3KQSA

Crystal structure of hpnmt in complex adohcy and 2-aminobenzimidazole
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqsA00
2V74B 3EGEA 2CKDA 2HR1A 3KR0A 1QAOA 2JJQA 2R3SA 3LBYA 3FYCA 3O7WA 5CVUA 2FRXA 2IDJA 4XUEA 3P2KA 4QTTB 4C04A 1OR8A 3EVZA 2C7OA 4RVDA 2B2CA 1SQGA 2NXCA 1XCLA 3SXJA 2UYCA 2HV9A 3FTFA 4BLUA 4R8SA 4ER0A 2WA1A 1Z3CA 1XVAA 4GBED 4PYQA 3A25A 2QRVB 3I64A 4LWOA 4CKEA 3QV2A 4C03A 4PYOA 3MTEA 3ME5A 5KVAA 1JR4A 1YZHA 2ZLBA 4AZVA 2UYHA 3EVDA 3R6TA 5E9QA 4PYIA 5EMKA 3G8BA 3WSTA 5E8JA 2OKCA 3ID6C 3UJDA 2IPXA 1EJ0A 5EG5A 1NV9A 3UJ8A 2YUIA 2OYRA 3NDJA 3PVCA 1N7JA 5FUBA 5G02A 3I58A 3KHKA 3JWGA 3SSOA 3KQMA 1YF3A 5DX1A 3UBTA 3OFJA 3JWHA 4K6MA 2JH9A 1R8XA 4YMHA 1RI2A 2HWKA 1WXXA 3KPUA 2PX4A 2NNWB 1WZNA 2PT9A 3KQSA 1RJDA 5EOVA 2P40A 2OO3A 5E2AA 5FA8A 4YUYA 3ELDA 3EVBA 1I1NA 4HTFB 5H02A 1QANA 2ADMA 4FP9A 5DTQA 1PRYA 1NW6A 2Z6QA 4MQ4A 3R0QA 3MERA 5LQCA 2ZZKA 3G8AA 4C4AA 2C7QA 2AR0A 2P3QA 3ELWA 3V97A 3GCZA 2O07A 1XDSA 1ORHA 5U4XA 3TKAA 3TRKA 3AWIA 2VS1A 3HNRA 3M70A 2EJTA 3K6RA 2WA2A 3V8VA 2PGXA 4PIPA 2AS0A 2OZVA 2ZULA 2P8JA 2ZWVA 5KS2A 2PJDA 3HCEA 4RTOA 2GS9A 2GAFA 2K4MA 4JXJA 4QDJA 3P9IA 1FJXA 3DMHA 3GIWA 3KPJA 2PT6A 2EX4A 1D2CA 3M33A 3EVGA 5HILA 2ONYA 2CMGA 5DXJA 1UIRA 1VL5A 3LKDA 5DSXA 4Z2YA 1IXKA 3T7TA 5LQJA 4BP3A 2ZBPA 3B7PA 4G56A 4F86A 4PYLA 3AXSA 4GUAA 1JQ3A 2O06A 1SUIA 2DULA 3BGDA 1KR5A 3F4KA 3P8ZA 5EGSA 5EMMA 4C05A 3NVKI 4QTUB 1R8YA 2ZW9A 3UJ7A 5B1SA 1KIAA 5F2NA 1DUSA 1X19A 2BM9A 1P91A 3MB5A 1JTFA 1G8AA 3FTCA 3DMFA 5CCBA 1X1AA 4OA5A 5EEHA 3OZTA 3TM5A 4BLVA 2AVNA 1DCTA 3E7PA 3OCJA 3UA4A 3UJBA 1AQJA 2ZBQA 3DXXA 5FQOA 4C06A 5EMLA 3LCUA 1N2XA 3OZRA 3R3HA 1B42A 2OB2A 3DXZA 1AV6A 5DWQA 1NV8A 2AZTA 5ERGB 1P1BA 2G8NA 2ZIFA 3KR1A 4HSGA 2G71A 3AJDA 3LBFA 3G2PA 3KQPA 2OXTA 4V0RA 4F85A 4YUZA 4KWCA 4QQKA 5LR6A 2P41A 3B89A 3FUUA 3OE4A 2N47A 3ER8A 1M6EX 3G89A 5ICEA 5KQRA 4GC5A 3C3PA 3B3JA 3E8SA 3EGIA 3LCVB 3UZUA 2C7RA 5FWAA 5CCXA 1U2ZA 4RTRA 8MHTA 4GOLD 3FPFA 1HNNA 1XDUA 3RW9A 4C08A 2V7EA 3KPWA 3LL7A 4RTMA 4GEKA 2IIPA 3EVAA 1RI5A 4Y2HA 3D2LA 2CWWA 4MTLA 2XYRA 3G88A 4DM3A 1SUSA 5FQNA 2XVMA 4ER7A 1NW5A 4ER3A 5HIJA 2Y1XA 5HIMA 4FGZA 4PINA 3UWPA 2G70A 5HFJA 4WVLA 4RVHA 2PLWA 4HTFA 2IDKA 1YFLA 4C07A 4OQEA 4BY9E 3G5TA 4FT4A 5CIYA 2QM3A 5JR3A 3P97A 2PKWA 3P9KA 4WXHA 4AZSA 5K0FA 4KIGA 3UJAA 2ZSUA 2YTZA 3BGIA 4LECA 3GDHA 2IBTA 1ZGAA 3A26A 2UYOA 3O4FA 4GQBA 2H11A 1XCJA 2Y1WA 3PX2A 4GF5A 4HC4A 2PX5A 3BWYA 4FSDA 3FPHA 2HTEA 3E23A 3HVHA 3OPNA 2PWPA 4RV9A 4EKIA 2YXDA 4YV0A 5K05A 3HP7A 1H1DA 1VPTA 5EKXA 2QE6A 1RJFA 5E1MA 1NE2A 1BKYA 4PONA 3TLJA 3KQOA 4KVZA 4HGZA 3HVJA 2AOVA 2ORED 4HH4A 4PYNA 3UFBA 4GOMD 2Z6AA 1TW3A 4FS8A 3NVMB 3Q87B 5DX0A 2JG3A 3DUWA 2P35A 3EGVA 1ORIA 3HA5A 2FK7A 2IFTA 2P3OA 5CUQA 2O05A 3TOSA 1NBIA 3MCZA 5GIPE 5EPEA 3JWJA 3S68A 5BP7A 4KDRA 3EVEA 1VQ1A 1XTPA 5LSAA 4DZRA 3DR5A 3CGGA 1KHHA 5K0EA 4E33A 2BH2A 3M6UA 9MHTA 5BW4A 4EKGA 5GIOE 4BP1A 3EEOA 2ZZNA 4X63A 5C9ZA 2QYOA 4EVIA 5K8VA 3CJRA 2AOTA 1EAMA 1XXLA 5DM1A 1BOOA 4ISCA 4HGYA 1YFJA 3CJTA 3IV6A 3LPMA 3M4XA 3RIEA 3SSMA 2KW5A 1VLMA 2A14A 4O29A 3TQSA 1L3CA 3MQ2A 1PJZA 2AOWA 2PSSA 1R74A 2FYTA 3B5IA 5DX8A 4PYJA 5ICGA 3AY0A 4PNEA 3LGAA 2OPBA 5K09A 5DPMA 3HCFA 3NMUF 1G6Q1 1RJGA 3FTDA 3BWMA 3GRZA 1R18A 3E05A 3R24A 4IKPA 3EVFA 3CBGA 1O9HA 2HNKA 3FUXA 1TW2A 2B78A 1L9KA 4QVGA 3KPYA 4RVGA 4PWYA 3DH0A 3SMQA 1KYZA 3GXOA 3NWEA 1KP9A 4DF3A 4YV1A 1IY9A 3P71T 4X60A 2B3TA 1F38A 4B17A 2P3LA 5BW5A 3PT9A 3REOA 4KDCA 3FRHA 4RTNA 1JG1A 5FWDA 3P9NA 4MIKA 2O57A 3CJQA 3KQVA 2BM8A 2ERCA 3ERCA 3PB3A 3QOXA 3G2MA 4RTQA 4IWNA 4OQDA 5EVJA 2YXEA 2NP7A 2NYUA 1R00A 3FUTA 3LKZA 3HVKA 3LCCA 4RTKA 2PY6A 3PFHA 1VE3A 1BHJA 3KQTA 1FPQA 3AXTA 4FR0A 2QY6A 4AX8A 2XVAA 3BKXA 4U7PB 3FRIA 5GM2A 3BGVA 4QQNA 3NDIA 5E1OA 5EIWA 2VDVE 3HCBA 3G2OA 3EEYA 3SGLA 2O0LA 3SM3A 2AOXA 1FP1D 2Q41A 3FTEA 3Q7EA 3KPVA 4OBWA 2IH5A 3GRYA 4P58A 1AF7A 3GNLA 5DSTA 5EEGA 2AOTB 1O54A 4R6WA 2GLUA 2P7IA 2GA9A 3UJCA 3GRRA 3M6XA 3TPZA 5GINE 3LX6A 4RX1A 5HZMA 3HM2A 4RTJA 5FADA 1I4WA 2AOUB 3T7SA 5HEKA 3LHDA 2AN3A 1JQDA 3BUSA 5DRYA 7MHTA 3PX3A 1FBNA 3DMGA 3DULA 2YX1A 1M6YA 4YUXA 4QDKA 3BZBA 2FK8A 3CCFA 3KQYA 2PBFA 4EK9A 3EPPA 5DM0A 2ZBRA 3BWCA 3GRUA 2VDUE 1INLA 1DL5A 1VP9A 2GPYA 4FT2A 3SVZA 5K01A 5M5BA 1KPHA 2HMYB 3OE5A 5CVVA 5DTMA 5BXYA 4ER6A 1I9GA 3PS9A 2WK1A 1JQEA 2ZIGA 2NXJA 5LQRA 4HRAA 5HOQA 5LQAA 4CTJA 1T43A 1N7IA 3A27A 4R8RA 5C0OE 5JUWA 4MHTA 3HA7A 2XYVA 3OFKA 2ZCJA 5C1IA 4DCGA 2I6GA 4RTSA 5CVEA 1L1EA 4KRGA 1P39A 3A4TA 3EMDA 4RVFA 2PXAA 5FHRA 2AN5A 4Y30A 2FHPA 3DP7A 2JHCA 4XCXA 5IH3A 3DXYA 3C0KA 2CL5A 4CTKA 2ZIEA 2G1PA 1EQAA 4GOND 3KR9A 4OA8A 3B3GA 1BC5A 3H2BA 4L7VA 1X1CA 2EJUA 5EQJB 5EZSA 5GOZA 5ICFA 2XYQA 2BZGA 4M38A 4YUVA 3THRA 2OBFA 3ELUA 4PGGA 4E31A 2G72A 4CKCA 4DKJA 2Z6UA 1QZZA 3VSEA 4EQZA 3FPEA 4KW7A 4MWZA 4X41A 4E2YA 2ONZA 3GRVA 1NW8A 2CMHA 4LWPA 2JH8A 4GOOD 1F3LA 1WY7A 2OB1A 1X1DA 4ATNA 3BXOA 3DOUA 3G5LA 3UJ9A 4DCMA 1IM8A 2UYQA 3LECA 3OZSA 2PX8A 3K0BA 5P8WA 1KPGA 5ICCA 4H0NA 3KKZA 