3KQYA

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-7-ol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqyA00
3GXOA 3MB5A 3KPJA 5K0JA 4QDKA 5IH3A 3NJRA 2C7QA 3B3JA 2IDJA 5EEGA 3TKYA 3GCZA 4RWZA 3DOUA 5LQCA 3BXOA 3UJBA 3TLJA 4RTPA 5DM1A 8MHTA 5LQUA 1R00A 4XCXA 3G88A 4YUWA 2NNWB 4KDCA 1P91A 3NDJA 4F86A 5DWQA 2ZBPA 2ZLBA 3BWBA 2PJDA 2B9EA 2Z6QA 4QQKA 1WXWA 4FZVA 4PGGA 3TOSA 2N47A 4FT2A 3HCDA 2ADMA 2C7RA 5GIPE 3LCCA 5F2NA 4R6WA 2JHCA 5LR6A 3LDFA 5HEKA 2PWPA 3OZRA 3UZUA 1O54A 4HGZA 3THSA 1BOOA 2O07A 3P2KA 3G8AA 1O9HA 3I5UA 1MJFA 5EEHA 2G70A 5CVEA 3FYCA 5GINE 1ZGJA 3OU7A 4E32A 2OY0A 4FT4A 5E9WA 4R6XA 2BM8A 5EIFA 2AVDA 3HTXA 3NMUF 3KQQA 4GF5A 4O29A 3SXJA 4C06A 3IHTA 3CJTA 2AN3A 2P41A 3UFBA 1WG8A 2UYQA 5EHIA 4C08A 3KQSA 4R8RA 4QPNA 5K0EA 4MWZA 1KP9A 9MHTA 1WZNA 5CVDA 4E30A 4YV1A 3ERCA 3DXXA 1XDUA 2UYHA 4AZTA 2AOTB 2ZWVA 3C3YA 4EMSA 4PIPA 3FTEA 2FPOA 4A6DA 5K0LA 2YXEA 1M6EX 3BKWA 3HCAA 2PXAA 1G60A 5FQOA 4CTJA 3H2BA 3FZGA 1VLMA 4X1OA 1BHJA 3KQOA 3G7UA 3OZSA 5GP1A 4QPPA 4RSRA 1P1BA 3DP7A 5DPMA 4YUZA 3BGIA 2GLUA 2VDUE 1SUSA 3CVOA 3GO4A 3MHTA 4PCLA 4HH4A 1H1DA 4YUVA 1QAOA 2ZVJA 5K0NA 1N7IA 2OB2A 1VP3A 2NP6A 3FUWA 3VYWA 1JR4A 1KYZA 1VBFA 2QM3A 3LL7A 5CM2Z 1JG2A 3M6VA 3P9CA 3RODA 1R8YA 3OE4A 3OFJA 5G02A 3LDGA 3CGGA 3ME5A 1FPQA 1EG2A 5T6BA 3TR6A 4C04A 2GAFA 1NW3A 1QANA 3HCFA 1JG1A 5DSXA 3FYDA 4RTNA 1NW8A 2XVMA 2WK1A 3LKZA 1XJ5A 1YZHA 2K4MA 2AOTA 1O9GA 4RX1A 1JQ3A 5DXJA 5T67A 2C7PA 1HNNA 4PYLA 5EZSA 4AZVA 2JG3A 3UA3A 5FWAA 4BLUA 3P9NA 4EQZA 4HRAA 1KPGA 5K0FA 5KYGA 2AOUA 2P35A 2VDVE 3NWEA 5K0GA 5DTMA 2P7IA 4RVDA 3MTIA 4IKPA 5K09A 3EPPA 4NECA 2PXXA 3QV2A 4YUYA 3P71T 3VSEA 2VS1A 3LECA 4E2WA 5CCXA 4CTKA 3M6XA 4ISCA 4P7KA 1SQFA 3HCEA 2AN4A 5E9QA 3TMAA 1UIRA 4GOMD 4RTMA 2ORED 3OZTA 4RVGA 4E33A 3O4FA 4PIMA 3CBGA 5MHTA 2WA1A 3DTNA 4PCAA 3BZBA 1I9GA 2ONZA 4CXMA 1G55A 3RIEA 4YMHA 4CWAA 5EPEA 1KR5A 1RJFA 3KR1A 4LWOA 4OX9Y 2FRXA 5K05A 4ER5A 2PX8A 3ELUA 2ESRA 3B7PA 3TFWA 3M6WA 2XYRA 3U81A 2O57A 3AWIA 1IM8A 1KIAA 2O06A 3E23A 2PLWA 5FA5A 1KYWA 4EVIA 2ZTHA 3R9XB 3LCUA 3TM4A 1NV8A 4PONA 2AVNA 3AJDA 3EMDA 4XUDA 2UYCA 1XVAA 4HC4A 4PGHA 4MTLA 3ELYA 5EKUA 3SR4A 5JUWA 5K8VA 5KQRA 5E1BA 4RTQA 3NTVA 1JG4A 3FRIA 3REOA 1RJEA 4RV9A 2YQZA 3HEMA 4IV0A 3LDUA 5CVJA 2CKDA 1UWVA 2O0LA 2YXLA 2NXNA 2BR4A 4DZRA 5CUQA 2OXTA 3K6RA 3P8ZA 5FADA 3E05A 3UA4A 5HOQA 3KQPA 3GIWA 1X1DA 5LQAA 3B89A 2ONYA 3GRRA 2BZGA 4DA4A 3EVCA 3PFGA 2QE6A 2R6ZA 5LSAA 2OO3A 3V97A 1EJ0A 3CCFA 3GRZA 2G72A 4PYMA 3KPVA 2ZZKA 5EOVA 1R6AA 5H02A 3GU3A 4EKGA 1G8AA 5K0BA 5GM1A 4E31A 1OR8A 1JG3A 2ZSUA 2B78A 3KR2A 2BH2A 4A6EA 2GA9A 4BP3A 1TPYA 4UOEA 2JJQA 3AXSA 2VDWA 4M36A 4P58A 3A26A 4AZWA 2EJTA 3KR9A 2AOVA 3KR0A 3MTEA 3MCTA 4PWYA 5KS2A 4QQNA 4PYNA 5CVUA 5HIMA 2I6GA 3LGAA 2IP2A 5BP7A 4CKCA 3TQSA 2OYRA 3SGLA 2UZ4A 7MHTA 3A7EA 1NW5A 1AQJA 4KIGA 1YF3A 2B2CA 2I62A 2ZBRA 4PYQA 3SVZA 3C0KA 5DX0A 3T7TA 3M70A 3IV6A 3ER9A 4QVGA 3KPYA 3D2LA 5HFJA 4C05A 1INLA 1RI4A 1RJDA 2P3QA 2WA2A 3G8BA 4BP1A 3KQYA 1EJ6A 3GWZA 4ER3A 2HWKA 3P97A 10MHA 3EEOA 3EVDA 2ZW9A 2AOXA 3DULA 2R3SA 4EK9A 2JH8A 4MIKA 2PY6A 2YUIA 2OKCA 2ZWAA 2B25A 1QAQA 2EX4A 5DRTA 5EMKA 3UJDA 2OBFA 2C7OA 5GOZA 2EFJA 1KXZA 1PJZA 5P8WA 4DQ0A 5K0CA 1XCLA 4G56A 3BT7A 4HGYA 4IV8A 3FTCA 4U7PB 5EKXA 5FTWA 3X0DA 3KPWA 2AOUB 3A7DA 2YVLA 1ZHFA 3FUTA 1JSXA 4E70A 1JTFA 1SKMA 2HV9A 1L3CA 3O7WA 4ER7A 2Y1WA 1DUSA 3E7PA 3OU6A 1L9KA 1WY7A 3DR5A 2ZCJA 1BKYA 3C6MA 3HNRA 1WS6A 3LPMA 5DLYA 3ER8A 4B17A 1QZZA 3A4TA 4AX8A 4PNEA 3I64A 4U7TB 4DM3A 1NE2A 1XDZA 2DPMA 4RTSA 2EJUA 3ANXA 3OU2A 4LG1A 3FRHA 5ERGB 1YUBA 1QAMA 2IFTA 4GC5A 3A27A 5E1MA 3FTFA 3OCJA 