3KQYA

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-7-ol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqyA00
3UJAA 5K0CA 3FTEA 1X1DA 3OFJA 1MHTA 3GGDA 3QOWA 3B3GA 3HVHA 5U4XA 1NW8A 2BR3A 1R00A 3KQQA 5K09A 3LL7A 5GOZA 3UWPA 2ADMA 4CXMA 1DUSA 4X41A 5D1HA 1L3BA 4AZWA 2R6ZA 5E1DA 3P9IA 1SQGA 3E05A 3I5UA 1JSXA 2WK1A 4KVZA 4P7GA 5KVAA 2FYTA 1DL5A 4HG2A 2EX4A 2JHAA 3MAGA 3MB5A 2WA1A 3IV6A 3KQTA 4QPNA 5F2OA 2OKCA 3HA5A 4OQDA 1NBHA 4L7VA 5EHIA 4YMGA 3G89A 2E5WA 1KIAA 3B3FA 5C9ZA 4HGZA 5JR3A 2ONYA 4GOMD 1R18A 2FHPA 2AN4A 3DUWA 4F86A 2IDJA 1EJ6A 3G88A 3NVMB 3TMAA 4AUKA 4PYQA 3Q87B 5GP1A 3M6WA 3DH0A 1ORHA 5GM1A 2ZFUA 4QPPA 4MWZA 1L3CA 3Q7EA 1VQ1A 1G60A 3FTCA 3BKWA 1N2XA 1RJEA 4RWZA 4RVDA 1XDUA 1WXXA 4ER7A 5CVVA 3O4FA 5F2NA 4LG1A 5LQUA 2JHPA 2Q41A 3UJ8A 4K6MA 5FCDA 1AQJA 2I62A 2P3LA 5DXAA 1M0EA 1WG8A 1JG4A 1KPHA 3LECA 3BUSA 3QV2A 5DTQA 4HGYA 2NNWB 3E7PA 4AZSA 5KQSA 2HTEA 3ELYA 4DM3A 4E33A 1JTEA 2CWWA 2YVLA 5DX8A 3UJDA 3BGDA 2I7CA 3OU2A 3UJ9A 1AF7A 5DSTA 2NYUA 2ZULA 4X63A 3SSNA 3GRYA 1XCLA 2PXXA 1WY7A 3OPNA 4FT2A 4Y30A 5FTWA 5EOVA 4YMHA 4R6WA 1JTFA 4WVLA 2P35A 3PVCA 4E2YA 2VDWA 2PX5A 2BR5A 5B1SA 3KQWA 1L1EA 3NDIA 1YFLA 4H0NA 1XXLA 5LQKA 2PT6A 2GS9A 4WXHA 3GRUA 3BGVA 1JQDA 2G72A 1I4WA 3GO4A 2OPBA 3FYDA 3LKDA 4ER5A 3KQSA 3TKYA 3U81A 2EFJA 1QZZA 3BGIA 3R24A 2QY6A 5CVEA 3I9FA 3A7DA 4LWOA 2OZVA 1D2CA 2P3QA 1WXWA 3DLIA 2VDUE 1IY9A 3CKKA 5ICFA 4F84A 1X1BA 5BXYA 5KYGA 3FPEA 4OX9Y 3B7PA 1UIRA 4RV9A 1SG9A 4RTNA 4GOND 4R6XA 4A6EA 2UYOA 3GCZA 5FADA 3BZBA 1DCTA 1D2HA 5ICGA 2UYCA 4ER3A 5K0FA 1F3LA 5DTRA 3DXYA 4PYIA 1NW5A 4P7JA 3MERA 1XJ5A 3ELWA 1YFJA 3A4TA 1EAMA 1ZQ9A 3FUUA 5DPMA 4XUCA 3TRKA 1P1CA 1UWVA 2GH1A 2ZZNA 1AV6A 1VP3A 3ID6C 3G5LA 1U2ZA 3AY0A 5CVDA 3EGIA 2FK8A 3DTNA 1P91A 2HMYB 3EVEA 3VC2A 4PCAA 4CTJA 4JXJA 4C04A 3GWZA 3CCFA 5K01A 4GF5A 3NMUF 3G5TA 2O06A 2ORED 5MHTA 5FHQA 4KDCA 1KPGA 4RTKA 2P3OA 2NXNA 2HR1A 3GIWA 4E2XA 1KYZA 2VZ9A 4M36A 2C7OA 1G38A 3LDGA 5C1IA 2QRVA 3HNRA 3ME5A 3PS9A 1XDSA 2PWPA 3FPHA 3PLAE 3BWMA 4C06A 3P9KA 3EVBA 2ERCA 5E2BA 2BM9A 4BP1A 4RVGA 3PFHA 3EEOA 3HCAA 3JWGA 3L8DA 5HIJA 2AR0A 4O29A 5FUBA 5IH3A 5K0NA 2UZ4A 4BLUA 3G2QA 3EMDA 4HTFB 4E2WA 2VP3A 3BWCA 3P8ZA 5KQRA 2PBFA 3OE5A 3G8BA 4EQZA 4DQ0A 2HWKA 1BOOA 1BC5A 5K0BA 4PNEA 1N7IA 2PKWA 3UA3A 3UFBA 2XYQA 1M6EX 1G55A 3T0IA 4PYNA 2AOUB 2V7EA 3R6TA 5EMJA 5FULA 1D2GA 2G8NA 4FSDA 4PYKA 5K0JA 4FS8A 3FTFA 2YR0A 4P7FA 1RI3A 4YUYA 4V0QA 5EPEA 4ZTBA 2GB4A 1Q0SA 1QYRA 3D2LA 3GNLA 3I53A 3KQPA 2GPYA 3P9CA 4C03A 5KS2A 1HNNA 4Z2YA 3JWHA 2PSSA 3ER9A 1L3IA 2AVDA 3P9NA 4OBXA 3C3PA 1T43A 3EMBA 4FGZA 5EVJA 5FA8A 1ORIA 1R8YA 2FK7A 3FUWA 4EVIA 5EMLA 2IGTA 3CC8A 1L9KA 1NW7A 2GAFA 3JWJA 3KQYA 4PYLA 2PLWA 1KHHA 2EJUA 5DT2A 3VYWA 8MHTA 5K0GA 5BP7A 2B2CA 3DXXA 1QANA 2ZZMA 7MHTA 3C3YA 4A6DA 1YF3A 3DOUA 5EZQA 2P7IA 2FPOA 3GXOA 4QQNA 1KXZA 5DM0A 3IEIA 2AN3A 3HCCA 1SUIA 5LQNA 2ZSUA 3SGLA 1G6Q1 4X61A 3SSOA 2HNKA 4DMGA 4QTUB 3PX2A 1O54A 2ZWVA 3BKXA 1XDZA 3M6VA 4BY9E 1JR4A 2WA2A 4PINA 2YXEA 4PIPA 4GEKA 5CIYA 3MHTA 5DM4A 4EKIA 2NP6A 4DKJA 3AJDA 3FRIA 3NVKI 2AOTB 5EG5A 5CM2Z 2O0LA 3UJCA 2OBFA 3CJTA 5K8VA 1X1CA 3AXTA 1IXKA 2CMGA 4GC9A 2NP7A 2O57A 4B17A 5FA5A 5FQOA 3MGGA 2C7QA 2YXLA 2BH2A 3PX3A 4YUZA 1FBNA 2IBTA 4EMSA 5EKXA 1Z3CA 5E2AA 4GOOD 3SMQA 3HEMA 4C05A 3REOA 5E1MA 5ICCA 5ICEA 1F38A 2ZWAA 1X1AA 3E23A 3OZRA 5E9WA 3PFGA 4RVHA 3THRA 1JG1A 3DR5A 5JUWA 2AN5A 2YXDA 3NW9A 2PWYA 2A14A 4RSRA 3IHTA 2IBSA 4RTMA 5EGSA 1NV8A 2OY0A 4FR0A 4G56A 5EZSA 1ZG3A 4DCGA 2JG3A 5GWXA 4Y2HA 5EMKA 3TM5A 5CVJA 1JQ3A 4RTJA 3UA4A 1BKYA 2ZBPA 3CJRA 3K6RA 5DRYA 5DX0A 3TKAA 3ELDA 3HCDA 3G2MA 4KIGA 5F2KA 4P58A 1WZNA 3E8SA 3BWYA 3HCBA 3CJQA 5DXJA 2R3SA 2CKDA 3RW9A 3K0BA 3EGEA 5FWDA 2DULA 2IH5A 3R3HA 1H1DA 2DPMA 4QVKA 2GA9A 2P7HA 2VDVE 3KPYA 1RJFA 2NXCA 3LHDA 3NWBA 3P2IA 3FPJA 1IM8A 3T7TA 3GRZA 1JG3A 2YX1A 2ZW9A 5DLYA 2PGXA 2ONZA 3AWIA 3S68A 3THSA 4OQEA 1EG2A 4AZTA 4MHTA 2AOTA 2AOWA 2PJDA 3KR9A 1VLMA 2BM8A 2IPXA 2ZBRA 5DWQA 3RODA 2ZIGA 4XUDA 1VPTA 1FJXA 3EVFA 5EC8A 2I9KA 4IV0A 2UYQA 4U7TB 2Z6AA 5EIFA 4PWYA 5K0LA 3KQVA 2IIPA 2PXAA 3ER8A 1XCJA 3FUTA 4R05A 3SVZA 4X1OA 4R8SA 3HP7A 3KQOA 3UJ6A 2XBMA 3ANXA 3HCFA 4QQKA 3A7EA 4E30A 4C08A 4YUWA 3CVOA 4FP9A 4KDRA 5DM1A 2OXTA 4YV1A 5CD1A 4XCXA 4GUAA 3GU3A 3AXSA 3CBGA 2XYVA 4QDJA 3HA3A 3KQMA 2EJTA 2P41A 3DP7A 3M4XA 5LQAA 4OA8A 2UYHA 2AZTA 3OU6A 1X19A 2H11A 4YUVA 1WS6A 1RI2A 3VSEA 4YV0A 5K05A 2PT9A 3HA7A 1Q0TA 9MHTA 3EVCA 2O05A 3KR0A 3C0KA 3KR1A 3SR4A 4RTLA 4CTKA 4UOEA 4FSXA 2ZCJA 2G70A 4RTRA 1ZGJA 5K0EA 4ER6A 4C07A 1N7JA 2ZTHA 3ELUA 1JSZA 1SUSA 5CUQA 4U7PB 3HTXA 1KYWA 4AX8A 1RJDA 5T6BA 1G8SA 2PXCA 3SM3A 2AOUA 1FP1D 5EEHA 5FHRA 1EJ0A 2B25A 5CVUA 4E32A 3MCZA 3LBFA 3O31A 4DF3A 5HOQA 3JWIA 1PJZA 4HSGA 4M38A 1R6AA 2PX2A 3DXZA 3LX6A 1VBFA 3R0QA 1XTPA 4RTSA 1FP2A 3HVJA 2C7RA 3NJRA 2GLUA 3H2BA 5LSAA 1XVAA 5LR6A 2JHCA 3DMFA 5DSXA 3OFKA 3FUVA 1NE2A 1EIZA 2I6GA 3KR2A 1O9GA 1R74A 2B3TA 3EPPA 3MTEA 5E9QA 3LCUA 3QOXA 5GIOE 1PRYA 2ZVJA 2KW5A 5C0OE 4RYLA 