 3IEIA 5BW8A 1TM7E 3V4LA 2PNJA 2N1BA 2QSZA 4KLZA 1EI9A 2XYPA 4AO7A 1XAHA 2XYQA 3DTVD 3RTEA 3DCIA 3DV9A 4BGEA 4E21A 1LLFA 1QXSA 4HOYA 4HFRA 4MYTA 2XECA 3EQ9A 4G56A 1HKUA 2X14A 3MPOA 3RRXA 5JNLA 3TG2A 1GQ2A 3H9GA 1V3UA 3NPMA 4Z54A 1LQUA 1YRBA 1KJJA 4MQFB 1XEWX 3EWSA 2TMGA 5JQWA 4KTTE 2ODEA 3FZYA 3M83A 4KAFA 1P0PA 2FG6C 1UWLA 3E5RA 3RYIB 1QAMA 1K98A 1VLQA 2FPIB 3M9WA 1ZOPA 3Q3CA 5LQAA 2P4EA 1MO3A 3VMMA 4D99A 3PNPA 1ACLA 1GUDA 1AGNA 1PT5A 2FZVA 2ZITA 3BMQB 2FYTA 5CT5A 5JS6A 5T5QA 4YROA 5LC1A 4C0SA 5LQSA 5L6LB 1E3SA 1QPBA 1V9SA 5BSVA 5C7IO 3M6XA 5C5EA 1VCHA 1PV2A 1PWZA 4OLBA 2Q8NA 4MW5A 2HLNA 4FE4A 5J5CA 4C0JA 2X3FA 5DASA 1DAHA 1KFBB 4UMFA 4NI5A 4FKMA 5FPQA 1TZKA 2HFJA 2V6IA 3CRW1 2XVZA 3I72A 2SKDA 4FMDF 4TROA 1I4LD 1XFAA 5JVDB 3QPAA 5HQTA 1HR0B 5FUVA 1OXTA 1AN0A 2OFWA 3NIWA 4X8HA 5JCZA 5KZMB 1W581 3CLTD 3ZKAA 1PFVA 4JB0A 5B1HA 3WGLA 3ZZUA 1Z6YA 1RQ2A 2JPDA 3JS5A 4GMKA 3G8YA 3KEMA 4XUEA 4D9IA 2C9OA 3AU9A 3E9MA 1P33A 4OHXA 3DEIA 1YOVB 2FQWA 1W7AA 3IVAA 3G0HA 4J1SA 4LXIA 3MMSA 2JIMA 2JBAB 3IUJA 4AG3A 2ZYIA 3C48A 3IKJA 3HKBB 4M1WA 5IKMA 2XRFA 3DMPA 4YBRA 3WWYA 2NX2A 4MRVA 4CL2A 5GAJA 1UM9B 1EUCA 2ZPTX 1AQIA 3JQ9A 4G41A 2GXSA 5B3JA 5L3VA 1E0JA 4Q3LA 2HRDA 3HH8A 1W85A 5BMVB 2EVWX 4PO1A 3U44B 3P0FA 2CCGA 4MIKA 5K3BA 2H31A 1CW2B 1H65A 2O2EA 4X20A 1TMYA 3BB3A 3EG5A 2C8JA 3MCWA 4DFDA 5IXSA 3BQMB 1AHIA 2CB9A 2YRXA 3PE6A 5EYPA 5ECWA 3PVSA 4M8KA 5KYGA 2N42A 4Y9TA 4BNHA 4D9HA 5CLJA 1E1DA 1VMIA 2E85A 1CTQA 4KXXA 1Q7BA 1MAUA 4Z53A 4RCVA 4C3VA 3WBJA 1QP8A 2DFLA 3H18A 4Q82A 4XASA 1Q1GA 2X22A 4JK3A 4S3MA 1FP2A 5ALKA 3GRVA 1ZCFA 2ZFUA 1XC7A 3A1UA 1YRWA 2OM6A 2JLYA 4R3NA 1IUPA 4Y18A 1NP7A 