3KQPA

Crystal structure of hpnmt in complex adohcy and 6-aminoquinoline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqpA00
4POOA 5FHRA 2F8LA 8MHTA 3FUTA 3DMHA 3FUWA 4QVGA 1R18A 4PCAA 5HIIA 5CVVA 3I9FA 2ERCA 2ZULA 4QDJA 2GA9A 4RVFA 1VL5A 3OE4A 2PWYA 1XCJA 4HGZA 4PYLA 3GRYA 2YXLA 4KIGA 5CUQA 2I6GA 1FP2A 3FTEA 2JHAA 3HA7A 2IGTA 5T6BA 1L3BA 3E05A 5DM0A 3HCDA 2ZIGA 1P1CA 1DUSA 2ZFUA 3A27A 3EGVA 2CKDA 1H1DA 2DULA 1RJGA 2O0LA 4AX8A 3R9XB 1V39A 1QAOA 3AJDA 3I53A 2OB1A 3M6WA 4BLWA 3RIEA 2PX2A 2OXTA 3OPNA 2C7OA 3CKKA 5CVEA 2IP2A 1I1NA 4X61A 3GU3A 5ICFA 3UWPA 5ICCA 5LQRA 1IXKA 4GC5A 4AZSA 4V0RA 4F84A 3EEYA 3GXOA 3P71T 3BGDA 4P58A 3G2QA 2B78A 1EG2A 1EAMA 2PX4A 3JWJA 4M36A 4DM3A 5DWQA 5E2BA 1SKMA 4XUCA 3NW9A 3M6XA 5K0GA 1KHHA 3P2EA 4WVLA 4O29A 2UYHA 1ZQ9A 3GCZA 4GOMD 5F2OA 2VP3A 4FS8A 5FWDA 3HCAA 3TFWA 1UWVA 2P3OA 4YV1A 1VQ1A 2QE6A 3UBTA 3E23A 4YUXA 2VDWA 1JG4A 4QTTB 5K01A 3GIWA 2ESRA 5ICGA 1L1EA 2OBFA 1IM8A 1YZ3A 3ANXA 3I5UA 3HCBA 3NTVA 5CIYA 3GJYA 2Y1WA 3PTAA 2PV0A 2OKCA 2AN5A 3G7UA 4Z2YA 10MHA 3CBGA 2DPMA 3MAGA 2YQZA 4CKBA 1XJ5A 1RI4A 3BWCA 1D2HA 3PFGA 2HR1A 5H02A 4BY9E 4E2WA 1R8YA 3KR9A 5FTWA 3TQSA 1UIRA 4C08A 1BKYA 5LSAA 2WA2A 3K0BA 1L9KA 4PYNA 3P9CA 3IYLW 3FTFA 2JH8A 4FZVA 3VYWA 5GIOE 3C3PA 3KQTA 4RTJA 4HSGA 3OCJA 2P40A 2HNKA 3MB5A 5DXAA 5FA8A 4ER3A 3PLAE 3TKAA 1VP9A 3HVHA 3T0IA 3M6UA 3FRHA 4P7JA 1JQDA 1Q0SA 4R8RA 3ER8A 1TW3A 3UJ8A 5E1OA 3P9NA 2PGXA 5FADA 2AOTA 1D2GA 4KDCA 3DTNA 2GB4A 5BXYA 3PX3A 2OB2A 2P7HA 4UOEA 3H2BA 5LQJA 3FPFA 2IFTA 4Y2HA 1D2CA 2EJTA 2AOWA 1G60A 5EMJA 3BKWA 3HCCA 1XTPA 5DX1A 1G8SA 4U7TB 2G71A 3UZUA 1SUSA 1QANA 1JTFA 4BP1A 4KWCA 3SR4A 2BR3A 2YUIA 3KPWA 4X1OA 5EEGA 5HZMA 1U2ZA 1YFLA 3CC8A 4OX9Y 4LWOA 4CKCA 1RJEA 5EQJB 5DT2A 1VE3A 5CVJA 2XVAA 2XBMA 5DRYA 3DULA 1IY9A 3C6MA 3MGGA 3OU6A 3S68A 1RJDA 4DA4A 2K4MA 1KR5A 3E7PA 5C1IA 1INLA 3EVGA 3KU1A 2PWPA 3KQPA 4Y30A 4BLUA 1PRYA 3L8DA 5K05A 3KPVA 4HTFB 2JJQA 5LQUA 5HFJA 3KQYA 5LQCA 3CCFA 1QYRA 4LWPA 2ZIEA 4DCMA 1JSZA 5HIKA 5DTMA 3B3FA 3C0KA 5EHGA 5K0JA 5LR6A 1OR8A 4V0QA 2JHPA 5KQSA 3G2PA 3LL7A 2QY6A 3EGIA 4G56A 2OZVA 1BOOA 3K6RA 2N47A 4QQKA 4ATNA 2P8JA 3GO4A 3HM2A 4X60A 5DSXA 3R6TA 3TKYA 3B3JA 2B3TA 2VDVE 1XDUA 1YB2A 2PT9A 2UYQA 1ZGAA 5HEKA 3RW9A 4RX1A 2P3QA 1X19A 1X1DA 4KIFA 1SQGA 5EHIA 4DZRA 5F2KA 4RTNA 4E2YA 3KQWA 3DXXA 3GRVA 3G5LA 5HIJA 3LBYA 3PFHA 5EIWA 1MHTA 2P35A 3REOA 4E2XA 5FQOA 3CJRA 5T64A 2PXAA 2WA1A 3UJ6A 3CGGA 1AV6A 5HILA 1JQ3A 2JH9A 2Y1XA 2ZW9A 1ORHA 1NW3A 2PVCA 1R6AA 4HH4A 3P9IA 5JR3A 3AWIA 3LCVB 4A6EA 2B2CA 1NW8A 3FZGA 2QYOA 4PGGA 4PYKA 5EMMA 3THRA 3AXTA 1JSXA 4HGYA 1WY7A 3MTEA 3MERA 4PIMA 3FTDA 2LD4A 3HA3A 4ER7A 3SVZA 1QZZA 3EPPA 2QRVB 4RYLA 2PT6A 1YUBA 1M6YA 3AY0A 3GDHA 3OZSA 2BR4A 4IWNA 5HIMA 1AQIA 4HRAA 5IKMA 1SUIA 3BWYA 4FSXA 4R6WA 1NW5A 5K0CA 3HCFA 3F4KA 2AN4A 1NV8A 2UYOA 1FBNA 1X1AA 3TM4A 1KXZA 1P91A 1KPGA 3ELUA 3GRUA 4IV8A 4RTLA 3HVJA 2AOVA 2NP6A 5ICEA 4AZTA 3KR0A 3EVZA 3G2OA 5CVUA 4GEKA 3MQ2A 3E8SA 1L3CA 4HG2A 4YUWA 3OZRA 1ZKDA 5DPMA 1G6Q1 3BXOA 3UA4A 1RJFA 4RWZA 2Z6AA 2Q41A 2ZLBA 4PIPA 3TPZA 4QVKA 2ZCJA 9MHTA 5KS2A 1SQFA 2JG3A 3MCZA 4PYMA 2HTEA 4MTLA 5DSTA 3LCUA 4F86A 3A25A 5D1NA 1YF3A 2AOUB 4RTOA 5MHTA 3DLCA 2P3LA 4DCGA 1JQEA 4YV2A 4FR0A 3B3GA 2ZIFA 5CM2Z 2E5WA 3TM5A 1M6EX 5EZSA 1P1BA 2JHCA 5K0FA 5DM1A 1O9GA 2I62A 3FPHA 4YV0A 4RVHA 1XCLA 3A7EA 5BW4A 2EG5A 5EGSA 3EVEA 2CL5A 2FK7A 2ZBRA 2ZVJA 3G5TA 3TOSA 1KP9A 5JUWA 5P8WA 5GINE 3FUVA 3O31A 2R3SA 5U4XA 1UFKA 3ORHA 4ZTBA 4AUKA 5FHQA 4C05A 1X1BA 4ISCA 1WXWA 3C6KA 5HOQA 4ER0A 4C07A 3DMFA 5LQNA 1QAMA 3KQQA 1B42A 4PCLA 5E1MA 2UYCA 2G70A 3DXYA 3FPGA 3LGAA 2NXNA 2YXEA 1N7IA 3IV6A 3ERCA 2XYVA 4R8SA 2PXXA 3P9KA 1G38A 1N7JA 2VZ9A 4BP3A 5DM4A 2BM8A 4CTJA 4M7RA 2OPBA 3V8VA 4CKEA 4RTSA 1EQAA 1JG3A 1JR4A 2IH5A 4JXJA 1L3IA 2IDJA 3ID6C 1VPTA 5EVJA 3OU7A 3HNRA 5DLYA 4L7VA 3GNLA 2NYUA 3R24A 2YR0A 3BWBA 3T7RA 3TRKA 4CWAA 5E1DA 3SX0A 3M6VA 4FP9A 2EFJA 4E70A 4GOND 4OBWA 3O4FA 3HVKA 3PS9A 2H00A 1RI2A 3KKZA 2H1RA 5DXJA 3P2IA 2O06A 1PJZA 1TPYA 3GRRA 2B25A 4P7KA 1ORIA 3UJCA 3MHTA 5EKXA 1Z3CA 2IIPA 4OQEA 4MWZA 2I9KA 4QDKA 1BC5A 1RI1A 5GP1A 3ME5A 1ZG3A 2ZWVA 1WS6A 7MHTA 2PX8A 1BHJA 1JG1A 5E9WA 3KR1A 3TMAA 4F85A 1AF7A 5K0EA 4IKPA 1KYWA 2P1DA 5FUBA 1FPQA 5LQAA 3EEOA 5E2AA 3SSOA 3G2MA 3P2KA 3FRIA 4GQBA 4CXMA 2ZBQA 4GBED 4GC9A 5KYGA 4X63A 1NT2A 3V97A 1NE2A 2HMYB 4LECA 4PONA 3I64A 3P97A 1XVAA 2OY0A 3KQSA 3LKDA 3EMDA 3X0DA 1MJFA 3LDFA 4E32A 1DCTA 5EMLA 5LQKA 2CWWA 3OFJA 1I4WA 3PVCA 3PB3A 5T67A 2ZZKA 4PYQA 1AQJA 1XDSA 3SGLA 5C0OE 2G72A 2PKWA 4AZVA 3IEIA 4CTKA 4P7GA 4EK9A 4PGHA 5EMKA 4RTKA 3BUSA 1ZGJA 4GOLD 3UJ7A 4DMGA 4AZWA 2NXJA 1NBHA 4RVDA 2PY6A 4GOOD 3QOWA 3JWGA 3SXJA 3FPEA 5DRTA 1XDZA 3CJQA 1WZNA 3HVIA 3QOXA 4LG1A 2P7IA 3B7PA 3BWMA 2KW5A 3BZBA 4RTPA 4ER6A 2AVDA 2IBSA 1F3LA 3IHTA 5K0NA 1T43A 1O54A 5DX8A 2BM9A 3TLJA 2ZTHA 4NECA 1KYZA 1P39A 3DP7A 5EOVA 3A26A 3MCTA 4KVZA 5DTQA 2PJDA 4EVIA 2IDKA 5ERGB 4C06A 4RTQA 1DL5A 1YZHA 3FPJA 3HTXA 3G8BA 2NXCA 1NW7A 2HWKA 1FJXA 3NWBA 