2QRVB 1P1CA 2XYVA 2PXCA 3EVZA 5BXYA 1EQAA 2NXEA 3DUWA 3G2OA 2ZZNA 2GPYA 1VE3A 3UBTA 5BW5A 5D1HA 3P2IA 3ID6C 4KDRA 4KVZA 1KPHA 2PX4A 5DM2A 1B42A 5HILA 2IH5A 1X1CA 5DM0A 5EC8A 5M5BA 3BGDA 1L3IA 2GH1A 2VP3A 3G2PA 5E9JA 5FULA 3I53A 3E8SA 4L7VA 3LHDA 3GGDA 3HCBA 1F38A 4CKEA 1ZGAA 5DRYA 4POOA 2CMGA 2NYUA 3KQMA 3LCVB 3PB3A 4PYOA 4LWPA 2IDKA 2PT9A 3I58A 1R18A 2Y1XA 2V7EA 2P40A 3HA7A 4FSDA 2CWWA 3JWGA 4F85A 3SSOA 4QDJA 4MQ4A 4X61A 2V74B 3I9FA 5K03A 3HVKA 4M38A 4XUCA 3KU1A 5EMLA 3PVCA 2YXDA 3MGGA 4QTTB 3R0QA 2YX1A 5EMMA 1FP2A 5E1OA 5B1SA 1Y8CA 3DMHA 2QRVA 2PV0A 3IYLW 1M0EA 3KPUA 3BWMA 3P2EA 5E8RA 2ZIFA 3M33A 2YR0A 2AS0A 3BUSA 3QOWA 2PT6A 3A25A 4E2XA 3GRUA 2JHPA 3OPNA 1D2HA 1Q0SA 2BR3A 3CJQA 3WSTA 2PWYA 3P9IA 5KVAA 1IY9A 1IXKA 3FUUA 3BKXA 4DCGA 2BM9A 4GUAA 4KIFA 1D2CA 3PS9A 3MERA 4OBWA 3GDHA 4GOND 4FSXA 4R8SA 4E2ZA 1NW7A 4GOOD 3G2QA 5DT2A 4DMGA 3T0IA 2IH2A 3EVAA 2VZ9A 4AZSA 1RI1A 5DTRA 5C9ZA 2G1PA 5BW4A 1N2XA 3B5IA 5CIYA 1L1EA 3T7SA 1UFKA 1NT2A 3G2MA 1NBHA 2I9KA 2HNKA 1M6YA 1Z3CA 5D1NA 5EMJA 4YV0A 2JH9A 3GNLA 4Z2YA 4BLWA 4C07A 4M37A 5CD1A 5F2KA 1DCTA 2AR0A 3UJ6A 5ICCA 4K6MA 3O31A 2XYQA 2AN5A 5GWXA 4E2YA 5ICFA 3GRVA 5EVJA 5U4XA 3UWPA 2BR5A 2P8JA 1XXLA 4Y30A 3HM2A 4ATNA 3MCZA 5FA8A 1D2GA 5LQJA 2YTZA 3KQVA 2Z6UA 2IPXA 3EVBA 5EQJB 4ZTBA 2AZTA 1XDSA 2KW5A 3HA5A 4RTLA 3DMFA 1ZQ9A 2FK8A 3C3PA 5F2OA 3R24A 4EKIA 1F3LA 5KQSA 3BGVA 2FCAA 3PX2A 4OA8A 2ERCA 3B3FA 4YMGA 3TRKA 1R8XA 1VP9A 3SSNA 4X63A 5HIJA 3Q87B 3THRA 5DM4A 3Q7EA 1JSZA 2H11A 4QVKA 3BWYA 5GM2A 3T7RA 3SX0A 4DCMA 2NP7A 2PVCA 1SQGA 4FP9A 2OPBA 1SG9A 3S68A 2HMYB 4F84A 3QOXA 2LD4A 4RTRA 5FQNA 3G5TA 4DF3A 2NXJA 4P7FA 3KKZA 1NKVA 1X1BA 2GS9A 3ELWA 3EVEA 5EG5A 3L8DA 4X41A 2EG5A 2QY6A 5LQNA 3NWBA 5CVVA 5FUBA 1YB2A 2Z6AA 3PTAA 2ZIGA 5HIIA 1YFLA 3EMBA 4GC9A 3NVMB 3TPZA 1RJGA 2PX2A 3FPEA 4LECA 3PX3A 3FPHA 2ZBQA 3HA3A 3BWCA 1RI5A 4FR0A 1JQEA 4H0NA 3DXYA 3IEIA 2GB4A 3DXZA 2JHAA 5HZMA 4ER0A 2ZIEA 1N7JA 5E2AA 3UJAA 4KW7A 1FJXA 4KWCA 5EIWA 3HCCA 1L3BA 3LBFA 3P9KA 1PRYA 1T43A 1EAMA 2P7HA 3AY0A 3SSMA 2HR1A 2A14A 4C4AA 3V8VA 1ORIA 1AV6A 1DL5A 2DULA 1NW6A 2G71A 4MHTA 1X19A 3B3GA 3ELDA 3NDIA 4YUXA 5GIOE 4RTJA 4RVHA 1KHHA 1SVUA 4HG2A 3DH0A 1P39A 3ORHA 5FWDA 3R3HA 5C0OE 4RVFA 3LX6A 1RI2A 4AUKA 2PX5A 2B3TA 4GQBA 3CC8A 3HVHA 3KQTA 3KQWA 3F4KA 3FPFA 3EGIA 3HVJA 2F8LA 3LBYA 5T64A 1EIZA 3FTDA 3KHKA 1G38A 2ZULA 1JTEA 2UYOA 3GJYA 1JQDA 3EEYA 1RI3A 4GEKA 3NW9A 4HTFB 5ICEA 2PKWA 3TM5A 5K01A 5CCBA 3NVKI 3GRYA 2H00A 3EVGA 3MQ2A 2CMHA 3M4XA 1TW2A 1WXXA 2ZZMA 4FGZA 4KRGA 4FS8A 2I7CA 3LSTA 3PLAE 3UJCA 4RTOA 1AQIA 3PT9A 1VL5A 1KPIA 4PYJA 1VIDA 5DX8A 3HVIA 3JWHA 5EZQA 4P7JA 4R05A 4Y2HA 1BC5A 3UJ7A 5LQKA 3EVFA 1G6Q1 3MAGA 5FHRA 5JR3A 3FUXA 5DTQA 3JWJA 4JXJA 4PINA 4OQDA 2PBFA 2OB1A 1QYRA 2QYOA 1I1NA 3K0BA 1VQ1A 5HIKA 1YZ3A 2IIPA 2OZVA 4V0RA 5E1DA 5LQRA 1FP1D 3R6TA 4PYIA 4BLVA 2HTEA 3CJRA 4OA5A 4WXHA 3FPGA 1Q0TA 4HTFA 1MHTA 2PSSA 4X60A 2ZFUA 3OFKA 1I4WA 3G89A 3RW9A 1ZG3A 4M7RA 2IGTA 3TKAA 1R74A 4BY9E 4V0QA 3SMQA 2PGXA 3EGVA 1FBNA 3G5LA 5EGSA 5FHQA 3OE5A 4ER6A 3HP7A 4QTUB 5DX1A 3FUVA 5E8JA 1YFJA 2FHPA 1SUIA 3VC2A 1AF7A 2E5WA 4OQEA 4YV2A 3SM3A 2FK7A 2NXCA 2IBSA 5DXAA 2IH4A 3M6UA 3LKDA 3VC1A 4WVLA 1X1AA 2H1RA 4CKBA 5ICGA 1ZKDA 5IKMA 1XCJA 1NV9A 3DLIA 3DMGA 3AXTA 4RTKA 4GOLD 4IWNA 2AOWA 2P3OA 3FPJA 5DSTA 1TW3A 4C03A 3UJ9A 1XTPA 2IBTA 1ORHA 1HMYA 2G8NA 2O05A 3JWIA 4HSGA 3CKKA 4P7GA 2Q41A 4PYKA 4DKJA 2XBMA 3DLCA 1V39A 5C1IA 1NBIA 2CL5A 3EGEA 4XUEA 1VPTA 4OBXA 4GBED 4RYLA 2P1DA 2FYTA 5E2BA 5EHGA 2P3LA 1G8SA 2XVAA 5FCDA 1U2ZA 3UJ8A 3PFHA 3C6KA
chains in the Genus database with same CATH superfamily