4FSXA 4AUKA 4OBXA 3LDGA 4KIFA 2NXNA 2B25A 1EJ6A 1RI1A 2R6ZA 4PCAA 3SSNA 4RTPA 1KYWA 4A6DA 2IBSA 1MJFA 2JHAA 3FZGA 1ZKDA 1WG8A 3GJYA 4HG2A 4XUCA 3M6VA 3PFGA 3R9XB 3HEMA 3HA3A 3ELYA 3HCAA 4E70A 4YMGA 3FUWA 3OU2A 1RJEA 1G8SA 2ZVJA 4PCLA 5DLYA 5K0CA 3ER9A 4EMSA 5FHQA 1G55A 5DM2A 1VBFA 4M37A 1NW7A 4DA4A 1UWVA 1MHTA 1KXZA 5F2KA 2UZ4A 3VC1A 2OY0A 2AOUA 4M36A 3IYLW 5FCDA 4M7RA 4FZVA 3P2EA 1JG3A 3B3FA 2IP2A 2H1RA 4IV0A 1VP3A 3NTVA 1SQFA 1SG9A 3BWBA 2PXXA 3KR2A 1FP2A 5EZQA 5HIIA 5EC8A 3THSA 5HIKA 1X1BA 2EG5A 3FYDA 3MAGA 4E2WA 1Q0TA 5K0LA 4CWAA 4RSRA 4XUDA 3JWIA 2IH4A 3PTAA 1JSZA 2FCAA 2ESRA 2PX2A 5F2OA 2YXLA 4E2ZA 2GB4A 1EIZA 4RWZA 4DMGA 5KYGA 1D2HA 1RI3A 3I53A 3NWBA 4NECA 1XDZA 3G2QA 3GGDA 3NW9A 2I9KA 3P2IA 3C6MA 3QOWA 2C7PA 1UFKA 5EHGA 4E2XA 1SKMA 1TPYA 1HMYA 4R6XA 4BLWA 5IKMA 2AN4A 5E2BA 5EKUA 3SR4A 10MHA 3HTXA 3A7DA 3MHTA 1AQIA 3RODA 1NW3A 5E9WA 3LDUA 4YUWA 3PLAE 4X1OA 2P7HA 3KQQA 5LQUA 4AZWA 2EFJA 5KQSA 4QPPA 3HCCA 3P9CA 3TKYA 1VIDA 1EG2A 3MTIA 5DRTA 3ORHA 5E1DA 1ZHFA 3SX0A 3VC2A 3CKKA 3X0DA 1XJ5A 5LQNA 4P7KA 4QPNA 2ZZMA 2ZTHA 5MHTA 4UOEA 1G38A 3LSTA 3DLIA 5EHIA 5K03A 4QVKA 5T67A 3TR6A 1QAQA 1L3BA 1NBHA 3NJRA 5LQKA 2NP6A 5CVJA 3U81A 1ZQ9A 5E8RA 3DTNA 1L3IA 2PXCA 3I5UA 2IH2A 3L8DA 5FTWA 4AZTA 4CXMA 4RTLA 3DLCA 2BR4A 3OU7A 5D1HA 5GM1A 2VP3A 5DT2A 5E1BA 2P1DA 3GU3A 4A6EA 4F84A 5K0BA 3HCDA 3TM4A 1ZG3A 4PYMA 2XBMA 4DQ0A 3BT7A 1QYRA 1SVUA 3T7RA 4R05A 2NXEA 4YV2A 3LDFA 4IV8A 2ZFUA 1WXWA 3HVIA 4LG1A 5CD1A 2PWYA 1M0EA 4OX9Y 2PVCA 4PYKA 4U7TB 2F8LA 5K0NA 3UA3A 5K0GA 1Q0SA 1RI4A 1JSXA 5E9JA 5FA5A 3UJ6A 3O31A 4X61A 3T0IA 4ER5A 1P1CA 5K0JA 4E30A 3CVOA 2IGTA 3KU1A 1Y8CA 4ZTBA 4PIMA 3GO4A 5T64A 1YUBA 3EMBA 5D1NA 3C6KA 2I62A 2QRVA 3MCTA 3FUVA 5DM4A 3TFWA 2YVLA 2GH1A 3A7EA 3FPGA 4P7GA 5GWXA 1NT2A 1NKVA 3IEIA 4CKBA 2DPMA 3BKWA 3I9FA 1ZGJA 5DTRA 3G7UA 1D2GA 5FULA 2H00A 1JG2A 1YB2A 4RYLA 3EVCA 1JTEA 2VDWA 2FPOA 1YZ3A 4POOA 2BR3A 2LD4A 3TMAA 5EMJA 1G60A 1V39A 1KPIA 1QAMA 5T6BA 2AVDA 3IHTA 3VYWA 3FPJA 2BR5A 5EIFA 3C3YA 2JHPA 4V0QA 1R6AA 5DXAA 1JG4A 2PV0A 2YQZA 2VZ9A 4P7JA 1WS6A 5CM2Z 4P7FA 2E5WA 3CC8A 4GC9A 2I7CA 3ANXA 3MGGA 5CVDA 2YR0A 1O9GA 5GP1A 2ZWAA 3KQWA 4E32A 3M6WA 4PGHA 2B9EA 3GWZA 3OU6A
chains in the Genus database with same CATH superfamily
1QV7A 2A35A 4K05A 1Z5VA 4Q66C 1Y3HA 2YMLA 3SM3A 2FRXA 4CL8A 1XTVA 5JZVA 4OMDA 3W6UA 1VG8A 1XEXB 2EJWA 3L01A 2OFPA 4RVDA 1WB6A 3EXHA 1J5PA 1GPMA 4P4SA 4A15A 3TRHA 4BLUA 4R8SA 2R00A 5F21A 3TAUA 1C9KA 3M81A 1JJAA 4FR2A 2QY9A 3EPHA 1M1YA 2QRVB 1CBUA 5AOBA 2ZJ6A 3VTFA 3L1VA 1CRLA 4C03A 1Z4JA 5IM5A 2R7LA 5DYWA 5AICA 1QFYA 4LVOA 1NQUA 1OX5A 2Q4EA 3ASYA 3EFBA 2ISSD 1MIOA 2QPAA 1H42A 3QBVA 1YS4A 2KJQA 4OQFA 3X2EA 3VI3B 1B0UA 1JKXA 3LCRA 4CZ2A 1FZQA 1YZVA 3TSCA 2Q0XA 2Y1GA 2C83A 3F0TA 3FKSA 3QU2A 4OD0A 1COWA 1DKUA 1YBMA 3OLXA 4FCTA 3KV3O 1EVIA 1H6AA 3IMEA 4M7OA 1YF3A 4BPRA 2J48A 4B82A 5E6UB 4GR9A 3SS9X 4CLHA 1PK9A 4IINA 3RDPA 2Q28A 2NU7A 3G2KA 5IKPA 3NC1C 3U19A 2WWHA 4YUYA 2VAVA 3LTEA 4OL0A 3BD6A 3EVBA 3V8RA 2AMYA 4IHJA 3FLBA 3SS8A 4TLDA 2GAOA 1R6VA 3FZNA 2QTZA 1YJQA 4OUDA 5BSMA 4DSZA 4ARZB 4ZEOA 1Y3FE 2B4KA 4GH5A 1WRBA 1D2NA 4LK2A 3V97A 2CK3A 2BOVA 4DB4A 2FR1A 3FNIA 1SXJE 4JB2A 3OCUA 2JJ2D 4QGAA 1OZAA 3DDSA 1KDOA 1M74A 1T3SA 1SG0A 1NFFA 1MAUA 3U80A 3CVUA 2XOXA 2V45A 4JSTA 1KMQA 5HK8A 4OI4A 1KYIA 5AH0A 4BX8A 4JXJA 4D3ZA 1E3EA 2RFLA 1O95D 1H22A 2HU2A 3C85A 4BFUA 3JQ9A 4ZJYA 3I5MA 3O03A 3U44A 1EX7A 5JS8A 2CMGA 1PT9A 1CWUA 2X86A 3NIDB 4WGGA 3N58A 5DXJA 5I8ZA 3LO8A 2AL7A 3CVJA 4I0WB 3E3AA 3UKJA 1JXAA 2DH5A 2ISCA 1ISGA 2AHRA 1U8XX 1XTKA 1CJBA 2IEGA 3IPXA 4EG0A 1Q3HA 1RDFA 1YVUA 3L79A 5EGSA 5EMMA 5F2NA 2HHCA 2CXPA 1H9BA 5B1IA 1DUSA 1KEPA 1F0NA 5E0OA 3TQTA 3CH5A 3MB5A 1KQFA 1XZFA 3LPNA 1GGHA 4Z8YA 3IC5A 2QR5A 1JHMA 3WOVA 4GO1A 3DZ8A 3LXXA 1KOJA 3AB8A 4U7DA 2WT8A 5CNKA 4MVJG 2NUAA 5IHPA 2GZ3A 4JJ6A 4M76B 4PSAA 2R62A 1KE1A 4E2FA 1XEXA 4YROA 1P9LA 3LC7O 5GAJA 4U2KA 3ZWWA 4WK0B 4D5GA 4FJ1A 1S8FA 1PX2A 3CLHA 1W36C 2HCBA 4FLMA 2VQ3A 3HA2A 3AJDA 3EAGA 2C2OA 1E1LA 3ZU5A 4OYRA 3UIEA 4I19A 5BXQC 5JXHA 2QVCA 3R09A 2ZYWX 4UAUA 5FNVB 4AECA 4G85A 1XZKA 3G2JA 4TYPA 3ZWPA 5FOUA 1T9ZA 2ZSFA 1VHQA 5IHXA 4UU7A 3DLPX 5KAPA 2W83A 2Q3JA 3UW1A 2BONA 3O4IA 1NLFA 2PZ8A 1PJ8A 2R1ZA 2IF2A 2Q62A 3IE2A 1CE8A 4JT4A 3EBLA 3NBUA 5DI9A 5IEBA 5JCXA 1DARA 3ZCRA 1QQAA 1F20A 2E3JA 3U1TA 1U5AA 2GK3A 4HLCA 2ZATA 3PA8A 2AFVA 4FT4A 5EMHA 1CVIA 4ARZA 3ENQA 1ND5A 3PHIA 5BWOA 2OHXA 3Q7IA 3WYBA 1SXIA 2B20A 2BTQB 5AXBA 2IBTA 4CCYA 3HLYA 1YA6A 4LY3A 5BURA 5CX4A 1T8PA 1GSAA 2P68A 4HNGA 3DYVA 4BEWA 5AQEA 4L4YA 5F7JA 1L4YA 4MA0A 1P18A 3OZVA 4NE7A 4PZEA 1J56A 1H0HA 1QB8A 1U1IA 2A84A 2CFSA 1Q3TA 2M32A 2J9GA 2WW8A 2YMQA 2BMDA 4G5OA 5IBPA 2NAPA 3GQBA 4DCOA 1FA9A 4EHLA 3EQ6A 4GE3A 4AYTA 3QPVA 4KVZA 3VVLA 3O3OB 1AG9A 4BTLA 3SX2A 5LMNB 3IVXA 3PV0A 1N0IA 2QQGA 3SOZA 2ZCVA 2WMNB 3RRXA 1XA3A 3H1FA 4GL4A 1G9SA 1SO8A 1MQ8B 3H2JA 1E66A 1DKOA 3NT4A 4IDDA 3CH4B 3EDQA 4D4MA 4LE0A 4YQEA 2ZCUA 3PPIA 3U3KA 4UAJA 5GIPE 3A4IA 3FMVA 5LKRA 1C1YA 