4ER5A 3Q7EA 1VIDA 2ZZMA 4YUYA 2YXDA 5FWAA 4DF3A 4XUEA 5B1SA 2IBTA 3BT7A 1XXLA 1KPHA 1G8AA 2FHPA 3O7WA 3FYDA 1YFJA 4YUZA 3BGIA 1RI5A 4R05A 3DXZA 2OYRA 3NVKI 2PLWA 3OU2A 5E9JA 5K09A 2BH2A 2AOTB 1KPIA 5EKUA 3GRZA 2WK1A 5E9QA 2I7CA 5EEHA 5KVAA 3RODA 4YMHA 3LDGA 2Z6QA 3DUWA 1R74A 1NBIA 3KPYA 3SSMA 3OFKA 1FP1D 3GWZA 3SMQA 5GIPE 3FUUA 3EVAA 2AR0A 2HV9A 2O57A 3D2LA 3KQOA 5FCDA 2ZZNA 5E1BA 2C7QA 3R3HA 3KHKA 5CVDA 2ZBPA 3P8ZA 3HA5A 4KDRA 3ER9A 3ELYA 3NWEA 4QTUB 2VS1A 4M37A 4DKJA 2G8NA 5KQRA 1JTEA 4GUAA 4OBXA 2PX5A 3ELDA 1F38A 3I58A 3B5IA 4C04A 2NNWB 4OQDA 3EVCA 5BP7A 2O07A 3QV2A 3THSA 3TR6A 2GLUA 4B17A 4H0NA 2EX4A 2UZ4A 4KRGA 1EJ6A 1JG2A 2FK8A 2ONYA 1HMYA 2QM3A 3NDIA 4M38A 5GM1A 5K0BA 2G1PA 2P41A 5DM2A 5GWXA 3NJRA 3T7SA 3G89A 4FT4A 3UFBA 2ADMA 1G55A 5EZQA 5GOZA 2B9EA 4DQ0A 5K0LA 3JWIA 3EMBA 3SSNA 4MHTA 2FYTA 3FUXA 1WG8A 3BKXA 4RV9A 4OA8A 3U81A 4XCXA 5K8VA 3PT9A 3UA3A 2GH1A 4EKGA 4XUDA 3SM3A 4PWYA 2AOUA 3DMGA 3LHDA 5G02A 4FT2A 1KIAA 4C4AA 3G88A 3LBFA 4P7FA 3GGDA 4EMSA 4YMGA 2IH4A 2R6ZA 4HC4A 3NDJA 2AVNA 3VC1A 3JWHA 5FA5A 5BW5A 4RTMA 4FSDA 4KW7A 3EVBA 1TW2A 3NVMB 1SG9A 3LKZA 2YTZA 2C7RA 4GF5A 3CJTA 4RSRA 5E8RA 1HNNA 2ORED 2AS0A 5F2NA 4A6DA 5DX0A 3KQVA 3LDUA 4PYIA 3NMUF 1NV9A 5GM2A 3UJDA 4HTFA 4K6MA 4PNEA 3VSEA 4E2ZA 4OA5A 4C03A 4FGZA 1VLMA 1QAQA 3KR2A 2V7EA 4U7PB 4EKIA 2PSSA 4QQNA 3LCCA 2FPOA 5DTRA 3R0QA 2AN3A 3A4TA 2AOXA 4RTRA 3OE5A 1N2XA 2YX1A 4QPNA 4R6XA 1EIZA 2NP7A 4IV0A 2CMGA 3UJBA 2GPYA 3WSTA 4PYJA 2PBFA 1O9HA 2QRVA 1SVUA 5CCXA 1NW6A 2C7PA 2EJUA 4MIKA 3FTCA 4E30A 5C9ZA 3KPJA 1X1CA 2O05A 3DOUA 2VDUE 4PYOA 5EG5A 2CMHA 5FULA 3EVDA 3AXSA 3HCEA 3KPUA 2Z6UA 2XYRA 3A7DA 2IH2A 2AZTA 3MTIA 2IPXA 3DR5A 4BLVA 2ONZA 3VC2A 1VP3A 3M33A 5K03A 2BR5A 3LX6A 2A14A 4WXHA 3LECA 1M0EA 2ZSUA 4YUVA 4EQZA 5M5BA 3BGVA 2XYQA 3G8AA 2FCAA 1Q0TA 3HEMA 3PX2A 3UJAA 2FRXA 2PXCA 3CVOA 5CD1A 2H11A 4RVGA 2OO3A 2ZWAA 3M4XA 3Q87B 1VBFA 1Y8CA 4MQ4A 3LSTA 5EIFA 3KQMA 1ZHFA 3C3YA 5CCBA 2GS9A 5EC8A 4QPPA 4E31A 1EJ0A 2YVLA 1R00A 2GAFA 3B89A 1NKVA 3EVFA 3FYCA 1RI3A 3HP7A 3EGEA 5IH3A 2BZGA 5D1HA 2NXEA 3DH0A 1WXXA 4PINA 3UJ9A 2V74B 2XVMA 3DLIA 3LPMA 3M70A 4X41A 3OZTA 1R8XA 3T7TA 5EPEA 5E8JA 3ELWA 5FQNA 1I9GA 4E33A
chains in the Genus database with same CATH superfamily
1TQ4A 2C77A 2RG7A 1Q0ZA 1IC6A 3MMXA 1AQNA 3DMHA 2BZ0A 3MWFA 1XJWA 3RQIA 4UTPA 1G66A 3MPOA 1ORTA 2NQTA 2AH5A 3A14A 4XKJA 1NW4A 2ERCA 4UNIA 3C97A 2QTRA 3GB9A 3SMVA 3ZE1B 4E15A 4E1AA 3DDZX 4G65A 1KO8A 1WU7A 2PLNA 1H2RS 4LJAA 4ZHSA 1Q92A 3AVOA 4PHFA 1T2CA 1Z8NA 4W8GA 2Q9BA 1REQA 2A84A 4G0ZA 4INZA 4XJXA 2C9MA 1FFGA 4X8HA 3VR4H 5AOCA 1PX0A 1TAHA 2HK6A 3FDJA 8ADHA 3NIGB 5DI3A 5AR1A 5DBFA 4MKRA 2B8EA 2WAOA 2Y27A 2BF4A 3RVDA 1D03A 1HA3A 1RJGA 1DXYA 1RVDA 1RLTA 3I4FA 4L8WB 4YT5A 1ADJA 2IXTA 4G5XA 3WL8A 3IQEA 4KKXB 3F3YA 3LOUA 4J43A 4EKYA 5IHPA 5KNDD 5D3KA 2O8BB 1BWPA 2C95A 3F71A 1A2QA 3VJMA 2WUWE 3GU3A 1CJVC 3TEJA 3X2FA 3OJXA 4N6OA 4W99A 3DMYA 1G3MA 3FJOA 3BWXA 5SZHB 1PDOA 3I5AA 3PDWA 4HLUC 5BRNA 1LBHA 3PRYA 3RS8A 3FSGD 1MDFA 5CD9A 3BG5A 3KOZA 4PW0A 2V6BA 3VO1A 3VU0A 1VI6A 2W83A 4DIKA 3RG8A 3F9CA 2V7WA 2HZBA 1SRRA 5LQMA 4O4LA 1DB3A 4DARA 3MM4A 2H8KA 1CSEE 4TX1A 1ABBA 3WIEA 1HM5A 2RK3A 2VP3A 4FS8A 2D0PB 3MCVA 5DP1A 4UD6A 2JAPA 1DAEA 1QPBA 2OG1A 2QE6A 3U39A 2AZDA 4PAWA 4BX9A 1LDGA 1VHLA 3HFJA 3N76A 3UK0A 3EZFA 3R3WA 4ZJUA 2F9FA 5KKAA 1TUIA 3N6VA 5LB2A 2VATA 5CGZA 3RAJA 1NVXQ 1VYHA 4TLEA 4D4GA 3HBFA 3HACA 3UKDA 4DSUA 4KREA 2R47A 2X9VA 2MSWA 2VYNA 3BFKA 2IXDA 4UMVA 3Q5EA 4KQHA 4NNJA 1VMIA 3ETHA 3KZ1E 3R6GA 2QX4A 4XSGA 2H8GA 2PWZA 2PWAA 1M0SA 2WM3A 3M83A 1TTQB 2HV8A 3NRCA 4RXTA 2RG1A 3VR5A 3B6ZA 3IHKA 3WL7A 4CT0A 3TW6A 3KQTA 5EXEA 3OCJA 4DILA 4ER3A 2CNBA 3A1FA 4C3UA 2PFSA 3W3AH 1VP9A 4EENA 3ESBA 3NHFA 4G2NA 4R8RA 5KNDH 2DUJA 2IYQA 1TW3A 3DL2A 3KHTA 2AG6A 3PUXA 1FFYA 1QORA 3QJ5A 2VHZA 3FXAA 4DLXA 3IQGX 3SXPA 4P4LA 1ATZA 1O96B 4P80A 3WYGA 1ULUA 1ZJZA 2I6QA 4UOEA 5BUQA 1RCUA 1FNBA 1CVLA 3R40A 4DUGD 1YIDA 4NE9A 2EJTA 3RTEA 3S2UA 3WK6A 4D3SA 2PGAA 1JFSA 1YDMA 2G77B 5EKSA 1NONA 1T1IA 1ZY2A 4ARVA 2CDNA 4X95A 2G82A 4ZU3A 4LFBB 2CJFA 4WMLA 2J9XB 3ON5A 4D9FA 1A9YA 3BE8A 5EEGA 4EA6A 3NOXA 1FU7A 4B7UA 4XJTA 4KQFA 3LUBA 3S40A 1RJEA 1JAIA 2AFVA 1FP4B 5CFPA 2IVFA 3I6QA 3DULA 1IY9A 3C1AA 4QYMA 1Y7LA 2XIJA 4R2WA 5LP6C 2DHCA 4BNUA 4RULA 1HRDA 1R0LA 1INLA 1JXQA 4FN4A 3TN7A 1E20A 1ZNXA 2FJ0A 4Y30A 2DFLA 5KC9A 2I5PO 3STTA 3OTOB 4BRZA 2Y6UA 3W5JA 4PX3A 4ZT2A 4P08A 2WHXA 3UUGA 5DTMA 1EUYA 4KPYA 5LMNB 5ER6A 4YJ3B 1CLUA 2Y93A 3QLVA 3URKA 1P5ZB 1WUJS 2FFAA 4V0QA 4ERXA 1IN1A 1EFUA 3G2PA 2M2IA 3IBSA 5AKHA 3KUUA 4ZO7A 2UZ1A 1HFKA 5AOAA 3AVYA 3H2JA 1C9JA 1USUA 2C2ZA 4EPVA 3BDIA 3SKYA 1BX3A 3I01A 5C8XA 4YY3B 1LDBA 4EJSB 4WJLA 3P4YA 2OZLB 2VLIA 2Z8YM 1XDUA 2WKSA 4J16A 1N6IA 1ODIA 3GROA 2CHUA 5DB4A 3OX3A 5LMCA 2D5CA 1Z13A 4LZZA 5EXPA 2GK4A 4ZALA 2IHVA 5KYVA 2RGBA 1U2DC 3A04A 3EDCA 3IT3A 3DFIA 1KI7A 2P35A 3N7TA 1MT0A 1Y80A 4L9WA 4AP5A 3NAMA 4MJ7A 3QTTA 1N9KA 5HILA 3O4RA 1FF9A 1P0PA 1KHTA 3A6GA 1GXSB 1OASA 3FSRA 