1NV9A 2ESRA 5T67A 3LPMA 3VC1A 3WSTA 4DA4A 4CWAA 2BR4A 4NECA 5G02A 2IH2A 3I58A 2H00A 3UZUA 4KW7A 3M6UA 3V97A 2LD4A 4IV8A 3SX0A 5LQRA 5DTMA 3NDJA 3GRRA 5EKUA 1JG2A 3C6KA 2Z6QA 5EQJB 5FWAA 3OZSA 5BW5A 3HVIA 4GC5A 3MQ2A 1KPIA 2HV9A 4ATNA 4F85A 4RTOA 2CMHA 2QYOA 4AZVA 3KPUA 2VS1A 2OO3A 4RVFA 5DX1A 5EHGA 2QM3A 3P71T 3MCTA 2OB1A 1KP9A 2P40A 4P7KA 5HFJA 2FRXA 5HIIA 3EVDA 5P8WA 3SSMA 3UBTA 2ZBQA 3DULA 3B89A 4HC4A 2V74B 4PCLA 2Z6UA 3P2KA 4PONA 4X60A 3A25A 5E1OA 4POOA 1VL5A 1TW2A 5EMMA 5CCBA 4RX1A 1FPQA 2PX8A 3FYCA 5H02A 3LBYA 1JQEA 5BW4A 4KRGA 5IKMA 2G1PA 3BT7A 2P1DA 4E2ZA 4EKGA 4HTFA 4V0RA 5ERGB 2NXEA 2XVAA 3OU7A 2OYRA 2C7PA 1I1NA 3RIEA 5CCXA 5E8JA 4RTQA 2FCAA 1NBIA 1NW3A 4IWNA 5EEGA 5HIMA 2XVMA 4BLWA 2JH8A 2CL5A 2PY6A 3G2PA 3LCCA 4LWPA 4ER0A 2QE6A 4PYMA 5LQCA 3KHKA 10MHA 2QRVB 1YB2A 3A27A 2PV0A 5E1BA 3KU1A 3SXJA 1YUBA 4GQBA 4QVGA 1Y8CA 2ZZKA 3HCEA 1G8AA 2YQZA 3FZGA 3M6XA 1SVUA 1I9GA 1ZHFA 3TQSA 4IKPA 5E8RA 3BWBA 5HEKA 3DMGA 3G2OA 3KPVA 2PX4A 5GIPE 4E70A 1KR5A 3PB3A 1NT2A 3MTIA 1SQFA 3EVGA 3OZTA 4QTTB 3FRHA 3UJ7A 5HIKA 3B5IA 3GRVA 3B3JA 2H1RA 3OCJA 2AOXA 5K03A 2G71A 3O7WA 3G8AA 4XUEA 3TPZA 4OBWA 3GJYA 3KPWA 4PYOA 1QAOA 2F8LA 4CKEA 4HRAA 3T7RA 2JH9A 1YZ3A 3DLCA 3M70A 1ZKDA 3TLJA 4CKBA 4YV2A 3BXOA 5GINE 2ZIEA 2N47A 4ISCA 3TR6A 1RI1A 1VIDA 3GDHA 3LCVB 1ZGAA 3IYLW 2Y1WA 4HH4A 3P97A 4M7RA 1M6YA 5HILA 1BHJA 4FZVA 1INLA 3FPGA 4MIKA 5GM2A 3LKZA 3ERCA 1OR8A 3OE4A 2BZGA 4KWCA 1TW3A 5LQJA 1EQAA 4GBED 4LECA 1RI5A 3FPFA 4KIFA 4FT4A 4EK9A 1O9HA 4M37A 2P8JA 3A26A 3LGAA 4C4AA 3P2EA 4QDKA 2JJQA 1QAQA 4DCMA 3PTAA 3EVZA 2IP2A 2IH4A 1UFKA 5DRTA 1SKMA 2YTZA 1R8XA 2IDKA 4MQ4A 4RTPA 2AS0A 2EG5A 2XYRA 1NKVA 2Y1XA 4BP3A 3TFWA 3UJBA 2AVNA 3F4KA 3V8VA 3TM4A 5DM2A 1AQIA 1VE3A 3LDFA 4PIMA 3PT9A 3HM2A 1MJFA 5E9JA 2ZIFA 3M33A 2IFTA 4PGGA 5EIWA 3FTDA 3NWEA 1P1BA 3EEYA 3LSTA 5HZMA 1VP9A 3KKZA 3C6MA 2AOVA 4PGHA 5FQNA 1NW6A 1YZHA 2K4MA 3TOSA 2NXJA 3I64A 3CGGA 3EVAA 2ZLBA 3X0DA 3R9XB 1QAMA 1RJGA 3NTVA 2OB2A 1P39A 4MTLA 2YUIA 1RI4A 1HMYA 3G7UA 4R8RA 3KPJA 3HVKA 2PVCA 1B42A 2B78A 3LDUA 4PYJA 4DZRA 3ORHA 1TPYA 4E31A 5M5BA 4CKCA 5D1NA 2B9EA 4BLVA 3T7SA 3FUXA 3DMHA 4GOLD 2O07A 5T64A 3EGVA 4OA5A 4YUXA 1V39A
chains in the Genus database with same CATH superfamily
3U48A 1UMCB 1Y4DE 3ADPA 1U0JA 1NUHA 2WB2A 2W11A 1Z88A 3MSXA 3OFJA 5HWSA 5J2UA 1W49A 3PCRB 1MHTA 3WB9A 2QQ0A 3H5OA 3HVHA 4AF6A 2F3PA 5KIAA 1QS0B 3H3FA 1MGOA 4F7DA 2AUTA 4HYYA 1BGXT 4L7QA 4LJAA 4XA8A 5JT1A 1TQ2A 3RRZA 1QFSA 1L5OA 2J67A 3QPBA 3MWYW 3ZGLA 4DIMA 1JSXA 5KVAA 2DJ5A 3HJHA 1S6YA 4ZVUA 3BERA 5F2OA 4E2FA 3HA5A 4LYHA 3GGGA 1PX2A 1JFTA 2OHJA 2PR7A 1RKUA 5IT4A 4GX0A 3JQ9A 1OLOA 2QRMA 2P5UA 4ZO4A 2CLMB 2CEAA 3DUWA 1MX9A 1KJJA 4AUKA 2BVNA 2VJBA 4JR2A 4CI0B 3R7DA 2OVBA 3AI1A 4OQFA 5IZCA 1MP0A 2I78A 5CNIA 4F6LA 4D4GA 2NYAA 4UVDA 4QIHA 1P9RA 3AZQA 3L4SO 2O2EA 2FWPA 3OF2A 2PV7A 3HFRA 3SJCA 5FPSA 1C41A 2F59A 3KX2A 3AVUA 1R4MA 1VGQA 3MGBA 3EDCA 2PKEA 4EW2A 4F4UA 5C7OO 1AQJA 5FBQB 2XUPA 1Y3IA 3LBIA 1JG4A 2N1BA 1JR3E 4MOWA 4IJKA 4AK9A 1X7GA 2Q1SA 4UNPA 2NQ2C 3OEED 4IJWA 4KQXA 3GD5A 2NU7B 3GVHA 2Q2WA 3EDMA 4J1TC 4BNKA 1IQUA 1DKMA 1WBJB 1NUAA 3FKJA 3FWKA 1O0SA 1WSAA 3OZAA 3IOBA 3THWB 1JDVA 1P72A 1KI9A 1DZ3A 3JPYA 3N6VA 4R6WA 2ZRLA 1ODLA 3Q9UA 5I01A 4U9IS 2DWQA 4B46A 4ZVPA 1TZBA 2NU6B 4IMRA 2GTHA 1T4DA 1HOXA 1KSHA 2ES4A 4MVXA 4S35A 4X6XA 5CLLA 2B5OA 2C3OA 1WSBA 4UFPA 4FU0A 4QGHA 4WXHA 1EVZA 1JI0A 1JFVA 3R5KA 3AR4A 5HE9A 4HX9A 1H85A 3R24A 4OXQA 5C1OA 2JLXA 1EDZA 2WFLB 1VI5A 5C81A 1GGVA 1U80A 3TZCA 1Z2DA 1IY9A 2GBGA 5KYGA 1W52X 4MPJA 1W5EA 1R0RE 1U04A 2ZYAA 5A0TA 3RABA 1ZW6A 2HZ7A 3UYLA 1E3MA 1AZLA 4EECA 1JKFA 3GT4A 1A9QA 3P96A 3P4XA 3RK4A 5L6LB 4A8JC 5K0FA 4C5AA 4BNGA 5BT8A 1QTQA 1D5WA 3GMIA 3GYGA 4MI3A 4W5NA 5AJUA 4HDAA 1JAXA 5AXDA 3TRKA 2B7CA 4HGOA 1UWVA 2LR0A 2WI8A 3BMCB 3P32A 1NN3A 1BXGA 4NZMA 4U7DA 3UNXA 1EBUA 3SLGA 3VQTA 1AV7A 4LXQA 2R00A 1WMEA 1N6HA 4JXJA 3SQXA 1I3LA 3J7AC 4HFRA 1BW9B 3CCFA 2Z98A 3KB1A 4QJ3A 1P7WA 1XAHA 3PDUA 5A9TA 1FYEA 2FFJA 3PEVA 4KWEA 1Y1KE 4NXMB 1SVKA 1TT7A 5FHQA 3GXBA 1M6WA 3CTMA 4R5HA 3EEBA 1KRHA 4M36A 3KU4A 3CNLA 4D6PA 4XVRA 3PFNA 4RD0A 2JBAA 1M67A 1SUFA 3LUFA 3A37A 2XSZD 3U7EB 4KHPB 4Z99A 4DM4A 2VH2A 5AM0A 1NPDA 3GGJA 1AGNA 4KO8A 3UPDA 1PF7E 3ZLBA 5C8YF 1RC8A 4KR2A 4PZCA 2AR0A 2ATVA 3HNOA 2W2VA 4LTMA 1DAKA 4J7UA 4E2WA 3EMDA 4O2BA 4ZZ1A 2CSXA 3WGVA 5LUAA 2MDTA 5CXSA 2A86A 3ROEA 3B36A 2UVDA 4ZEMA 1GKIA 2GD1O 3SOZA 1BNCA 3E5NA 5EYPA 4N5DA 1VBNA 3PGJA 4TKZA 4ANFA 3BRSA 4TYQA 3QI7A 5C4GB 5F98A 2G4LA 3EFBA 3MWJA 3PFWO 5ICSA 1W9HA 4D80A 5TE9A 3OJXA 4UCWA 4FS8A 1YZUA 4UCFA 4YUYA 1ZY2A 4I4LA 3DONA 2HU8A 1Q0SA 2O48X 3AY7A 5AJTA 3RQIA 4NE7A 3CUUA 2X22A 3L7MA 2Z1MA 2XDAA 3HDYA 4XCVA 4OBXA 3N2YA 1R6DA 3LX8A 1CUVA 1OGYA 2D54A 1T35A 1UC9A 4F4CA 3IILA 4KWTA 2FPRA 4KGZA 4M9CA 2VOJA 5LJIA 1F6WA 3EPJA 3A1EA 1RHRA 3O73A 3UJPA 3U39A 1BG6A 8MHTA 4MWDA 4YJFB 2BTQB 2GEKA 3JD0A 1OZAA 1UP7A 4Q3NA 1GQSA 3AHEA 4U6SA 4C0LA 2H9YA 2B8JA 3PI7A 4WCFA 3NTOA 4PGMA 2HSWA 4A8TA 1YKSA 