5LSAA 2BMWA 1RWNA 4X97A 5LXTF 1WW2A 1PJ4A 1XEWX 1YRWA 4DZRA 4DJDC 4KIUA 2XAAA 5HKKD 2RGDA 3DMYA 3T34A 1VE1A 1C50A 3W6ZA 2Q21A 4AL4A 3SKYA 3H8WA 1XMXA 4TYQA 5DO9A 2VT6A 2AOTA 2GERA 4ZOCA 4GI3A 1PTKA 2PR2A 4N5NA 1HSZA 5DM1A 1IOWA 2W2KA 3P0HA 3S28A 3M4XA 1J09A 1QIDA 5DH9A 3WY9A 3KBOA 1DC4A 4C0SA 5IUNC 4D41A 4H77A 1DOAA 1P7ZA 3R5TA 3IDSA 2AOWA 1Z28A 3VDRA 3GY0A 5FNVA 4BP8A 3FAZA 1I14A 1D1SA 2MYTA 3J7AC 1E2KA 3NMUF 4O2BA 1SR8A 4P82A 1P31A 5CW2A 3GRZA 2CLIB 3FPBA 1ZRHA 2EXXA 2PM8A 4CMIB 4CT0A 1L9KA 2QLLA 1ZGHA 5FIUA 4LYHA 5JAIA 3FGNA 3FIJA 1OB5A 1YC2A 1QCDA 2P11A 1DOZA 3WL7A 4B17A 2QD5A 4Y2RA 2VO1A 4GLOA 1LLCA 3OAAD 4UDOA 4YLEA 3DPSA 3IVGA 4PM4A 5FWDA 4QC2A 5B1EA 2Z2XA 3K9WA 4PO8A 3HADA 1M72A 1RYZA 5DGXA 4J16C 3PB3A 5CA1B 3AVVA 3BHMA 4ESEA 3DYIA 3EH2A 1RFGE 3O38A 4N01A 4NWIA 4QFDA 4RF2A 2FQQA 5FUVA 2LIPA 5FUMA 5HRAA 3IKMB 4MPJA 2XUGA 1E1CB 1EVJA 3OZ7A 4ZQBA 5K3AA 4AY4A 2A9JA 4CUKA 1G9XA 2Q99A 4Q1AA 6ABPA 4WK6A 3SNKA 2G36A 2E5FA 5B6IA 2L19A 4AURA 3FWYA 3LC0A 3NUQA 3ILYA 1N78A 1DGQA 4KUHA 1NRJB 2BMAA 2OV2A 2VDVE 1RKQA 3HCBA 5ES3A 4D3XA 4UASA 3G2NA 3IDOA 1EGHA 1BE1A 3GK3A 5AJXA 3W5AA 3TVYA 3R41A 3AOEC 4M4SA 1AUVA 4IQ0A 1O54A 1OA0A 4D6XA 4DAOA 2V98A 3DXFA 4KQ1A 1SQSA 1EX9A 3ZJTA 2ZK7A 5FOQA 2DTXA 3ROKA 1T5HX 2A33A 1ZM4A 1QVAA 1YQWA 5BSGA 4CIAA 1ANKA 3H5VA 1BZYA 1IM2A 1D2MA 1JR3D 3MJTA 2A3NA 5HDQA 4D5EA 1M34B 3PX3A 1C1DB 1RKBA 1LB1B 1ZZGA 2QROA 2R6DA 5EE1A 5C7IO 3ITEA 1GLNA 4J0JA 3LOQA 1Q0RA 4I14A 5M04A 3IJ5A 4K9OA 1KFCB 3BREA 5EZYB 5BV0A 8ADHA 4HDMA 4RIEA 1YB1A 1VG9B 4XIFA 1GZ3A 2GN0A 3X1DA 3JD0A 3ACDA 2P4SA 1DG3A 3VYTB 1HORA 4Y6OA 5CXSA 3AILA 4D9FA 3KZ1E 2CVOA 3DDHA 2Q2WA 5EIXA 2YL2A 4CTJA 5MGNA 4MHTA 1ZL2A 1SEVA 4M7PA 4F5EA 4KZPA 5IKOA 1FW6A 2PQ6A 3NIFB 4DLRA 3L07A 4QGBA 1RXSA 4DR1B 3PI7A 2PXAA 1DB3A 4JI0B 1NI4B 5C7LO 4DADA 2ZJ2A 3TB6A 1P60A 1ZUHA 4Z9FA 3A2MA 4UBLA 4YN3A 4LNHA 1ID1A 1X86B 1BEZA 1MG0A 2CYBA 3BFJA 1D6SA 4XX0B 4G5GA 1NULA 1TO2E 4OEHA 3FTQA 3TIIA 2XQGA 3OHPA 4J0EA 1HZJA 1XGKA 4CTMA 2YZ2A 2P9EA 1BGXT 2Q6KA 4X41A 5B3JA 3GFBA 3PJDA 4GPD1 2C77A 2UU9B 2AJTA 1W5SA 4N6OA 3GLGB 3BE8A 3DNMA 4ES6A 1FFYA 4XOUA 1Y42X 3CEMA 1E3JA 4HQLA 1YVDA 4MW0A 3MHTA 1M83A 2QJTA 3ZNOA 4Q1CA 4NMLA 4ENWA 1M54A 3QWAA 1S3IA 4X1IA 3BQ9A 3T3GA 1E1CA 5SZIA 3U4QB 4FSXA 3DVRX 4PU0A 2Q1SA 1KY5A 3KLNA 2OCBA 1DWOA 3NHPA 3OHSX 2AG0A 4CDGA 2V7UA 3H87A 1H2EA 1K2WA 1S4QA 1D3AA 4LJ6A 2ES4A 1V2HE 1P5RA 3RD5A 3TLYA 4E4RA 1GQSA 4IDFA 3M6VA 2DGDA 3HA3A 4KMOA 5AMXA 4Y1RA 4QQRA 5C7YA 4RHUA 3OOJA 5KSOA 3K5PA 4U8HA 1JBQA 4Z8XA 3ZZNA 5IUJC 3VHXA 1D2AA 1C14A 3NBFA 5F2KA 3TZHA 4IJ5A 4RK0A 4OHPA 2WEKA 3KUDA 5I7VA 2PUVA 4OBEA 4S0XA 1JYFA 5ECDA 2F1IA 3EXG1 4MQBA 3OEEA 5FBWB 4F3TA 4J03A 1J07A 1J23A 2I2FA 1GVHA 4KREA 2G9RA 1VG0B 4PCVA 1FYXA 1JKMA 5DT9A 1LVHA 3L04A 4R69A 4RKRA 3THSA 1QO0D 4D3FA 3QNWA 5ERYA 4AY6A 5EZYA 4OP3A 3S5UA 2NWQA 1KAHA 3ENNA 1IN4A 4RELA 1WETA 2XB4A 3FLEA 1EHIA 4DEXA 1CY1A 1YQQA 3MAAC 3OFND 3SYNA 3MTDA 1EIZA 3CF6R 4LHEA 3UV7A 4A23A 1J4AA 3T3IA 3NWBA 1FX1A 4C0XA 4DWWA 3K0EA 1FDOA 4ZTZB 2I4RA 3T1HB 2BZ0A 1F8UA 1LPOA 5G1NA 5BN3B 3ROPA 2HMUA 2J46A 4UHKA 3VR2D 4UHBA 3RODA 2PAAA 1NW3A 3BXXA 4PSUA 4QJ5A 2EJCA 1WXHA 2XNDD 2CF5A 3FOAA 1QLJA 4WLOA 3RRMA 3UPDA 3U7GA 3RC2A 521PA 4MTCA 3SX0A 4B6PA 3FNGA 2IWHA 3ZBQA 1AB6A 5KCZA 1NP6A 1E5QA 4MUMA 4XX0A 3TR6A 4LX8A 1XQWA 2D5LA 1V6SA 5A5VA 2NP6A 1XPRA 2VT3A 3RRBA 3MSXA 3WYFA 4FX5A 4BLQA 1Y3AA 2BF4A 4P3OA 4QLBA 2FRDC 4WY8A 4KU4A 3OU7A 2OWEA 2ZVPX 1T5DX 4W1RA 4F84A 4NZPA 4QTYA 4Y1EA 4C78A 4K9NA 3X43A 1PUIA 4Z7NB 1OKKD 4CGYA 2Q6IA 1CY7A 1Q21A 4IV8A 1KMCA 3GN2A 1MXHA 3U4QA 3GCGA 3PFIA 4NK4A 2P9YA 2JCSA 1GRVA 4Y2UA 3W5UA 1RACA 1IZYA 1E5VA 1FU8A 1ZM9A 2FPWA 3DLAA 4D7AA 4M89A 4GBJA 1XALA 1KH3A 4Q1DA 2IGTA 4PFKA 4R7GA 3ISVA 5F2EA 3HP1A 2OD7A 2YXPX 2DBZA 4PNZA 4QU5A 5T64A 3SDZA 2PWZA 1N6HA 2WTAA 2WTUA 1QJCA 4C6RA 1EPUA 1ILWA 1HKUA 4I4LA 4LK3A 4MLCA 3PGXA 4G4JA 1R12A 1G8FA 2C4HA 1FNBA 2Q50A 2ZRKA 3ROGA 4D9EA 2RI1A 4IZ6A 2VNHA 4U8GA 1YS7A 3RBAA 2DFLA 1ZGJA 2CW5A 2ZAIA 5D87A 1VL2A 3TNFA 4RDIA 4BLPA 4GPTA 4DFDA 5K8UA 4R2KA 4FOLA 3IT3A 4UU0A 5JSKA 3W9UA 1A8HA 3DG9A 3STTA 1E79D 1LK0A 1XZMA 1YB2A 1KWGA 2A0UA 4MUKA 1W46A 4C22A 3BMXA 3O8CA 4UU8A 2WWVD 4YMUA 5BV7A 1U63A 1AF4A 5ERXA 1VJRA 2EBUA 4NDZA 4XGKA 5EXPA 4AZ0B 1B0ZA 2LIVA 3NBXX 4O4IB 2JHPA 3ZU3A 1CLEA 2VSOA 3GOHA 4XXHA 2GCIA 3CRQA 1W4CA 2VNJA 4EA8A 3Q0TA 2VZ9A 1K7XB 1HM5A 3JCZA 5JAHA 2JBAB 3CR3C 2VH2A 3IDQA 4LF5B 3QRWA 4DYVA 5B3KA 5BN3A 4O4LF 2X5OA 4ARCA 3UM9A 1EM8B 1DAEA 4N9WA 3OSZA 2B35A 1Z7BA 1Q1GA 4X44A 3N2KA 2AEJA 2AJBA 4WL0A 5HHTA 3BB3A 1XWFA 1E4EB 3B12A 3LQRA 4PGHA 3ZWXA 3OZIA 5C5IA 2UYCA 2O5EA 2CKDA 3DFIA 4FN5A 1QAOA 2IYLD 2R3SA 3R0JA 2VTVA 4Q9NA 5CYOA 1DXQA 2PX3A 3KJZA 3V32A 2QJFA 1KYVA 1U2TA 2I76A 1G7SA 2QAGC 3RSLA 3V8PA 4AF6A 5G0SA 3FTFA 3ZY5A 1AN9A 3HRIA 3HYSA 4KQMA 4I8DA 2VI5A 2W9XA 4LHSA 1DO2A 4B7XA 4NMWA 2CHEA 3JAMA 3WGKA 4DDHA 4KNVA 1YTLA 1B3RA 3SLGA 1M2GA 3M0EA 2MDTA 5BR4A 5B3JC 5L51A 1UP7A 3EVDA 4C4RA 3WQSB 4G86A 5BMVF 