4CLHA 3B3QA 3DR5A 4LRUA 1M8GA 2YJGA 3JD1A 3LXXA 2A7XA 5GONA 3T0FA 1VBFA 4BHTA 4HXYA 4FOSA 3HZRA 3JQCA 1LSSA 3OUUA 2B4RO 3A1WA 4ALMA 1AO3A 2AN1A 2XBLA 2WT8A 3SMVA 1GUYA 2AI2A 4AP9A 2ZXUA 4ZCLA 3FVQA 3OOHA 4MWCA 4JXJA 1O96A 4I5EA 5CDUA 4OI0A 1W0KD 4N4AA 3EVTA 4IGIA 3VO9A 1O08A 3VYWA 4CIVA 5JHGB 2IYNA 1LBSA 3H97A 1NZJA 2WWRA 2PPLA 4Q3DA 1DIGA 4W8GA 3MTDA 2JKYA 2IXDA 1QGUA 5AI0A 3WISA 5LDGA 3W8RA 2Z09A 3GLSA 4KQXA 1KJ9A 2QLLA 3SYNA 3WY9A 4DLSA 1TZ2A 5K3FA 2CK3A 1ZVQA 2W93A 4K9OA 3TXYA 2NT3A 5FFNA 2QRQA 2H2GA 1JLRA 4LDRA 5ALFA 3WG9A 1ZSYA 2RGYA 4YMWA 1QX3A 3M70A 2FY8A 4D4JA 3I73A 1MX1A 1QP7A 1W34A 5GJWC 3IKLA 2JAQA 3BWEA 3EMDA 3LBYA 3RS3A 5B12A 1IONA 4ZVUA 4GIBA 3WNBA 3LKVA 1FXSA 3CO0S 4GSLA 1O7JA 1HYHA 4NYMR 5KTTA 4PCUA 2QRVA 3AHJA 1E4VA 2HU8A 3Q10A 4EY8A 1UPUA 3NEPX 2QUZA 3QU2A 4DLBA 2XWBF 1OMOA 2JLWA 3QVMA 1ZMRA 5BWLA 1DKOA 1KZ9A 3A7EA 5JAMA 3I3OA 4A8TA 4FB5A 1LLCA 4L3WA 5ESRA 4K28A 1XZAA 4HNQA 5EXPA 1G64A 1GNTA 3IBFA 4YR9A 1PL7A 1I2MA 1WMBA 2OYSA 2M98A 5JH7A 5HP4A 1LVHA 3A6JA 2QAGA 1C1DA 2JLQA 2Q6TA 4J0JA 4PO3X 3W1VA 2PR2A 1GA6A 5ALSA 4PQFA 3BQNB 2I91A 4HVCA 2IY9A 4PGGA 3NFRA 2ZJ7A 4I9GA 1XKLA 3CSSA 5A4IS 1CUGA 3CZQA 3ZXSA 4BFLA 1M6HA 1G5IA 5IRCD 3RM3A 1SELA 1SKUA 2E2WA 2JARA 4MXDA 3WIVA 5CB8A 5JCPA 3DMNA 4MW4A 2ZZKA 4KX3A 4L5BA 4BQRA 4G65A 4U2CA 1JKFA 1FYDA 2QTGA 1QIKA 3FZEA 3OQPA 4EDHA 3WJ7A 2B9VA 1I3OA 3OTQA 3EOBI 1RWMA 4H6XA 3C5EA 3NASA 3KE9A 2DTDA 4N5NA 4NDZA 5IPFA 1DAFA 5JI3E 5KYUB 1R7RA 2JGNA 2DCUA 1ADFA 1FDRA 5KNLA 2NVOA 1N2GA 5JPCA 5JCOA 1B6RA 4CF7A 4G5GA 1PQWA 1BSVA 4NABA 3WO1A 3LKZA 1TCUA 1KAOA 2Q4EA 4M9UA 4OH7A 5DULA 1KBZA 3LHSA 1PVOA 4R1PA 3GLHB 3NH9A 