3HCCA 3UB4A 4D74A 4N3NA 1IE3A 3BD6A 3SGLA 2WTXA 5LQNA 4M3NA 1KH3A 3IHKA 3PQDA 3OIWA 4GYKA 2YFYA 1U6IA 2D1FA 3BZUA 4I1VA 4L9AA 2C83A 1S0UA 2NU9B 5JBNA 3IEVA 3REFA 3DEYX 1E1DA 3DKRA 3B20A 4RM3A 1XTTA 5JFGA 5JNWA 1ONSA 1KYVA 5D5QA 3BHJA 3DTVD 1NVTA 5LBUA 4S1TA 3CJTA 1A8IA 2E2WA 2YS7A 4Q5IA 1X1CA 4RWEA 2OAEA 3DVAB 5DBHX 2O3QA 2O57A 1CDEA 3KVRA 1OBFO 4O4IA 5IWAB 2ZJ4A 3JWEA 2NZJA 1QIMA 1V3VA 1MEJA 4KWIA 2Q8QA 3CY6A 1WUYA 3LX5A 1ZVQA 2CJFA 4G4GA 5CEJA 4JROA 4MUMA 4QQFA 4K6GA 2FPLA 5KAPA 2YMLA 3WVNA 1D4OA 4REQA 1Z6ZA 4TV9F 2FPXA 3KWMA 1MRNA 1H5NA 3GFFA 1J2EA 2H1WA 1V2GA 1WHTB 4EFLA 4KDFA 1O9BA 4OB6A 1V6SA 3DL2A 4EJSB 4PG4A 4OMDA 6Q21A 4PQYA 721PA 5F5NA 1Q77A 1LQUA 1I14A 1LJ8A 2BDTA 3SJUA 2XYHA 1J2TA 1JQ3A 3ESBA 1OXMA 3ISVA 3TLKA 4G23A 4D43A 3IAAA 5DRYA 4IH4A 3TLGB 3ZXXA 3DVSX 3ZBTA 4C1NA 4H17A 4BNZA 1D2AA 4GKVA 1IB0A 5J5VA 5DCUA 2Q0SA 4L8FA 4YO7A 1Y8RA 4I9UA 2Z8YA 2B94A 4CMKA 4CT0A 5CT9A 4C7KA 1ZUHA 3O94A 3CCCA 3D3KA 3LNCA 3NPMA 4WD3A 4WQMA 4YIKA 4BC1A 2HPHA 1DGQA 4QGGA 2I3BA 1QRSA 2NW6A 2DE0X 3FF1A 4J7CA 3NWBA 2ZYUX 4ZD6A 5F2EA 1ZIXA 3DD5A 4DJEC 4NENB 4UTVA 4G2NA 5G3YA 3QEJA 3T7TA 2CXRA 2WTBA 1XZLA 3USCS 2OG1A 3MAAC 5H9WA 3TG2A 5JYBA 4ZV4A 1PIWA 2PMKA 3LYUA 2I1LA 3NALA 1BHSA 3L6EA 5HCNA 1RZRD 3SHFA 4A1OA 4CCYA 1SPBS 2V5UA 1WXDA 3L1JA 3MTDA 5F73A 4BJ6A 5E4YA 5HK8A 5SZHB 4RGQA 3DNFA 2ZJ6A 2DGDA 3MELA 3R5JA 1DE0A 1OWOA 4R16A 1QC5B 5J4KA 3V7UA 2VPYA 3QVLA 3AUYA 5FNVA 3UJ6A 4D8VA 4EB6B 1FUKA 2EHDA 5AT1A 1RLIA 1M0TA 3HYLA 1Q0LA 4ZQFA 1E1YA 4FGKA 4HDMA 4YJ3B 3DJFA 3L0IB 2BV3A 4HNAB 3OPQA 4BC0A 4P5DA 4C21A 4CKZA 5EHZA 3DOFA 1AB5A 1M6HA 3KZXA 5EJIA 5ED4A 1VFPA 4D96A 4WZAA 3A28A 4LF9B 3F3YA 3QLTA 1NXTA 3QY0A 4Y9DA 3KR0A 4BV8A 1UBNA 1E6KA 1SCUA 4CTKA 3LQYA 3RK1A 1SOUA 1NLMA 4YCLA 4TL6A 2R6DA 4L9RA 1GQFA 4B6GA 1SUAA 3J7TA 2XQKA 4WESB 2GPAA 3RTBA 4L8VA 5I6DA 4RCYA 3KOWA 4M4SA 4XH9B 2MSCB 4EG5A 4A0RA 4AX8A 1KEUA 4WN9A 2BGTA 2HZBA 3QHPA 2HT6A 4XYEA 4D3YA 3K0EA 4MV7A 3NVAA 1UDWA 2TMGA 5KMGA 3EVTA 3ZKWA 4ZAXA 1TECE 3LPCA 3O31A 2IZ6A 3V8EA 1KZYC 1RFLA 2RI1A 3NWJA 5KYWB 3OZ7A 5BRNA 4ZT3A 1Y7LA 4DBZA 3J80A 1A04A 2D4AA 3EXFA 4JKIA 1XU4A 4RTSA 4RO0A 3OQPA 2EWWA 1DFGA 1GNQA 1Y9ZA 1GILA 1T34A 2GFIA 1C29B 3GN2A 3OPMA 3QU9A 3JASB 1ENYA 3OFKA 4TTVA 4E0BA 4F4DA 2BP7B 3R7LA 3NM4A 1AUPA 1E0DA 2CT8A 1GY8A 1LU9A 4FGWA 2HQRA 1KVRA 4CWAA 2P2LA 3E9ZA 5T5QA 4KW7A 3HJGA 4IDPA 3V4SA 1E8NA 1HKUA 2JCBA 3JYOA 3GRRA 4IM7A 1VLHA 3U1BA 3Q98A 5B3KA 1AKVA 3SHQA 2BGMA 3KJFA 3HVIA 2O7SA 2X19A 4TTIA 1UZLA 1YI1A 1XOIA 2CNBA 1YOVB 3CRQA 3FNEA 1SQ6A 5KSZA 3KC2A 5BSVA 3Q2KA 4OQMA 2ZQZA 4E08A 5AHKA 1SB9A 4R51A 5AW6A 1N5RA 4CLOA 1QHGA 1FX0B 1S1CA 3EFOA 1WUKS 2DQ4A 1BXGB 3I04A 4NENA 1WO8A 2OB1A 1VIAA 3TLMA 4YBRA 5B4TA 4P22A 2V74B 4RHUA 1GRRA 1OYOA 1L4HA 1J5EB 4YJGB 2WHQA 5F33A 1TW2A 3X1MA 1UOQA 3FYCA 4CQMB 3WL4A 1SBQA 3WAJA 2ERYA 3GJ4A 2YDYA 2QUKA 3OEEA 1TJ5A 3ZHZA 4V0RA 2IYLD 1ZD3A 4TZKA 5CT6A 3X2FA 2HO4A 1KDYA 2C2WA 3WLFA 2XUDA 4BMZA 2WDZA 2E6UX 2C2ZA 5AI8A 1DJLA 4MVCA 4BLWA 4NNJA 5F51A 3ONVA 2WT9A 4M8IA 1PSWA 2EFCB 2YMPA 1SD5A 4B6OA 1BN6A 4IXWA 2I1VB 5E4JA 3ZWMA 4ED9A 1NVVQ 4R3NA 3LLSA 1CUBA 3WISA 2GJ8A 2YJZA 4Q03A 4FEAA 4KDEA 3M6XA 5L7YA 1GTZA 4EY7A 1GPNA 2FRVA 5B4UA 5HEKA 1Z4PX 2CVQA 5HQJA 4O1MA 5K3FB 3U3KA 3G2OA 1F20A 1VHWA 4QLAA 5G3ZA 2VO1A 1QRAA 4PG6A 4JAVC 2XUIA 3KS9A 3WBJA 4RETA 3OZTA 2EU8A 3QFSA 2QUAA 4FC7A 1PS8A 1R4ZA 1A9YA 1PQUA 2ETVA 2GNAA 1UDRA 2H2HA 4M6WB 4A27A 3HBAA 3SBEA 1UKZA 4UU8A 4XVUA 5AVXA 1WDLA 4Z4CA 4TV9B 3U4HA 3AG6A 1QAOA 2C3YA 2ZAMA 1RWPA 4S1NA 4ZCPA 2YJ3A 5BSTA 3HNPA 3VAAA 1V8BA 2JIZA 3B6IA 3OX3A 2BBOA 4IICA 5HBGA 4YV2A 1I4TD 4MZXA 4M0DA 4NK5A 2XIQA 2CVHA 2H65A 3QX7A 3AP3A 1UADA 2NSJA 1ENPA 2N3ZA 3CLUC 4XDHA 1X6VA 1FP6A 4X5OA 1JJ7A 2WKRA 1SBCA 4XJXA 2PKCA 5HILA 2A88A 3B5EA 5DBIA 1YC2A 4RU1A 1TW3A 1YTUA 1RC0A 1YK0A 2C94A 2ZITA 4XGRA 1CUZA 2ORYA 4E6EA 4EG7A 6AT1A 1GZDA 3H04A 4G63A 2PSHA 4NYIR 2W6JD 3EOZA 4OTZA 4WZAE 4PRKA 2VYND 4L8YA 4Q9IA 1EX9A 1RR6A 4KQKA 2ZB3A 4EGCB 1C2TA 5GVRA 1G8YA 2AS0A 1JHMA 2RGXA 3GC6A 5AKYA 2XYGA 3HUEA 3TFWA 1HFKA 3ZBPA 2NT3A 3V8VA 2HIGA 1J2UA 1VHTA 3D8SA 1XVUA 1MRSA 2O20A 1U8EA 3IMEA 3OJWA 4XPZA 2UUPA 2ZIFA 2PBLA 1Q0HA 4V0LA 1J0CA 1FJ2A 1A5AB 3RIXA 4TWZA 5HZMA 1OUMA 2AD5A 1VP9A 3KKZA 3LQFA 2J6HA 3SEZA 1E9AA 5FQNA 5LQMA 4JQZA 1C9KA 1T8RA 1P39A 3H9JA 4RYDA 4BGVA 4H31A 5KX5B 3B7WA 4FFBB 2OAGA 3AR9A 2F48A 1BX3A 2B78A 3RU2A 3U9TA 3AF5A 3DYBA 5H83A 2NWQA 2EL9A 1ZI9A 3F5QA 1I13A 4M8LA 1FDSA 4WLEA 1CP2A 3EAFA 5FWXB 2JIPA 3QK7A 4GI7A 1C7ZA 2BJVA 3T7SA 3OMWA 4BLVA 4CIXA 1IPFA 4D98A 5FBKA 1KY4A 3NHZA 4IPTA 5J58A 1CQPA 2AJDA 5C5EA 4TM8A 5LU9A 1G3QA 1K4KA 2BFBB 2PR2A 1ZSNA 3VAYA 3ZWCA 2O6LA 1HGXA 4CEHB 2BR3A 1D2RA 1H9CA 3HE3A 1Y7IA 5DYIA 3U6BA 4CUKA 2FU5C 2X6RA 2AKEA 3FZQA 5NLLA 1N3BA 3OC6A 1TF7A 5AKHA 3WIUA 1B93A 2BF4A 4KVZA 1A97A 2XQJA 4OM7A 3W6PA 3FNRA 3LYLA 2H0QA 1SXJD 1GP2A 1NF8A 2C5HA 4P93A 2EGGA 2WF5A 2D2FA 4YCDA 2QRZA 3BMCA 3GUUA 2D0DA 5AMXA 2ZAGA 2WLTA 2DPXA 5K3OA 1DC3A 5GJVC 5AVYA 3DAYA 