1E66A 1MJGA 1PAUA 3MINB 3TVYA 4YDHB 3UAVA 2QN9A 3WBBA 1NVUQ 2GLXA 3ACDA 3TL3A 2C7QA 1WNFA 2I3GA 4PQRA 3E9CA 4BVEA 1WCWA 5CDHA 4XIJA 1N34B 2YQ5A 3FPBA 1VI6A 1P73A 1MCZA 4M6WA 5KU1A 3UJBA 2J4DA 2IXTA 2XYGA 4WWHA 3TXXA 5H7XA 4KV7A 1C50A 2BAGA 3OMWA 1K5HA 1P9RA 5IU6A 5CB0A 3E9QA 3MWEB 3LY5A 4GW3A 1TAUA 1WXWA 2GF0A 1QG4A 3PENA 4MWCA 3FDXA 1R5NA 4KX5A 5EUQB 3U1VA 4R6WA 1XNGA 4WERA 1N25A 3QFSA 1YKSA 2Q8NA 3QHQA 3VXKA 5HK9A 4F9FA 2CXSA 4ILKA 3O0DA 4WCFA 1G19A 5JS6A 2QGFA 2AUNA 3ON5A 4OUDA 4QOFA 1N7GA 4FT4A 2V58A 4D25A 4EQ6A 4PY2A 1PWYE 2BTOA 3ZEAA 1E3WB 3CNEA 1L7XA 2PH7A 2DSTA 4I2VA 1NKTA 1E2GA 1KKLA 5CVDA 5I9LA 4QBIA 4BBZA 2H3EA 1SK8A 4DT1B 1Y80A 1MQ9A 1UWLA 1LFAA 3OC0A 1ODTC 2C84A 3OZCA 2YXEA 1M6EX 1QHEA 3NO4A 4RQUA 2C94A 3L82B 5GGXA 1K9VF 2XZTA 3W04A 1W5SA 2W4QA 5JCOC 4OV6B 2VOJA 5JXIA 3SBEA 4QGBA 5DE3A 1DXYA 1WULS 5K8VA 1JQ5A 2ILVA 1OA1A 3ESBA 3HBMA 4L27A 4AJEA 4DB4A 5NLLA 4MICA 2D8MA 3H86A 1YHNA 3HZRA 3OFND 3DZFA 3S6JA 3RIXA 1VMAA 1EUYA 3K5HA 3EXG2 3NBAA 1UK6A 5E4YA 1AN0A 4E15A 1TCBA 1YS4A 2AKYA 5BR8B 2BJHA 2O8EA 4YALA 5CFQA 4AULA 4XDHA 1BQ4A 5CB4F 2QL7A 4PNEA 3KFVA 2YHIA 4N5MA 2AOTA 2JK1A 2F64A 4JU8A 5JG7A 4CKBB 4CVNA 4B7AA 3FTQA 3N2ZB 4DLLA 5KX5B 1T6XA 3K0AA 3A4LA 3S3TA 3CF6R 4EMTA 3PKZA 4I5EA 1ISJA 2EC5A 2BV3A 2G7MC 2HRQA 1VMKA 1UBOS 3GOHA 1TD9A 2RGBA 1R37A 1HYQA 4ZREA 3M6XA 3AVVA 2G5PA 1KO8A 2GRAA 4E6PA 1K9SA 4IHJB 2DR3A 3VSDA 3T3HA 4P3KA 3ZC3A 2HK6A 3PHLA 4INZA 3I01A 5AW2A 1BE1A 1H66A 1QQTA 4LJSA 4UE2A 1YB6A 1PZNA 3BH0A 1CUZA 3I4FA 4U5QA 1WPRA 1IUOA 1UKBA 1X39A 4XWWA 1F2DA 4BJ3A 1B6RA 2CE2X 1YDHA 1DAKA 3M6WA 1NR1A 4OSOA 3R7NA 4LDNA 3V7UA 4F8JA 3HV2A 4D9NA 5JWRA 4UNRA 1OZAA 3ANLA 1E7SA 4G5GA 1QK5A 1TRHA 3TM4A 5CM9C 3QEMB 1LBIA 2CKMA 2UYCA 1XVAA 3HCWA 3M89A 3QMPA 3X43A 1O6GA 3DLAA 3TO5A 1R4MB 5ALDA 1O77A 3FH0A 1QKIA 3OWOA 1IN8A 1M66A 2GK3A 5BMVB 5LKRA 1ZESA 3TX2A 4ARIA 1Q19A 5C1OA 3UMVA 5J23A 1IYZA 1EFAA 4XYGA 4IP0A 5DYNA 3HJCA 4XQ9A 4F9EA 1QG2A 3OA0A 2EFCB 2CUNA 4IV0A 5CH8A 2B7LA 1CDEA 4FKMA 3ROFA 1IG3A 2L0XA 4BV9A 2RH4A 1R9NA 1JBKA 2CJWB 2X8AA 4ZZ1A 3I28A 4M86A 3RROA 3AFIA 3CNOA 4I4IA 3ZHUA 1XZLA 1DWQA 3AM4A 3Q85A 2OLEA 3D0KA 1Y4AE 3TOXA 3BAZA 4K9KA 1IN5A 3W5VA 4BVGA 2A5FA 1LLCA 1YVUA 4E1BA 1Z6GA 1HFKA 3GLTA 2QF7A 1HYHA 2YY6A 2OUIA 4Q24A 2C77A 3V97A 1SCJA 2ZWPA 1SFRA 3EXEB 5EOVA 1RVV1 3DLHA 3BTUA 3OJ0A 2QPTA 2A2ZA 4JR0A 4K3VA 3G1TA 3UMYA 2CVPA 1GTZA 4GZMA 4A6EA 4P0TA 4BP3A 4E5PA 1UPAA 1TUBB 1JHVA 5K0LA 4MI9A 3GA7A 4N0DA 3UUFA 1U8TA 2J30A 1S7GA 3V48A 1O94A 2A94A 4GPEA 4ENTA 4JV5B 2V8BA 3R7AA 1JLKA 3DAOA 3M7IA 2GUWA 5J5VA 1XA3A 2B2CA 1D3AA 1PZGA 1KMIY 3BVPA 1FTWA 1KZGB 1W6RA 3IBSA 3ZX4A 5BNWA 3AOEC 1CR4A 2YMPA 3QG5A 1H93A 2FDRA 2X9VA 4IY1A 5HFJA 4MR7B 2QROA 4MUFA 1T5OA 3ZCXA 2F1KA 1KAEA 5BN4B 1KU6A 1FEZA 4UKDA 10MHA 2C57A 4EGFA 2Z8ZA 3MMPA 3EVDA 1NQ5A 4Z2AA 2RJ3A 1BDHA 4ZODA 1YRWA 3IOYA 1JP7A 3Q0EA 3GRFA 2YHBA 2WHRA 2WMNB 3E8MA 4OL9A 2UXCB 3HU5A 4ISBA 2V7QD 1ORTA 3Q5EA 3KTAB 3AINA 1ZGGA 4X93A 3PC3A 5TJ9A 1OXTA 3UCXA 2BY4A 5A6SA 5C46F 3R7WB 3I6MA 2ZAIA 1TF5A 2IZ1A 5B57C 3KYDA 2WHPB 1WM1A 2V96A 1QRDA 1USKA 1KIFA 3UH0A 2WIAA 4WAUA 4GRIA 1L3CA 3F8TA 1DUSA 1U2SA 5K3CA 4O4JF 1WZUA 2FPKA 3T4XA 1XEXB 1MKYA 4HNVA 4Q3NA 1QG0A 3I64A 1JFVA 1YQTA 1WL8A 4DA8A 2J3HA 2C5HA 2GVNA 3FPAA 3DKRA 3KKKA 4ZEWA 2ZYSA 3T7KA 3TN7A 3V8EA 4BMNA 3MGAA 4LTMA 4TS3A 1SBNE 1SU6A 4I3FA 4QYMA 1NTOA 4W1PA 2R00C 2WPNA 3AFGA 5BXYA 5KNCD 2J5XA 4FQ7A 3BOSA 1UXGA 4IRMA 4KUHA 2O8FB 1BWQA 1SBYA 4TKVB 1WXHA 2GPYA 2JZCA 2WAOA 4KO8A 4YC7A 4TLLB 1GL6A 4WBXC 5CW1A 4E5MA 1RC1A 3DFMA 5GPBA 1U2PA 2YIJA 4C9BA 3RRXA 4EATA 5DM0A 2DBVO 4AN4A 2IPAB 4B45A 5IHPA 