4Z53A 2A0KA 2HX1A 2R7KA 3JQGB 3VPAA 4YJ2A 3H6HA 1QQTA 1FU7A 3CA8A 3ZWBA 1NV9A 2YUIA 3V1MA 5C18A 3B2EA 1HNWB 1UXKA 3QFSA 5FF9A 4AUEA 2V6MA 1BQ4A 3PVCA 4XEHA 5FUBA 3LWDA 3KHKA 1IXZA 5TPWB 3LI2A 3RUAA 4EVQA 2E9SA 3CY6A 1RTTA 1Z4MA 2ZUVA 1SB8A 2WUVA 1MR3F 3EDMA 3SN6A 4YCCA 1CRPA 3VPFA 2WINI 3KPUA 4LRUA 4NZNA 3ZLVA 2FH5B 1MRZA 1YA8A 4IKOA 1WUHS 2OILA 2XRYA 2FAXA 2C2WA 2Y0PA 1ZN9A 4D4JA 1MJGM 3RT7A 5EJ5A 4GWGA 1U3CA 3DFKA 3ELWA 4NTZA 4TS1A 5JWRA 2XTJA 2GFQA 3A0RB 4IQFA 1Z0DA 3OJCA 2YV1A 3ICWA 4K5QA 2Y9MB 1V16A 3FKJA 2DFNA 3K6RA 1LSUA 4J9VA 3TGLA 1SXHA 1NQVA 3VR5D 4A2PA 1SHUX 3GDGA 1EWRA 2X8LA 1WV0A 1ZSNA 3EGCA 2WQZA 5ECGC 4KR9A 1V1RB 1AHPA 4ND2A 3ZTTA 1P1KA 1EE1A 4AZ0A 1G4UR 2H1FA 3EZ2A 3MOGA 3WGUA 4CDRA 1X74A 1U1EA 2PD4A 1JB9A 3PJEA 4C0LA 4ZTUB 1ULZA 1TDJA 1B73A 4BQRA 3D3NA 4M99A 5CFOA 4DR2B 4WV3A 4F86A 3AMVA 1JQ3A 1XQ1A 3QJYA 1TUGA 4OOEA 1J8MF 1Z75A 2GEKA 2JDIA 4FZ3A 1EM8A 3PDIB 1Z5ZA 3A9TA 2W2VA 2WWTA 1GKUB 4R2IA 3EAFA 1VL6A 3P26A 1E4EA 2RGBA 1UQTA 4FMCB 4UCFA 2PJUA 3JS5A 2Q5OA 3I2KA 4MPTA 4OHZA 2QJWA 1U8TA 2FE1A 2XGSA 2HQ1A 1XQVA 1ZGGA 4F3KA 2G9VA 2ZUFA 1C81A 2VBIA 1R3DA 2ZTMA 5KWSA 3DBIA 3E82A 3DBLB 2JGRA 1U94A 1AGYA 4PBRA 1KARA 2ZU0C 2R6FA 2OMEA 1F4LA 1OBFO 3CG4A 1P8AA 2WD8A 5LMZA 4NFYA 1KZ7B 2OAQ1 3PE3A 3AL0C 4FHGA 2DWQA 1NBEA 5MFZA 3FSEA 2HGZA 4TWRA 3MG9A 1E2BA 5LR6A 1E9EA 3NC4A 2PGAA 2DPYA 3UQYS 3JQGA 4EI2A 2W98A 3AIMA 3E8SA 5CDSA 3OY2A 2UYYA 4ZAVA 1NBWB 3IXLA 4KQWA 4V0LA 5HZHA 4ERXA 3T7JA 3ADKA 3KTFA 3BRCA 4RDXA 1R9NA 1I4TD 1BRMA 3CNNA 3QTTA 1KMHB 2BIFA 2IIPA 2ZSJA 4G07A 2E1PA 4AZ3B 1TMYA 1BROA 2IV2X 4YP6A 4ER7A 2AA3A 3TLMA 5HWSA 1M6VB 2QW0X 3UWPA 1AMNA 3WNZA 2PZBA 3NP9A 1FP4A 4PHTA 4CE6A 1C30B 1AUPA 1OFHA 3GGCA 2AEMA 4M9SA 1RWBA 3LYLA 4R51A 3PEWA 1KZYC 4L8FA 4RJLA 1SHTX 4ZC8A 3LA6A 4P93A 3S2FA 4B4KA 1SPXA 2C4VA 5K0FA 3UJAA 1A9OA 3L7LA 1Y1QA 2Q5FA 2YW9A 1L7PA 3T3NA 5LZ9A 2O4CA 4EB6A 1JH9A 1XUOA 1Z26A 3WISA 4KBFA 5JE8A 1KJNA 4P54A 1YFZA 3QBEA 1UKBA 2NUTB 3BTOA 3PNLA 1TZKA 2XIQA 3NOQA 4MZXA 2EP7A 3SZRA 3ZGOA 4EUKA 3W6OA 1SELA 3E3MA 3VVBA 1FRZA 2QE6A 3NG1A 4ZRDA 2Q3MA 5K1ZA 2RGNC 4DIEA 1BTOA 3T94A 3FGPA 4PONA 1ST3A 5G2OA 3ZQKA 4QKQA 1LRJA 3KQOA 2C3PA 5JJ5A 4HAWA 4JWTA 3NM6B 2IUTA 2Q9AA 4RKQA 1J9GA 5T4EA 3MRXA 4DWJA 4ILEA 1KU0A 3WQRA 3G02A 3T7DA 1C4XA 1NN3A 1QONA 1ORIA 3W7AA 4XYGA 5KJ1A 4UM7A 4S05A 4IMIB 1DAPA 3PDIA 3QX3A 5BW8A 1YB6A 3W3AD 3MGKA 1XRLA 4MP6A 2BFAA 3GMSA 3MWDA 2BJWA 2NZ8A 5EUQB 4PCUA 3MSCA 4ETWA 3AM4A 1Z6QA 3GPDG 1R4NB 2J08A 4FGSA 5EP2A 1RBMA 4NIMA 3ZW9A 1P6XA 1J97A 2HPAA 5KYGA 5D85A 2HHAA 1A98A 1ZSYA 2R5NA 3SC4A 3DBLA 2I3AA 4F0JA 1KO4A 2CLKB 4HFMA 2OK7A 4F9EA 1GPH1 1PTJA 4AP5A 4WECA 3RC1A 4CM1A 1Z38A 1ETHA 2VJCA 2XMCA 2CUNA 2Y05A 3IV6A 4LVUA 4TMYA 5F1YA 1ORRA 3OOHA 3BJIC 3VSBA 2P4QA 1L3CA 4PEVA 2BM0A 4G0WA 1PJZA 5E7IA 1M0TA 4L08A 2JGNA 5JPCA 1DNPA 5AJHA 3FPSA 5DX8A 2WYVA 1Q7RA 3A1SA 4IFBA 1JHQA 4ZK2A 2EYQA 2I7XA 1HV8A 3HSYA 1R0YA 2ODWA 2QK4A 3CW2A 3D1LA 4J7XA 4Y2PA 5IXSA 3MBIA 2HFJA 1H4QA 2A58A 3D6HA 3LUBA 1HQDA 4C0KA 1Z13A 1SCQA 4R9VA 4DDVA 2QPTA 4YV7A 2JLWA 1KMHA 2HA4A 3WBBA 4DOMA 1A0OA 4RJ2A 1JHYA 4AZ3A 5JZBA 1OGIA 4L4ZA 3MT7A 2HTFA 1YI8A 4IDEA 1M6VA 1RVDA 5I9NA 2EQAA 3X1WA 1P9RA 1IXRC 1XT6A 1DCFA 4J1TC 3NLLA 4V02A 1C30A 3O3NB 3CJQA 5KTTA 5KEIA 1LFDB 3D5TA 5FEMA 4MR8A 5COAA 4D42A 4ZI3A 1XZAA 1EFRD 4LBYA 2VWHA 4HN2A 5IJXA 3MLBA 2ZPUA 4NC9A 1JEQA 2YXEA 3T1NA 4X20B 2B7CA 3PQ6A 3P32A 3ETGA 3PD0A 1X7XB 2PY6A 3KJFA 3A1WA 4A6XA 4UBNA 4Y7CA 3TLKA 3BH6A 5JJCA 4LCJA 3ZG6A 2C5BA 1GADO 3L1JA 3FTNA 3QHQA 4JT8A 3ETJA 4NYMR 2OQIA 2NUTA 3IX7A 4MW5A 4D9CA 1LPMA 3FTEA 2IYAA 4TS4A 4C5AA 3IT2A 4AMVA 3CPSA 2RMKA 3B1WA 1AF7A 3OOEA 5F4ZA 5B1DA 4BFWA 2X9QA 1A9RA 4F6CA 2GA9A 3R5JA 5JS2A 2RB4A 2BKXA 3BTSA 2BEJA 4BV2A 2Y1KA 2C42A 4QT4A 2D3WA 4FFPA 3W90A 1OB2A 1CDZA 2AUMA 1R3UA 2AN3A 3FBGA 2JLXA 3P1JA 2IHZA 4RLFA 3UO8B 3K7EA 3KUUA 1L8AA 3HBNA 4MYHA 2XE7A 1BMDA 2IF0A 4OHKA 1X8LA 5KYYA 1GNQA 4D4LA 4D74A 1TTTA 4WY5A 1R4NA 1JI0A 2P9JA 4ZGWA 2NSLA 2VDUE 2VCYA 1R9JA 5EE3A 5CVTA 5HS4A 1Z82A 4OI1A 3WK7A 1M2JA 3FF4A 4GVLA 4MZDA 2M6SA 1M75A 2IYNA 3UKDA 3K9LA 5CVVA 3M49A 2OA0A 4FW9A 1GQYA 2IHBA 1F60A 2FA9A 1DRVA 4YJHB 1FP6A 1GV1A 1U3VA 2VQSA 2CHUA 3N3BC 1PDWA 3FNQA 1RADA 2VYCA 2BPOA 5AK3A 3O84A 5LWQA 3H86A 1SBIA 1Y9ZA 2I6GA 3LZDA 3R20A 1FFBA 4CIXA 3WMFA 1WDWB 2AN5A 5JQWA 3HVHA 5AIAA 3TPCA 1E1RD 3MFYA 4F8EA 4OXNA 2PAFA 2R2GA 1V9CA 2PL3A 5AQ1A 2O59A 4NS4A 4WCDA 4F4FA 2D59A 3U7RA 4ITUA 3PXDA 2PKXA 3HO6A 3O73A 4O4JF 3C5VA 5FAKA 2VL7A 4BNFA 4GICA 4ND7A 1WMDA 2VQFB 1LTHR 4ME6A 2ZANA 1MB9A 2O2IA 1ZN8A 3E3NA 4JUCA 3KWMA 4IRXA 4XGIA 3X1ZA 1BXRA 1AKWA 1OOEA 1TQ8A 4RORA 1X39A 3HL4A 4EMBA 4W6ZA 2FHSA 2OB1A 2ROQA 3I2FA 3HSSA 1ZU5A 3MNFA 2DSNA 1SCUB 1FQWA 1BMFD 2A1TR 3PXUA 4K28A 4KOEC 3RREA 4X20A 1E9AA 2WYOA 4HPXB 5P8WA 2QLJA 1DXYA 5ICCA 1X7XA 2O3JA 3KKZA 1Z2AA 2GN4A 3G9XA 1TQHA 2AHOA 3VYVA 1VC2A 1ECPA 2ZYGA 3DKKA 1N8TA 2ZRDA 3QEBZ 3V8EA 2EFHB 2R6ZA 3ZNQA 4WSOA 3CUTA 5KI6A 4PG5A 1CJUC 3PPVA 4IW3B 5D01A 4XQ9A 