4W7IA 1XPJA 1ECLA 1JIVA 1TJ3A 3L9XA 5AKZA 4GL4A 4JT9A 4LK3A 4HB0A 3Q9LA 4UARA 1H2EA 2IYWA 3SKVA 4DC0A 3MD9A 5A02A 2OP0A 3ADDA 2OXEA 3P9RA 3S70A 1LF5A 2ZFUA 4TKMA 6REQA 3U37A 4JD5A 3AV3A 3COJA 5FPTA 3U3DA 1DKQA 2WUFA 1B6SA 2VUIB 4FE7A 2JFBA 4IIJA 2ISCA 3G2KA 4TXJA 4QSHA 3WAKA 1Z7GA 2I62A 4J0KA 5C18A 1M0EA 1TVEA 3IAEA 1EUCA 4XYLA 3DAGA 4FVTA 4OB7A 1CF9A 1B8PA 2UXBB 3UT5A 1R88A 1JEEA 2VJOA 4IX9A 3MIZA 1WL8A 4OB8A 5EKSA 3DV2A 4J76A 3OCYA 2BFDA 4PNPA 1OI7A 2HGZA 4KQIA 2AYXA 3IDOA 3O2QB 2GN9A 5AICA 3CVYA 4IDBA 1DAEA 4O8CA 2B8EA 3SJZA 4UBMA 2UZIR 5TF4A 1E2QA 2P6NA 4H7FA 3C45A 4PZZA 4WVLA 5IUNC 1EFTA 1N5IA 1XA0A 3LH5A 3LQ1A 3OWXA 3QV1A 1X38A 3GPDG 4KOAA 2C95A 4PE5B 5JNRA 1V48A 3QYPA 5JNLA 4EG0A 2H1FA 3KYDA 5B1SA 3VVMA 1V1MA 2IDZA 1QFXA 3NC4A 1T24A 4Y6SA 2O4CA 4HKTA 3L46A 1U0RA 3TSWA 2PWZA 4JI3B 5K4AA 3I4FA 2YNMC 4M0PA 1I1OA 1ECGA 3A4LA 1USUA 4KJZA 4M1EA 1QZZA 2V8OA 1H1LA 4LVCA 1R0BA 4MWEA 5HTKA 1M2HA 3GJ5A 2FMUA 1CC1S 2IX9A 4PX3A 2WD8A 3LKVA 2FN8A 3CKKA 1FX1A 3ORSA 3RG8A 3TW4A 2MSWA 3O1LA 3U7QA 3OVMA 4OHYA 3V1YA 5CURA 3TEFA 2QJWA 4OMUA 3V00A 1TM2A 2OENG 4A6EA 2AFVA 1F12A 3E3MA 2OV2A 3Q3CA 3AQ4A 4GH5A 4RSHA 5GQSA 1F3LA 2Q1WA 2XOEA 2B1IA 1R6XA 3LI2A 2DFTA 5D84A 3ELWA 1NWCA 2TMYA 3K20A 4G65A 4BAUA 4EDFA 4QFBA 3KLOA 1JH9A 3KTAB 3O8OA 2QX6A 4FXPA 2XCSB 1VP3A 5CFRA 4CLRA 3ZZTA 3P2MA 3LUAA 3O83A 2JJ1A 5DIZA 3LW7A 1Q2UA 2XMRA 1UPTA 3NGLA 2V6JA 4K9SA 3TUJC 3W2IA 4CIDA 3JRWA 2CXUA 2VUSA 4OLHA 1XTJA 3J81k 1DT3A 5AJYA 1J1UA 1KPGA 1ZL2A 4D0RA 1YZTA 3TL3A 3V1UA 3DTVA 1X1SA 2GPSA 5J2UB 4RW0A 1G9XA 4Z3KA 1DRUA 2FN7A 3ME5A 2OV8A 2Q4EA 4D4HA 2B82A 4H7DA 3ZTTA 4C06A 1GQYA 1H2FA 1P1FA 1TVMA 2IW1A 4LY3A 3IQDB 3EEOA 4EI9A 4Q9JA 3SS8A 2AXQA 5AH0A 3U7HB 4WI1A 1E9SA 1V9SA 2QV7A 2WNHA 4J0FA 5CLQA 4MKXA 1TKAA 2YV4A 4EQ6A 1B43A 2EWMA 5F1KA 2GN8A 4FYVA 2AXPA 4UM9B 3LQ4A 1NAIA 1GLNA 3F90A 3NBZC 2FZGA 4GPD1 5B7PA 1OI2A 1BVHA 1ZD9A 4F91B 3ZX5A 1BOOA 1NT4A 1Z37A 3C3JA 3KOYA 1N7IA 4KIUA 4RY9A 4ZIRB 5IVHA 4GYWA 2XCQA 3SC2B 1QYVA 5IJ9B 2HO5A 4JR1A 5AI4A 1Q2XA 5MGNA 3TD6A 2Y1DA 1HFEL 1XCGB 2YC4C 2W6CX 3AHCA 3CX4A 1IHXA 3K09A 1Q50A 4AMBA 5JS2A 4EKEA 3T5DA 4NU8X 4XRRA 3GUCA 3KKOA 2JGEA 2P2DA 2OO5C 2WWVD 3LWDA 3TO5A 3AEUA 1P0MA 1HDEA 3GVCA 3OZEA 3PI6A 3JZAA 3JYQA 1PVOA 1AJEA 1MIHA 2GCOB 5HM6A 2HHHB 3EIWA 4NMXB 2ZTSA 2WVGA 2H92A 3TZHA 2D00A 3GH1A 4EX7A 3TZQA 3DM9B 1XZMA 4O5AA 4Q47A 4JB2A 4ND5A 4PU0A 3FLEA 4G5HA 1YRHA 4N39A 4YMWA 1U0BB 5HJEA 1UZUA 2P0EA 5HR5A 2A3RA 2LBPA 1F9AA 1ZCBA 3NYRA 4C29A 1YGYA 3NAGA 3WFZA 1RBZA 4QQ8A 5JFTA 1GZUA 1R9NA 4H2DA 1I4DD 1WDMA 2VATA 1RZRA 2P75A 2MYPA 2XUKA 1KFCB 2DXIA 4JC5A 3W34A 3O1HB 5EWJA 3IFSA 3O82A 4UM7A 4EGFA 1ZU4A 4FEYA 5EJEA 5HKOA 3QTBA 2DFLA 1T36B 1KI6B 3NETA 2OVFA 1SXGA 4WACA 3AEYA 2J0QA 2NACA 1P18A 2NP6A 4P83A 1NRXA 1Z0KA 5EG5A 2EDCA 2AMVA 3MJRA 5A4IS 4EMUA 1LI4A 4J8PA 1ZLYA 3I39X 1G5RA 4G4IA 4MPDA 5CTJA 1ZA2A 3BCRA 1N6KA 1RWKA 2IGBA 4RVUA 5FBWB 5BMVA 2EKDA 421PA 2C8JA 2OFPA 3S2YA 1KQPA 5JJKA 1AF4A 3IPAA 2IT1A 1Z2CA 2WSBA 3RVMA 4DYHA 1TU4A 4HQOA 1NRIA 4LY9A 4JGIA 5AK4A 1K2VN 3RRYA 1RCFA 3BFPA 2P6RA 1VCNA 3RQSA 1SHUX 1OWPA 1ZNZA 4IUYA 2HA0A 3NTUA 4FZ5A 2P9QA 4G56A 1LQTA 1Y1SA 3SLRA 1ZG3A 2Q4BA 3QBJA 2P6MA 3I2KA 3KT6A 3MC1A 4CFSA 1GQOA 2C97A 3LUDA 5CVJA 1DLJA 5KCZA 4BNIA 2ZBPA 2ZCVA 3T8YA 2AR7A 4OQLA 1YULA 1FP4A 5GZ1A 3P9XA 4WJZA 1KC1A 2DRIA 1I5OA 2G80A 2SHKA 3BXGA 3FTNA 5ITWA 4ENRA 1D04A 5TEVA 5H1YA 4MW6A 2QG6A 3QUBA 3TS1A 2Z95A 5FJJA 4PNZA 3WSWA 1JR6A 1EE1A 1PJ4A 2IH5A 1OBHA 2QN2A 3R3HA 1JDUA 5JISA 2H7CA 2TECE 3HV0A 5J5CA 3PC8A 1KY5A 3UUFA 5EQTA 1U7ZA 3PTLA 5E6RA 2PZAA 3L4EA 3U44A 3JAKA 3EIEA 1FDRA 5JSQA 2BISA 3V8MA 1XLTC 3TD2A 2C3UA 3QTLA 1Z6GA 1EFPB 3C7TA 3RFTA 4J4BA 3UGTA 5FLXA 1TUBB 2JD0A 3NEPX 3F6BX 3WGIA 4MJLA 2P2YA 2G7ZA 2ZIGA 1U28A 4JP3A 5LKAA 2FDRA 4EF4A 4BKQA 3AY3A 2UYQA 4JQSA 5FTNA 5FUMA 1U0OC 5ESXA 3DEZA 2QXTA 3WHPA 3WYNA 1RYFA 1H05A 4BFUA 4HXEB 1NC1A 1PL6A 2HDWA 4R8SA 4NK4A 2IZOA 3ANXA 3WE7A 3KUDA 2FMXA 2QR2A 1VDZA 1XZAA 2P1RA 2ZRAA 3F96A 3WGKA 3HCWA 2AHRA 4NV1A 2FPWA 1DPFA 4ND3A 5C7LO 3TLBA 2ZTVA 4JODA 4MVJE 3OSZA 1EFCA 4L27A 4M9SA 1D9ZA 2EJTA 5AJWA 1FFEA 4I2NA 4I36A 4MVJG 4JJ8A 2VK2A 1N2BA 3ROXA 4A73A 4KVGA 1GD1O 3FYSA 4HLDA 3SYTA 5KJ1A 4W5OA 3TTXA 1YS9A 2RDMA 4GM4A 2PX0A 1T9ZA 3THYB 3Q72A 4MCHA 1BIFA 1XWWA 2J09A 4RTLA 1GKYA 3IXQA 3QX8A 3TIGA 3FA2A 3HYTA 4D9CA 4M99A 3NNSA 1Y1LA 1IONA 1RYNA 2AWNA 2PPVA 5BSKA 13PKA 5BVHA 1UPFA 3N0RA 4QHTA 1WA5A 5JHGB 3DPIA 1SBNE 4UM8B 4FYJA 3IQHX 4LK2A 1GU7A 3CUKA 3ZDZB 3OEWA 3HKBB 4COOA 1Q0PA 4PG8A 1E77A 4EBBA 2IUYA 2BT4A 1FSGA 2HSZA 4HSGA 5LZ9A 2LUOA 1R6AA 4UTXA 4I1PA 1ULSA 2XWSA 3E1GA 1V37A 5IUKC 1YDMA 2GLUA 2G83A 4CCAA 1EVYA 3JQBA 5G0TA 4MNTA 4Q24A 4WBNA 1HLGA 2Z30A 4JLJA 2I6GA 3M5DA 5T4FA 3W4KA 3BCHA 5IZCC 1P2SA 5I3ZA 2ZVJA 5FTKA 5C0OE 4MRRA 1NV9A 3ZDDA 5A2GA 3KJNA 4J16C 3NATA 4Y2TA 4Y3UA 5IM4F 4AIIA 1GAWA 1YZQA 5ESWA 2HF9A 3V97A 4FFRA 2JIZD 2XD9A 3KJGA 2H57A 2VAMA 3O38A 1SWWA 5FWAA 4EEKA 2HSDA 1FRZA 4FKBA 3H42B 1PJ8A 2JFFA 