4GD3Q 5A3QA 5LIPA 2EKZA 2PX3A 1SXGA 1JDTA 1OBOA 3RSQA 2ZJZA 4C22A 2Y0EA 1S96A 2F3UA 3K6KA 1N2GA 5J2UB 2PZGA 4MP8A 2VUSA 3TLZA 4N48A 3U39A 1PVVA 2QW1A 2QL9A 5FB3A 4EB8A 4X61A 4XQCA 3HVKA 2GCEA 1D1SA 1XNQB 4QTTB 3VOBA 3PEUA 4ZYWA 4RCYA 4YAKA 5JYCA 1A1SA 3NEJA 1PX0A 3N70A 4FR5A 4LYEA 2EVWX 4RK5A 4ACAA 5ETJA 3IQEA 3L06A 3OLXA 5FD8A 3LQ4A 1ISFA 2I2CA 1Q92A 4MQLA 4BFVA 1II9A 5YASA 3BWDD 4UXIA 3C7TA 5KHAA 3GLKA 1IXYA 2GCGA 1NVXQ 5LZ2A 1T35A 1MMFB 1X9HA 4I55F 1ZFNA 1VMIA 4FFWA 4EF4A 4DLZA 4OBWA 3LQ1A 2E1PA 1XEFA 5C8YF 1W36C 4Q02A 1R15A 4LRWA 3EY9A 3OPVA 1NY6A 4WFIA 4UDYX 5KYWB 4UTVA 3HUFA 3ITNA 4FX2A 3TE6A 5KBYA 1D04A 3LWZA 5DNCA 1UJ2A 4HVAA 1DTWB 1GTSA 2WSIA 3BMXA 1TFUA 3DCNA 3V4OA 2TMYA 1JJ7A 4YMTA 4BLWA 1UPCA 4Y2TA 2NO6A 1U9CA 4KQEA 1I2BA 1YS9A 4E2FA 3KYCB 2GJ8A 4JOQA 1XROA 2DKNA 3A2KA 5JRJA 5ERYA 1FYEA 2EP7A 3KJGA 2QRGA 3JVUA 1JR3D 4CMIA 4FZ5A 3LHKA 2ANCA 1QBKC 4CM8B 1IULA 4R69A 5A9SB 1W4ZA 4NV0A 4LPKA 1FLNA 1CY2A 4X65B 1E2EA 4RTLA 4CMEC 3A6KA 3R24A 3QE9Y 4RPKA 2R48A 2R86A 3AG6A 3BQMB 5IJ9A 1JKMA 1JHXA 3KVVA 1EX7A 4ITRC 4O2AB 2XNDA 2Y05A 3Q2KA 4DLBA 3IE1A 1CF9A 2BVNA 2SCUB 3HFGA 1M6HA 1JSZA 4DA0A 2F90A 2YY7A 3A1UA 1H1TA 4CMCA 3MELA 2QM0A 4DHWA 2BFDB 2C0QA 2E4XA 1L5LA 3AB8A 5THXA 1IWBB 1K7XB 4RF2A 4S05A 4B3HA 3HKCB 3COZA 3QGMA 4KOEC 4MEAA 1Q3TA 4DRXA 3VTAA 3IP3A 5C35A 1TJYA 2E6UX 1H23A 4DM4A 2GN4A 4MIEA 5F52A 1ISHA 5LM3A 1I13A 4YDSA 2R1TA 1U1EA 4BGIA 4XR9A 4OAOA 2ZIGA 1PDWA 3RM3A 2GRUA 3MINA 3O8LA 4FDVA 3GRAA 2PRIA 3NC1C 3LUGA 4TKLA 2J0EA 5BRNA 3TRDA 3VKVA 1FP4A 2QM7A 3EISA 4ODIA 5LYYA 4WGGA 3O75A 1QIGA 1L7DA 1MRNA 3ESZA 3M6LA 1SHKA 4KW7A 1AK2A 3HJBA 4TUYA 5EIWA 3U3OA 5KYNA 2QUJA 3FNGA 4DE5A 1TAHA 1EGHA 3IPRA 4RE6A 1SU8A 2OAP1 1QM5A 3CZ5A 3HKDA 1LTQA 2IDZA 3WYGA 4H7DA 3WIEA 5FUMA 3WGMA 3GDOA 5EZYB 1L5GB 1ZSYA 3L0PA 4HUQA 3K9FC 4ZC1A 3MWEA 4FGSA 4M1MA 3RRFA 1E6KA 4PTZA 4UDNA 1G3IA 3LVFO 4O2BF 1G21A 1JQJC 1Q6YA 2V0NA 1EX6A 3GLHB 2QVBA 2PHZA 2WYOA 4S3MA 4KOAA 2QE7D 2EX0A 1TQ4A 2IUYA 2G5TA 3KAJA 3D1VA 4URUR 2CV2A 2EOAA 1WHTB 3GVHA 3B6JA 1Y3FE 2WE8A 4YRKA 1JQDA 1GNPA 2IXDA 4K88A 2ZI4A 5TEWA 2RARA 3ZE7A 3UXEA 2D0PB 3AESA 1MO3A 4ID9A 4IDNA 4IRUB 4JC8A 3ZWQA 4A5OA 4ZIRB 2Q2NA 2GEVA 2YWRA 2V4ZA 2O7VA 3L05A 1M2HA 4K03A 5F7ZA 2GN9A 3M6MD 3PT9A 3Q5GA 1A96A 2AV6A 2Q28A 3X3HA 1CJKC 4MGHA 4AB1A 4HDQB 1VPEA 4FW8A 2ZIVB 4ML3A 4Y67A 4BO9A 2PLFA 1EE9A 1EFLA 3OZXA 2IYYA 3U3DA 4BIMA 3PEYA 1LNSA 3UY4A 2PA0A 4BQRA 1UPUA 5DTQA 3JATA 4PINA 2FQ1A 3AF5A 4D8YA 3DE2X 1QYRA 4WXMA 2BFPA 1IHXA 3T0GA 2AYZA 2DHCA 2IEBA 3IFSA 1E5QA 4KH0A 3VVCA 5M34A 1I10A 3ZDRA 2EXXA 1QIMA 1P1IA 3IJRA 2JLRA 1WMSA 4XEUA 5CK5A 4DR4B 2P2GA 5F35A 4GGMX 1C9NA 3N6VA 2J6IA 4N9WA 4P98A 4Z4FA 5BWMA 1GIAA 1K5GA 3UGKA 1KTVA 2PKQO 3FSGD 3IMEA 4WTOA 4V0QA 2PGOA 2ZVPX 4O4LA 5HMMA 3RIMA 4L72A 2RI1A 4QTUB 1UIMA 4QODA 3AHGA 2DT8A 2QOEA 2FGKA 1CJSA 1LPOA 2CFIA 1T5LA 2X6QA 2ZTVA 1AF7A 3I04M 3DEZA 4OATA 3UCEA 4JIGA 4R68A 4NQZA 5JH7B 2PZAA 2H1SA 4W6QA 3M6UA 1GSIA 3NKVA 4CKBA 4XDYA 3JWEA 3KQLA 1G9TA 4KREA 1JEEA 2V8OA 2QJWA 2VT7A 1SOVA 4NNPA 4TTIA 1RYNA 2OECA 5IKMA 3QI2A 3DV0B 3TLCA 3VYTB 3TVDA 1C3EA 5E7JA 3H1FA 1Z75A 1EESA 4N6OA 4PYKA 2FWMX 2HCJB 5B5SA 4EL0A 1GAEO 1DIOB 1LPPA 1NBIA 3ZHOA 4PFQA 2HPHA 4DIUA 1WF3A 4JDUA 4Q03A 4RSGA 2WSBA 4PIVA 4NAVA 2DLDA 2ZQYA 5DBEX 3RDPA 3HXQA 1FNDA 3QP9A 4DNFA 2G1AA 1SD2A 1BEUB 2GYVA 1SUCA 1VCOA 2O5VA 2Y71A 3PFHA 4I4LA 4IHJA 4V2UA 4YCSA 1ABBA 1SCAA 1ZZEA 2CJFA 1E9BA 1NHWA 2IP4A 2W0MA 5J1TB 4ZPXA 3SAJA 2RGUA 4M8NE 4JD5A 1JRLA 5IH3A 4KR0A 4W5JA 3U7EB 3EASA 1YMVA 3WLSA 2AR9A 1UJCA 2O2HA 3BIOA 2P62A 2I55A 4KU4A 4OVKA 3VUEA 1DRVA 3OMXA 2IJGX 