2ZUUA 1XTTA 1L5OA 5F5LA 3HEMA 3ZHYA 1BXKA 1A8UA 5BNZA 1RAHA 4LE1A 4PTLA 5A3JA 4UUNA 4BFLA 1ORVA 3CUWA 5JZSA 4EMSA 1IWPB 2I78A 1BXZA 3Q41A 5DM2A 4L4SA 2XUIA 3WJ1A 2YCLA 3LK6A 3ZW8A 1KXZA 2C7GA 2ZJBA 3H65A 2HZ7A 1E9FA 3GIDA 3HNOA 1Z4OA 5HF6A 2H57A 4XFJA 3D7LA 1WL8A 4GRDA 1O94D 3KQLA 1QHSA 3WP1B 3FJ1A 2P6RA 2FKNA 3QYFA 4K9RA 2H5IA 4Z1MA 2NYAA 5EQDA 3OETA 1B00A 5FWXB 1WNTA 4PFSA 4JYBA 2J30A 2JGKA 3VZBA 1JE0A 4C0WA 3MAGA 1Q0TA 1Q17A 3T7AA 3PKZA 4IILA 4XUDA 1JQJC 4TLLB 5MGBA 2AG8A 1Z2OX 1W1UA 1PJ2A 1YSCA 1RI3A 1ZIPA 2OE2A 2OECA 1AK1A 3I53A 3OIFA 4NP6A 2AFIE 4YJHA 4X64B 1RRCA 1KQ3A 1UFKA 2YKGA 3BB4A 1AKVA 3GVPA 3CCBA 3UHJA 4YRZA 1VMKA 2O5RA 4ZHSA 5KTRA 1N34B 4L5AA 4BQEA 3NHFA 3D7SA 1AQIA 3U3RA 1TIBA 1G8PA 2BCEA 2CE7A 1UM9B 5TRTA 3QW2A 4D96A 1KC3A 1PEDA 1I3LA 4GD3Q 5FWYB 2X0EA 4A3SA 2QVZX 3FKSD 5KQLA 2DB3A 3CEJA 5JH7A 4N7RA 1T1SA 3VR6A 5K4HA 4I5EA 1G8GA 3CVVA 2ZVQX 2RAFA 5EHIA 4B6OA 3SX4A 4QVKA 2R6CA 1P2FA 2ZRGA 1QO7A 3I9MA 3LIIA 3TTVA 3SAJA 1RAFA 3TE7A 2CNKA 1H1LA 3VDMA 3U7HB 2A1IA 3LKVA 2P62A 5BMOA 2PXCA 2CYCA 2R66A 1D03A 3GT4A 4R2HA 4X95A 4OH7A 1LF5A 1ZNYA 5JZMA 1VSBA 5K2OA 2CK3D 4FGJA 3RLIA 2O6HA 5H81A 5LZ2A 4BE9A 3HCDA 4ASUD 4ABTA 1MTOA 2VTKA 4MW9A 2V6IA 4U2BA 2O8EA 2OCIA 1SCUA 2Q5IA 4CU5A 1I3CA 2HREA 2FOIA 1YZYA 3GWGA 1P9OA 1IHYA 4Q3AA 3G59A 1KJJA 1J42A 1HMPA 5DBIA 1Y4DE 3AF6A 1QVVA 3E22B 1ZA2A 4MWSA 3AEZA 3QEKA 4I1IA 1FX0B 2EOAA 1NVKA 4LMRA 3CVOA 3GRPA 3RVOA 3U7QA 1MDBA 2NV0A 4OX9B 1TQDA 4HZUA 3ZE7A 5CT9A 1Z6PA 2Q8QA 2W2PA 4HAOA 2ZRNA 2C9BA 3F6EX 3MT8A 3R7WB 3T5PA 3ZBPA 1CQZA 4BTVA 2FCRA 5K45A 3IOBA 2G63A 3OD5A 5CNIA 5HXAA 1UP4A 3C3BA 4YEDA 3LUPA 1APBA 4D46A 2Q1WA 2ZIWB 5CFPA 2BFPA 5IJWA 3PC3A 3DT6A 5AD1A 5EWJB 1FDUA 4Q3EA 3V48A 1WKCA 4MK4A 4K9PA 2ECOA 4PLPA 1OQAA 4ZDWA 1T1GA 1RMQA 2XW6A 4ARUA 1GGVA 3DONA 1C0LA 3WB2A 4DRXB 3U5TA 1O0BA 2F3TA 4LMBA 2ZI4A 4N39A 1G60A 3MWJA 4I55B 5ALPA 3UMGA 1KPIA 3PGA1 5L3SB 3Q2IA 6AT1A 1T9GR 4A8PA 5T4HA 1E9VA 4G41A 3DT8A 3CN7A 3K3PA 3T5TA 3IJEB 4LY6A 3O4GA 4GWLA 4P7JA 1WS6A 3TZBA 4LXYA 4LSZA 3DTTA 1Z33A 2GCNA 4EYQA 3M2TA 1E98A 1A88A 4MUFA 1L5WA 3H6GA 2CF6A 2VBCA 2CLDX 1UM9A 3JQ8A 3QU9A 1EFHA 2H9YA 5BVGB 4P5DA 5FWYA 2EKLA 5I3ZA 5BYBA 3AVYA 1GAWA 5ALKA 4BVJA 5LBUA 1OI7A 1GZHB 1OFVA 3AK4A 4MKFA 1IMJA 3O1LA 3W2GA 4YI5A 3L9WA 1O89A 3I4LA 1T8SA 1N8NA 1U7HA 2QM8A 3ZD9A 1N2CE 5ALNA 4UCXA 4BV9A 3PUVA 1Z3CA 3RVDA 2ZU6A 5F7ZA 1XZQA 1GL3A 3G9QA 3IBYA 5CDGA 4M8SA 3JD4A 1FDTA 5EJ7A 3RUDA 5JVDF 3H11B 4L3OA 4NULA 1IZ7A 2ZLBA 4O6VA 3PKIA 1QH1A 2ZBEA 1O9BA 2JI6A 5E9QA 3ZVRA 1SK8A 3DDWA 1FFEA 4N5IX 2NU8B 3QU5A 2F1OA 3BAFA 4KPFC 4KYVA 1XNJA 3E22A 4I1UA 4G1VA 2N0SA 3N0XA 1FX0A 1GU7A 4JOQA 2OGUA 3O3MB 4TXMA 4TVBA 1A72A 4QXMA 3BAZA 2HQRA 5DBFA 3VZQA 2YMPA 1K75A 3F90A 1X9GA 3H05A 3TRJA 2I99A 4AMBA 1J99A 2PS9A 2XCIA 3OQPA 3PHCA 4TROA 4TRNA 2IUYA 2PGDA 5IDYA 3R7WA 3GEMA 4J4BA 3PD1A 5AYVA 3RM3A 2XWQA 4BV8A 4G8DA 3RWBA 1YDGA 4BU1A 3IJRA 2AZ4A 1EWYA 2PFSA 4KKVA 2ZZKA 5AKYA 4S0ZA 4DA7A 2JGIA 3TJZA 3HVRA 3D7MA 1LI5A 1RWKA 1COZA 4NCJA 5CVCA 5EWJA 5EMNA 3H5AA 2CSUA 2P5TB 2NVUB 2FVYA 3ZW7A 4A91A 3WO0A 4CG0A 4D56A 4KQXA 3N8HA 1ZMTA 4OQZA 5KS2A 4DRXA 1CVLA 1P72A 2DFTA 2GAFA 3F3SA 4U02A 2GSDA 3NP7A 4UNSA 3DMHA 3GIWA 4DCJA 1D7OA 5A7FA 1VL0A 4OHBA 4I55A 3UXMA 5JWOA 5L3SA 2GPNA 1LVUA 2JGEA 4B3XA 3LKDA 5DSXA 3RG8A 2RH8A 3MQFA 1IXKA 3PVSA 3T7TA 4BP3A 1QH8A 3GYGA 3QWFA 1Y3DE 1WBJB 2P4EA 2VF4X 3Q10A 2NM0A 1RJ9B 1XJQA 1SRRA 4MKZA 4P81A 1O6CA 2HJSA 4P22A 1L5HB 3SC3A 4BEVA 1X19A 4WLUA 4D6YA 5CEEA 3OC6A 4IAOA 1O0CA 3OUUA 4NCIA 3O2QB 1P3Y1 1XZIA 1ZN2A 1GR0A 5JBQA 1J0AA 2N42A 4I9GA 1DCTA 2GZMA 1C8KA 3D6UA 4YVFA 4DIFA 1BJRE 3I05A 3PUXA 5FQOA 2RI0A 2AR9A 4I2NA 5GV7A 2CNOA 1EGVB 2X3YA 4QUGA 3AZOA 4UTNA 5JRZA 2DETA 3ZHTA 3FDZA 1IN5A 3DXZA 3F74A 1GQQA 4IX9A 4RABA 3ZIAA 4BJ6A 1G9TA 2PVPA 2QL7A 1LWNA 4W8HA 5JI3E 2WE8A 3P9YA 1VRCA 2ZIFA 2C4MA 4HSGA 4IV5A 4KX5A 3UUGA 4CKXA 2Q3FA 3LYHA 1ABEA 4ML3A 4PR3A 1QHYA 1B8UA 4CEHB 2HRDA 4D8WA 2NAFA 1KQPA 3LZCA 2P41A 1L5NA 1NIPA 1M6EX 4EHBA 4S1TA 3WMEA 2XPCA 2CJYA 4O5OA 3BZUA 3UZUA 2FEPA 3U4IA 3C3CA 5CCXA 1YFLA 1GPDG 2BRUC 3PEEA 2GXAA 3RW9A 4NR0A 2WDZA 1TEHA 1PN3A 2ET6A 3KELA 3LWBA 1A9SA 3L8MA 4YBRA 3EQ7A 2IUSA 4WXYB 4R81A 1NWCA 4UJ5A 3ZVNA 2YC2C 4K8OA 4CDNA 4DQVA 2OZPA 5HIMA 4DLAA 1FQOA 3OC0A 4FGZA 4EYGA 5HFJA 2B83A 5I7WA 5AUOB 4YLGA 3C6ZA 1NJ6A 1RQ7A 1SKYB 1U8ZA 3ZIUA 4XD7A 4PYJA 1OJLA 4BY9E 2P6UA 3G5TA 2VR1A 3F7MA 4M54A 4ZYLA 5C5DA 1FTGA 2FGKA 4XARA 5KNBH 5KSZA 4UXJA 1X94A 3WL6A 2B6NA 1CW2B 3PT5A 1OW3B 2VH5R 1A27A 1MJHA 1RQ2A 1J90A 2NVUA 4JR1A 4IHQA 4RD3A 4BRWA 3CRW1 5DNCA 3RB8A 2F48A 3BS4A 4X93A 2WIFA 4YONB 2WJ4A 5AW3A 4RV9A 5K05A 1W94A 3GFGA 3AY7A 1TQ2A 3CCCA 1EZZA 3GLTA 5C80A 2NPFA 2MJLA 3U9TA 3AVPA 3RKSA 4IS3A 1PSZA 3PHHA 1DRJA 3OPYI 4M87A 3HVJA 1Y6ZA 2JEOA 4I1SA 3F5QA 1NX9A 3UCEA 2BGIA 3KKQA 4IOLA 2FQ1A 1BN6A 2H1HA 1P4SA 3CZRA 4AY2A 1RJ9A 1I3OA 4CPDA 4WCFB 1L4KA 2FK7A 4K9QA 3N7AA 1L5HA 2XAUA 3CX8A 2F9FA 1V3QE 4GI1A 1JTVA 3KKNA 4UFOA 3OIWA 3MJSA 4MQFB 1UOQA 2OCDA 