4AXBA 4Z4HA 2BMAA 4ADSG 2CXNA 1OXKB 3QVGA 4GDMA 3E9DA 4QAQA 4ZVTA 2DWOA 2ZSFA 1YR9A 4EWLA 3SBXA 2QMZA 5DGTA 1E3SA 1K8YB 2BFAA 2JI6A 3QPVA 2I55A 4WSOA 2P40A 1J00A 3NH6A 4YASA 3B9QA 4EW6A 1AZWA 5T8KA 1YV9A 3G2IA 1KO7A 1UP4A 1Y9AA 2D62A 2FGJA 2VYCA 1Q84A 4KEAA 4TMVA 3OF3A 4WZZA 5DASA 5FPHA 5TIIA 3FNHA 5IJXA 4YQZA 1JQEA 3PLNA 3WX0A 4F12A 3CB4A 1U0FA 1V5IA 2GR9A 1TM7E 2FZCA 2PEYA 2VPQA 4IIFA 2PH7A 4GPBA 3UAVA 4KN9S 2WU8A 3AL0C 4YNBA 1PI3A 3IKVA 4JBHA 3V34A 5J47A 1ZN8A 2CL5A 3NHKA 3JQRA 4YWHA 4A8HA 3I30X 5A06A 3R7NA 1AA9A 4X64B 5LQCA 3QX3A 4HMQA 1AUXA 1QQ6A 2OCLA 2EEZA 4TKLA 1I3OA 5B37A 1XEXB 2PL9A 3PK0A 1YE8A 1ZN7A 4W9MC 4DE5A 1N9GA 1I8TA 2R7KA 1RYYA 4D8YA 2QJRA 2ZJ2A 4TTTS 4HLUA 1OB5A 1M1UA 1Z5UA 1G8AA 1QDEA 2DPGA 2YQZA 3PP8A 2O23A 3Q8KA 2RGNA 2H07A 3HHPA 2ZI9A 3SZ3A 2O54A 1D1QA 4C88A 1AK1A 5M34A 1R37A 3UWSA 1HT2E 2UUAB 3I5MA 3VNAA 4MV1A 3PNVA 2BEVB 3S0JA 4OXYA 2PO5A 3GAAA 3HG7A 4ZOLB 2ORWA 1DJMA 1QJ4A 1M0SA 5LZ7A 2H2WA 2W8BB 4KHZA 1OWLA 4EO9A 5LMNB 3BM5A 1N32B 1JSLA 3RSFA 1VB3A 4A0SA 4OBWA 4JYMA 4P2BA 3V2GA 4W1PA 3Q7IA 4G0OA 5C34B 2F8LA 4CV2A 4HRAA 3OZVA 2SKEA 1FMTA 1QQTA 4MUGA 3MSCA 3QMMA 4NBVA 1LVGA 1U7PA 3A6FA 5T4BA 2VSQA 4ISCA 3S7ZA 4AJ2A 1RLOA 1M8JA 1ZITA 4B6EA 4F60A 4UPVA 1BMFA 1ZUNB 5JO0A 2DECA 4ZVVA 3SVTA 2Y1WA 1U3VA 3TLGA 3FYUB 3I42A 3F7NA 2BMJA 1M1NB 4OUKX 3EG5A 1YQ9A 1J24A 1W1WA 3KHUA 4X6LA 2QR3A 1BHJA 3CG4A 2JH3A 1KSGA 3TSAA 2C00A 1W30A 3GY0A 1NVDA 4KWCA 4YMUA 3T54A 4FT4A 2REXB 2PAFA 1SIUA 2YZMA 1DAGA 1JFRA 2D5IA 2C9OA 3OBBA 4N8DA 3UQYS 1QOQB 1SEPA 5KCMA 3N2ZB 4DTCA 5KHOC 3B8EA 3GK3A 2R62A 3EVZA 1GTVA 3VM6A 5LOVA 3D6NB 3L8HA 4HN9A 5ALRA 2XYRA 4MUAA 3ZQ4A 7ABPA 4MUBA 3K5HA 3ORQA 3PUXA 1MJFA 2Z5FA 1UOEA 2BGWA 3NAQA 1D6JA 4UVEA 4EB3A 2EJVA 4MIEA 2ID9A 4OQXA 1MPTA 2FSVC 2EGUA 5AKEA 3EFEA 4HQ6A 1FYXA 4HNGA 4MV0A 1AS3A 1O5TA 4G86A 3OEYA 4DABA 3DL4A 2OWDA 1J23A 3DOOA 1NJ8A 4MV3A 4CMGA 5KC9A 1PV4A 1NJ5A 3PXXA 3ZW7A 3C7CB 3WGOA 4OHVA 1BOFA 2DFNA 1PX0A 2WB4A 1H2RS 3HZRA 3MGAA 4ZAWA 3THOA 4EELA 3GDOA 1KJWA 3WFJA 3WFIA 4IHQA 4BFVA 5HQTA 1SC6A 1C9EA 5IPFA 2FQWA 1F5SA 4MW5A 1JEOA 1JKXA 3F67A 4ARZB 2Q3CA 3UENA 3G0HA 2EATA 1WVIA 3IUNA 4J1SA 5TB5A 4DMCA 1GPJA 4TTAA 3LDHA 4F38A 3TW0A 2X7HA 1YD7A 1OFUX 1N3YA 2OCBA 3T3NA 1NG9A 1U2QA 2HBQA 4GNRA 4TYMA 1K3UB 5CDTA 3F3SA 1RWBA 3WNZA 1DKNA 1SVNA 2RHRA 2B37A 2UZ0A 1ISPA 2VJDA 3KKMA 3LT2A 3MMZA 2KYRA 1M34B 2C8VA 3QXHA 3LXUX 4H6WA 4XB2A 821PA 5KQPA 3GPLA 3PE6A 2V98A 4BVAA 4N3GA 4DWWA 2ROQA 1WMSA 3KQTA 4WXMA 5FBLB 1VBMA 1YRQA 1VE6A 5E7JA 4Q6BA 1DOZA 5EHIA 2NO0A 3NBYC 2ZUVA 3D31A 1U8TA 1Z25A 3D4IA 3EZ2A 1P2BA 1KFJB 2P2CA 3GP8A 2W7TA 2VQ6A 3WYDA 3N76A 2H1OA 4ZC1A 1YBHA 2H0AA 2IDJA 2N1MA 3K35A 3ZHTA 4AF7A 2H2GA 3RM3A 1GDTA 4BNDB 1J70A 1I2AA 2RCNA 5L51A 2AXNA 2G9UA 2XXAB 4HQ0A 1BN7A 1EMDA 3DE7X 4I5GA 3G23A 4IYJA 2Q6VA 5BNFA 5A6VA 4B3GA 1TU3A 4WOPA 3I62A 3ZQ6A 1DQSA 2PMEA 1UOOA 2QMQA 3D6TB 3STYA 2I4NA 2ZUTA 5BSGA 2QRJA 1DQZA 2NNWB 4G5SA 5JCJA 3U4QB 3R3WA 4AZSA 5BNIA 3ELYA 1LX7A 3A0RB 4D56A 2IBTA 3EISA 3TNYA 1YACA 4R2HA 3FWYA 1XZDA 4DQUA 1O4VA 1NN5A 2NYUA 1ZK0A 3QVOA 4CMBA 2WPDD 2IPOA 2GKSA 3PD1A 5FL7A 1P9WA 4FT2A 3FDJA 2DHQA 1JTFA 4BN0A 1F4PA 2DZDA 4HY3A 3I6ZA 3ZU6A 1FNNA 4YLYA 2A78A 4E2YA 1Z0UA 1BCSB 3CF2A 4XVCA 2XWBF 4JLDA 5JNTA 3TGPA 2BR5A 1U99A 3GLIB 4F4FA 3ER6A 3NTQA 5AIAA 2ZQYA 3IP1A 4FFLA 3I9V1 5AXBA 1N0VC 2P9TA 1N78A 3HEBA 4CLHA 1E9DA 1Y1PA 4M86A 3KQSA 1W0CA 2L18A 1KSJA 4FOLA 2I3AA 4LYAA 3ZR4B 3I9KA 1U0SY 2VPWA 5H16A 5CHEA 1NKTA 1RD4A 1K9SA 4PC2A 1NBWB 5CPFA 1WXWA 5BUSA 1P75A 4TQ9A 1BDHA 4C76A 1VJRA 1IXRC 3SMVA 4XYMA 4UKDA 4A5SA 4LQ4A 2VK4A 2B4AA 3G8DA 1K75A 2L69A 1RNLA 4CMEA 5AOAA 2XJ9A 3GLSA 5ICGA 3GDGA 4AZ0B 2GYWA 2XA2A 4AIRA 2X4GA 2NU6A 1T1JA 3GFGA 4XUCA 4KKVA 2XF8A 3OD1A 4BNWA 1TMYA 2GZHA 3WA6A 4GU5A 5IKMA 5CX4A 5ITSA 5KYYA 4QPZA 1A9ZA 1DC5A 4X94A 3E27A 3IH5A 3PEFA 3BD8A 3C6QA 5AM1A 1CQIA 1MVOA 3AEKB 3QBEA 2VJCA 4BE4A 3S5JA 4J94A 1I51A 4KXNA 1I6WA 1XLVA 3PHHA 3RAPR 3G5TA 2LP4Y 2WG0A 5TVGA 2IIVA 3QKWA 4H6XA 3RFFA 2WFAA 2CXSA 4RTKA 1P5ZB 3E7XA 2HHLA 4RPLA 4CEHA 1VMAA 3CIFA 1EFRD 3FZNA 3FAKA 2AN1A 2QYTA 3PEUA 3R0XA 4QO8A 3I61A 4DV7B 1XL1A 2Z4TA 4FEGA 1KYYA 5F12A 4Z7JA 2BE7A 3RS8A 4IFBA 1Y5NA 3HVRA 4JA0A 3WIOA 3ZVNA 2FUCA 3K1TA 2BM9A 2F9MA 2G1JA 4Y2YA 1JHAA 4UAJA 5FEMA 3VR6H 4AO6A 1XTRA 3W2FA 4JP2A 1T2NA 1FA9A 1VSUA 4PG7A 3VOBA 4X66B 1L8QA 3N7UA 4NVRA 3V7YA 3DBLA 2ZU6A 4MQBA 4FQ7A 3K3PA 1D2NA 1Y1QA 2F43B 3FI9A 1JG6A 2JLCA 5JE8A 1S8FA 1NR1A 2V59A 4L57A 3OOEA 2VTBB 4LI3X 2WU4A 5F21A 1TYDE 1TZ2A 4D79A 1TLLA 5JCZA 2FW9A 1J2RA 2ZRBA 2JIDA 3DAPA 1R64A 2JFWA 4B33A 2AX4A 3T0IA 4PYNA 2QOEA 1BFDA 1VKZA 1XTBA 2Q9CA 1U02A 1SPXA 6YASA 4PLZA 2ZB7A 1JEJA 2QYSA 5D6NA 4NOLA 1UDBA 4YH1A 4C03A 5B58T 4OX9B 1WEKA 4NCHA 4NS1A 3V9PA 2AVDA 2IJGX 3F71A 3EQZA 1KTVA 4RM2A 3BRWD 4Z9YA 1GGFA 1QK3A 2HCFA 1M9NA 3D6JA 2AX3A 3F8WA 3JVVA 4OXIA 1XMQB 3AOEA 1XQWA 3WNCA 1U3CA 2NG1A 1VSTA 3EIQA 3Q8WA 3QLEA 4QGFA 1HI9A 5SZIA 2Q7XA 1SOMA 3GPCA 2VHUA 3QVWA 4P38A 1GV1A 5A2QA 4W7SA 