3FZYA 4KYVA 1JTVA 1DXOA 4QDTA 4MUHA 1R00A 3IOMA 1B8VA 5EPUA 3QEMA 4KDCA 1PFVA 2VXBA 4RETA 5FTLA 1W2WB 3IAS6 1Q50A 1Z4MA 4FLEA 4QQKA 4J0EA 3AF0A 2ES4A 5EIAA 2ZXFA 2PWZA 1NYLA 4DLPA 5F5XA 1T25A 1MZVA 1T8UA 4OHCA 2EEPA 4MKHA 3FD8A 4PRZA 4Q3KA 5KOIA 1SKBA 4GI5A 2YYAA 1QHHB 2IE8A 2O0HA 3H04A 1J49A 3HUUA 3O7MA 3ISTA 5DHTA 3CLUD 4PBRA 1Z34A 1NX9A 3NTRA 3RRYA 4TSFD 2H4XA 1W44A 3PQDA 3LWBA 5EIFA 4NYIQ 4DSUA 4GRDA 2L17A 3TRJA 4L9SA 4LDPA 3OAAD 3ZV4A 4BXOB 2GR9A 4R7TA 3N9IA 1G5PA 1FQOA 4NMWA 4V0OA 4DDHA 4FDAA 1ZL2A 5A06A 1KGSA 2BC9A 2MHCA 4YV1A 4FGJA 4WNAB 4MDFA 2XQGA 4GYYA 4IMPA 3C3YA 1UDRA 2ZPUA 3IE0A 3NATA 3QTBA 2EZ8A 4ZD6A 2YJ5A 1P74A 4S1OA 5FEUA 3BKWA 3TLKA 3IBCA 1YACA 5CCDA 4JX8A 4PLTA 4V0NA 1SVMA 3U6KA 4ENWA 4C0AC 1OBCA 4EMBA 1NNUA 2WLTA 2W8BA 3G7UA 5ES4B 3C8DA 1X3LA 4HOYA 4QYIB 5FLEX 1QGDA 3ZHZA 4Z6KA 1TQ6A 2BDTA 5B1IA 5CBKA 2RGNC 4MR7A 1B23P 2BSXA 3FOCA 4J0IA 4IINA 3T4EA 3HN6A 1FFCA 1XRSB 3AL0C 2AD1A 2ZXUA 1KYZA 2FWBA 2J6BA 1FFHA 1KMNA 1TA0A 3ENZA 4MUJA 5CVCA 4L7QA 4WECA 4XYEA 3ROKA 4BKOA 1SCKA 4DFDA 5C81A 5CT4A 1A04A 2GI4A 1BRMA 1T10A 2L2QA 1W52X 2YYSA 4I99A 1Z0DA 4UPDA 3IE2A 3KTAA 2B5WA 1H6AA 1PL0A 1IRIA 1Y63A 4RD6A 3R7WA 2Z30A 5DYWA 1SVSA 3HJUA 4FMDB 2WHPA 3I9OA 1DFHA 2NTYC 1WXFA 2EKPA 4WH0A 4WOJA 3PUYA 3OFNA 2C00A 3MTIA 5D3MA 3KWLA 2KE5A 1D7AA 4PGFA 3LECA 3EVNA 3L93A 5CCXA 1XU9A 4CTKA 4RKWA 4FLMA 1XEXA 4Q4AB 3O4FA 4G5XA 2ZE7A 3D3NA 4MS3B 1UFRA 4K9QA 1GTMA 3BZBA 2PH5A 4ON9A 1ZCAA 3PFWO 1AC5A 3RIEA 3V2HA 2VHEA 4J9UE 4CWAA 3VYVA 2HUPA 2DBZA 1XB2A 3R6DA 5K05A 1RCUA 5ALRA 5T41A 4CKXA 1QVWA 1D0IA 1ZOSA 2FRDA 2HIHA 2ZRPA 1FXSA 4KO2S 2XYRA 4DCJA 4N6NA 1EVKA 2Q1YA 2O8FA 4ZYXA 4TKVA 2J6HA 2V4MA 4OHRA 1XNJA 3A37A 4NE2A 2I78A 2OLJA 4ZI5A 1YTUA 1YKGA 4PRKA 3V46A 2F8SA 1OBHA 2ZRKA 3IHKA 3NH6A 3NT2A 1WOMA 1XCPA 4ETIA 5LFAA 4KVAA 1IDN1 4M7PA 3S8YA 1MRSA 1XAHA 4UTXA 1YZQA 1YI1A 2QZPA 2CK3D 1GGNA 1K08A 2AXPA 1T8WA 1WB9A 4KK3A 3SJZA 4NWIA 4N8EA 1J0EA 1M2JA 2BE7A 1JVNA 2BBSA 3B9QA 4P35A 5T8KC 2YVUA 3MWFA 1IZ8A 3HKBB 5SZKB 2ZRFA 1HRKA 2R8PA 2X23A 2A84A 1Q7GA 1X1DA 5H16A 3CEPB 2B5OA 4DA4A 4LJ8A 3V2GA 4COKA 3NR2A 1MX3A 2GEFA 3IAM1 4R1TA 1U2DA 2P2NA 1ZINA 3F0TA 5AVOA 1VA5A 5F2EA 3ZCPA 4X7BA 3WVNA 1WHSB 2AMYA 1SGWA 2QDXA 1T0IA 2WYWA 3B7GA 4RM2A 3SHVA 1TPYA 4WACA 4QICA 2W42A 3WKAA 3TGPA 2PRYA 4L22A 1Z5GA 5LCXA 3KR9A 3EK2A 1E4EA 2P75A 1O0CA 1MXFA 5CH3A 3I9V6 3KOXA 4OXKA 4YDQA 1LDYA 5H70A 3OBBA 4HNQA 4CF6A 2OVFA 2PS0A 3HCNA 3DFKA 4EVRA 3FOFC 1GAXA 1OW3B 1W85B 3D7LA 3GJ3A 4NX2A 1DTWA 1BRTA 2FSUA 1KQNA 4AMUA 4CLEA 5I3CA 3KLPX 4UOQA 5AQ1A 3NAMA 3ER9A 1ISPA 3CM0A 3KPYA 1JUDA 1XDGA 4A9AA 1INLA 4C05A 3KOZA 3SP1A 1QJ4A 1NL3A 3BCHA 3AO0B 1RKUA 1Y37A 2QRJA 3CE6A 3LRXA 4IOLA 1Z4PX 3WMXA 2R6CA 1WCXA 2FP4A 3NBYC 2PK3A 3ILSA 2NZYA 4IDOA 4J16A 3KYCA 2FEMA 3SDBA 3ULKA 4EW1A 3D3JA 2QRKA 3NNNA 1BJKA 2NT3A 3KDPA 5EMNA 2AOXA 3DS8A 3DULA 4TM8A 1T8TA 1C1XB 2G1JA 3RT9A 4F91B 5DGHA 4P80A 5TEVA 1L8XA 1NJFA 1XKQA 4OO3A 4CM8A 1GQSA 5DLEA 121PA 2PX0A 3UAZA 4EG0A 1NVKA 2Q5LA 3N2LA 2G36A 3QWHA 3OICA 4ZHQF 3U48A 3OX1A 1XCLA 4B47A 2PUGA 1UOEA 2HPZA 3KS9A 1Z5WA 4JI4B 4LDJA 1Y4DE 2DSNA 3HYLA 3LC2O 3WGQA 4BWFB 1I2MA 2OK8A 2YY5A 3PUJA 4GPZA 2CBGA 3DA8A 4QHSA 4L4UA 2WJ4A 3FGOA 3DAFA 1EKXA 1I0ZA 1P7ZA 1YAJA 2A1IA 2QN7A 3N05A 5DI3B 1MC8A 2SCUA 5F5NA 1L9KA 1QYXA 1MQSA 1D4ZA 4L74A 5DZSA 5C1PA 3LX8A 4FOTA 1GITA 1R4ZA 1WMDA 1XHFA 1WV0A 2J87A 3A4TA 4YK7A 2V6JA 1T1GA 3R4CA 3F7OA 1HOXA 3W34A 3WKBA 5JEDA 3ESYA 3W2IA 6ABPA 2MWMA 3D2AA 3HKCA 1S2NA 4XVQA 4GDFA 2PSEA 1DHRA 2OORA 3A3NA 1WXGA 4H59A 4NCNA 1ENPA 2BDEA 3DB1A 4AN1A 4AJLA 1ANKA 4D0GA 2J09A 3I4CA 1GFSA 1CZOA 2BBWA 