5IUKC 1M2HA 1N5MA 1SBNE 3PG5A 3F6CA 3F67A 2C3MA 4YJKA 3TK1A 4MKHA 3F9RA 2FMTA 4P5DA 2QYOA 1Z4MA 1P0MA 1CY0A 1BXZA 3G2IA 4BFTA 3UMMA 4WX2B 4ID3A 4H9GA 4YCAA 4JLMA 1VTKA 1W48A 1L7OA 1YZNA 3AY0A 4RYLA 4A73A 1G5HA 1XA0A 4D02A 4CEHA 5KSWB 1UXHA 3EODA 1SUIA 2FPKA 4FSXA 4KX5A 1TQDA 4LDZA 1WULS 3JVVA 2HUNA 1OBFO 3U4MA 2PA0A 1T5SA 1Z2AA 7ADHA 5HOQA 3HN7A 1P91A 1KPGA 2VT7A 3GRUA 3RUCA 3SU8A 2ZBVA 1S2OA 4OXIA 4ZQEA 1E9AA 4ANFA 2XV1A 3G68A 3FNFA 1BGWA 3E9QA 4IVPA 4DDKA 1W87A 1Q3KA 2ZQZA 2B94A 4HDSA 5HR5A 4D3ZA 1JJVA 1FMCA 1U1GA 3GIDA 5FPHA 4UTRA 4G0WA 1NQTA 2OV3A 4TMWA 3VBEA 1JPVA 4LJKA 1N2EA 3RTGA 4G85A 3N2KB 5EESA 1HT1E 1N5LA 1XD2A 1FFAA 1WHTA 3KELA 2AEFA 4N7BA 2QUKA 4OAPA 2WDZA 3U44A 4F60A 1U7UA 4DBLE 3WA6A 1SXJA 3S5JA 3DLCA 4A26A 2Q0SA 3E7FA 3GJZA 2O0JA 2EP7A 1QE0A 2UZIR 3OLWA 1QRRA 3E9EA 3OQBA 2JI6A 1YOVA 2BFFB 4J3JA 1GZDA 5FFMA 1TO6A 4YV0A 2XMZA 4K6FA 4NIMA 1XZQA 3EIOA 1JHQA 4LF9B 1L4YA 5EGSA 4Q7QA 3QLEA 1GUYA 1CUVA 3CPEA 5JUWA 4Y2RA 2E7ZA 2ATEA 4R1PA 3QY0A 1QCZA 3FUVA 3UMFA 4DIDA 2NO1A 5AK3A 3ZE2B 2DH5A 2FZVA 1A5SB 1PX2A 1DIGA 2O8VA 2PX6A 3TQCA 4CLXA 1R6VA 2ZB2A 4C07A 2ZB7A 1DAMA 4FDLA 4JIGA 1B42A 2VXYA 3RC1A 3RVNA 4B0OA 1E3MA 3OQNA 2ON6A 2NXNA 1P4HA 4IOLA 4JBYA 1ZGCA 2VDRB 3AB3A 4ALMA 3SC3A 2CYBA 3PEFA 4R8SA 5LJLA 2WYWA 1NZDA 2FGJA 4HZUA 1N7JA 1XMIA 3RIMA 1HBJA 4CFZA 2I6UA 4LQCA 4TZ0A 2J3MA 3KBOA 1KF0A 1JR3E 4L8YA 5KDDA 2OZPA 1OIVA 1RP7A 1I30A 4HN9A 2QLLA 4DCNA 2VDNB 1RXSA 2HSDA 3PNMA 3DD1A 3HPRA 1GLNA 2W6OA 4IKEA 4LXYA 5LU9A 3LHKA 1PYGA 3L8FA 4OQMA 4PYRA 4CE6A 1GCOA 2EW2A 2A33A 4C7MA 4KFCA 1Q7EA 3AR3A 4MZDA 3MJHA 3IR5A 1JGTA 4OXYA 3PJDA 4OEHA 4G4SO 4FP9A 4YXFA 1PIWA 3ILSA 1JHXA 4J9UE 5ALHA 3SLKA 5IT9A 1XJ0A 4W9MC 4A8JC 4NRDA 5EVCA 2X13A 3V9AA 2XT0A 4D7AA 5LUAA 2PS9A 2QUZA 3EZ2A 3K32A 3MVEA 5DHPA 2HDOA 3C3AA 3UJCA 2N75A 2SNIE 2EL7A 1BJTA 4IQ0A 4C5BA 5JXIA 1OREA 1IN5A 4DRYA 3BA1A 2KLHA 1KAHA 2O7SA 1SUPA 3OFSA 5I9IA 3L8EA 3SF8A 3KR1A 5AJXA 3NDPA 1U9ZA 4E11A 5H80A 3I9MA 1KJNA 2K6GA 3I9KA 2IPMA 4M0EA 4MR9B 5E2AA 4DBVO 1DNPA 3OC0A 3UXHA 4BAZA 3W5IA 2DTDA 2XTMA 4OG2A 4W1PA 2J9FB 3P0IA 1I80A 3R0VA 4BECA 3K8QA 3IX7A 1WXQA 1M73E 2F9MA 2QL5A 1KO7A 1RQLA 2ZZKA 1XWWA 1XKTA 2P6NA 5JSZB 4X91A 2ZT6A 1URPA 4UBMA 3RS0A 1T1RA 4XVCA 4PGHA 3PIIA 3OQ6A 2FI1A 3L7JA 5C80A 1EAYA 1E9EA 4L72A 3K09C 1MJ5A 4RVDA 5CXSA 2IXEA 4AZWA 5CFNA 3IP3A 3JQBC 4MKGA 2HPHA 4OQZA 1RZVA 2IV7A 1NA5A 2B2NA 2J3IA 3FYSA 5IVDA 4B3CA 1WBBA 2EKDA 5J63A 4J0IA 4FCTA 3MINA 2N1BA 4JGBA 4BMNA 3JR3A 2JLZA 4DSZA 1YGYA 2XLBA 2XSZA 2ZBUA 5EOVA 2QE7D 4E21A 1UPCA 1HL7A 4CN9A 4I9GA 2GCIA 4N54A 4XX1A 3RU7A 2PAAA 3DG9A 2A0KA 2VBGA 4MV5A 4N76A 2VT3A 1IMJA 2P78A 3KJZA 1JPUA 4NG4A 1HLDA 4NX2A 4QBKA 4RF4A 1US8A 4LQDA 2WSIA 4HDOB 4DF3A 2ZQ5A 1GPJA 4R16A 5JNRA 2FPIA 1U9IA 2J4FA 3HVUA 1OLXB 4KCGA 5K9ZA 4RDHA 3VYSB 3TLYA 1GAEO 1UOQA 3AY6A 3VH3A 1T9DA 2CVZA 4ERNA 2ZWIA 5CNIA 2WIBA 4BNFA 2WT4A 4PHGA 1XP5A 4L2IB 2PT7A 2JCSA 1FTYA 1QR6A 2WV9A 3TMKA 5BQXA 1PV4A 1U4OA 3NVKI 2KB0A 2Y0DA 2AOTB 1Y63A 4NZMA 1TLTA 3RG2A 3RUFA 5BN3A 3LQFA 3N2EA 2WP8J 3GXBA 3JQ8A 1K6JA 2BBOA 4DLTA 2QP4A 2O2SA 3ED1A 3KPYA 1JQBA 3LT0A 3B7GA 2EQ5A 1G5QA 3U3DA 4XQ9A 4I2VA 2O57A 4TQUS 3IP5A 2J59A 4LGMA 3RU2A 2OR3A 3WGZA 3BFPA 1PSZA 2BM0A 3NPMA 1RAIA 1Y81A 1GKYA 4M1WA 3FOWA 4Z9XA 5F78A 1OGYA 5I4KA 4FS3A 2WTUA 2MINB 4K9DA 1VGVA 3M49A 1L4KA 4YYZA 3LXMA 4W5RA 3VZQA 1G21B 2VTDA 2XWBF 4HGPA 2H1WA 2PS3A 3I92A 1BX1A 1HXHA 5TDHA 3WYDA 1OH5A 3OJFA 1R5NA 2QZJA 2Y67A 3SM9A 4Q15A 1QSGA 4FB4A 1D6SA 1FFXA 4KMOA 2QKYA 1QHIA 2C5SA 4ESEA 3LQYA 1XPRA 2IWRA 4FYXA 1BG6A 2G9RA 5LN1A 1MD9A 1WB9A 1NNEA 3G89A 4WBSA 1J9ZA 2BN4A 2RIPA 5EZQA 2ZT8A 3PC6A 3QA3E 4Y7DA 5LPNA 4YJHA 2WM8A 4RV9A 1MV8A 3MJVA 2QT0A 1BCSB 3IDFA 3T7DA 4ZMSA 3P5SA 1B0UA 2H07A 3K1YA 3LHDA 3PPIA 1IJFA 4FT2A 1E1DA 3VTZA 2WNIA 2O4CA 3D9QX 3BHIA 2WF5A 1ZC4A 4JWKA 3D7KA 4CMJA 3L7BA 5FA5A 1ABFA 3K20A 2R11A 1D0VA 1CS0B 1OFUA 4JVOA 5JZ9A 1SG9A 1TZJA 3H87A 5LYYA 3CBQA 5C18A 4X0EA 1H65A 1NOJA 3ESRA 1JEYB 1SBQA 4H7HA 1HNNA 3E61A 5DBIA 2N42A 4QYWA 3OQOA 1BHO1 1AJEA 4ZT7A 4CCAA 4JQOA 3T5GA 1YB4A 3ULKA 4F38A 1C1HA 5AD1A 1NY6A 3PV0A 5ALYA 4BKQA 2DPXA 2I55A 3LL4A 3MIZA 2PBLA 4FFVA 1YD7A 4TVOA 5KYKA 4I5FA 2QN3A 3OKCA 3KT0A 3KOMA 3RBXA 4B4VA 1TIPA 2AD1A 1FQJA 3LXRA 3OE5A 2IOFA 1RYHA 3CNEA 4QPNA 5EXXA 5HCNA 3SIRA 4DA8A 1Z5WA 4JAVC 4PO3X 4D4KA 3COJA 3THWA 2B4KA 3RS7A 2XOKA 4ETMA 2HJWA 2QORA 2VAVA 4QFMA 1YZFA 4J2TA 4AJNA 4DSOA 4DTIA 4H7FA 1X1CA 4J6EA 2AHOA 4PEVA 3ZK9A 5BN1A 1MBZA 3PGVA 3HKEA 3M82A 3H11A 5H16A 3R3VA 2FPIB 1A8IA 1C3XA 4CIWA 1YHNA 4M98A 4F2HA 2JCBA 3NHSA 3B5EA 2FR0A 3B12A 3ET4A 3LX6A 4NNOA 2SHKA 2ZSUA 1LXCA 4XIYA 4RF5A 5F73A 3CEPB 3EXFA 3OETA 4UE3S 3PA8A 5SY9A 3K9LA 1EWKA 1W581 3BH7A 2QYSA 5BN3B 4ND8A 2C2OA 5IMBA 4KQ2A 2CHEA 3Q87B 3QVWA 4UU8A 1R37A 4F5WA 5KQGA 3O1HB 5DGIA 3RSOA 1G3UA 1RKUA 3OWXA 3G5UA 1M2VB 1IM5A 2GAFA 3FMOB 3TMYA 3EGEA 3BJEA 3G0HA 2NNLD 4CVNA 1CUSA 1IL0A 5JBNA 4Q3BA 3PWKA 1OKKA 1GGMA 5KSOA 3QH4A 2PRKA 3WGTA 1KVRA 1CQWA 3OCWA 2XQFA 