5CLGA 2OR3A 4ZO6A 2FPOA 1UXOA 2GZAA 3DBVO 3IP3A 2VPTA 3IEIA 2NX2A 3IPYA 4F5DA 4CLDA 4QOEA 2IXDA 4RS3A 3IUQA 2JFQA 2WNIA 4GX1A 1GPUA 1EQUA 2GN2A 2PUAA 3BKXA 1I7DA 1KDTA 3VVBA 3EF0A 1CS0A 1JR4A 3NYIA 3OHSX 3QWHA 4AN0A 3AVYA 4O02B 3IHLA 2Y0PA 5CB8A 3U5ZB 1GYQA 3KE9A 2YC2C 4NV3A 3ZI0A 4TV9A 3JQAB 3I34X 2IE8A 3E2PA 3HUTA 4ESHA 3G5UA 2RGNC 4ZKDA 1Z8DA 2IKSA 2WD9A 2ZI6A 3C3WA 1RKQA 1QCDA 4RMIA 1GN9A 2W71A 3FY4A 3PX3A 4W4TA 3N2GA 3KEQA 5U9CA 4JU8A 1ZD5A 4IQ8A 4ZJYA 4DIFA 3TXYA 1XV5A 4PX2A 1ISRA 3QMVA 4M0CA 4OGKA 3KSZO 4CT4B 4E14A 5ICEA 5ICCA 1N2IA 1X1AA 5E9WA 2Z9DA 1C0PA 4B3CA 4RSRA 4QZVA 1W94A 3T6KA 1XQVA 2CJWB 5EGSA 4YEDA 5P21A 1KJYA 1OPXA 1Q6ZA 1T10A 2GK3A 3F6CA 4YMVA 2GJ9A 4ZHQA 1M54A 5JS6A 4C3OB 4Y2HA 5EESA 3MJTA 3GZNA 4DL9A 5C35A 2H4WA 4N5HX 3NT2A 4YCNA 4LJYA 5EERA 2O0MA 2VQSA 1BKYA 1H5UA 2IP1A 3KZ1E 3BDAA 4J7XA 4PM4A 4C0XA 2LKCA 4Q16A 4CM4B 2VH5R 5D3ZA 4E6PA 2FRDA 3IRVA 4QGSA 4CI9A 621PA 4CIAA 1DKLA 1P0CA 2H5JA 3CMCO 5TQ0A 2HA2A 5FL3A 2JDID 3EDYA 3HXKA 2BI8A 4G8DA 1P4HA 5EXTA 4EENA 1L4NA 3NBXX 4NFSA 2NSYA 2ZE7A 3O4JA 4F4JA 3G9XA 3NOQA 3MWDB 3CCBA 3L82B 4O2AA 3NUGA 4AKSA 1UBMS 1Z15A 1R15A 2VLBA 1BMFD 1GPAA 1NI4A 2GHQA 3LHDA 3NBQA 1RYDA 3QKTA 3ABOB 4LVOA 1I4OA 1EXNA 4LHWA 4YV7A 4MGYR 4AZTA 4MHTA 1C1XB 1R5BA 1SIOA 5LA6F 5EHNA 2YKGA 3TTYA 1ZR4A 1TEXA 4ONEA 1Z74A 3UH1A 4TTSA 3CSDA 2I1QA 2QL7A 5HUQA 1M1YB 1FVXA 5EIFA 1LPMA 5A6SA 1Z73A 16PKA 1P2VA 2IUEA 2C31A 3G2JA 1P62B 4XX0B 3ZTYA 2PXAA 1NQWA 1W6RA 2AQKA 4NS4A 2ZYGA 5FYQA 2J32A 1QF7A 3F49S 4ASUA 3HKCA 4K7JA 2XADA 2H7VA 2QAGC 3PNPA 4KFRA 5SYNA 3KOXA 4BLTA 4L50A 1HE8B 5H3LA 1P3JA 2F4VB 2XR1A 4GWKA 1EP1B 1W36B 1B15A 1BXZA 4J0DA 3W9BA 2C7BA 4IOLA 2FZ5A 1IJEA 3NDPA 5JD6A 5CLJA 4MRPA 2D3TA 5EE1A 3QNMA 2DH6A 4KBFA 3N0XA 3QOYA 4H7KA 1TM1E 4HV4A 1E5XA 4RJKA 4L0CA 2R4UA 2O8BA 1TYBE 5H80A 1JSZA 2CNWD 2C61A 5D51S 4WN9B 5EIAA 4Z3DA 4OK5A 5YASA 2YDXA 3TRDA 1FVFA 2R66A 5T6BA 2PKXA 4G1EB 4HFMA 4XLTA 3VXKA 3WLPA 2AMJA 1FP1D 2YCBA 2ODWA 2WSLA 2P69A 1A5SB 4O2RA 4I5IA 4QLBA 4UOZA 4RL6A 1RP7A 5BN3A 1J97A 2OYSA 3MCZA 1FL9A 1QG6A 4GPAA 4H16A 1AXGA 2BTEA 2PUGA 4BNLA 3BN3A 3DXZA 4YACA 3OIDA 1KS2A 1P4JA 5DE3A 3LD9A 3PXAA 1ULBA 3HVJA 1XPRA 4A16A 1KQFA 4NPCA 3QUTA 2YINC 5L9AA 5DSXA 4KTVE 4M1TA 5IP5A 2W98A 1W19A 4P2GA 2J6IA 1R74A 3KB8A 1JHZA 2SKDA 3NKFA 5D3QA 1RU3A 2ZSEA 1X0VA 2PIAA 1YIOA 2WIGA 3A31A 1HNXB 3LC7O 5U1PA 2WF9A 3DDOA 4OK6A 4ZDIA 3UPTA 3ACDA 3SX0A 5EA2A 4ZXPA 4IG4A 3ZE1B 4C43A 1UC8A 4RACA 1Z26A 3ML1A 2C4KA 1BEEA 1JWBB 1KVUA 221PA 4LRXA 4YJHB 3VJRA 2K2QB 3CX6A 1CUUA 4QDOA 1SCJA 2IIQA 3DDWA 2ECQA 3MWEA 4RDCA 3N8DA 1K5GA 5ALIA 4L8GA 3REQA 3CR8A 3O7MA 4JLNA 4KQ2A 1VGRA 1XLWA 2BAGA 2OO3A 3K4QA 4ZOCA 1PNVA 3I92A 4Q9DA 5C1BA 4G8BA 3SJBA 4B8YA 3LA6A 5AJHA 1M7BA 2ZS8A 1UKVY 2R6GA 2X58A 2DUNA 5I9LA 3UBTA 4RLQA 5A5GA 4AB1A 2OM2A 2GEBA 3VZBA 4P53A 3H19A 5JXWA 1C3EA 1GCUA 2OCXA 2R1UA 1XCOA 2V7GA 3R7AA 4UNQA 3TK1A 4Q37A 1PLLA 3NHPA 1GU0A 2P1DA 3L6CA 2JFOA 2Q6TA 3IBCA 4ITRC 1U7XA 3RH0A 1CRZA 2C7PA 3AEQB 4CNQA 2GD2A 1QMGA 1BYUA 4OJYA 4DMRA 4RTQA 4FJ2A 4IIDA 5EEGA 4B2IA 5ABPA 5AVRA 3NU1A 2HXSA 1WF6A 2QQFA 3QE4A 3UXMA 4PYMA 1YA4A 1S8NA 4R1QA 1KFBB 3U6KA 1BHO1 3JQAD 5IYZA 4HAVA 4BN4A 4RK4A 1EQ2A 1Z6QA 4ZA2A 2PMCA 3ZY3A 1X70A 3HCEA 4ZGWA 5ADVA 1U81A 2AKYA 2D5LA 1Z5VA 3MS4A 2GSWA 3LUJA 5KNDH 3KL2A 2XE4A 4IS2A 5DP2A 1W5AA 3KVVA 4LKRA 4MYCA 4REQB 2PQ6A 2IP4A 5AW8A 3OZUA 1JJAA 1YVDA 4EA6A 2ZUEA 2H4HA 2J8ZA 5IDXA 3ROQA 1N2JA 1LRKA 3HB5X 3UK0A 1WQ4A 4JUCA 4EYEA 2B4QA 2Z8ZA 4HUJA 4RABA 4LNUB 2QN3A 4H1UA 4Q12A 2QVBA 3Q9SA 3C3MA 5LLDA 3A6LA 5KYUA 4EPVA 5K03A 3O7WA 2PZKA 4JI7B 5LMZA 2DMRA 3EUWA 3GJYA 3LUPA 2RH9B 3D6HA 3ITDA 1LWNA 4IR7A 4XCQA 1FXWF 3TDKA 3WLIA 3ZV7A 3CRRA 1MQ8B 2BGLA 1DHTA 3C4QA 3EARA 3NRJA 4X7RA 3KKQA 4WCVA 1SCNE 3TLJA 5ALOA 3RYCB 3FXAA 2ASEA 1CUIA 5BYAA 3EODA 3R9KA 1RI1A 4IOJA 4ENTA 2D5BA 2RGWA 3I8XA 5A03A 1L7VC 1L8XA 2WYVA 1M7HA 3WJ1A 2FF5A 3DEFA 5KWVA 3U4QA 4HNRA 4OPMA 3JVUA 1O77A 3ERCA 1E2EA 3ABZA 3LKZA 4KP7A 1LA2A 3OE4A 3WJ7A 4H77A 3GMDA 4CL2A 2FUG6 3UC5A 3DTYA 4MEBA 2PVSA 1JZQA 1OFUA 2PDAA 3CWCA 1I80A 3R20A 1CEXA 3LOUA 5TLSA 4Z1MA 3W4IA 4RY8A 3S2GA 2MJLA 2ZDHA 3M9LA 1DP4A 3J81A 3ZK8A 3X2SA 3PC8C 2VJMA 5I7VA 3ETCA 4G5OA 3K8ZA 3TEJA 3CO0S 4HUTA 5B64A 4XD2A 4PSUA 3NPAA 2YUTA 3KVNA 1IWOA 1I4EB 4A2WA 5AHXA 2CMFA 5F5LA 4ZHQF 1K98A 1G17A 1N2GA 1NVUQ 3NBKA 1E7MA 3RROA 1ZIDA 2V4UA 3FGZA 4AI6A 3C6MA 3OIGA 5K6AC 4NCXA 1ZGGA 4D45A 2AIRA 1XG5A 2MSEB 4ZRDA 4AY2A 3RS0A 3KT3A 4B09A 1Y4AE 5AVTA 1XEAA 4K1XA 2ZUSA 3KELA 4FHEA 2IU6A 1W5SA 4AQYB 3R9XB 4C7OA 1KK3A 2QS9A 3KV3O 3K72B 4Q05A 4V0KA 4BO0A 4BWYA 1FU7A 3FCXA 4U3JA 2X7XA 1T25A 1ZRNA 2CXTA 3PKIA 1NP3A 4NBRA 1KYQA 3ZWPA 4K0RA 4K6CA 4D8XA 2BCJQ 4DNFA 4J6FA 5AM2A 1E4EA 3I04M 3MPUA 3QKSB 3GFBA 5C7YA 1FXUA 4N01A 1Q19A 2G1AA 1WIWA 2O2SA 2GAJA 2X4IA 3RR2A 1PU2A 2O7RA 2J9XB 4QUIA 2RG1A 3JALB 3ASVA 4GBJA 4P82A 2YJNA 2EP7A 2Z9CA 4BQIA 1YJ8A 1DQPA 4R5MA 1YBVA 4GKJB 3BILA 2R6R1 1R27A 2ADMA 2VWPA 4GQIA 1DUSA 1JEYB 3HBLA 4P4TA 5EKTA 