2VTEA 1KYXA 1WUYA 3K09A 2F1IA 3OIVA 2WD8A 3KL2A 5C7OO 4UNSA 4IMJB 4RBNA 1EWRA 1DQPA 4RZSA 3WIDA 5A5VA 4EZIA 4GOJA 1DRWA 3VTFA 1OWMA 5FFNA 3V34A 2IH5A 1GA1A 1RQPA 2X2FA 3P4YA 5BUSA 2B61A 1Z4KA 1BDMA 2I6FA 2X4DA 1M9NA 2QJOA 3BGDA 3VKGA 3P94A 2WIDA 2GO1A 1QX3A 1KAHA 3L6EA 3EDQA 3I8SA 4QU8A 1X7WA 4BV2A 1SIOA 5K0TA 2CNBA 1KFBB 3R6WA 2YVAA 2D1TA 2VKTA 3MBIA 4LNAA 2ZVDA 4M88A 4D9KA 1T1JA 3PTZA 1ABEA 3BX1A 3G0CA 1TMKA 1Y1KE 4YRQA 3PB3A 5C3UA 4G09A 4FNGA 3FDZB 4BRWA 4RVCA 2OQVA 4E5NA 2R4UA 3MGKA 1TA4A 3GLHA 2E4AA 3LK7A 1U2EA 1N75A 1YB5A 2ACWA 3ZCTA 2YX1A 4DV0B 2VBIA 3JRXA 5SYMA 1W93A 4LAFA 1VIAA 1CFZA 5LD2C 3GRPA 3P2EA 1NVVR 1D07A 4E1AA 2KYRA 1QZXA 4DLUA 4XB1A 4R8VA 2Q4EA 1PBTA 5BQXA 1E3QA 3AETA 3QMMA 3QX7A 1Y6JA 4YRNA 4JR2A 1NN5A 1Z37A 4B73A 4LV5B 1O4VA 3F5FA 5EP2A 4DYVA 2OVBA 3IBYA 1A76A 1CT9A 5CA1A 4EKDA 1KQOA 2P0AA 4FSXA 4Z9XA 4WKGA 2CZQA 4E2ZA 4ALNA 1M8KA 3R2JA 4FCWA 4DEYA 1XOIA 2ZKIA 4MVCA 3BB3A 1AO3A 4UTZA 1FE8A 3VBEA 1PEYA 3IUMA 3O83A 4XQEA 3TD9A 3FDFA 1J0CA 3KDAA 4AQ7A 2OHHA 4IIJB 4ZXPA 2ZBDA 4R1QA 5IAOA 1XVIA 3DNPA 3OY2A 2XAUA 4WN9B 4UU1A 3IR5A 4L8LA 3TMKA 2M1ZA 1UJNA 2BZ0A 1NI5A 5CHEA 1YQQA 3HB1A 4ND3A 1YZTA 1FJ2A 4LI0A 3D59A 1ODCA 1JEAA 3DDWA 2PQ6A 2HU8A 1CQJA 3PIDA 1A50B 1Z0SA 2VUIB 1HV8A 1X15A 3Q3EA 1MEOA 5J9FA 1F2VA 1Q74A 1X2EA 4H3SA 4JWTA 5JJ5A 1KI1A 4Y9RA 1C4OA 3R0XA 5BUCA 5IJZA 1FXWA 2Z56A 2X5KO 3C1UA 3FTPA 1U2QA 2CLDX 4YRAA 2VJBA 3I9KA 1ZOLA 2AG5A 2BUBA 3DMFA 3JQ8A 2FPIB 4HDNA 4RXMA 4D3ZA 4H1HA 3AQ4A 2NAFA 3IDQA 2VJCA 3Q3CA 2VEDA 5I01A 4BDSA 2ZB2A 4QJIA 1XIVA 2VDPB 1VXRA 2CYAA 3FM9A 4QNMA 4WOBA 5JH7A 3AUXA 1Z8DA 4DJAA 5CLFA 3Q7EA 3U7GA 1BE0A 3DV0A 4X44A 1Z7YA 2QTNA 4BNKA 1DG9A 3PGJA 4GG1A 3H6HA 1KAQA 4D5GA 2Q0SA 2W7TA 1QK4A 4TSRA 4OHFA 4RLSA 4RZXA 4CCSA 3DM9B 4UUQA 3ZCRA 2Z83A 1A2KC 2IZZA 1YUNA 3IQGX 2ZK7A 1ZR2A 1RYFA 2BGTA 3RASA 1TKBA 4B4OA 4YT4A 1X8KA 3N2GB 2R1ZA 3FHLA 2JGKA 5BOVA 4B4WA 1T5DX 1ZCJA 2VH5R 3LPNA 4O2LA 5ICSA 1QP0A 1RJGA 4X85A 5T3YA 5LP1A 4LJRA 3ECSA 4NTZA 1P60A 4ZTUB 2I8LA 1RWOA 2W83A 1EU1A 4EX7A 1FS4A 1D6JA 3QUAA 1NJSA 3T99A 4C2TA 1EVLA 2CJXA 3VOSA 4BDTA 2BJWA 2P9JA 3DBOB 4JLMA 3A58B 1Z8HA 3LBFA 4NZOA 4D82A 5AM5A 1NRXA 2QBYA 3EZNA 2IYEA 4DLVA 4Z7NB 3TTUA 1DS6A 4TKZA 1DL5A 4F4CA 1SBQA 2G71A 3VVMA 4Q7JB 2AE1A 3RS5A 3PXEA 4F1JA 2JHFA 4Y2SA 4M9CA 2A35A 5FWDA 2ZRQA 3ORHA 2HIAA 2VWPA 3C3EA 3LQFA 4U6NA 5CIQA 3LX6A 5DGIA 3N3AC 4GP6A 4D6PA 3FPSA 2VK1A 3ZV7A 4GP9A 5C5DA 1CDDA 1GVHA 4F2DA 5IAKA 4ZK2A 1COWA 3KQWA 1QHHA 4XZ3A 2GPTA 3EGIA 1G38A 4KWTA 4MVJH 2O7SA 1KI4A 1HFJA 1B0ZA 4Z86A 3RGGA 1W46A 4O0LA 2FMFA 2QB5A 3TTWA 1SCNE 1DTEA 2PKWA 3OX3A 4D9BA 2Z1NA 3OT1B 1B6TA 1ONSA 1ENYA 2WABA 2XKAA 3ICWA 5AJWA 4F6CA 1S8AA 1HDIA 4OIFA 2QE7A 3HS3A 4QTZA 1MGPA 4W9RA 4Q9DA 4O5OA 5MF6A 4NU0A 3ZD8A 1IBSA 3DVRX 4HWTA 1E7RA 3E7WA 1BE8A 1N6LA 3EEFA 1U8EA 4WNAA 3RJMA 1K27A 4BMOB 4RLHA 2G82A 1J42A 2GKOA 1V8FA 4Y0NA 4UM9B 2W6QA 3CGWA 4R0NA 3EDOA 1PCXA 4LE1A 2PBFA 3SFTA 3U3JA 3ZGLA 2E85A 3SC4A 2W6ID 3PCRB 3LW8A 5K0CA 1XA0A 1HSZA 3SI7A 4V0RA 4D8VA 4EGJA 2HTFA 1UK7A 2NNLD 1NYQA 2VBCA 4BLVA 4NOKA 1L5QA 4KTVE 4B40A 5ITWA 1KQFA 5AIBA 1GEEA 2Y1FA 4FN4A 3U62A 2GZ2A 3LJKA 4WXPA 2IGTA 4DQDA 3L6CA 4IDCA 4GQAA 2JI6A 5KDDA 3PQ5A 1NMYA 1X77A 4K2AA 3HP7A 4PFKA 1EEHA 5JPDA 2DOKA 3B12A 4IPTA 1NX6A 3FKSD 5H0IA 2YV1A 4DZZA 3CZAA 3OQPA 1GP2A 5H3CA 1NURA 1ZL0A 4QGFA 1ATIA 1ST2A 5JDCC 4BBPA 4ZGBA 4QLOA 2C5BA 3ZU4A 2R8ZA 3B70A 3ZWAA 4B4DA 5A4JA 3VOAA 5A7HA 3AXTA 4JYPA 1POWA 4QXOA 3R5KA 3OQ1A 5LMCA 1TW3A 1NR5A 5FOUA 5DW0A 1NXXA 2CDCA 2DQSA 2QD1A 2ZRGA 3PP8A 4HSGA 5CNKA 1KEEB 3PIRA 1GCAA 4C4RA 3FR7A 2ZOSA 2CL5A 5JAOA 4DAEA 