1BZYA 4MVJH 4ZXPA 1SU4A 4OGLA 1I2BA 3MJTA 4MW7A 1GTVA 3LX6A 2Q1TA 4BFYA 3QOFA 4ALJA 1HFJA 1JKMA 2P5SA 3RHZA 3HXLA 2ZSDA 5HZGA 3BK7A 4ON9A 1B23P 1LFAA 1NU8A 4PX3A 3CBGA 1M9NA 2Q7OE 2P62A 2PMFA 3H2SA 3KQWA 2EYUA 5JZMA 1U28C 3GFSA 1GITA 4DRXB 3SF8B 3X2SA 4JJ4A 1P5FA 2RHDA 5HGJA 4U7DA 4DN6A 2B37A 2Y67A 5JAQA 3PR2B 3T12A 3WE7A 3KELA 3UWOA 2QSYA 1QU2A 2PUEA 3AHDA 1ZN7A 4HDSA 4NNPA 4IJKA 4PLWA 5CD9A 4BB0A 3JQAD 4YP0A 4L4RA 5LZ8A 2AYZA 3W9BA 2JIZA 2GPJA 4TQGA 3CRQA 3G2IA 3KU1A 3EFOA 3JZFA 3B7PA 4JI1B 5C1OA 4HZGA 3LP5A 1YMVA 5KEIA 3AJRA 5FNVB 3ID6C 4OXIA 5L7WA 1BE0A 1NXPA 3RJTA 1T5BA 1FCJA 3KUDA 4DCTA 3BRWA 3JQFC 1X3LA 1L1RA 4GQAA 1TMOA 4LZOA 1W29A 5JDCC 2GEFA 2ARKA 1UDAA 3FCUB 3R3VA 2XCSB 2WQ7A 2O54A 1ZY2A 1X9GA 4N0DA 3JQFA 2QM0A 2F00A 1ECLA 3I9V6 1GAEO 1T0HB 4EWLA 1OLUA 4RTLA 1LPBB 1YCDA 1IBKB 1L4UA 1XZPA 1K8ZB 1UBMS 3GPCA 1KSGA 1H2ZA 3A11A 3PNKA 4NH0A 1IQRA 3IEVA 3E82A 2AXQA 1NXQA 4GI5A 4M0LA 4RPIA 1NW8A 3WLMA 3CA8A 3H3JA 4LQCA 4NOJA 5EE9A 3U3XA 1P0MA 3RADC 2P79A 3KXIA 2ZU0C 3C3PA 3WRYC 3H04A 3HN7A 4O59O 1X7ZA 3GRYA 1DEKA 3JQ8A 3L49A 2CD7A 4NLLA 1O0BA 2AZDA 4DR6B 5BN1A 2DUUA 4C0BA 5ADVA 3DOHA 3ZU5A 2EFJA 4J0HA 3H2KA 5ESXA 1VGVA 2B4AA 4JU9A 5C8YF 1JL3A 1CF2O 4ZT6A 5LD2B 3O8NA 2GT1A 2WB2A 3I04M 2ZIUB 1RC1A 2GJKA 3K30A 4XOIA 3ROFA 3T7RA 3EUEA 1SK8A 1Q6ZA 1A5AB 2CL0X 2H5IA 4JVNA 3UAYA 1HZZA 4BLOA 3LUKA 2X5JO 2Z3ZA 3KCNA 1HBJA 3NBUA 4Z7JA 2JFZA 3UFBA 4ND2A 1XPRA 1AXRA 3ZOZA 4CF6A 3X0DA 2J08A 4DSTA 3B48A 1G0NA 4ZCSA 4PVCA 3JZIA 3DMFA 3HB9A 5K0ZA 3II6X 4KWEA 3C5CA 2V8BA 4FFWA 2IWRA 2WLSA 1TM2A 3N8GA 2EV9A 4F71A 1M6WA 3CRMA 3ZJVA 3USES 4BNWA 1HF3A 1MZVA 1WZIA 4AMUA 3WLLA 4EI2A 5JECA 