1BW9A 1N6OA 3NBUA 4FYKA 4NPAA 1N6LA 4JT2A 5E1DA 3RSGA 1TTTA 5M2QA 4JX8A 5CBPA 1MH1A 2D2IA 2WTEA 1WUHS 2Y1CA 3MAGA 3IV6A 4F45A 1TFUA 5KYXA 1B14A 2ZPAA 4DR3B 3NP7A 1J49A 1OFVA 2BGJA 1JDZA 2EDAA 5A0VA 2GVDC 3TSYA 4ZK2A 3M2PA 2Q5JA 3QE3A 4JQOA 1MHPA 5BV2P 4LF8B 2IYXA 3SZUA 5BWCA 2QSUA 2OV4A 1WW2A 2GBCA 1CUJA 2X0NA 1WW8A 3G2NA 3VDRA 2ZR7A 3RKUA 3VZQA 2V6FA 3AG5A 4URFA 1T5SA 1LK5A 3AJ8A 4G36A 2M6SA 1LDBA 2FPSA 2BUCA 4KVAA 2CLIB 2Y2UA 2ZBVA 1E8MA 3R09A 4F9EA 1W36C 4KUHA 3NJ4A 3LLUA 4F5EA 1SZCA 1W75A 4QPPA 2E4YA 3PGA1 3RUAA 1HC7A 1Z28A 2EVWX 3PUWA 3BS4A 1EEHA 3O95A 1VHJA 2I6UA 4HGQA 2ON6A 4MYTA 4MYUA 4LW8A 1PV1A 1GCOA 3EQ2A 1RLTA 4UAVA 2PNFA 4LAFA 3BRCA 3AFIA 4OHMA 3AVPA 3OTOB 3F0TA 5HCUA 4FR5A 2G04A 4GR4A 1T8SA 4M49A 2YVLA 2XNKA 4UFNA 1DINA 4NJMA 5K8UA 1LNQA 3WBKA 4WA8A 3QWIA 4LX8A 3GRFA 4IF4A 5BYBA 2VVTA 4AD8A 3PEWA 3QVKA 1Y8QA 2QNIA 3MT8A 4JI0B 3OJEA 5BVGA 5LZ5A 3UTCA 3H1AA 3A6HA 3SP1A 1RRVA 4W6ZA 1CJUC 4QYSA 5KTMA 1WU8A 1ZZEA 2V0CA 1K5PA 2Z9BA 4CBVA 3TTVA 8ADHA 1YFLA 4HZUA 4F06A 1J2JA 1ZM9A 3JQ7A 1XXLA 2FLVA 3H2SA 1LPSA 2NV6A 4WGFA 4KQHA 4HLNA 2RK6A 4UDYX 1L9XA 5A5DA 3T0GA 2WC1A 1BZYA 2Q3HA 5HZGA 1P4SA 2YVKA 4RK6A 1K9VF 5CVEA 3JSAA 2QY6A 1VE9A 1UH5A 4K6KA 1E3WA 4R98A 1VGVA 1LBHA 1TLFA 1ZVMA 1A9TA 3BXEA 3WOHA 1D09A 3IT3A 5IJZA 1D2CA 3NZEA 2PZ8A 5IKPA 3GEGA 3TPCA 4LE0A 2OQVA 3BRWA 2GTPA 2HJ9A 4EPRA 1ZONA 2Q1TA 5IAKA 4TUYB 3UK7A 2WMDA 1T0JB 1VG8A 3IULA 2P77A 2AQIA 1OBCA 2I6TA 4IUDS 5EIOA 3RV4A 4EAAA 4C0JA 3WSVA 5B1EA 4B5LA 4ZP1A 3VHRA 2IS4A 1XDGA 3AZOA 1PZMA 3EZ9A 3FVVA 3BXPA 4IDAA 3IUEA 1XAIA 2PE5A 1QLHA 4JLKA 3CNNA 4I4NA 4IZHA 2WWIA 3P45A 3GWZA 3R41A 3H9UA 1C80A 4YRMA 3LWNA 1Z2EA 5K01A 2K7FA 4KR3A 2O06A 2ORED 3PGLA 5FJIA 5A0FA 2FI1A 2WZBA 5KSYA 1B1CA 3EAQA 1FTWA 2OD9A 2AXEA 4FBLA 4HX2A 1KMMA 2IKQA 1KAHA 3HNRA 4RFSB 4D5GA 2ZSBA 4Q93A 1YHNA 3DOIA 3SI7A 5LJLA 3PE4A 4WE3A 1PV2A 2XMBA 1YR3A 1JHPA 3SNKA 3PLAE 3RC7A 2IDMA 2W4QA 3N0VA 3PXEA 2NUTB 4Q1AA 5HIJA 3AEQA 1AO0A 1FMLA 4AY4A 3T5PA 1B23P 2Q27A 3IE2A 4KXXA 1R16A 5MFPA 2A57A 1UODA 3ROTA 3QLJA 3E9NA 3DFMA 1B74A 2I22A 3WKEA 2AZDA 2C2OA 3DOJA 3FTQA 4HNQA 2X40A 3THWA 1Z5WA 2HWKA 2I5PO 3I76A 3ZYCA 2FPPA 3HKBA 2JGFA 4WTOA 3TZLA 2OGTA 1QG2A 2BBSA 3QVXA 4G4SO 1BWQA 1RMTA 1N0IA 5TMDA 4MPRA 3OEHD 2FSVA 2V55B 4RQUA 2WJJA 3RS5A 4OUDB 1AS0A 2GPYA 3MWEB 4LPKA 3N3AC 1LI7A 1B26A 4OJTA 3K70B 3AF2A 1DKOA 5DI3A 2PSSA 1UDAA 4YRCA 4WZBB 3MCWA 3QU4A 1HE1C 3G7NA 4Y6PA 4X97A 1TA9A 3ANYB 3G1UA 4BMOB 2LGJA 1L5NA 5H9VA 3K53A 3UH0A 3Q41A 1YCHA 4BQOA 4LXUA 5AVJA 2Z56A 4FCWA 1X87A 1PUXA 3ILVA 3OPYA 2QVLA 1E9CA 3PUVA 4BEBA 3JWJA 3GLGA 3GGCA 1W85B 2H8GA 3WB0A 3WB1A 2GSDA 3C5WP 5EAIA 3IGFA 4HWRA 4FYIA 2ZEJA 4MRMB 4P4UA 1JQLB 5K4HA 3V5NA 2HC9A 3QPWA 3IQEA 4EFNA 3D3WA 5BV7A 3ST7A 1KRWA 4L0QA 3LT1A 1JFFB 1B2RA 5LYJA 3DWEX 1N1DA 3EXIB 1G6Q1 4UHEA 3LVBA 4YLGA 2X23A 1Z63A 4AY5A 4GXNA 2EFYA 4F86A 3PFIA 1QVVA 3M6VA 3H4TA 5DV9A 2N0SA 2FWAA 4DLUA 4UHDA 3FDXA 2CL6X 4QL3A 1KI8A 1A1SA 1Y3FE 2G06A 1YI0A 4BX9A 1IDN1 1RYHA 1S2NA 4QBKA 4BMXA 5KKCA 1G41A 2AOTB 3PPIA 3JD1A 4FZJA 4C0HA 4WKCA 1YRWA 3BGSA 2IYAA 4K6FA 4ZVMA 5BPFA 5K8VA 2OHOA 3RJTA 1IXKA 5GADl 3WWZA 4DLVA 5FQOA 1AB6A 1E64A 2IHJA 2JAPA 4P4SB 1M2NA 3VFDA 3ZGNA 4KZPA 1I2BA 3REOA 3F3MA 4Q9LA 3JRXA 2VJQA 1UPXA 4FDVA 4M9RA 5KB3A 3OH8A 4EY8A 2FX5A 3COYA 4KWHA 2PUCA 3H6HA 4OU5A 4NABA 4QYTA 4XWWA 1M5TA 3MUEA 1RWQA 1NIJA 3O03A 4GZMA 2C58A 4OKSA 1TYAE 4KU4A 1HMPA 1XX6A 2P68A 5EZSA 2HI0A 1KJ8A 2VJLA 1L5SA 3M5PA 4DZZA 3B60A 3WK4A 2AJBA 4H9GA 1HYBA 5FP0A 4DR6B 1NU6A 1UEJA 1PT8A 1CIVA 2CZCA 1IN4A 2LNDA 3S1SA 1C9NA 2WAXA 3MILA 3IA2A 1A2OA 1TZJA 2ZBDA 4IMJB 2EOAA 4FM9A 1XEFA 3UO8B 4DJFC 2A33A 2DCUA 2CLCX 3PQFA 3NASA 4EHLA 3UTDA 2HLHA 3Q6MA 3UGKA 2AZMA 1AKNA 1XC7A 1ZK3A 2Z4RA 2ZREA 3BICA 3JATB 3M4JA 4Q0MA 3AVWA 4NDZA 1WXIA 3V4OA 1F6DA 3NRBA 2VJAA 1LBIA 1MG0A 1Y7HA 1Z4JA 3FR8A 4B87A 1GN8A 3HA2A 3CF0A 3M81A 4COKA 2W2NA 4RPJA 4DG8A 2R68A 4MJXA 1OU4A 1T9BA 3DLHA 1ZNYA 2W8ZA 3OUZA 4XQ0A 3THSA 3TQHA 4ZOLF 3VR6A 3T41A 3PPWA 4AG6A 1GZ4A 1YB7A 3KR9A 4P1ZA 4Q9AA 1T6BY 4XUDA 2PHZA 1ETHA 2XUOA 3NC0C 3INRA 4GDFA 3ILXA 4RZIA 2OBYA 4NCIA 4UNIA 2BGRA 2VQEB 4JVNA 4DNPA 3CEHA 4IOMA 1A69A 3A06A 3SY8A 5F7ZA 3ER8A 5CFMA 4UJ5A 2X5XA 1T4CB 2D2EA 2VPIA 1EGQA 1FS4A 3EPKA 3NXKA 3BVPA 4L3WA 2NZXA 4BU1A 2QX8A 1A9XB 1NJFA 3HFGA 3RTEA 3PRYA 1U1DA 3N05A 3LIPA 3E22A 1JBEA 1W8DA 4CT5A 1XPOA 1DAPA 3CBGA 4I1IA 4OJQA 5TQVA 2ACEA 1GG8A 2F9FA 2LCIA 2CFIA 2AZTA 4ZEOA 5C46F 4GHWA 4V02A 1TAGA 3RJMA 5BV1A 4DA9A 4ZGBA 4UUPA 4DWOA 3TOCA 1LS6A 3CZRA 3AESA 1TNDA 4ZO7A 5KVQA 4ENSA 4JR0A 3QIAA 4LFAB 3NM5A 4TMFA 4WUVA 2GJSA 4B0PA 4RVNA 4W82A 7MDHA 3ROKA 2C2GA 4PF1A 4TX1A 2GEFA 2I54A 2QQGA 2A1UA 4LHSA 4PICA 4IDNA 4DY4A 3K6SB 1FQJA 1SIBE 3PXUA 2OAP1 2P90A 1QBKC 1RSZA 3OO1A 1AHHA 1H42A 3FNQA 1NVBA 1ZA1A 2CBGA 3K9CA 4QTZA 3OKPA 5CVUA 1OCEA 3BIOA 4BE9A 5KPJA 3N8IA 4DCVA 1QM5A 4NBNA 3ZDXB 1DAFA 4WXPA 5BV8A 2Q6OA 3O8NA 3EZLA 2XUQA 3TSOA 3CEAA 3X1DA 4EYGA 2ECKA 3DPSA 5JHHB 4QVIA 1Q92A 2YRWA 3ZLJA 