2WSMA 1YQ9A 2O23A 4FR5A 4BVFA 3AVUA 3AUSA 4IP0A 2PXHA 1SQ0A 4HMPA 3PJGA 1T8WA 1F2VA 2PTGA 1GPBA 3OIUA 4DLYA 1T6XA 4H31A 4HYQA 1JHAA 3U4DA 3SQWA 1UBJS 2I8AA 1QF7A 5JADA 1RYEA 1DJNA 1STOA 3LPMA 1VSUA 4AJLA 4MAAA 3OTGA 4M0UA 3KYBA 5TR9A 2FG7C 5JYDA 1U6JA 2I4MA 4CEHA 3EFOB 5JDCA 3QY9A 3TS1A 5ICGA 4DBLE 5LNK6 5IC5A 4FEAA 5JY6A 3LGAA 2EKBA 2RKWA 4GP7A 3X1YA 1G6Q1 2BD0A 4P4LA 1WVMA 1YASA 1DXOA 2F3PA 1VCMA 3RJ5A 2OENG 1L7MA 5BUSA 4QUAA 1E63A 1H2FA 1HT0A 1H2WA 4Q7LA 1EINA 2ACEA 1J0BA 3FJOA 1AGPA 1NFRA 3B9PA 3ZE1B 2OFWA 3AEUA 3GX1A 3GZTB 1TAQA 2HK8A 4IJMA 4UTZA 5I5GA 3O0DA 4EKNB 2BGMA 1JILA 2H52A 1M9NA 2FLWA 3P2JA 4G0QA 5DNYB 4WLFA 3U9SA 1I0IA 5BW5A 3C15C 1MRSA 4M0DA 2IHUA 2QX6A 2FTKE 1O87A 3CZAA 5D6OA 4HQFA 1I0LA 2FSIA 4S1OA 1WW8A 2QX4A 4JI8B 3H1TA 2J0EA 1L5SA 2DZDA 3OEED 4RMHA 4B87A 1UZUA 4NY1A 3DVSX 4IUDS 2I2WA 3PHLA 2JIOA 4PPGA 4RF4A 1ETUA 1QCZA 3ZZ1A 2Q7XA 1VE3A 1BHJA 3T9BA 1DUVG 2JI9A 3AHFA 2QY6A 1TM3E 2FQXA 3R3JA 1UAAA 1OSNA 3ZHUA 1H93A 3Q8LA 3AEYA 4N47A 3H13A 4LJ9A 2GBLC 4B31A 3EPLA 1OH5A 1QPZA 3ZDQA 3GLIA 5I6DA 4OBWA 1TTQB 2JEZA 3SD7A 3FPAA 3RTAA 2Y4OA 3AHCA 5KJFA 2OC9A 4FYWA 5DHRA 4XVRA 1OWNA 2O54A 2QNIA 2FEOA 2FPMA 4LJLA 4RTJA 1XJCA 1FLDA 1W4RA 2PS0A 3SVLA 2A8YA 1W44A 2XQIA 3LHDA 1N5JA 1SURA 3L49A 4NSNA 5E6SB 4KR2A 1QHFA 3C8UA 4WCFA 1JQDA 3STXA 2QDXA 2HYIC 2JL1A 1DO8A 4MULA 3RLFA 1YONA 3HU3A 4LOLA 4QDKA 5KPJA 2UUAB 2NMVA 5E2IA 4JDPA 3KDAA 2ZB4A 4TSFA 4FNMA 2ZBRA 3BWCA 4ZVNA 1JHZA 5EFZA 2XDWA 4O0LA 5FV7A 2KI5A 2GPYA 3B5JA 3JYLA 4MWTA 3R9XA 1FYEA 4OL9A 1KPHA 2VAXA 1UUFA 1OCEA 5E4TA 3RSOA 4ABYA 3W8DA 3PS9A 1C3XA 3ET5A 2J0VA 5CR9A 4GAEA 1HF3A 2J9FB 2YFKA 5GZ1A 1GZ5A 1N3IA 1TCBA 3CX4A 5AW1A 4W5JA 4MHSA 3ZWKA 2W8ZA 4E5KA 4AQ7A 4R2WA 5AVXA 1L1EA 4KXUA 2QMZA 4O8CA 4C4SA 4DGSA 1XOIA 1F17A 4Y30A 2I91A 2QZ4A 3L93A 2KE5A 3EX7C 2ZJ4A 3PCTA 1QVZA 2R4TA 2QS9A 3WKCA 1ZINA 4HR7A 1V43A 4BL5A 4EY8A 1TYZA 1BCSA 1PD0A 3N6RA 2QR2A 1G42A 1GTJ1 4HNSA 5EE0A 5IMBA 1W88B 5CYFA 3SQMA 2DUJA 1SRQA 5KSWB 4OLBA 1VYTA 2Q2OA 4ZANA 1CVRA 1GITA 5BQ3A 1TXGA 1TK3A 2A9PA 4JVMA 5A9SA 4C1BA 3CKLA 4MWZA 4IX1A 1PIWA 2WAYA 4BFXA 1PEAA 4LWPA 1YL7A 1QHHB 2GBGA 1E18A 1Z8HA 3BA1A 4HUQB 1K5HA 4KIWA 3WRYC 4B6SA 5IXYA 2PGOA 1YRAA 2X5XA 3G5LA 4K9KA 1PWHA 1JIKA 1GPWB 2ZJYA 2PX8A 1E9RA 1WCXA 1MEEA 1LY1A 3JWPA 1LNQA 3O74A 4GI2A 3NZEA 3VUEA 1BCRA 1QJ4A 2HEGA 2A9VA 3E15A 3LDGA 4JITA 4UUMA 3RT9A 3UMJA 4E14A 2PS1A 3DEFA 3GZJA 4U7FA 1BHQ1 4QA9A 2ZOSA 3I92A 7YASA 4WFKA 3O5AA 3WE7A 3CLRD 3FVTA 4I4TB 1IPFA 3EZXA 3TAHA 1CZUA 1IRXA 3ER6A 1LH0A 3QENA 3OJEA 1WEKA 1JFRA 1T1EA 2JNWA 3C3XA 4ITVA 2FLVA 1NUQA 1G21B 2ZVDA 4M60A 4UHCA 2CSXA 3EPJA 4HAXA 2PGLA 3JVVA 4URYR 2P2ZA 1Z0JA 2XE6A 3BZWA 3HS3A 2H0AA 2UYGA 4OFXA 3B1VA 3VDXA 1PG2A 4UE3S 3RVLA 1P5JA 5E6SA 1N2SA 4G4SP 2PKRA 2AG6A 1NDQA 2XF8A 4DV3B 1AO3A 3JZDA 3B8HA 3OQMA 5REQB 4E46A 4Z4FA 1FXWA 4GRAA 2PR7A 4YRDA 1ORTA 4LDZA 3TQHA 4M88A 1DAKA 3UXYA 2MSWA 4CETA 4PLFA 1XVVA 4E2WA 1WTAA 2B4RO 3LCJA 3DP9A 5B53A 3JWIA 2IH4A 3S44A 4E2ZA 2J3HA 3D3EA 4PRLA 4RWZA 4CR6A 4ECEA 2AYYA 3INNA 1XYYA 3GGDA 3FSGA 1B6SA 5GJCA 3RVJA 5ESXA 3VPSA 4E2XA 1S01A 2Q4BA 1DCKA 4QULA 4BMOB 4HOYA 3M8KA 3P4UA 3UH1A 2G17A 1L7DA 3RROA 3SC2B 1ZNWA 3AM3A 4IZIA 2X77A 4HDNB 4I6GA 3PSAA 3ZCSA 1H0RA 1GPAA 1GXSB 1HEUA 4ENUA 4M0MA 4GZ5A 2OKGA 3RS9A 3RYIB 6GPBA 3KT3A 3ILHA 3LPLA 5JD6A 5DBGA 1W0JA 1IY1A 3PLNA 4FHCA 1EG2A 4MUNA 3ORHA 2BC9A 5HF5A 1X80A 4MUHA 4HH3C 3HXLA 2GDZA 4LJKA 2ZYDA 1W88A 3N6VA 2RHBA 4NPAA 1K8ZB 3BIFA 3GN1A 1NBHA 4XM2A 3UENA 3GBPA 2ZS7A 4A26A 2GYYA 4EJSB 3M4JA 4EVRA 5FI1B 1ISJA 5E8RA 5KINB 1UBRS 1UZNA 2IGBA 1BO6A 4DV2B 3MLAA 4X1YA 1T3ZA 4PC3A 4CR7A 2FPGB 3JYOA 3ZQUA 3SBXA 4R68A 3FGZA 4GMFA 5CJ2A 5FORA 3W05A 4A6EA 5C53B 1K06A 4KZKA 1DC7A 4PAOA 2SKDA 1JWLA 3IELA 2NXEA 1KI4A 4BZPA 2IYUA 4LG1A 1CP2A 5CD1A 1T34A 2VNKA 3DB1A 2PVCA 2PKQO 2RGWA 4MYTA 4CM5A 3D02A 3VR6H 5G0WA 3TZKA 5J5CA 5AVYA 2FWRA 1JHXA 2CL7X 3Q1KA 1N33B 2CUTA 2X4LA 2X8WA 2LV8A 5EI5A 4BFYA 4FB4A 1MC5A 2NUPB 4P38A 5BN1A 1G5PA 4J29A 3AONB 2XRFA 5L40A 4L72A 3HGQA 1XL0A 2J6BA 4FGKA 3CLKA 4EGAA 2D2EA 4UXIA 1MQAA 1ZI6A 2IHVA 1ZM2A 1G21A 2PMBA 4IH4A 5ABPA 3EIXA 2RGYA 2JDID 1CZLA 3Q3HA 4YPFA 4QASA 1DJMA 2ASEA 3LS2A 2W2QA 4GP6A 4K9LA 1NZJA 4M8LA 2ZDHA 4KI7A 4P84A 1SOMA 1LUAA 3C4JA 3W2TA 2JFNA 3OP1A 3BQMB 3ZU4A 1WE2A 4JJAA 3HC7A 4JN6B 2YWFA 5CH3A 4BFSA 1PT8A 2I3DA 2GO1A 4MVJM 4Q9IA 5FOVA 2GAJA 3EVCA 4UHEA 2D74A 3VH1A 1NNUA 1OLXA 4NQRA 4RFSB 4UQPA 2WU0A 1DHTA 1US8B 4Y6SA 2IEAA 4FZ5A 5JISA 3NTLA 2R5FA 2YJ3A 2R97A 3TUJC 4URZR 4XQGA 1CQJB 2EEZA 2WHXA 2CNWA 3FPJA 4BCCA 3ZE9A 2BHSA 5E6RA 1YQDA 5C8YF 1HE8B 2O2DA 5DXAA 4EHHA 3K70B 3AVXA 2AKAB 1T2UA 1XRPA 3F6SA 2PVSA 1PFKA 3HUTA 1I01A 2IW3A 4Q4HA 2ZQ5A 2R8YA 1JW9B 3D3QA 3JD3A 4CQMB 4QOHA 3SC2A 3TR0A 3CC8A 1WBBA 2P4HX 1THGA 4GLFA 1CFJA 4CFYA 5ELLA 4G67A 3AO0B 3GEHA 3FCXA 3HKEA 3RYIA 3UAYA 2ZI3A 1NJFA 4EITA 3ED1A 1ADFA 5DHFA 3FDJA 4EYSA 1OR8A 5B6JA 2G6TA 2H1WA 2WKWA 3BK2A 3L4BC 4WKGA 2PANA 2HV9A 4KGDA 4AO8A 3NALA 4EW1A 4W7SA 4KQ2A 