3AF2A 3NC0C 3BXZA 2FYTA 1SD1A 3AT1A 1H2AS 2P3LA 4Q4AA 3IQWA 3P0RA 3SZ3A 1N5JA 2J9FA 5KNLA 3KYIB 4B09A 1K86A 4OF4A 2O2EA 2ZUSA 4QDKA 4WY2A 3SQDA 3TSZA 4ZOLF 4ALJA 2C4VA 3LIPA 4KN6A 3WC4A 2J3MA 4WZAB 3NRCA 3GYGA 3UT5B 4GX5A 3TXYA 1KJQA 1LI7A 1KOLA 2J4FA 1OFVA 2ZPTX 1Q5PA 3IHLA 1AG9A 4AROA 8MHTA 5ER6A 5KJCA 4I6GA 4BAUA 3HRHA 4ND8A 4S12A 5SY9A 4F1KA 4NKRA 3NDJA 4IL5A 3VHXA 4F86A 4XD7D 3SFZA 4R7GA 1LWNA 3PQ4A 4F3YA 2Z6QA 4B3RB 2VDLB 5F77A 3NOVA 3K3PA 3TFQA 1NOKA 2GJAA 2IY8A 3FVVA 5EQFA 5BOSB 1IZ0A 3F6BX 3U40A 4IEEA 1IN4A 1QFZA 3O82A 2NVOA 3R3XA 1DE0A 4LQ4A 4NEHB 4GI3A 4UZEA 3SZLA 2C5FA 3HN2A 4TL7A 3W9UA 4A6XA 2VPPA 3FVQA 2ONCA 3NIFB 2PWPA 1JE0A 1YZNA 2ECQA 4JQSA 3OZRA 1XNHA 1O54A 1QPZA 2WIFA 3W2HA 5IANA 3EQ6A 4LZAA 4NHEA 1K7CA 2ZQ5A 1X7ZB 3T9EA 3NH9A 2FXIA 4IYJA 4RZ2A 3TRHA 4C0SA 2CSUA 1R88A 2BT4A 2AN3A 4FDMA 5GVSA 1Z2DA 2OHXA 3F6EX 1BDIA 3DZKA 4B85A 1CRZA 1PJQA 4GM0A 1DIBA 5EVCA 5MN4A 1F5NA 1H0RA 3AJ9A 3AGPA 3ZV5A 1CX9B 4HWPA 3ERCA 5ARBA 2Q3MA 5B58C 3C48A 4CMJA 2A9QA 2X6RA 2XADA 1JAZA 2ETVA 2FPOA 2OR3A 3BXFA 4O6VA 2OV2A 5I5GA 4TSFA 4KQ1A 4HLUA 2WJPA 4ZWNA 4N5DA 1M2NA 1WWKA 4TS9A 1L7NA 1GGMA 1W9MA 2AK2A 3HU1A 5H4GA 4BKPA 1P4AA 3MT0A 1W85A 3OAAA 5B3JA 2V3WA 4QPPA 1CVLA 1M54A 1ILEA 3A9VA 2VEOA 4FKBA 4N0PA 3AW9A 1U2GA 4YUVA 4FSHA 3D6HA 3EH2A 4UBNA 4YXWD 1L5WA 4NFYA 3OD1A 1PT6A 3ZGOA 3QYPA 2EIXA 1E9FA 1UAAA 4LK2A 5DOVA 5JZSA 1E2FA 4L08A 1DCMA 3F90A 5IC4A 4QM6A 4HGOA 4PLWA 5DSXA 2WWWA 2HDWA 3MNFA 3T4PA 3WZMA 2KMLA 5JZ9A 4HDAA 1MABB 2XHEA 4FGWA 1Z15A 4D9CA 2WFZA 3SHFA 1TJ3A 3UA3A 2FEPA 3BRWD 2D0OB 3LQYA 3OEED 1T26A 1NMXA 2WU4A 1Q91A 3MGBA 3O1IC 4US0R 4L8GA 5CYGA 2QIOA 3N07A 2C95A 2PXXA 3K1AA 2J3IA 5CAEA 4EPRA 4HWGA 1JIIA 2XEXA 5FIUA 5JSZA 4B33A 1O0BA 4CV0A 4X95A 1PKXA 2JA1A 2V6BA 3GG9A 3QVOA 4PIMA 1P61B 3CBGA 3T06B 4B2IA 4OKNA 3OOJA 3GLIB 4BTLA 1CQXA 3IB6A 4KRYA 5CXQA 3NDBB 3ROQA 2B30A 1C80A 3CW9A 1O6FA 3GOQA 3V1MA 3JZDA 4DZTA 3H0EA 1RSZA 5DLDA 4FBMA 4HB2A 2AXEA 3CUSA 5KO2A 1RBYA 2D8AA 3Q9NA 5TXGA 1OTYA 2EP5A 2JBHA 4NJEA 2R85A 2UUAB 5CRIA 1IM8A 2CSXA 1TM1E 1EINA 1YR1A 4REQA 2NO9A 1NV8A 3AHDA 3C3MA 3BMOA 3V80A 3M49A 1N9ZA 2A7QA 3IJPA 4BMYA 5HR5A 3RUAA 4BNDA 2WWIA 4ZYZA 2RHHA 3A3KA 3C3AA 2HJRA 1LZKA 3B5JA 3M5PA 2CFTA 4QXMA 4UJ3A 3SC6A 3UUEA 3U44B 2ZWMA 4AC9A 1QS0A 4G84A 3RNOA 5FBVB 5L45A 2B1GA 3FRIA 4YCJA 3REOA 3Q9SA 4Q21A 1ZGZA 3USES 1EXMA 4FJ2A 4QWWA 2OLKA 1JU3A 2ZJ3A 3B2EA 4WKCA 3LDUA 1WUHS 1HFWA 1YR2A 4GX0A 8OHMA 4Z3KA 4QYWA 3GHYA 4EGSA 5EP1A 3RFCA 4GMDA 2BP7B 3HYNA 3R8FA 2O8DB 5DGTA 1Z9BA 1G4AE 5DH9A 4GR9A 5BSRA 1AS2A 1KJ8A 2BZGA 1UPTA 3JTMA 4HWRA 4ZI3A 2FW0A 5JISA 3CCFA 1ZNYA 5K0BA 1Z0FA 2ZYIA 2CK3A 1T13A 4LC9A 5C51B 3GUVA 1F8YA 1R3DA 1XF1A 3O2JA 4OJNA 4UTOA 4XTCS 3RH0A 4BYGA 1TECE 1J1ZA 3NLLA 3THWB 2CDAA 4HAXA 4BECA 2GOYA 3KR0A 1C7JA 2HF9A 2KM1A 4D3YA 4DIEA 3AV0B 4FM9A 4PSDA 2FPWA 2XWPA 4Z54A 3IPLA 1ZIYA 1T34A 2C83A 3TW8B 4UPEA 1Q83A 4GZLA 3G2LA 1GCUA 4X7MA 1N8SA 5HRCA 1PV2A 4UVIA 1TTQB 2EU8A 3IRVA 1NP7A 4X9XA 2C4UA 1KK2A 3Q4GA 4IIJA 4LGCA 4MJXA 4RD0A 3N53A 4RKQA 5KNCH 5EI5A 1EJ6A 3O6VA 4RM3A 3ZXXA 1N8NA 4DV1B 3DTVB 5K4HA 4YRSA 1Y5NA 1SUEA 2JCXA 4HATA 3VNRA 4F4IA 2X7JA 2XA9A 3KXKA 2ZJ5A 1NM5C 4DLRA 4K2HA 4EGCB 1W0KD 3QW4B 4L9WA 2OGZA 2G08A 2L19A 4NFHA 2RK3A 1UJ6A 3CISA 1NUUA 3W5SA 1UP7A 1K06A 4G37A 5EE1A 1DQSA 1NP3A 3PUWA 1HDCA 1O6ZA 3GBVA 1L9XA 3IXQA 1ZHFA 2YMQA 2FSPA 3H18A 3LM8A 4MMXB 4OQMA 1C3VA 1K0UA 2X19A 4RZQA 2OXEA 3H13A 4GZ6A 3RIGA 1FUEA 3E7PA 2D1YA 3OEYA 4DCVA 4X6UA 1C9EA 1UINA 3C6MA 1GY8A 1V8DA 3E0QA 3TCNA 4C01A 1DTSA 4CQMD 2VHUA 4YVFA 3Q7TA 3EFHA 3EBPA 1QHSA 1QNLA 5FL3A 3HL4A 1K8ZB 1NSYA 2CB0A 