2Z2ZA 2JIMA 4MVJM 2NUAA 5KWJA 4C3ZA 4AXXA 2K2WA 3ESAA 3BCSA 1OAOC 5DMXA 3P2YA 3BJIC 2CE2X 1X9GA 2W2LA 4YJDA 2ESRA 1J6UA 1HSOA 4BNFA 1A72A 1R3DA 1YE5A 2PFGA 3N74A 1YL7A 1EK5A 1G21A 2OCAA 3AWDA 1NN1A 1JBKA 3H2YA 3IP9A 4YDRA 2O2JA 1BA2A 3SG0A 4Z7OB 2V54A 4QYMA 2CL0X 3GNSA 5JTUA 1M6VA 1EWVA 4GC5A 3GEMA 5DLQC 4FZ3A 4LBVA 1IK6A 4ATNA 1U4SA 4YTEA 2DR2A 2IS6A 3K8YA 4FDUA 2XTAA 3T7DA 5HSGA 1BX0A 4MA0A 1V8FA 2BH9A 1T2UA 3DQPA 3MTBA 5EHGA 3PQ2A 1U98A 1F7VA 3GGSA 3AUJB 3P2JA 5ADWA 4E4YA 4HFJA 1JXMA 1NDQA 2V3WA 4BZWA 1J2YA 3C1UA 2ZBQA 1GR1A 3ODGA 4PCLA 5BPHA 4MW1A 2WSMA 1E98A 1XRPA 3P2KA 1E6EA 3PCTA 3BHMA 4MWTA 1T9DA 3GG9A 3HY3A 4MW7A 3MT9A 4I8DA 1E2LA 1NMEA 1A76A 1LGYA 4OH1A 3KQLA 5FI0B 5L3RA 1HDXA 1WVGA 2FFBA 2NXEA 1BWPA 3CZ9A 5B36A 1PWEA 2ZSAA 4JB0A 3Q0IA 1DUVG 1XWFA 5DLPA 4AS3A 1MX5A 4BRZA 1O6ZA 1P74A 4GKAA 1CULC 2IHVA 3H5AA 1ZK2A 3A27A 2A1TS 3WHLA 4M9XA 4GGOA 1NVEA 4WIAA 2Q4OA 2CDAA 4M54A 4HQNA 3FZGA 1S8OA 1V1MB 3VU9B 5IARA 3CR3C 2G09A 1FDTA 4NLLA 4Y1RA 2C4NA 3OOWA 1EM6A 3C43A 5ITZA 1URPA 3EHDA 1OVGA 2PANA 1UT8A 3PZRA 3C8DA 4PO8A 4Q7EA 1MZPA 2FN9A 2XBUA 2F1RA 1YL5A 1E99A 1P73A 2C5SA 3UJ7A 1SHJA 3B3JA 4JUIA 1L5HB 2YHAA 4CFYA 3DLBA 3OTHA 5IJ0A 3IUYA 1N2SA 2MSNA 1RVV1 2FP4B 3NM6B 4UZSA 5JAIA 3WZMA 2R9VA 3I9LA 2HKIA 1M8FA 1VI2A 1C9YA 3JAWA 4KUGA 5KWIA 5FB3A 3M70A 4O1IA 1IEXA 4UFOA 4BASA 3WLKX 3MRXA 3NHMA 1KYXA 1Y37A 3SHWA 5BUQA 4IHAA 4RJJA 5FEUA 4R3WA 1K4YA 4ZVQA 4E5VA 5LDGA 1W5BA 1NTRA 2WWTA 2YV2A 2HIHA 2XUZA 2VP2A 3F1KA 4NSNA 4KPFC 3P9YA 2BKVA 4Q82A 1B73A 1VKOA 4Y6LA 3PIRA 1AHPA 3O91A 4MVJI 4OATA 5GM2A 1INLA 4ZVOA 3D3WB 3GYBA 3TQOA 5CB6A 2YXPX 1F60A 4I81A 3D2BA 1QFJA 3ZHQA 5LQJA 2PCJA 3INGA 4BRWA 1KAMA 1PNTA 4YDSA 4FI3F 3E1KA 1QAQA 2O5EA 4BBPA 1KSFX 1HY3A 3F98A 2Q3EA 2Y1XA 3HR8A 5FNZA 2CE7A 2QW8A 2PEZA 4JA2A 1MORA 1UKAA 2CLLB 2P9EA 4XUGB 1HRDA 4A1FA 5KYKA 3T61A 5EVCA 3WP1B 3V46A 5JSZB 4UMFA 2QI9F 2WIAA 3AW8A 3COPA 3FTDA 1FK8A 4K9DA 3K9WA 1KMCA 3I9MA 1ETUA 4PS1A 4FYXA 3MF4A 3ZGOA 3PJDA 2GA8A 3GJ3A 4D9IA 4RZ3A 2BY4A 1AIPA 1STOA 2AMYA 4B44A 4EJ2A 4LC1A 3SF0A 1C7FA 1T5IA 2HCBA 4GS5A 2GUWA 1QHXA 3VNQA 1KMHA 3U62A 3UKOA 1QP0A 3G0IA 3TECE 5BYKA 1B42A 4F7WA 2Z5VA 5LD2C 1L5GB 4K9PA 3CVUA 5SY4A 1QGED 1THTA 2I6SA 4PHTA 3OEHA 2RHJA 5HVNA 1V5GA 4IJVA 1SKUA 4MR8A 3TDMA 1PT6A 2B7BA 5D3MB 1CEYA 3WP0A 4YUXA 2F1KA 1X15A 2BGNA 1F17A 4LC9A 3ZCXA 3QYFA 4LGYA 2ZIWB 2YBEA 3SEAA 2XWJI 1QDLB 1XROA 4JVMA 3BFVA 5CPBA 1Z8FA 2FSFA 3H5NA 4MP8A 3HPQA 4MRSA 3WJAA 4NCKA 4LF5B 4KMSA 1QCZA 2B1JA 1JKIA 2REQA 3L93A 3LHSA 1G7CA 2OHFA 2PG3A 2R6ZA 3OE7D 2VQ3A 4IH1A 3QKIA 1BMQA 2EG9A 1CZHA 1UEXC 4N7MA 4WFQA 1IUKA 4TUYF 4XDGA 1QX4A 4DV4B 2Q3FA 4O4JF 3WYBA 3ZI4A 2CHGA 4GOMD 3N7AA 4WFKA 3H83A 3NWPA 5ALKA 3Q3GE 3HSKA 4D2IA 4BFWA 1MIOA 1Q7EA 1EJ6A 3G88A 4JL5A 1K63A 5GP1A 2WWRA 1ADYA 1H8HD 1K7YA 1GL3A 1XAGA 3JQBC 3Q0EA 4DQDA 1XRMA 3C16C 4B6JA 2O5CA 2FGKA 2Q2VA 2JFNA 1BA3A 1L3CA 2V9PA 4B6QA 4PS0A 4C4ZA 3O4VA 5CBKA 1BMDA 2HA3A 3PV0A 2IY8A 4ER7A 4MQEA 4ZVNA 4CN8A 4CMIB 2QQ5A 3F6EX 5F2NA 1V41E 2NZYA 4R40A 1LBQA 4FSHA 1I7SB 4MULA 3U09A 2PT5A 1QP4A 1WG8A 3P9ZA 1MCZA 1SU8A 1XDWA 4ML3A 4TYPA 1JQKA 4X7MA 1KRXA 1X7WB 2PGOA 1NJ1A 3JQ7B 2PS1A 2HAEA 2K6GA 4G9EA 2LCFA 4IJ5A 4IBOA 2HHCA 5K8JB 3FHTA 2QN7A 2GCNA 3MG9A 3GLHA 1FQKA 3VNVA 4J9VA 4UUBA 2X8AA 4YLEA 2P4EA 4I50F 3UMRA 1J20A 2AL7A 2IE0A 3M1YA 4YMHA 4DMKA 1DADA 2I71A 1IQ0A 3QX9A 1A95A 2F8SA 4YRRA 3C5HA 2RSLA 2FMFA 1GZ3A 3DYVA 1CUAA 1HQKA 2CBXA 3WRXC 4BGEA 1PZFA 4EO4A 4YRZA 1NXSA 3LPDA 5EE5B 2IYEA 1T4BA 1Y98A 5LQKA 2JW5A 4MUJA 2ZTMA 5A7FA 1PTJA 1XELA 3D7RA 1U2DC 3MBIA 3ORFA 3PQ3A 1GG5A 1KI7A 4IDFA 4PBRA 1Z0DA 1NATA 1H2XA 3CMMA 1SOVA 4KG7A 4MR7A 1ECPA 2Y0CA 3GCXA 3ZWNA 2XKJE 5JJLA 5JSUA 1WQ1R 3ENKA 3QXJA 1RXSA 2FDXA 4RNDB 6LDHA 4OX9Y 2DR3A 2B21A 1P1KA 1ZVJA 3RU7A 3KXPA 4ZZ0A 4CZ2A 3DBRB 1CQJA 4MWCA 4RH3A 2LXNA 4KQJA 4TL8A 1A88A 2A84A 4POAA 1SVOA 2RH8A 2OQ2A 3EZ7A 2ZK7A 2FMKA 2ARKA 3G5LA 1C81A 3H4MA 2A9VA 3EFOB 4P6VF 4ZOLA 5KYXB 3EGIA 4DSTA 4FHCA 5GONF 4TLDA 5JXJA 4JC8A 5H70A 3ZKAA 2NZVG 2AEFA 2Q62A 3C5EA 3F9CA 3H8JA 4GXRA 3DZBA 1QR2A 5C8XA 2WAMA 4M1ZA 1AUOA 1Z0JA 4TPKA 2COKA 1NDHA 3K2QA 2VAPA 3T9AA 1H2BA 1GEEA 1Y33E 2EQBA 1U9YA 1UEIA 2Z09A 2QV0A 4JDPA 2JGMA 2QRVA 4ITVA 3S6JA 5JAUA 4BDSA 2C20A 2IZ1A 3BWMA 4L9SA 1UR5A 2LDXA 2FOLA 3R5XA 4CMIA 1ODSA 3NORA 1BKSB 1B76A 5EXEA 3RHTA 2ZU0C 3BIWA 2ZUUA 2HCTA 3L8GA 4PZEA 4INAA 1MT3A 1E5LA 2ANCA 3B1YA 1AHIA 1GADO 2RKOA 1GRCA 3GFRA 4GLOA 2X2FA 1ZH8A 3K9LA 5CX1B 1E2GA 4I4TB 4ABYA 4HEJA 1BDMA 4O3MA 1Y6GA 4JY7A 3UY4A 4F56A 1N2ZA 1BC5A 3RVLA 4DMLA 3DDUA 5PNTA 2IS1A 1CY6A 5B6JA 1G55A 1G9SA 1LKZA 3SN6A 1UJMA 3ZIAA 2WYIA 3X44A 4A91A 1RXUA 2G8LA 1F0YA 2BPOA 2QN1A 3LIIA 5A9RA 5TVKA 2L0XA 3LUHA 3UATA 4CEIA 3T7JA 1T3ZA 1HG1A 4P84A 4RULA 5KS2A 2X8JA 1CU1A 2VHZA 3AERA 2REQB 3KNZA 1HZZA 1UFRA 5J63A 5MN6A 1VTKA 2GYYA 3JWHA 3K9BA 4QAJA 2BTOA 5G0SA 4EATA 5DNUA 1R0SA 1SCUB 1T0HB 3C48A 1REQB 2ZE5A 4HF7A 3H1PA 1CERA 3P0RA 3CNBA 2GLTA 2QP9X 5I8ZA 4UXIA 3BL8A 4EMBA 3AVTA 1JLRA