4OQYA 1EFVB 4QKQA 5F1PA 4WBNF 5A4AA 8MHTA 2RD2A 2G9UA 1GTG1 1SXQA 4FOSA 2ZBFA 3R75A 1Y9DA 4QBIA 1J1ZA 1NHGA 1JWAB 1NSFA 3JARA 4V1CI 3EYWA 3GJ4A 1VHDA 2R00A 4AMZA 1EHCA 1W25A 1SOWA 1K5PA 1UKZA 1TUBA 2K5UA 4OUDA 4WXPA 1S7GA 2MSKA 1NQWA 1F1JA 2B4AA 4FTWA 7REQA 3AFHA 3LV8A 1JDUA 1EGQA 2C4WA 3AF2A 5KAMA 4R0VA 4Z9FA 2Z1DA 1UJ5A 2ZCUA 1T3LA 3E0XA 4S1WA 4D4MA 3EXHC 4BCBA 4C4XA 3AHFA 5B55A 1O3YA 2IP2A 3X1KA 1ZD8A 2HLPA 2Z3ZA 3IO5A 4BO1A 4DJAA 1C30A 1I2AA 2Z9BA 3VR6D 5TXGA 2SCUA 5ICCA 1MNAA 2JJ2D 2VJMA 2X8BA 1ODSA 3L0IB 2HUPA 1AKEA 4NV1A 2II6A 4FFRA 1F0KA 4RGVA 1J70A 4YHBA 4LF7B 2A3RA 2ET6A 1SVLA 3H19A 4KMSA 2G25A 3QZUA 4LHSA 4QHSA 1E96A 1XTVA 2W4QA 5AWFC 3SZGA 3EPKA 1GV1A 2FVYA 1YVUA 5FWDA 3AR8A 5J2UB 1KMCA 3T7KA 5L8VA 2CYAA 4ND4A 3CRQA 1BXGA 1P2BA 1SUAA 2OKGA 4HGQA 3QLJA 4DDTA 4ZXPA 1AGNA 2F1JA 1EFPA 4HDKA 3V1TC 2PBZA 2Q7XA 4Q4AA 1IWOA 3LFUA 4Q7MB 2W8BA 2MHCA 2PHZA 2H7CA 4X62B 3LFHA 6NULA 2QA5A 1PJSA 3OBBA 4UTZA 3LRPA 4I0WB 1SVSA 4H4EA 1NVVQ 3VR0A 5C7LO 2EX1A 2G5TA 4UTVA 5LXTA 1EGAA 3LCJA 1SUBA 2OAQ1 3JWEA 3OTGA 4F2PA 5JDIC 4J7XA 2F3RA 3TX6A 2JFOA 1FU4A 4GLOA 2D1RA 1G64A 3LUCA 5GIOE 3HK2A 1CRLA 3MB5A 5COBA 2EDCA 3DFUA 4JENA 4YCSA 4IDBA 4JSRA 1T5OA 2FCRA 4UU0A 3Q3CA 1AQUA 4MYHA 2UUCB 2W4MA 3P9NA 4DE5A 3R9IA 5EJ6A 3QOFA 3H6KA 3RS4A 4PG7A 1RVV1 2YYAA 2RK4A 3WYAA 1DOAA 2IZ5A 2JFBA 3PX3A 3J7TA 1JYEA 2IFTA 4AS1A 2IYWA 3R5FA 4U00A 2UZ1B 3HCCA 4GYYA 5EP1A 1M2JA 5G1OA 3LC1O 4C4PA 1JPNA 4PGAA 1QANA 4O5AA 5I7VA 3QEBZ 1D09A 1KZ4A 4R4JA 1LY1A 3QBEA 1VLVA 5EJIA 5IX8A 2X4DA 3LO5A 4L07A 3P4XA 1U2ZA 1U31A 4JB3A 4PF1A 3DV2A 1JH8A 3QEJA 4JB0A 3S81A 2NSYA 3MT8A 4MJXA 1YTUA 1KI6B 4MRSA 5C1OA 1X3SA 1LPOA 2XBMA 1E9VA 1OYWA 4LF8B 5C1BA 4OP1A 4DMLA 1YHYA 1Z2EA 2JPDA 1O0SA 1ZJYA 1QZUA 3KU1A 1H1LA 2MYNA 4OI2A 4BNVA 1U8FO 2A8YA 2ETVA 2WWHA 4C3VA 1J00A 2R4TA 4RC9A 3OCYA 1ZA2A 1PUXA 1WM1A 1WWKA 1K2WA 1WUTA 4M1EA 4OGFA 3QYJA 1RMYA 4NCNA 4ZDWA 1BROA 4FGKA 2IHKA 1VA4A 1ZCBA 3AFOA 4QA9A 5EIAA 3SLGA 1GA4A 2PZBA 5JXHA 5LYJF 4MV9A 4Q19A 5KQSA 1MOZA 5EIEA 2OOSA 4C6TB 1BOOA 2GM3A 3P7MA 3MGAA 3WZLA 3Q8MA 1N4DA 5BQOA 5DW0A 1E2UA 1M2WA 1DT5A 1WMFA 2SECE 2W58A 3AUYA 3HM2A 2CFCA 3HMKA 4ZCLA 4BNKA 3CNLA 3D6TB 3TB4A 2JK0A 1C9MA 3LW7A 1YASA 4ENSA 3QVUA 2G6TA 4WOPA 1DFGA 1X1DA 4UZSA 1P4AA 2CY0A 2QRHA 3S2IA 2P2GA 1NVUQ 5EGNA 1PWYE 5EXDA 3AEXA 4E2XA 4AMBA 2NZJA 4TKVB 2LV8A 2WA1A 1BQ4A 3E7DA 5JSKA 1E6LA 4N12A 1FZTA 3NATA 4KBFA 1KKUA 1RYDA 1JW9B 2JH9A 3ETDA 3QF4B 1BXGB 2BMFA 1UKAA 3AQIA 4OOEA 3TTVA 5LLSA 4RMHA 3THOA 4EYEA 5KIAA 1SXHA 3AWIA 3KSDO 3HCPA 4C3OB 3MLEA 5EKTA 3TZEA 1CJTC 4AZ3B 3KZCA 2NUTB 3DOCA 3HKCA 4KBGA 3T7CA 2R8BA 4DDMA 3L4BC 3PQ5A 2M98A 3F74A 2VQDA 1C4KA 1O95D 2VWGA 5TVGA 3E18A 4BDSA 1QV9A 3B38A 2GAIA 2Q21A 4HRAA 4UW9A 4L9RA 2IUUA 4EW6A 3AHCA 1UXKA 1XEXA 1YVRA 4TWAA 2GEJA 3HUUA 2Q0QA 1XCPA 4UOQA 3T5MA 1ZD5A 2OD2A 1W88B 3HVJA 4NK4A 3T06B 4OHZA 2E18A 3HFSA 3T3MB 2VXOA 1WMBA 4IMJB 3EDRA 2QAGC 1T3GA 3VI3B 1J8QA 2ZTSA 1U7TA 3RU9A 4Z8XA 1XGKA 3H1TA 2LKDA 3GFFA 4X6LA 4Z0HO 4F6RA 4J1TC 1SXPA 1KR2A 4HG2A 2LZ0A 4OM8A 3WMGA 5A4DA 1BRTA 3F7NA 1EXVA 1Q1QA 4BHTA 2NU6B 1LUAA 4Q7LA 5FBRB 1MC1A 1NSYA 2BH9A 4WUVA 3WGYA 4RVNA 2AJLI 3ZGLA 1ID8A 3PQ3A 3GLKA 3F6BX 4RABA 4Z7NB 3F5MA 2HMTA 4YXWA 4EYGA 1QGDA 3H8VA 4PTZA 5AVJA 4M49A 2R84A 5YASA 4CMBA 2JCXA 3VDQA 4ARBA 3MD0A 4KK4A 4YCDA 2JHCA 2OQIA 2QX8A 1KY4A 3FPHA 1JWBB 3GJ6A 5FUVA 1E2HA 1RYFA 2OHVA 1PD0A 1RQ7A 3SEQA 1BKSB 2ZIUB 3AR6A 4QUJA 5CTJA 1WMDA 1QTRA 1XL0A 3N5CA 3JVEA 2XQGA 5BT8A 2P2DA 2VCHA 5EJGA 4BGEA 1TXGA 2CK3A 5AK5A 1JFRA 5BSRA 2ZS9A 5IT4A 2DJIA 5GADl 3FX2A 1Z08A 5CGQB 1OV6A 3OCZA 3TQFA 3HCWA 2PMEA 3ZCSA 4QFBA 2VPYA 1N7IA 4WN9B 3QKRB 3MTBA 3TFQA 1KJIA 3QP9A 1U9IC 2RCYA 4ZAVA 1QGAA 4OJKA 1SQ5A 1NWHA 4NYMR 4ZHQF 3BBPA 3K3PA 3PITA 4O2AA 2B1JA 3L6EA 4CYMA 4QJ3A 1EQAA 1A97A 1FLAA 1JR4A 4M55A 1ZLXA 4RTSA 2KE5A 2IDJA 3FD8A 2CNWA 4OGGA 2PNJA 3UBMA 2PX0A 4YQYA 4H60A 4N6NA 3FAZA 3ZXXA 3T7RA 1E3WB 1A9XB 4EFDA 1N1EA 1EA5A 2A1UA 2H92A 4JLBA 3M2TA 4IGFA 1KBOA 1R4AA 3ROEA 1I7QB 5K8LA 5EWLA 4TS9A 1UQRA 1WCWA 1U0EA 4MH0R 5C4IA 3OZVA 3P2IA 1U8AA 5KUTA 3IL2A 2O06A 4C30A 3FYHA 1TT7A 4MI9A 2AK3A 4IJMA 4H7JA 1ST3A 4BMDA 1XMVA 4QGAA 5EKXA 1JEAA 1I9CA 2ATXA 3PFBA 4YWJA 4KZPA 2ZUEA 1GKLA 3ME5A 2ZAMA 3JX9A 2ZWVA 3QYPA 1PJ3A 1YK0A 2VBCA 4P5PA 1G2PA 1T15A 3RRYA 4YCLA 2ZYRA 4D5GA 5K0EA 1M0WA 3RYHB 4GD3Q 4Y0NA 3CPJB 3L93A 2FWIA 4OBBA 5A2QA 1RXEA 3HJNA 1W9MA 5MDHA 3NTLA 3QU7A 4BO2A 2GBLC 4HWOA 4FGWA 1PW5A 3UWDA 4KO1S 5BSWA 3VYVA 3PB3A 5DIZA 1U7PA 2NGRA 1AQJA 4IIJB 4FGJA 5DVZA 3CW2A 1MVLA 3IEIA 4OFXA 3QLUA 4PZUA 1KMMA 3U26A 4WOBA 3VR3A 4RTKA 2FJPA 2GM5A 2X8LA 3GDWA 1J2TA 4NPAA 4DANA 5JWRA 1SKAA 4NJMA 3RAEC 4I3GA 3JQDA 4UTOA 4OMCA 2HWXA 2ANBA 2I34A 1PNVA 4DCJA 2NU6A 4C0JA 5F21A 3IOCA 4LCEA 5KTTA 4MQFB 4PLCA 5ITZB 4XQCA 1MJGA 4KOAA 3GPCA 5ESDA 2O4UX 1MAAA 3GWGA 3MB8A 4UHHA 4CMEA 1P39A 1JXAA 3EHEA 1ZGGA 2BTQB 2YBDA 2AKEA 2P9EA 4RIIA 3ZCXA 1JDSA 2ZUSA 1KO4A 2JI9A 2P4EA 3KTAA 3RDPA 1HQYE 1FFBA 3SVLA 2I54A 2IZ1A 3GFVA 