4YMVA 2AG1A 1X1QA 3P9NA 1YHNA 1TMGE 5CT9A 3HJUA 4LNUA 4ZYVA 1KO7A 2FJPA 3K16A 2R1TA 3EGOA 1C3LA 3NTLA 4E1VA 1SVLA 1NHWA 2ZAOA 4OUDA 1Z4IA 2H63A 2ORWA 3PQ8A 4MA4A 1M8PA 4RXTA 3TNFA 4BVKA 3MRVA 2PJZA 3G17A 4BNXA 1P5JA 3A06A 3UGKA 4X5OA 4LIPD 1BRMA 4MWGA 1E5DA 3IGFA 2Y0CA 1D2EA 1UXGA 2EZ9A 5EQFA 4E4TA 4CG1A 3E84A 4CG2A 2ZUEA 3AJ8A 4H35A 2D3TA 2XB2A 3RTCA 3ZUGA 3ITEA 1JG3A 4IFBA 5TLSA 3I01A 3L8CA 2O8CB 3UK2A 3ES9A 1Q1ZA 4YV2A 2C2ZA 5ALRA 1QAOA 2I4LA 5FI0B 2PUDA 3LK6A 1OT3A 2AQIA 4QDJA 2Q1UA 3SQDA 3PPXA 1R9GA 5AK4A 4CODB 3WKAA 4RC9A 4WTOA 3NHBA 3NH6A 5F1OA 2E4VA 1U8ZA 1BX1A 2D13A 4ZVQA 5T4BA 3S68A 1QR2A 4OYYA 5CT8A 1QFXA 5GZ1A 3WAGA 1R4AA 4EKEA 2QQ5A 4Z4QA 4QDXA 1B14A 1O95A 3D2CA 5TPZA 3U7IA 4KXYA 1F8GA 5EUBA 4H1UA 5AFSA 5KYNA 2XB6A 4PGFA 5T67A 4ND3A 3D8UA 4BKQA 1RHKA 4CKBB 1Q91A 3GLHE 4O4LA 3Q2IA 3ZBPA 1GGKA 1KDOA 3GCDA 4R9UC 3KEGA 1RJWA 3QW4B 5CIWA 4HVTA 4L7VA 2XUQA 1WB6A 5JQGA 4UEWA 2FJUA 2FEWB 2GVZC 3FN4A 3GGSA 2OQRA 1A2OA 1FVOA 4ZKEA 4QU5A 4PRLA 3D6TB 1LJLA 2ZI5A 3R3WA 3ND7A 2XXAB 1R16A 4Q9AA 4BP1A 1ZGCA 2DBQA 1MH9A 1QF7A 1PFKA 2EGUA 2H7YA 4D25A 1XROA 4O25A 1IIRA 5D86A 2CXNA 1F8FA 4CM1A 3HZHA 5LQCA 1A0OA 2H11A 5LP6A 1MNQA 1MD9A 1I1NA 4G81A 4IMJB 3CKMA 5JSYA 3RIYA 2MSKA 3DL0A 3DO8A 1SHUX 3R24A 4AZTA 2PA0A 4Q1BA 3ZIAD 4CDMA 1N1GA 3BMCA 2V03A 1USIA 3ZEIA 3GLGB 1NFRA 1JKJA 1R6DA 1TUBB 2G70A 5DK6A 3HJFA 2GRJA 5LNK1 2IGBA 3O8QB 1DKPA 1X6VA 2XT6A 1PR1A 1PEDA 4ZVRA 5M5BA 1YR2A 1UAYA 5I8PA 1Q1BA 1GP2A 2YBDA 4IIYA 3UMSA 4BGDA 2FWAA 3NBQA 4QPNA 1MTZA 4TOIA 4TTAA 4X6YA 5EXDA 4C0AC 5H16A 2GD2A 2GXQA 2GJAA 1O6GA 1Q3KA 4GPEA 3IKVA 1UKAA 1MB9A 4GRAA 2GOYA 4LC1A 1HORA 4I46A 3WB9A 