3ILXA 2C2ZA 1JFSA 1E3LA 4BFCA 4AKIA 5ALWA 4YPVA 4OJTA 3QUCA 1O6ZA 4ACBA 2D62A 1BG6A 4FONA 5I7HA 4PYOA 4NL4H 2FPGA 2PH5A 2FFHA 3EDCA 2HCJB 1GLVA 2II6A 3I6MA 5T3YA 2UYHA 3T9FA 3CT4A 4R9RA 1FEZA 2OKCA 3UJDA 5C46F 1A7KA 1GOTA 2O3QA 2WSSA 2WAAA 1LC0A 4J0HA 3MXOA 4LYYA 3TZEA 1SBCA 5FFFA 4ED9A 1QP4A 1TGYA 2NOAA 4TZKA 2X1HA 1NBOA 3C6XA 2H59A 2QSYA 3SZ3A 4EF4A 2NUPA 4CN8A 1EFDN 1E62A 2IDMA 3OFJA 4YMHA 3D8NA 3R3YA 2HWKA 1S02A 5A04A 2Z9BA 5DNWA 4PS0A 8GPBA 1RHKA 2VQDA 1NVBA 3HDYA 4KH1A 4HTFB 1O97D 3WB1A 5U1PA 1TI7A 4I3FA 5DF1A 4YJ3B 5DNUA 2XI4A 3QELB 3QKRA 1S2GA 5LKAA 2O2CA 3VPBA 1W9MA 2WIBA 3EBOA 5KYVA 5H1YA 1XD2B 1ZITA 3NGXA 1FDWA 3WRVA 2IYQA 3HB7A 1Y6GA 3UCFA 2BJHA 4QOGA 5AI9A 4JIGA 4MA5A 4YYZA 1JIIA 1I5RA 1ZWKA 2HLPA 5DULA 2Q1TA 4ZYYA 2ZWVA 1DIOB 3IQWA 4NH0A 4RFSA 3TSZA 4PLZA 3PFCA 1US8A 2B36A 5EJEA 4JHXA 3KS9A 4HNQA 2FZKA 1U31A 2ZWIA 3TMKA 5A4IS 5ITVA 3WLPA 1YH3A 1ZD9A 1DOHA 3N6XA 2P2DA 1KJYA 1UIRA 1T5TA 2P90A 3E9CA 1JT2A 3ZWNA 2FEXA 1GPLA 5H3LA 3B7PA 4PIVA 3SF8B 4Z49A 4TZ0A 1NNLA 1W4AA 4ND1A 1XMIA 4X8LA 1CUXA 5A2QA 4FLFA 2FW6A 3K0AB 4XGQA 1KIAA 1KVQA 3EY9A 2ODNA 2A78A 1J7JA 4ZV4A 3KHTA 4BRZA 3H5WA 2W6JA 2CFTA 4DC1A 3R74A 8OHMA 4H15A 2NO1A 1DC6A 1OBHA 4MHOA 4MI3A 2VK8A 1FQJA 4KGZA 1TB4A 2HIHA 4M9UA 3OZRA 2P6NA 3FDFA 4LTMA 3U6BA 1AV6A 1JHUA 2M2IA 3DOIA 1Q7GA 3I01M 3OJ0A 5CBKA 1ZHOA 1OFGA 1T9HA 3BVPA 4M0EA 2XODA 4I6JA 2H8GA 1XRJA 2GVZC 3C7AA 3IIIA 2P0YA 1PG0A 3IPYA 5LA6F 5LDDC 5AKGA 3KKOA 4F3YA 1XHEA 3N05A 3Q2KA 1ZL0A 4FE4A 1BFKA 2FJUA 1LNZA 4A4DA 1Z62A 5KUTA 2O2SA 2B69A 3LCVB 2G7MC 3HDQA 3AHDA 4FE7A 4DR6B 2F9LA 1Q7EA 1XRNA 4GOLD 3DWGA 4GYJA 3OEWA 2NZ2A 3HB4X 3HR8A 4HB0A 1E7QA 4ZYTA 3MD0A 4Y2HA 1R15A 1AS0A 1CUEA 3F49S 3LXUX 3BCSA 4WBNB 2GXUA 4JBGA 1MW8X 1HDEA 5D6NA 1T4BA 2VXYA 2WSBA 4RVHA 4HTFA 3E9YA 3HWSA 4BKUA 1V8PA 4YP9A 5HTKA 3JR3A 4YJ3A 3KTOA 3QELA 1D04A 2OD9A 2VP4A 2M6RA 4ZVSA 2OO7A 2Z58A 3HI6A 4ESOA 3FPKA 3HO1A 1TCUA 2OHGA 2PSJA 2H11A 3V4OA 1LSSA 1ZOSA 2WLTA 3BWYA 3PD7A 1PS9A 1OPXA 2CJFA 3IR7A 2HTEA 2XRMA 1EVEA 4HB3A 3SJAA 4EKIA 4MRSA 4QHYA 1S1MA 1S7GA 3KJQA 4EG5A 2GKSA 4YAFA 1WMAA 1E99A 2ID9A 4BNZA 1K4KA 2AOVA 1II0A 4HH4A 3RUEA 3TMYA 1YRHA 3GFFA 5F9HA 4GOMD 4LZPA 2NQ2C 1B1AA 2P35A 2N46A 4XRRA 2ZM6B 5BY2A 2DLDA 2Z4SA 4HTAA 4PICA 3VYUB 1UBLS 2P3OA 4ZCQA 2IOYA 1CB7A 2BFMA 3D2BA 1ZD4A 3DEYX 1PQUA 1J2JA 1QORA 4RIHA 5JYCA 4PG8A 2IYSA 1Z4NA 3ST7A 2H5JA 4CHGA 2XGGA 2C31A 4AY3A 1R0LA 1VLVA 4EKGA 1NQAO 1V7CA 4RACA 4WKNA 4ECAA 1N6NA 1NQTA 1DV1A 1NP3A 2HADA 1OT3A 3IUSA 4KFTA 5FD8A 4IHKA 5B6PA 2PT7A 3C4QA 5IH7A 1EAMA 1VPLA 1CQXA 1N2EA 2OLEA 5FPHA 3V1KA 1JRLA 2AMVA 2H54A 2PUTA 3TLCA 4ZDJA 5A7HA 1YFJA 3VC7A 1UBGA 3DD5A 1E77A 2QVGA 1DTSA 4QYIB 2JFUA 5KB3A 1XLTA 3AERA 3B5IA 1FBTA 2VF2A 1H2HA 4CIVA 1KEVA 1TAHA 1U2EA 5AM3A 3FFWA 1RC1A 3CNQS 1XIVA 5FR1A 1GZDA 2VJQA 3EC1A 1NSYA 2OFXA 1XTQA 4FOSA 3CW8X 1QGZA 1GTL1 1KIFA 1XU9A 2IUEA 1O9HA 3CBGA 3OTQA 3PNPA 4MVJE 4N41A 1S4MA 4NE2A 4BXOB 2WJGA 1GKYA 2KX7A 5HJ5A 2C82A 3KZVA 2YN2A 2XHZA 4RHCA 4EGCB 2CL0X 3LUCA 4US1R 3V8QA 3BICA 2R6JA 2DCUA 4WBNA 3AR9A 3OPYB 2FPPB 1RLOA 1UPUA 5CK4A 3UB4A 3U3MA 1Y1LA 2VF8A 2IODA 4ZVMA 1EP3B 1ENZA 3BWEA 2BFFB 4FW8A 4KQ9A 3L0SA 2VRCA 4QU9A 3WV5A 4Z1MD 3FUTA 3P9RA 4CDMA 4Z4QA 1QOZA 1DAOA 2YYSA 2IPAB 3P0RA 1LSJA 5A05A 2Y6VA 4AX4A 3KEMA 4BMCA 1RWQA 2C0CA 2P9QA 2WTMA 3R0XA 1P75A 1Q2XA 3BJEA 1O6BA 1MPTA 5T4FA 5DW0A 1CEEA 3TDKA 4ESVA 1BXGB 2ZT7A 3HY3A 5JRDS 4MDFA 1K9SA 3N9IA 2AOXA 4PLGA 3Q7EA 5YASA 2XA1A 2ZEJA 1C29B 3AKYA 3IESA 3LHSA 4LDPA 3T4EA 1ZLXA 3G1TA 1FFSA 4MKGA 1U3FA 2O6LA 2R8XA 1KFKB 3BMOB 3H9EO 3ITKA 3Q3CA 4DLPA 4E08A 2OAP1 5GINE 1QH9A 1M1XB 1MAHA 3MOIA 4RA9B 5CCDA 1L4HA 1X9IA 3DW1X 2JIPA 4LRQA 3IMCA 3P9SA 1IY2A 3ENWA 3RTEA 3MYYA 1WPQA 1V7QA 2H18A 1O5TA 3BUSA 5FNVF 4D9KA 4EI7A 1QSGA 1WZUA 3QUBA 4IYRA 5DBEX 3VR6D 5JNTA 1M6YA 4Y2VA 2HIGA 4V0ME 1HDIA 1NNSA 3QWBA 3PKJA 1SUCA 3YASA 4F9TA 3EIHA 3G6WA 2V3CC 3MILA 4GECA 3JQAB 1KP3A 1UODA 4PZPA 4NBLA 1JVSA 1I9GA 4HHEA 1FCJA 4IIBA 5EHNA 1Z4KA 2H4WA 1USUA 3W2IA 4HV4A 1PR0A 1P0IA 1T43A 3DNFA 1N7IA 1WZEA 3E2IA 8LDHA 3TQRA 3MJHA 2YINC 3CLVA 1NSTA 4TN1A 3K9HA 4UDYX 4QXOA 3W34A 1JLMA 3UF0A 3HU1A 3UB3A 2WMDA 2WFMA 5TLSA 1JFTA 4EOGA 2WVGA 3CLUD 1U8AA 5IH3A 1TQ6A 4R3NA 3WJ2A 3ZOKA 3P5BA 2LVBA 1EQAA 1YJ5A 4GOND 4EPWA 1HQCA 2F00A 1Y8ZA 5CIQA 3ADCA 1MN6A 3DO8A 5EQJB 4WKBA 2E4AA 1AK9A 1JMVA 4ZZ3A 4R1UA 4GGOA 3IBCA 3IOMA 4LX0A 1G3IA 2ZT5A 4FDVA 2CNLA 4BXOA 1Q1EA 2Q46A 1Z4IA 3UMYA 1Z15A 3NNNA 2JI8A 1N75A 2ZR8A 3TQCA 4DKJA 2GWHA 4FEYA 3RPEA 2Z6UA 2EATA 3LE8A 5F2OA 3IP8A 3AVWA 3I39X 4X8HA 4KW7A 1X77A 1YI1A 5BSHA 2GK6A 1WKVA 2PO5A 2OQRA 2SHKA 2FPPA 3OPYA 4Q21A 4WZ6A 5AOCA 1NW8A 4LGMA 3UANA 2JH8A 2D1TA 2HXYA 4MIEA 4NZOA 2GVNA 1D09A 4FOPA 1W29A 2XX3A 4DA8A 1L7VC 5LJIA 2J5KA 2D5BA 2XB2A 3EVNA 4XVCA 1LSOA 3D8BA 3GCXA 1DELA 2Q3CA 3D5QA 2QU7A 4LV8B 3LFUA 2XZTA 5D5QA 1ZUIA 1PWEA 2RCYA 4JBHA 1E64A 4JENA 1PYOA 1AGRA 1PR6A 1BXGA 3AUFA 3GLHE 2BTEA 3S3TA 3HXOA 2D6FA 2O2ZA 2GBPA 2J7PA 5JPDA 2REBA 1M66A 1B43A 