3E4DA 1NQOA 4CM7A 2JZCA 1U0OC 3AP2A 3P96A 1Z33A 4Z9BA 5K4HA 1RAFA 3COPA 2AJTA 2Q4DA 4O2LA 1OH8A 4Q4HA 5A04A 3I5MA 3L5OA 1XPOA 4YACA 4S2EA 2PZMA 1NUAA 4FW8A 1OAOC 5CYOA 3WKCA 1MABB 4DXAA 4ZMBA 1GZ3A 2WF6A 3RT9A 2OYRA 4I50A 4MCHA 5K09A 2MTBA 1PQPA 1L5FA 1SFRA 1JVSA 2JATA 3MUNA 3PE3A 4NY1A 5LYJB 2IVZA 1ZCJA 1VCHA 3VPSA 2XUIA 1QH9A 4XPZA 4OB7A 1NF8A 2HH9A 4GZLA 1WQ1R 1DUVG 3P9YA 3AILA 3FVQA 1C7ZA 1JUDA 3OFKA 4NVRA 1WLSA 4BQRA 3TGPA 1EFCA 4ASUD 3WZ2A 4KTVE 1JU3A 2C5AA 1OVGA 2F90A 3NDRA 3TJRA 3OZWA 4QGGA 1A7AA 2BF7A 4X64B 4BQIA 4URXR 3PVZA 1DKRA 5SZJA 4BQOA 4P0TA 4DLSA 3GVXA 1P3JA 2EOAA 4B6PA 4C7VA 1E7QA 1TEVA 1Y1LA 2QP3A 3PT5A 1CS0A 4G1MB 5BWCA 3ELDA 1E2NA 5I8WA 1K6XA 5A05A 4ND7A 1R0ZA 2XCQA 3L8CA 2VPTA 5ELXA 2VP5A 4KWIA 4PX9A 3VR5H 3RAGA 1CJMA 3TUJC 1VLLA 4M0DA 1MQAA 3DZDA 5DNCA 4QREA 2IDZA 3C8ZA 1G4AE 5I47A 3STHA 4BVKA 4CF7A 3NDBB 1WQ3A 5GWXA 1PZGA 1GAJA 3ZX4A 5J9FA 3AIOA 1C0IA 3GQBA 1WZ2A 2YC4C 3DB2A 3U40A 2PUCA 4FYMA 1DJLA 1RLIA 5IM4A 2QNBA 1O6CA 3OZEA 5TX7A 2OSBA 3DPSA 4IF6A 1TI7A 4LMPA 5K8VA 2C5BA 2HADA 3NI2A 4RTOA 3T3NA 5LZ7A 3H18A 5KPDA 3IXLA 3ZY6A 4JC4A 4XX0A 2AQ8A 2VPQA 4WCFB 3NBUA 1KIAA 1W36B 3Q9LA 3IT1A 1RHJA 2JZNA 1RRPA 2Q1YA 2CLOB 3RM3A 4FC7A 1K7SN 2B8JA 5D85A 4GDFA 4RKYA 1T2DA 4NZNA 1DCKA 1EJ2A 2XUPA 3D6AA 2R87A 1KQNA 4DC0A 3F73A 1IBSA 4ZK2A 2CNDA 4OYLA 5JNTA 1L7RA 1UEJA 2I3AA 4IJUA 4MRRA 1RC8A 3MG9A 2ORED 5F2NA 3Q7IA 4U6NA 2YMPA 3L6BA 1C0EA 4MR7B 4UEWA 4GR9A 1YVPA 3NYQA 4R8LA 2WU8A 3SJAA 3SQNA 3T5TA 4K6MA 1VJ1A 4RKRA 3HBMA 3EB9A 3NP7A 4J76A 5TPZA 4R81A 2POQX 2Q3LA 4ZAZA 2FSVA 3DBRB 1PLJA 3SNKA 2IEIA 2FSHA 3HLTA 3KR2A 3PXBA 3U13A 5KTNA 1UK7A 4LYFA 1OB2A 2J5BA 3UB4A 1XMSA 3PJGA 1WHSA 1N2XA 1E1MA 2QRLA 3GYGA 3OQHA 1VKOA 4R6XA 1I2CA 3MWDB 1N6HA 2CLKB 4V03A 2PBFA 1OTHA 2PRYA 3C8MA 5EJ4A 1NW6A 1YDEA 3PWTA 4MIKA 1GQFA 1Y5LA 2V7QD 1LQTA 1JHVA 3C4VA 1VHWA 4JR0A 4LS3A 4ZYYA 1F6BA 4BRSA 3KPUA 2VJCA 3PPYA 3PUYA 1KJYA 1WUIS 3KP1A 1ECJA 1K8ZB 4QBHA 4C0XA 3RVLA 4G24A 3OTQA 2F17A 3LCMA 3OUTA 2CFIA 3LECA 3ZE7A 3V8RA 721PA 4REOA 1LSJA 1SUCA 1X7YB 3LUKA 2PL3A 3OM0A 3IDSA 1GJRA 4X7PA 1X6VA 1EX7A 4UJ3A 3I04M 5EIFA 2QTTA 3WNVA 4HNHA 4Z9AA 2WE8A 3WIBA 1U3DA 1E3EA 4JKOA 1SB8A 3CXRA 4DDUA 1AO0A 3SS7X 3HZOA 3O8NA 4NG5A 4C4OA 3W7VA 4RY8A 3CLRC 3W05A 1A1SA 2BFEB 2RAPA 3M70A 1E4VA 3AONB 3K05A 2GVDC 2NZYA 3OVMA 3W5VA 4HFMA 1Y6QA 4UOZA 4MDEA 2VP0A 4UE6A 4PNHA 4KFTA 1N3YA 1ZK2A 3EWIA 4F71A 1QNLA 3C5CA 3QVSA 4B71A 4PLTA 1COZA 3DE6X 3FZQA 2X3UA 1PZFA 3K94A 5AM5A 1CB0A 2AJDA 4QYTA 5HJEA 3U62A 1VDMA 3B9PA 3H2GA 3U7RA 3B60A 4ZAGA 4MMXB 4HX2A 3S0JA 3GRYA 3OAAA 1I33A 2C4TA 4FMPA 3ZWNA 3JASB 3OLXA 3FTEA 1BGXT 1OX4A 2IGTA 2VSXA 3DVLA 4OXXA 1VSBA 1YRQA 3E05A 4Q02A 2EERA 4P3YA 3VHXA 4OXQA 3EE6A 3M1AA 3ZHYA 1OI3A 5BORA 2Y0CA 5CA1F 2X40A 3W79A 3Q40A 3I9V1 3QEMA 4EG1A 5A3JA 2FG7C 1GR0A 1ONNA 1SXJE 4FHGA 4DV6B 1SZCA 4MEJA 4YR9A 2YHUA 1YS7A 2Y1EA 4ND6A 2WWVD 3WB9A 4MS3B 4F9TA 4NK5A 2OORC 2OBXA 4PZDA 1GRVA 3TTYA 1T8YA 1I1NA 2QTLA 3UWPA 3C5WP 3PNLA 4FOPA 1I3OA 1ZN2A 3WNQA 4V0RA 2H3EA 1D2EA 1OFUX 2FR1A 4GLFA 3WGVA 1RWWA 2VDMB 4NR0A 5C81A 5KWIA 4IJQA 2ZUUA 3F1LA 4D4LA 3LTEA 4G8CA 5DWQA 2HXGA 3IAHA 4G25A 3NW9A 4Z3OA 2VZEA 5K0GA 4MA5A 2VHEA 3IP8A 4QQRA 4I14A 4RFLA 1RC1A 3F5SA 5J40A 4DPKA 4O3MA 3A37A 3L0DA 3EBPA 2NV6A 3ECSA 5IAAA 1UWVA 2JLVA 1E5TA 1KI1A 4MWEA 2BFCA 3ROMA 1GL7A 4BQNA 4FKMA 1JSLA 1MO3A 5FBHA 1FA9A 1QMPA 3TS1A 4WDQA 1L7NA 2J33A 2VYVA 2XUDA 4HHEA 3HP4A 1XG5A 2I2AA 5HMMA 1YZ3A 3ANXA 4DV2B 4YJFB 3AKYA 2NZ2A 2PRZA 3IAM6 3MRXA 3PTAA 4Z2YA 2O8BA 1KJ8A 5G4KA 3RIGA 4A15A 2V65A 2YQZA 3MAGA 1XJ5A 4S1OA 1QG0A 3A3KA 1G6OA 2BJWA 1HNWB 4C08A 3WOHA 3U7FB 1KY5A 8AT1A 3H5RA 2QRPA 3L0SA 1QHNA 3AEKB 3V3TA 2PMDA 3DF9A 5LZ8A 5JCXA 4B3MB 1LBIA 3NANA 4R51A 3KSAC 4W7IA 3VTFA 3GLTA 4HB2A 4RU1A 1J8MF 3AI1A 4V2IA 1U81A 3ROKA 4C0BA 4EHKA 5AXAA 1ZW1A 1LVHA 3M6UA 1Z35A 3LF2A 2RI1A 2COUA 2ZBGA 1D2GA 4LHXA 3IQFA 2PLAA 2R65A 4B09A 4R68A 2IXAA 1K7YA 4D9GA 4BMPB 2I33A 4YJHB 5CDTA 2P7HA 1UQUA 3OF3A 1SIUA 2W93A 2ZYIA 2VYVD 5F1KA 1S2MA 4JA0A 4JYPA 4J49A 5DX1A 3BH0A 2D2XA 4N3CA 3QM1A 5LL6P 4QDXA 5IJ9A 1BYUA 2QD4A 3TVDA 3JSXA 5EJ8A 1NVDA 1PAUA 5CT9A 3ZD8A 3LI2A 1UODA 4IDHA 1XU7A 2YIMA 3NHWA 5FX2A 2Z5FA 1W30A 3DOOA 4LZLA 2W70A 3RSSA 1C7EA 1VLQA 5EUBA 1O0CA 5DBGA 4ZEXA 4R5MA 1W0KD 4YP0A 4X44A 5ALLA 1XP8A 4LKRA 4UXJA 1PFYA 4QJ4A 1E2DA 4A8HA 1RRGA 4RHEA 4FCCA 1OX4B 4HR7A 1XZDA 4X9XA 2QN8A 4EHNA 1QFXA 1N1MA 4KH0A 5EIHA 4IY1A 3HB5X 3D6MA 5BOSA 4A6XA 1KP2A 1C3EA 4L3VA 2OHOA 5K0JA 3Q6MA 4HV4A 4FC6A 1ZMRA 2PRSA 2E5FA 4XM1A 2F6RA 1OILA 3MZ0A 1DWPA 3BVPA 1KYQA 4Q1CA 3FNIA 1NVAA 4OD0A 3EXIA 4WASA 2CV0A 4DBLC 4NULA 3GHYA 2H2GA 3AG5A 4I8XA 1F8XA 1H5QA 1RAHA 4MLPA 5AO9A 1R0YA 4JJAA 3WNBA 3ZGZA 3HKEB 4YRBA 4LBZA 1RXCA 1IXRC 6CHYA 4UHDA 1SBCA 5EIOA 1E8DA 3THYB 3EQ7A 2ZIZA 4B82A 1FP4A 5HKKD 3EC1A 2G8LA 4KK3A 3SZLA 1JHDA 3BXHA 4O4IA 1JKIA 2GCEA 3ANSA 4HGOA 4OGWA 3RIYA 1NPYA 4BKUA 2DLDA 3V1YA 3AF6A 3IEUA 1T0IA 2YN2A 3RABA 4RLSA 3EARA 3WIDA 5AKLA 3UCEA 2XCTB 1XXHA 