1IN7A 3QPDA 4I0WB 4OHRA 5F77A 4JJ7A 1Q0SA 3I5UA 1GVNB 2W8BB 2P2YA 3KYDB 3ZY3A 5KJFA 2FZWA 2YWRA 4WLFA 2HBRA 4L0QA 3LYAA 3P0JA 3VZQA 1JBKA 3ONNA 4BLSA 1IQUA 4HZIA 3WP1B 1JFSA 4A8JC 1NOJA 3GLQA 2L2QA 3E3NA 1ZQ1A 4BLTA 2J3LA 1DRVA 2JFVA 3SHQA 4J1TC 5JE8A 1AMNA 1MVOA 3PYLA 3U7EB 3RIXA 2JCXA 1SNYA 2JLZA 3A3PA 3QJGA 4Z4CA 1BA3A 1QYWA 2R96A 1T26A 3LY5A 3TD6A 5ARDA 4GI7A 1AOXA 2ZUUA 3E5HA 2WM9B 2V7UA 3PPIA 4QX6A 1R0XA 2P4SA 4RV5A 3NVKI 4RY9A 2EGGA 1RC0A 2PMKA 3ABIA 2Q3MA 1THMA 4S0XA 1QTIA 2VJOA 1SBNE 4H3SA 2YYYA 3NEJA 4JQYA 3K8QA 4FFMA 1L7BA 3IP9A 3PIDA 3UY4A 1HLGA 5EG5A 2RAUA 4LJ4A 4QQFA 3E05A 3RFUA 4HF7A 5CDYA 1LSUA 5EMHA 2EZ8A 2Y1XA 3PDIA 4YP7A 2DLDA 4TSFD 5FWYA 4YY3B 1NOIA 1T2EA 4EG4A 3LUBA 4UXJA 5CVEA 4DLPA 1PL8A 1ELOA 1NZDA 5TGTA 3BDIA 1R64A 3QITA 4BLRA 4FFBA 3U3OA 1E7SA 1SXQA 3IPRA 5KX5A 2XUJA 2OESA 3KVVA 4CN8A 3KYJB 3GH3A 5ALJA 3DDCA 3G9UA 3THOA 1EZ4A 2D3WA 1XJWA 2HXSA 1Z8NA 3COPA 1XCGB 5MDHA 3IT3A 4DQUA 3BIJA 5AMXA 3RT7A 2ABWA 5HS4A 1CLUA 3IV6A 2Y0EA 1OREA 1XWFA 3L7KA 2NQ8A 4HG2A 4AZ3A 3T35A 4DIOA 4P58A 3P4UA 1E0KA 1WY7A 3ASZA 3D59A 1I9GA 4FFSA 5F51A 4ZI7A 5JXWA 4IDQA 5CMLA 3B3FA 4XIFA 4LWPA 1C9KA 2HSJA 1P9OA 4RANA 3OLWA 3K9LA 4OHVA 3K0KA 2QUAA 4QXPA 4V03A 2DERA 4BVAA 4W6ZA 4JZKA 1XQXA 2BJHA 4M1ZA 1LQ2A 3O1LA 1QHYA 1JPVA 1D6JA 1OI4A 3KBBA 3EVCA 3LSYA 2WHPA 1FB5A 1BDBA 2Y3IA 3C3MA 4IF4A 4K6OA 4KCGA 4MS3A 1KJQA 1AZTA 1SH7A 2VP3A 1G7CA 3EUAA 3EDQA 4TLMB 2QEQA 4EJSC 2R8PA 2XUKA 3TUZC 3FAZA 2AYYA 3LQFA 1OLSB 4QD3A 1Z28A 4Q0MA 2I34A 4WRRA 3KLBA 3SFTA 4QOEA 1N92A 3KAQA 3S81A 1JG7A 4UNPA 3CZRA 2CB0A 4HGZA 1Q0ZA 2OFFA 5IT9A 4RMIA 2QMUA 4IO0A 3EA4A 1G19A 3Q72A 4KNWA 4KZPA </