2P9BA 3BFPA 3CEPB 5JAQA 1UT5A 2GWRA 3H2YA 4GI5A 5K0CA 3PC2A 4GMDA 3OCZA 2PQ2A 1PQPA 1P7YA 3WK8A 2X19A 1JPUA 1X1TA 4WOCA 1LNSA 1PNQA 2R6AA 2RHDA 1OBOA 2Z95A 5B7NA 4M36A 3DR3A 5F1PA 1KJIA 4DXHA 4M7RA 3G8CA 3PR3A 4U39A 3V4VB 2C61A 5DXFA 3S5JA 1YNOA 4EF6A 2OORC 3NGLA 4M98A 4YQZA 3S1AB 1ST2A 1GZ6A 1NLUA 1SQFA 4YCAA 1OREA 4TS3A 4N3NA 5K8TA 5LXTB 4CKWA 3T3OA 1GG8A 3DOOA 3KR2A 4JJ8A 4AY5A 1XPJA 3AI2A 3Q9UA 1N2BA 1YI0A 1KI3A 5KYKA 5KPDA 4QDUA 4CYMA 2QP9X 5AR1A 3CE9A 4CCWA 4GBGA 3BM5A 3JQAA 4S1WA 3U5ZB 4P53A 3PRHA 1XF9A 4IJVA 4GEGA 2HKIA 1AHHA 4ZCLA 4DMGA 1OXUA 5M3BA 3ZNPA 1DE0A 3HG7A 1LJLA 3QOWA 2H4YA 2HU8A 1II9A 2EZTA 1Z7GA 3LP5A 1TRHA 4FLEA 5CA1F 1E8DA 3PNBA 2COEA 4D3YA 1ZD3A 1XLWA 3M6IA 2WAMA 3I6BA 3QEJA 2I7VA 5BYJA 3WNCA 1LKZA 1P2BA 2UVQA 3JPYA 4RO0A 5DRTA 2JCGA 1SZPA 1EUDB 2K7ZA 3SEAA 2P9CA 4JLMA 4BB9A 5G0UA 1N5DA 4RJIA 1IG0A 3NXSA 1RLUA 5LQNA 5TPZA 1M73E 5HTOA 1QAQA 2DQZA 5BQFA 4AP6A 4M1ZA 3MCUA 6ADHA 2QTRA 3OLQA 4Q3BA 4EL5A 1NTOA 2ZIUB 1M1UA 1S0UA 3DOEA 3KEFA 3TX2A 3WNVA 4B0OA 4KDEA 4CIBA 1ZK0A 1UEJA 2X2OA 3EHEA 3RHZA 5EN4A 3WYDA 3CSDA 3ZWAA 1XMQB 2UVPB 1ZXLA 1ZG3A 1IY0A 5C52B 1CYEA 5KTYA 5CCEA 1SVUA 2NVWA 5FI5A 4R05A 5JASA 5EVCA 1K8YB 5LIPA 5C31A 3U48A 1T0HB 2GJ4A 4HK4A 1VFPA 3QSYA 1P9WA 1JIUA 4A92A 4GYWA 4PYKA 4H4DA 5K0NA 2YYAA 1J49A 3FVQA 4L16A 5EJ2A 5TJ9A 4B2IA 2HCRA 5K5EA 1ADCA 1VHTA 3ND9A 4IF6A 2X58A 4OGGA 3TL2A 3W2FA 3D5EA 2AC2A 4DDTA 3C8MA 1KK1A 1UZAA 2VXCA 2HLHA 2X2EA 2G5PA 3NWJA 1DTWB 3KBBA 4QOEA 1KRXA 2B8EA 3CUUA 3NT5A 4MAMA 4QUDA 5AHWA 5FLXA 4ZAYA 1U28A 3SQDA 5DM4A 5IXJA 3LUFA 4MSUA 4L0CA 1MV8A 2H16A 2IOQA 1XLVA 2EFEB 1FFAA 4OFZA 1RRFA 1OPRA 2XLCA 1TMOA 4CM9A 2HUNA 3OX1A 3S1AA 3VR4A 4HVTA 3AHGA 3KEQA 5LXTA 2H00A 2WB2A 2C99A 3PQ4A 1JR3E 4YRPA 2PMEA 3NIGB 3IDZA 3W1EA 2HEIA 3D7NA 1WSBA 3BXHA 4LY9A 1UXOA 2N3ZA 2OBXA 4I3GA 3ZIAD 1FUYB 1Z0IA 3T1OA 1H2BA 2GTPA 2GPBA 1J8VA 2MSNA 3BHIA 3M9WA 1UEIA 2UV8A 5EMJA 3T9AA 4B3CA 4C4TA 1AUOA 3IB6A 5LBTA 4CHTA 2XD9A 1QCCA 3D31A 3VYWA 1LDBA 2BV3A 1Q50A 3C3YA 2OQVA 1D1QA 1LBHA 2C2YA 2FWMX 2XMQA 2Z2YA 4C3UA 5JAOA 3NHKA 3D0RA 1XFDA 1KAGA 1NXQA 4C0QC 5CIWA 3A58B 1I2ZA 2RH5A 3MIZA 5CVDA 3RABA 3J7TA 13PKA 1QFJA 1ODJA 2YR0A 4WN3A 1RAGA 3V4FA 2QX9A 3ZDRA 1KSGA 2EC5A 5GGXA 1Y37A 5IJZA 5IT4A 2FPRA 4L85A 3T35A 1PGOA 2JJQA 4ZO9A 2WSLA 1VM6A 1EUDA 1SZDA 4PZUA 4URUR 4MCHA 4FQ7A 2QRZA 1XQ6A 3HK2A 4J4TA 5CX1B 4NRDA 3OQIB 4ZO8A 4K86A 3SC6A 4ER0A 1CUZA 3F98A 3HUEA 2SICE 1USIA 4J1NA 4RZ2A 2QL6A 3NHSA 4XD7D 1SHLA 2NGRA 4GBED 3SZOA 1CY0A 4IOMA 3DNPA 4LNUB 4MQ6A 1X2BA 4DJJA 1G5QA 5AW8A 1JR4A 1YZHA 2OTCA 4GMHA 3IE0A 2UVPA 3IULA 5CJJA 3O8DA 2DHCA 3KJEA 4FQ5A 2WF8A 2HQBA 4PYIA 5EMKA 3ID6C 1U1DA 3O4RA 3W6NA 4G89A 4CFSA 2CBXA 4UUQA 4NKRA 4P31A 3KKEA 3MUFA 2FP3A 1Q6YA 4EFKA 3PRYA 3ZKWB 1N7JA 2O1XA 4A10A 1RMTA 2RD2A 5DX1A 2I6QA 3T5CA 5J4KA 4N7MA 1R8XA 2YYZA 3GFQA 5EPOA 4ZK6A 4LOHA 3WGOA 2IPLA 1DTWA 2VJOA 2HJGA 3GI1A 4L4XA 3RGGA 2BT4A 3IERA 3EIEA 5IVPA 3FFBA 3F5SA 3R6DA 4B6EA 3ZHCA 4EYOA 3EFHA 3KLMX 3LBHA 5IAJA 4WXRA 2AMJA 3KFXA 4JKIA 1RXUA 3DOCA 1GLGA 3QIAA 1I7PA 4TT3A 5C34B 4OLHA 4MROA 3UGJA 2IIVA 3BMCB 3CUVA 3ONVA 4HDAA 1ULUA 4QO7A 3V33A 4PZDA 1RKUA 1J39A 3HWX1 2IU6A 4S2UA 3LM8A 2O14A 3AV0B 4OYYA 3M70A 2EARA 4EGJA 3EWNA 5EYPB 1MD9A 1BVHA 4BAZA 3CG0A 4QXQA 1JDJA 2QVXX 5G53C 4KK4A 5H59A 1TF2A 1KKUA 3P9IA 2WTBA 5ANRB 4KAXA 1U2GA 1QGOA 4N8SA 1A4IA 1O7JA 3OLWA 4QICA 5KREA 1MA3A 2ZJ8A 4TTTS 4WNAA 2VPIA 4MP8A 2YXBA 3L46A 1WDLA 4JX8A 2NTNA 5LQJA 2CDCA 2IKQA 2EIXA 2IPMA 3UT5B 3I9JA 3OQVA 1FTQA 1CC1S 4OHCA 1Y0BA 4BPBA 1R0CA 1GAXA 4G5RA 1KY2A 1ODIA 3B1ZA 5B1SA 5KX5B 4KHPB 1JEYB 1M2VA 2BM1A 1MVNA 3Q8WA 5BYAA 2OYCA 2HDNB 3T5DA 5CCBA 3H1EA 4O8ZA 2FN9A 2VNAA 2X5JO 4C4PA 5DOVA 4ZZIA 1BMQA 2DKFA 3TNYA 3S70A 4F4DA 1BVRA 4L8YA 3UA4A 3DXXA 5KDLA 4C06A 2LKDA 2XMSA 4YR7A 1JQBA 3AFHA 3S2SA 1TAUA 1OFUA 1OV4A 4BAUA 1B42A 3OQIA 1EYZA 4IMJB 3FMOB 4J43A 2WYIA 1TYDE 4CL3A 3QLUC 4PZCA 3AU9A 2PUAA 1UC5B 3UHAA 2VP2A 4C6SA 5I7RA 3ZJUA 3KQPA 3QFHA 4LNUA 4XDZA 5SZKB 2Q4TA 4O3MA 2J3EA 1JDBC 2Z8YM 2QJOA 3I23A 3NV7A 1Z7EA 2PL1A 3UFXB 4F46A 3EXAA 4GOKA 2QG4A 2G1JA 1YMUA 2FEKA 1BS2A 2FQYA 3R3SA 4TKZA 3KCQA 1DS6A 1BEUB 2ZJOA 3ODGA 3PR1A 4J3FA 2XMBA 4KN5A 3QY0A 4YQFA 3LQKA 1XDUA 3UWOA 1Y5IA 3LL7A 2HSZA 4DC9A 3ZKWA 2FWPA 5E7MA 3CISA 1J8YF 2BUBA 4U2DA 5FFMA 5MFPA 2BZSA 3D2LA 3IR6A 4PXYA 3QYPA 1LS6A 1LLQA 2HLNA 2Q0HA 2Y1XA 3RRFA 3KLOA 3EZGA 1J8FA 4O4IF 3MJFA 4BZXA 3DMTA 2W2LA 1K9VF 2XMDA 2V4MA 4OMUA 4TKVA 3QLTA 3MWLA 1U0LA 4CMEA 2C07A 2PRZA 3NKVA 4ALIA 4URVR 3EEIA 2Z0MA 3GLKA 3I9V6 1B6TA 4WXHA 4AZSA 6Q21A 4RA6B 2VUIB 4L50A 4TYNA 4PZLA 4RLSA 4TSFD 3E84A 2F8MA 1SG6A 3H16A 3PX2A 1KBOA 4IL5A 4V24A 4B2PA 4XE5A 4M86A 1HFKA 2P8SA 4N1AA 1PT5A 2PH7A 2VJDA 3BWVA 2GEUA 3VO1A 1H1DA 3KC2A 4DCNA 3IVCA 2RDMA 1E61A 2VEDA 2I03A 3D0QA 4KAFA 4L27A 3ES9A 1Q12A 2EL7A 3HB0A 3NOXA 3WGVA 1JMYA 2ORED 1DEHA 4WZAE 4JY7A 4O4LB 2CJPA 3DZCA 2X42A 1NJ5A 3EGVA 3UT5A 1K5GA 1E1DA 1T2AA 1N36B 4ZMRA 4DANA 4GYYA 2Z1NA 3IVMA 5I7AA 4ZVOA 3H18A