4G0QA 4XI9A 3Q88A 5ESWA 2FHSA 2HXSA 3IC5A 6ADHA 4D3XA 5BNIA 4URHA 1CT9A 1JSXA 1PL0A 1DELA 1T2NA 3AXTA 4HGYA 4JUDX 4PIMA 1N78A 5AM4A 2MWMA 4U63A 1TGYA 2ATVA 4HADA 5BW6B 4BP9A 1KJQA 2IOFK 5IKMA 2VPXA 4ETNA 4NAHA 4W1RA 2O2HA 1KSHA 3F4KA 2AN4A 3DQPA 5FLYA 4L22A 1JKMA 2UYOA 3H75A 1FBNA 2WUFA 2JVJA 1JX6A 1PQUA 1RWXA 3SSAA 1NI4A 4WKOA 4Z49A 3FFWA 1FCJA 4FYHA 1XEWY 1UXJA 2WF8A 2WAXA 3DZGA 4S3MA 1GG9A 2EJBA 5IWAB 2HYIC 3HJAA 5JXJA 4EY8A 5BNTA 2FSGA 2OCDA 3NHZA 4RWZA 4CM3A 4F5DA 3VNRA 2FFHA 3ORYA 3RIHA 1UR5A 3H3JA 3PNYA 4BN0A 4ZZ3A 4J3FA 3FPLA 4BJ5A 1NN5A 2HTEA 5DSTA 2J87A 2HRZA 3V8PA 3CZAA 1HSOA 3PHCA 4FIZA 1CJBA 1JMYA 2AOUB 2PD4A 3JQ7A 3LUDA 1V16B 3ORFA 4HGRA 4OSPA 1CRWG 3B3GA 3KEOA 3UK1A 2VHCA 4JT2A 3CTPA 3Q11A 4BFYA 1G6HA 3M6MD 3RYCA 4HEJA 3ZZ0A 2AE1A 3ES9A 3R0JA 1LPBB 5EMHA 4UNRA 1A9PA 1T9AA 4UULA 4C7KA 3HJFA 3CUUA 2J0UA 3IEKA 3ZBPA 3OQPA 2DB3A 3P0EA 3N2YA 1UFQA 4OREX 4ZVRA 2G17A 3U9SA 3UT6A 2UAGA 4QYSA 2FF7A 2ECPA 3HWWA 1RW4A 4PSAA 3C1UA 1QP0A 3U9TA 1VE7A 4XZ3A 1HZZC 2Q6KA 3FPGA 3ZNOA 3WLEA 1ZD9A 3V7UA 1XD2B 4I3HA 4F2WA 5J1SB 1UH5A 4GPZA 1W29A 2R0QC 3KZNA 3WL5A 1PR5A 2QMZA 1P6XA 4M9RA 4QOEA 1P19A 1D5WA 1SXJB 2CJXA 3BFVA 3O4VA 4P35A 1LPAB 1KK1A 2EATA 2VF5X 5IAJA 2PU7A 4HDRA 4IZHA 3LP8A 4ITUA 5DSZA 1YAJA 3S8MA 3D7RA 4UATA 1OQAA 2RGDA 4XFDA 5SYNA 4PAMA 3TRKA 3O93A 3VISA 1GUZA 5E6UB 1YK1A 4W6QA 3QBJA 3LWNA 4I8IA 4LRYA 2BYTA 2DUMA 4O4IB 2RGUA 1ZUNA 1J25A 2QRZA 3E0QA 4KFSA 3UHPA 2DPLA 4X97A 5AKGA 5IAEA 1GGKA 3ROZA 3X1WA 2FR8C 5CFMA 1IG3A 4RHYA 3X43A 3Q98A 3N05A 2EGHA 1WMSA 3GNQA 4MQFA 4RZUA 4B5LA 5H9VA 2D1QA 1ULAA 3IBCA 4BNDB 4MJ3A 3VSAA 3PNKA 4XGKA 1WSBA 4JP3A 1JG1A 5E9WA 1A7JA 3RJZA 2BTQA 4EGSA 4ZEVA 5HZKA 4ZHQA 5FUBA 3JYOA 4E13A 4I1OA 4LOAA 1L1FA 2V9CA 3A2NA 3Q2KA 4LY6A 3T5BA 1ONOA 2CB0A 4GQBA 3ZXIA 4UD2A 4GBED 5E3HA 4C4ZA 3JVIA 1W75A 3MELA 4IP0A 4TYMA 4LECA 2EZ4A 2HMYB 4PONA 3AKZA 3ADPA 4A2QA 4BBPA 1UJ6A 1EXWA 1YBAA 2ASVA 1E1YA 1JQLB 3NYWA 1C81A 2V6FA 4AS2A 3E3AA 3SGLA 2O20A 2FB9A 1ZVJA 2EBUA 3AUJB 3OZDA 4O4LB 4E7OA 1QIGA 3KHUA 1WUHS 2Z4SA 1QHEA 1T0PA 1WD5A 1ONSA 3WLIA 4BO5A 4CM4B 4UEOA 4DMGA 1PNRA 1NQ5A 4LPSA 5IAGA 3RVBA 1JA1A 1XVLA 4TKUA 1K86A 1CP3A 1C9DB 4UXIA 2OFFA 3R74A 2HYDA 5D01A 4BKOA 3SWWA 5LYJA 5BV7A 2ZI3A 3B7PA 5CLHA 3T3OA 4FXOA 1U94A 4ER6A 3ZD9A 1U0NA 1EFLA 2Z1NA 4MRPA 1EEHA 4EZIA 1EDOA 3QPVA 1F6WA 1KI4A 4MV3A 2PVPA 1NUSA 3V3KA 3DMPA 5DTQA 2W11A 4RSHA 4CETA 3INNA 4EF4A 2AT1A 1CUBA 2QPTA 4LBYA 4YTEA 5DMHA 3WLKX 3OTIA 4RTQA 2WVHA 3N7AA 3DONA 4Q3NA 4PSCA 1MRZA 1KRWA 3PNPA 1LZLA 1LV7A 1UXOA 1T1SA 1Q14A 5DISB 1C1XB 1IZ7A 2HLNA 3FFXA 3WJ1A 2P30A 1U2DA 5JSZA 2XUJA 1KEVA 2L17A 3ENNA 3AUUA 4MW0A 4N7MA 1I5EA 4R8VA 1F5NA 3CEHA 1AXRA 2GF9A 2ZRJA 3QK7A 3IQZA 4M3NA 3KETA 4JI8B 4DTCA 3EGCA 5EKUA 1BEUB 1FNDA 1FU8A 1M1NA 1TLFA 2XVXA 4KPUB 3GQBB 4WY8A 1V5IA 2BAGA 5SYAA 2EP8A 3TOCA 3V46A 3HCNA 4ZGGA 3E22B 2CLLB 3CINA 3BK2A 5K6AC 2F3PA 3DBHA 1K3FA 1JQJC 1BRMA 4KQWA 2D3TA 4EI2A 2H08A 1PZMA 3JQPA 4O2BA 1SPBS 3D6HA 4IX1A 1NAIA 1E6EA 3SI7A 4GQIA 1XDWA 4TMFA 3FA2A 4IINA 5LNK1 1NDUA 1UADA 1M54A 2HA7A 4I1RA 5B58C 4DKJA 3PHGA 5REQA 3KZOA 5F7ZA 1K66A 3GFPA 4C04A 5TSDA 1HOTA 5KYNA 3CNNA 4NU0A 2JIBA 2QLMA 1KOGA 5BP7A 1NAHA 3TWOA 3IKVA 3N8DA 5IDXA 1MENA 4YLGA 3GLVA 4TXMA 1X13A 3C39A 1P1JA 4CIAA 2HBZA 3BHMA 1G18A 2JIQA 3S2YA 3Q72A 2WWIA 3F6PA 3VPFA 1FNNA 1YA4A 2P41A 5J4YA 3H1GA 3ND6A 4RQTA 1EQ2A 1RQNA 1N9GB 3J81A 1M3SA 1F0NA 3FHLA 1RBZA 4AQ7A 1JDBC 4M0FA 3VPHA 3EMBA 3SSNA 5LLTA 3I23A 2ZAOA 4LWZA 4HJXA 1A5AB 4X45A 3EXHA 2O14A 4PG5A 4EKGA 2VDJA 3GGSA 3SM3A 1TO1E 2HWUA 3NBXX 1W2WB 4OHFA 1PLKA 3L1JA 1GGVA 2XCLA 1WIWA 4E1BA 2AW5A 1P1HA 1QDEA 1XLTC 4GXQA 1UBKS 1PR6A 3I4LA 3C70A 4K7JA 2R6ZA 2Y1DA 1AZTA 1LI4A 1CF2O 3HKDB 1XYVA 4RK7A 1FLDA 1VG9B 2YWGA 3A1EA 2XZTA 3OTHA 3WNDA 3ILHA 4PC6A 3SZRA 3D5TA 3VR1A 3DQZA 4RSRA 2O8CB 3E84A 1SKYB 2QAGB 3HDJA 1UDCA 2CXUA 3M34A 4K26A 4LZOA 2DR0A 1PEAA 3KJQA 4HD8A 1QJ4A 4MWTA 4TM7A 1O1YA 3ENWA 5ELMA 4M1MA 4OA5A 4QGHA 3LBNA 5KWEA 5H5JA 1AK9A 2CCGA 3IR7A 4PNZA 3VYRB 3BA6A 2RGRA 1IQPA 2FGKA 1VL1A 1N77A 1NKSA 2G5PA 1M76A 2C2MA 4GZMA 4FFOA 3EA0A 3HFRA 2MU1A 3KEMA 3R3UA 2QVBA 1SVUA 2B0JA 2BH2A 2G4VA 4LF4B 1PQWA 3L02A 4RNCA 4MP8A 2HA5A 4GZ5A 2ASEA 4XAQA 2JHGA 3AXSA 3AHJA 3DZBA 4RF2A 1XRRA 3D2BA 2JK1A 3TZLA 2J5XA 4WFJA 1B73A 1N8KA 3O91A 3V00A 1E6UA 3U5TA 4CG1A 4QVIA 2ONZA 3UAGA 3SFVA 1K5GA 1W5TA 3MAJA 5K03A 3WWYA 3AQ4A 1SEVA 1PR4A 4J7AA 4BUZA 3CH7A 3MXTA 2IX3A 3QF7A 2FMKA 3T4EA 3TE7A 1NP6A 2LR0A 1WUYA 4A8JB 1EE9A 5JAOA 2FZ4A 4LBWA 4RJTA 3RSCA 1B16A 1TM4E 3KLPX 4L27A 4TZTA 4UM9B 3DYBA 4DVJA 3F7TA 1VSTA 3L4JA 3UENA 4XRGA 4C78A 1Y34E 4MUAA 4EUNA 3LBAA 2AXNA 1EXMA 1MC8A 4B5KA 3QJGA 4G4GA 1JR2A 2ORYA 3SD7A 2AGVA 3CO0S 2FLWA 4R83A 4WGGA 5D3ZA 3HG7A 1J9GA 5B12A 2AWOA 3S1SA 4OBEA 5AIAA 4QYIB 4PC2A 1W0JA 5AOVA 3A0RB 3PDIA 3T3EA 2AD5A 4FN5A 1LI5A 4OI4A 1AU9A 1WEHA 2XXJA 4M1SA 5KOJA 1GYPA 2PGOA 1E6CA 3WHLA 3EAGA 4CTOA 2IEAA 1NQUA 4NBWA 4DR1B 3UO8B 2VHWA 4U1RA 2R60A 2Q2QA 2BFCB 1L8LA 1ORRA 4V0KA 2WT8A 4TV9A 2GBLA 5ITZA 3KZVA 1PJ8A 3A27A 3L8MA 4V0MA 2DULA 4K87A 1YDHA 3TTXA 4M99A 5IZ4A 3TNDA 3BK1A 3EGDA 3A70A 3C4JA 1I3KA 4BNJA 1YU9A 1E8MA 3DKVA 3RR2A 2GEVA 3SR0A 3K0EA 3QFHA 3LJKA 4S0ZA 5DLQC 2A9PA 5EJAA 4YHHB 3UV7A 2QDKA 4Q4HB 1ZI8A 1E9SA 1RT9A 2Y99A 1SCIA 1KERA 2RIRA 1GLGA 1D2RA 5AI0A 4WLVA 1Q77A 3JWJA 2BI4A 2CL6X 4M36A 3S2GA 3VKGA 1F20A 2QB5A 3KKEA 3KTDA 2TMGA 4MIYA 4WVLA 1JG6A 4YUAA 1D6JA 2KBFA 3L7DA 4I50B 3ETCA 1V6AA 4XEUA 1QP8A 3L6RA 1QQAA 3HV2A 5L7TA 4JEMA 4LJLA 4EW2A 1I3MA 2VDWA 4Y9DA 1GG8A 1E1NA 3TAUA 4Q34A 3VUEA 1NBME 1AGXA 5CA1A 3WK4A 4IOJA 3C3XA 3RK4A 3P2MA 3QX7A 5FTMA 1N0HA 2DFTA 1FQWA 4BATA 3G7UA 4HN2A 4P92A 2QN2A 3DKKA 4LPKA 4BGVA 4DR5B 1RJWA 2OFWA 1XFDA 1R8YA 1NLUA 3DEZA 3MUFA 2OLEA 2WQ6A 2F1KA 2QGZA 2BIFA 3NHKA 4MCIA 4P2BA 2HLHA 2WAAA 4LJYA 3KKMA 3UKOA 4F1WA 2IIQA 1Z5UA 2C78A 5HCIA 3V5NA 2VNJA 4V0ME 4HY3A 2O1SA 4L5IA 1C4OA 3EC2A 4CEIB 4LFCB 1Z9BA 1J07A 1U2TA 4CQLB 2VIIA 3H4TA 1TECE 2D8AA 1AGPA 4J1TA 3B6KA 3PNVA 2BMJA 4C0SA 1OX6A 3B82A 1SBIA 4P7JA 3VZSA 4BWFB 5IKOA 4QLAA 1A9QA 5E1OA 4WCVA 3DKRA 2I29A 5ES3A 3EG5A 3RS5A 1FUKA 1TO2E 1N2SA 1PYOA 2DT5A 3FWYA 3L0YA 2HK7A 3RS9A 4NOJA 4ZGBA 3WKEA 1H6BA 2QIPA 4Q4AB 1I8TA 4UREA 4DMKA 1D2CA 3EQ8A 3LQQA 4FLMA 3CLHA 1E98A 4RVOA 3KSZO 3PQDA 1KNXA 1NJSA 3E1SA 2B5WA 1S2NA 5K51A 1QRUA 2D59A 2OAP1 3F0TA 1OZFA 3JR7A 3Q8XB 4KWCA 4V2UA 1ISPA 5KC8A 2O3JA 3QVJA 3IEMA 3CNHA 1S3FA 3JQQA 5G0TA 1I4OA 5AFSA 3ZNPA 1II8A 4L9AA 1V5WA 4JJKA 3THYA 4N7RA 2FQQA 3PDHA 2ERYA 5BV8A 2C7GA 1XVTA 1UBNA 2QX6A 2PL9A 1R4MA 3LPCA 5CVJA 3OU6A 4RFVA 3W2EA 1NTOA 1AUVA 3M3HA 5K4AA 1QPGA 3GLHA 3HQ4O 5FL7A 4EHAA 1JA0A 3PXXA 1REQB 2D6FA 1L5LA 2E1RA 5K05A 1Y7PA 3LKVA 2IBMA 4TLDA 4BFUA 2A7XA 4C2AA 2WM9B 3UANA 1WPXA 2WICA 2Y0EA 3E9MA 3LS2A 4PTYA 4Q3DA 4GXRA 3RWBA 3DZJA 3URMA 2VHJA 3EGIA 4D26A 3V2UA 1RWPA 2HHAA 2NO0A 1L4GA 3LW8A 4BTLA 4CV0A 1OBHA 1T1JA 3SBEA 1IOWA 2ZOSA 3IVMA 3DAYA 4RMNA 1PJLA 5B3JC 1C7JA 1Q1AA 2X0JA 3O92A 3R6TA 3AM5A 3AT1A 3ESDA 2O19A 3SS8A 3TQHA 2IK8A 3G8CA 1IHOA 1ZK1A 3LMKA 4PZPA 4ZV9A 4KR0A 3VZBA 2H17A 1CY2A 1RM3A 3D4PA 1PK9A 5F2KA 1Y6FA 1TA0A 3JQAB 2AZXA 3GFTA 1ZFNA 2HO5A 1U0SY 1Z38A 4CL8A 5JAPA 1K8YB 1I2BA 3FDZB 4BVHA 2X9GA 3E15A 1QVZA 4JFRA 1EVKA 4ZU6X 5EHXA 3N0RA 1BS9A 4JLOA 4RZSA 5EJFA 4KOEC 3ZWWA 4GICA 3EYAA 1SC1A 1D8TA 1RMTA 4U3JB 1V4BA 2X9NA 3NNSA 4Z99A 1PHPA 1VIAA 5IEBA 3HDQA 3NAGA 1CE8A 1XU4A 1EEXB 2GJKA 4RD2A 4DUZB 2O8FA 4R9VA 5EKDA 1U9CA 1AKWA 1LW7A 2W2PA 4I5GA 3UFXB 1K9VF 4F3NA 2O2YA 1YL6A 1YUBA 4F5YA 1MQ8B 1AQIA 1VSUA 4IIVA 4FDVA 3S6JA 3F96A 3AJ8A 1NW5A 5HE9A 1DZIA 1DX6A 2P1RA 4EI8A 2JI4A 2V59A 4MRMB 1B15A 4HFJA 5K0SA 2Q4OA 4XWOA 1BMDA 1QLHA 2J0UB 4CEIA 4MOWA 4O0MA 4XIJA 3SQWA 2NP6A 2W8ZA 2YFKA 1Y8ZA 4BEBA 1WXHA 2CHGA 2XJ9A 4JJZA 2WUVA 3NP9A 4B3RB 3T94A 3O0TA 1QQTA 2C3OA 4F04A 2JB9A 3RNOA 2ODPA 4LXIA 4Q9JA 4ZDJA 1G6Q1 3MTGA 5JJCA 5KJ1A 1VKRA 2NM0A 3QBVA 1E64A 5DHUA 4QG3A 4NBKA 3E8XA 1DXQA 4OMFG 3W2TA 9MHTA 4GGMX 4EITA 4AULA 1MPTA 4PYMA 1OB5A 3V6MA 4HOYA 1LNZA 2FPRA 4E07A 4R8MA 2V5AA 1V71A 3QFRA 5CDUA 1H8EA 4GI1A 1FSZA 2QSYA 3UGJA 1TAQA 2HDHA 4Y2PA 5K0FA 4MUIA 3K0CA 3ZZUA 5J4VA 2WJAA 2XTJA 1PGJA 4XWGA 2OHHA 4ZOBA 5DEOA 3DO5A 4FFLA 1B7GO 1W96A 4BZXA 1V1JA 1AOXA 3RV3A 3WAGA 2VHXA 1AX9A 3DPIA 4UCQA 3BMNB 1WQ4A 3DAFA 1X1BA 3NIDB 2VK2A 5JO9A 5T57A 3MOGA 3NIFB 4XDZA 2X14A 4RA6A 3LGAA 3BXGA 4H6VA 3V1MA 4Q01A 2B21A 2ZSKA 3VAZA 1QS0A 3FNBA 2Z30A 5CCEA 4Q00A 5JCOC 4KC0A 2RB4A 2ODTX 2VTEA 3JWPA 4H3HB 1X8JA 2GN4A 3HXKA 4F9FA 4IUCS 4C14A 1I0ZA 4HDCA 2OPBA 3QU5A 3RF7A 1P31A 3NGMA 3DOIA 3EULA 4ZVTA 4CDMA 2RAVA 1JG3A 2FSVC 3B52X 3E53A 4OKNA 1IEXA 4YAFA 4PQEA 3VVBA 1L3IA 5AJYA 4QQ8A 3H7AA 4LXUA 5EVJA 3QVVA 4EEKA 1AKVA 3W1VA 2EAUA 5B7PA 3GZTB 5IU6A 4BO3A 2OC9A 4J07A 3VOSA 2ORVA 2BSQA 3H0KA 5TLSA 3TX2A 1BHQ1 3M6VA 1BE8A 2EFJA 2FEOA 1TT5B 1UT8A 1VJCA 3FDZA 3HWSA 3NFRA 1T8WA 1TUBB 2H1RA 2E21A 3C7AA 4AG5A 4E3WA 1TPYA 3GRRA 3MJCA 3NEAA 5TR9A 3TAXA 3IQXA 5CB6A 1ULHA 4LJ4A 3V1KA 3MHTA 5I9SA 3KG2A 1KQOA 4YAOA 5IBRA 5GZ1A 3KNZA 1TCVA 2FEWB 4BX2A 1CE8B 1ODFA 4MWOA 1AUOA 2W43A 4N82A 2JAUA 2JZOA 2WFZA 3JQAD 4P84A 2HT6A 2NUPB 4PPYA 2WU4A 4CM8B 5J58A 3RUHA 4GMFA 1RRFA 1FPQA 1NBEA 4FR2A 1YJAA 4G5GA 4CEHB 1V43A 2ZBQA 2X2FA 1QMGA 5JTUA 4N8EA 3WVNA 5B4UA 3I64A 1XMPA 3GLIE 4F93B 4D82A 5DOZA 1NBMD 4D9MA 1OLUB 4JMLA 1I94B 1E2KA 2GN6A 3PVCA 1N4AA 1CNFA 1GTMA 4O4LF 5BYJA 3AP3A 1VL6A 1FDVA 3UGTA 1TZBA 1D2AA 1FTSA 4FK8A 1T6BY 1XNJA 3NEYA 4AG3A 3D4BA 4BRUA 4DR2B 4WIAA 2DQKA 1QWSA 1ISHA 2VJBA 1Z4OA 3REQA 4D0LB 1YQDA 2F59A 2UUBB 3FCYA 2P7IA 3KXKA 2KW5A 1EFPB 4WINA 4QO7A 5I48A 3IHTA 5JWOA 3FF4A 4ZTUB 5CT5A 4BYMA 1LSSA 2ZTHA 1J21A 4F97A 1BMFD 3IHWA 2QJWA 1OA0A 1U99A 2NU9A 4PAGA 4WZBB 1QIKA 3SYKA 3EXIB 1U0TA 4NBRA 3ICWA 3ZNNA 2KPOA 4BL5A 5JZSA 1YOVB 2BFFA 1Z2PX 2C04A 4Q9NA 2Q3EA 1LPSA 4L3OA 2YV4A 3HN2A 4CR8A 3EEBA 5LKAA 3A3PA 2IU4A 4KYTA 3ZKWB 5I8PA 3GELA 2ATCA 3RVRA 1PCXA 3G1TA 3UV3A 1QGED 3AKEA 1MORA 4H1VA 4F4DA 5T7BA 5EJ2A 4IIJA 4MKZA 1C2TA 3EBOA 3IODA 3QMMA 4UU1A 5MN6A 1MX9A 3O7WA 1UXIA 1OZAA 3IUQA 3WRYC 1RI5A 2QLJA 3L6OO 2PUHA 3NJ8A 4NQRA 4RHCA 2DECA 1DKLA 2CXPA 2OHJA 2IYYA 2NMVA 3CVJA 5CHEA 3DNPA 3KDPA 2W2KB 2I7CA 4WNIA 2JGNA 1XKXA 5FUYA 2GJ9A 3VGJA 3AL3A 1AT1A 4KHZA 4XVRA 1FQOA 4DBZA 4N5HX 3L4KA 5JQGB 3N70A 3GWZA 5ALVA 2C7BA 3HLKA 5FT9A 3CX3A 1L5GB 2YOFA 1PEDA 2POCA 2QAJA 4LMAA 5L3SB 1Z28A 4C0HA 1UJMA 1V8ZA 1H2XA 1S3IA 1KSJA 3ELYA 4BAUA 1EDZA 1N9ZA 2WWTA 3EZYA 4MLCA 5LA6F 1KI6A 2AQIA 4CL3A 4C0LA 2YASA 1VLJA 2NNWB 3DEAA 3PBKA 1R9NA 1GQQA 3QPAA 4E5MA 3AEUA 4DLBA 5IXSA 2QVCA 4S04A 2FV8A 4W5QA 3R7LA 2IYVA 1ZNZA 4XQGA 1HMYA 1FXWF 2BKUA 1EVQA 3CRW1 3OAAD 5GM1A 3TRIA 3WV4A 4E7PA 4ZYZA 1Z83A 2FEPA 2DQ4A 5K1ZA 2JIDA 2BJVA 1G55A 3KLNA 5GOZA 4DQ0A 2CMKA 1P29A 1UM9A 1A2BA 1I1OA 3KEFA 1Y1PA 2VI5A 1G0NA 3WL3A 1P7PA 3G6KA 4OXNA 3ZGYA 3ZE6A 4EY6A 2AOUA 4U0JA 3I2YX 3HU3A 1CUEA 2GQ0A 1XHFA 1KK3A 3KOOA 3IPXA 3NBAA 4HZIA 2D5AA 4PX5A 2A9RA 5FLEX 5TMDA 3FCOA 2YWFA 1X1EA 4C21A 4DXHA 2P2CA 1FRZA 2J9FA 4KQCA 3HYCA 4XGQA 3VOAA 3IQDB 4URWR 4D42A 1DC4A 1XYYA 4QTXA 1TW2A 3QWHA 2VHYA 1KSFX 3SHVA 1UBJS 2C7RA 5KSYA 3DWEX 1I13A 4CL2A 4ZVNA 2WIGA 1VB5A 4H6XA 4I2NA 4OYYA 3GBVA 1FNSA 1VL8A 4TRNA 4PYIA 3NMUF 5KOHA 5ALSA 3ZJUA 4LV8B 1ZOLA 1T5LA 4Q5IA 4C03A 5FBLB 4DJ5X 1ENZA 1OBVA 3T7IA 3CCCA 1QAQA 3NV9A 1EWVA 4LNUB 4AJEA 2GJAA 4G8DA 1KRXA 4K0RA 2HF9A 2P5UA 3LCCA 1M2GA 3I6BA 2P9JA 2YIJA 5EE5B 6Q21A 1JF8A 2WD8A 2CMGA 1IK6A 2D5IA 1C1DA 3TIXB 2BHTA 2Z2JA 2O0MA 1YDWA 3FTCA 3QVGB 5IBQA 3KPJA 1I24A 4EUFA 3EVDA 4GVLA 2GNOA 1XEXB 3SKVA 2JGJA 4CF6A 4QGSA 1PYDA 1N2CA 1EH5A 3PDIB 4W5HA 3A6PC 3DR5A 1QIFA 3ZE0B 4LVCA 4UUAA 3MJSA 5COQA 4LRSB 4NCHA 2UXCB 1ZUNB 2IHNA 3BGVA 1O2DA 4QFDA 3HEMA 2PUEA 2WSBA 3B1ZA 2PXCA 3D7SA 3DHNA 2H11A 5AW2A 1K08A 1PFWA 3JZMA 2RGCA 2J31A 3GDOA 3JQ8B 3HU1A 3FPCA 2GXAA 3H83A 4R5HA 4CTNA 3BIJA 3WFZA 4E31A 3HP7A 3N0TA 5F12A 4L76A 4OKSA 1WHSB 4YO7A 1XLVA 3S2SA 1R4NA 2JF0A 5D1HA 4MUYA 4EKDA 3ZV7A 5DGXA 1BZYA 4S1TA 1FUEA 2YVQA 2WKRA 3DF7A 2GAOA 1ZAYA 1BVUA 1MGOA 3ZQ4A 1I9GA 4UBNA 4HB4A 4GECA 4DIOA 4TWRA 1MIOB 3P0HA 4IYJA 4UBKA 3KOXA 5LUBA 1QBKC 4IHQA 4C22A 3UCFA 3UJHA 2AG5A 4XSVA 1VL5A 4D9HA 3QPWA 3Q7PA 1EM8A 1WPGA 3KLOA 1QG2A 1NX9A 5AI8A 2VC2B 5DNDA 4XGRA 1KE1A 3GP3A 1O6FA 1Z39A 2R9VA 3CS3A 3M4YA 2QVLA 2OXRA 4H3KB 2EFHB 2PK3A 2ZTMA 4ZIRA 2DHRA 2IYEA 2VDWB 4Z0TA 4IIHA 3FB4A 4WN9A 2D7CA 1Y9AA 1BD3A 2BDTA 4UXHA 1FVOA 3A10A 4EA8A 1Y7HA 1KTIA 1A9RA 4OFZA 3GLIB 1V39A 4ZT5A 3QHAA 1S1MA 1E1RA 5JARA 5J3JA 3EXEA 1YKFA 1ZCZA 3ZH9B 3KVNA 2C7OA 5CVEA 1DZ3A 1ESEA 1OPRA 3ETLA 4CLEA 5AIBA 1QIHA 1W2HA 4FIDA 4GC5A 3G9XA 4PQYA 1M7BA 3FOCA 3FDFA 1ZZGA 4KXXA 3T7EA 6REQB 2CD9A 3DGEC 4V0SA 4R3WA 3TQOA 5H4GA 4D6XA 4HS4A 4RZ2A 5EWLB 4XUCA 4A4DA 3S27A 1QCCA 4D98A 4ODIA 3DHVA 4IWYA 4EEXA 2WW8A 5AVQA 4B75A 1IAQA 1JAXA 2E55A 4RV5A 1TJPB 3X1DA 3EIUA 4I4TB 1MT3A 4JD5A 4BDTA 1SXGA 4D9EA 2KX7A 1RE1A 1YONA 2WMNB 2WTEA 3L1VA 1NFQA 2BTOA 2QMYA 4WK6A 3RV4A 3GIWA 1OWOA 4TV9F 3VH4A 4DUGA 3UAXA 1H2HA 5K01A 5DNAA 1E4OA 5NULA 5CIYA 3GVIA 3P9RA 3ZV3A 1ESDA 4RCZA 2PV0A 3U3JA 1KDRA 1G41A 1MH1A 3IAAA 4LXGA 2VUIB 3AFIA 4AN1A 5I7UA 4KPEC 5F9HA 2X6RA 3HDYA 2GCPA 1C1DB 1P18A 4FXPA 1P17A 1HE8B 1FK8A 5J2TF 3A2KA 3HJTA 3SDZA 1JHYA 3HUTA 1X74A 3GH3A 1II8B 3HB0A 1YIAA 3FJ1A 4NV3A 1CUUA 4KAXA 3UWKA 1S96A 3WLTA 1LI7A 3FTFA 3VYWA 1OHHA 4Z4EA 1PDWA 4CV1A 1F12A 3QUSA 2B6HA 2GK6A 4ZCSA 1NBAA 3HFGA 4BWYA 4QPZA 2NOAA 3AX6A 3JU3A 3DQQA 1JAYA 2B1RA 5FUQA 1ZI6A 2BVNA 3W1EA 1BVRA 2OFXA 3OCVA 1N9GA 1Y0BA 2I03A 1YACA 3B1JA 5JEDA 2HCRA 3AR9A 3D1VA 3EWNA 2PCJA 3LYUA 1L5VA 3QPDA 1XALA 4ROTA 3GI1A 2W37A 4JLDA 3VYTB 1EFDN 2C57A 1T4CB 2F3SA 3M3PA 3BKWA 4K86A 1J22A 4TKLA 5D3QA 4KFUA 5LDHA 1FC0A 3T8YA 2IP1A 3T4UA 2Z5GA 3R3YA 2GRUA 5K4GA 3AVTA 4H1UA 5LA6B 3I28A 1YAHA 2QXTA 3HKDA 5HZMA 2UVDA 3BRWD 5CRIA 1YFLA 1G7SA 5H3LA 1QIDA 13PKA 1GIAA 1MIOA 1NUUA 1IXSB 1XFAA 3MCAA 4YRDA 3H8SA 4R41A 5F5LA 3AF1A 3ZLVA 5L51A 4P4NA 3KJGA 3K7EA 3PWSA 3B1XA 4EO7A 2VNHA 1GPYA 3SDBA 4ZT3A 2JFNA 4BFCA 2PWPA 4IMIB 4BLUA 1QLWA 4OUDB 1KH3A 1Y9JA 5KAPA 4TZ6A 2ZSFA 1YJQA 2ROQA 2Z6VA 3MSCA 5KNDA 2K2QB 5KYXA 2J6IA 2OE2A 4L28A 1VJ0A 3O8QB 3SC4A 4ZIRB 1UBEA 2ZIEA 3F3SA 2QJFA 3TEFA 1DTWA 2HCTA 3H1AA 3U7HB 5AQEA 4TWZA 1Y3FE 1P5RA 1OJLA 3DAPA 3BHJA 1B2RA 1T4GA 3EDQA 1BOFA 2QY6A 3BSYA 2PSFA 3LDAA 4D44A 3V2HA 5C1PA 3THXB 3EXEB 4IOMA 1A1VA 1I14A 1MAHA 3OLCX 5L9AA 1L6IA 2YY5A 5L7WA 3QUBA 4WBNB 1T13A 3AETB 3CSSA 2D2VA 1O58A 1OSNA 5DMXA 2XWQA 2QUJA 2UYQA 4IG4A 4EPTA 1I0LA 1GZ5A 4P83A 4A10A 1X19A 1B76A 4RH3A 4CLRB 2AFIE 3IEXA 4E2YA 4LI3X 1CWUA 1Q0RA 3TXYA 1WY5A 3WFIA 3MWYW 5HIJA 2HBQA 2P9ZA 3ISJA 4GWGA 3W0LB 1L8OA 3B9RA 3ZIDA 3U4IA 1KFJB 1ZXXA 4KODA 3ZDCA 4EG0A 5J2UA 1SBTA 1SCJA 4PO9A 5P21A 1WCIA 2XVYA 4PM4A 3ZY2A 2CZQA 3NPAA 4FOLA 1YMUA 5BOSB 5AW8A 5EUQB 2XNDA 2ECKA 3LCVB 2ZJBA 3B6MA 3ZWCA 3EMKA 5EJ9A 4WLUA 1SOAA 2O3SA 4HPJB 1TZMA 2OEPA 5CVCA 3TTWA 4XX0B 3K35A 4KO2S 4LXTA 3NQ41 2C20A 2OAGA 3MT0A 2P9GA 3EPPA 5ARCA 2QRVB 4PFKA 2J41A 3GDHA 1M6YA 4NJOA 4ONEA 3DCYA 2V6GA 4HNQA 3TB6A 1X92A </