4ZI7B 2EJUA 2WKQA 2YRFA 1E2JA 1QH1A 1ADBA 2DP4E 2FMHA 2I99A 4IS2A 4DIDA 5KX5F 4P92A 1RLIA 2QTLA 3L7AA 1I30A 2RHLA 4J29A 2ZYDA 4AS2A 4W5OA 3URMA 3N2GA 3OCCA 3WFJA 2H4YA 4EHJA 4C6RA 1E6UA 1HRDA 5DM2A 3BREA 1FRQA 3AF4A 2DQZA 4HVTA 2IK8A 5EC8A 4C4XA 4IHJF 3G2PA 5TMEA 1TFRA 4PAOA 4HZGA 5DTEA 2O19A 4MSUA 2PL5A 5IP5A 2R6R1 1QLWA 3HJGA 4JSYA 4D45A 2ORWA 2WYHA 3FWKA 2G4LA 3F5DA 3LMKA 4GM1A 5ENDA 4P08A 1JFLA 3NTUA 4MXDA 3AGQA 2NYUA 5IF9A 4WY5A 4TL9A 3JQDA 4PQFA 4ZQEA 4JDPA 4M7WA 1CPYA 3INGA 3BA1A 3ZDXB 4FX5A 5KREA 4YQEA 3VQTA 4DDVA 1R6XA 5CNIA 4DCSA 4QDJA 2QZZA 2V74B 5EMMA 4C4OA 3JQ9C 2RG1A 1B74A 1V11B 2QTRA 4ES6A 1XMQB 2Z8YM 4FCTA 2PV0A 1UWCA 1XPJA 3KPUA 4LHSA 5IFLA 4JYZA 2PUJA 5G0VA 5BMVF 1AD2A 3PVZA 2QQ5A 2XW6A 1RJ9A 1X14A 3BUSA 3C3XA 4Q66C 5IC6A 4WD3A 3IA7A 2Q1TA 1FLVA 2PJUA 3GRUA 3ICPA 1PYGA 3HSKA 1QIHA 2V7PA 2NTVA 2H07A 1Z12A 3HR7A 1NI4B 3IUNA 2DX7A 3FUUA 2O5EA 1E2PA 4GUAA 4KIFA 1XP8A 4RABA 2GBIA 1FFGA 1MG0A 2GWHA 2B36A 4BO8A 4R8SA 5CFOA 4MV9A 1NW7A 5IABA 1II0A 3JYPA 1M34E 4FW9A 4HX5A 4LOHA 4R5MA 1HNWB 1SG6A 1QU2A 2G63A 2H5JA 3PQ3A 2G06A 1M2OA 5KTKA 5ALUA 3ZU6A 1E1NA 2C4TA 4U7FA 5B3LA 2VWQA 5TMBA 2GN6A 3G2MA 3A1DA 4V38A 1M6YA 1H2EA 4R3UC 4MKRA 5A7FA 4L3OA 4RK0A 4AURA 4P38A 2H4ZA 1W0CA 4FYIA 1E61A 3UJ6A 1VC2A 1TDJA 1Y7LA 3A04A 3GJXC 4B4KA 3I3OA 2A5GA 4HNAA 4YJ3B 3IQDB 4G5QA 5U4XA 1RZRD 1JI0A 1O5TA 4DR7B 4NHOA 1M33A 1SR8A 4J07A 5COBA 3N75A 4KHZA 5HFNA 5HPYB 5KYYB 3V33A 1D2GA 4EDFA 5CW2A 2QQ0A 3ANNA 3WIVA 1DOHA 5HGXA 3H0CA 1S9HA 5EJ7A 1X86B 2FK8A 4X3PA 1REQB 2JGAA 2VF7A 2A0YA 4IQGA 3TUIC 2C82A 5DNDA 2OBXA 5L3SA 4GX2A 4F46A 3EA4A 3T7RA 4DCMA 3CG0A 2VJYA 4PX9A 4EA8A 3PDIB 1XZFA 3ADDA 4M0MA 4Z0PA 2DT5A 3CRQA 2M9MA 1D0VA 1V1RA 3CN9A 2VJKA 3A10A 5JI2E 4DMMA 3LP6A 3A4YA 5FQNA 4OYYA 2Q4TA 1U1FA 4NULA 2R6AA 4FC7A 2WWFA 2PANA 1HTBA 1WPQA 3EFOA 4WOPA 2EG5A 5CGZA 3SMVA 1QF6A 1V1MB 3DOHA 4HAYA 3M2PA 5F1PA 2C3YA 1HLFA 3L7IA 3R1IA 2OBLA 2P5YA 1F48A 1TT5A 1YB2A 2WU0A 2PUHA 3IUQA 3K9GA 4JEIA 4JUCA 3MWGA 3ZH2A 3CLRC 3SVTA 1W4LA 2ILTA 1SC6A 3VO8A 3WSWA 1SHTX 5KQPA 1W36B 2VJNA 3BL6A 3E82A 3T15A 5ILGA 1IN6A 4WZAA 4ETMA 4DV5B 4IFEA 3UT5A 2QHXA 1DARA 4JCCA 4B7ZA 5KOHB 1F14A 2SKDA 4MARA 2IUEA 1PRYA 3AUTA 4YWHA 3FI9A 2NT4A 1G291 1TOAA 2C3PA 4RD1A 1FQKA 1QLHA 2AZMA 2WB4A 4I4NA 4HAUA 4N3NA 4B8WA 2JLAA 3T5GA 3USZA 4MGIR 1WVMA 2X9GA 3L92A 2HMSA 4H7IA 3AQIA 1U2RA 2EF0A 3ABZA 3QE0A 4K28A 1NJ1A 2DBRA 1FU4A 2IS4A 1DV2A 2Q1XA 2EG9A 3ASUA 5B2ZA 1NFRA 2WM3A 4OTZA 5FBWB 4G1CA 3NAGA 2AJ8A 4BFUA 4OXYA 4MIYA 3LZCA 1L4UA 1YVPA 1OBVA 3HVJA 1FUYB 1KOFA 1IPEA 1XJQA 1ZVQA 2KB0A 3FDJA 2H9AA 3UMRA 4Q48A 2PX6A 5GOTA 1WXIA 3H4TA 2C2MA 4YCLA 1E8DA 1PHPA 3TD2A 3MTDA 1ZM2A 4CI9A 5J2UF 4CJXA 5FH9A 3GRYA 4I2NA 2Q0HA 2FLKA 5CX1B 3W5BA 2X22A 1UMDB 1IL0A 3W6UA 5BWOA 2H54A 3RUIA 2ODEA 2H5EA 3FYUC 2PRJA 4JGGA 4JLWA 1D2AA 1W19A 3SXPA 1NU8A 3ZQ6A 4PYJA 3PNKA 1I0IA 3L4EA 5CB8A 5LA6A 5HUJA 5EAIA 2J9XB 2NO0A 3MFQA 3F7TA 2Y99A 3P9YA 4MHSA 4RL4A 5SYNA 1LQUA 1OE0A 4LVOA 4MCJA 3U13A 3MAGA 2VRNA 2OTCA 3UV7A 1UQUA 1E7YA 1X1EA 2IF2A 3KV3O 3UC5A 4IJKA 4CIVA 5KQLA 3UYLA 1B41A 2C0PA 5K8TA 4MINA 5HF5A 3QLUC 4Q6BA 4S1PA 2P30A 3BWXA 3FF1A 3RJ9A 4RDXA 1O57A 2XCIA 3WADA 4BQFA 1MVNA 2G9ZA 1M83A 3RUPA 3IAUA 4EKYA 5HIKA 4CETA 1GKKA 5U9CA 1TK3A 1IBRA 2QUZA 4IXWA 3HKEA 5IT4A 1PS0A 1XCMA 5LP6C 3JAKB 1MHTA 3LC0A 3OECA 4C3OB 5BN3B 4Z53A 3WZ2A 2XRZA 1YK1A 2Z43A 3B2NA 3W2FA 3FF4A 5FUYA 3WL7A 3A31A 3FAKA 2OD2A 3LSYA 3D6VA 1DO8A 2D5BA 2EGHA 4CUKA 2AZDA 4LYAA 3Q3IA 2Z3VA 4J0CA 1VE1A 1ORVA 1I4TD 2DC1A 4V0ME 5JPCA 1W5TA 3VC2A 1IMJA 3C8HA 4RANA 1AUVA 3SJBA 5HQ3B 5IFKA 2C31A 4YJGB 2NVUB 3SBOA 3T1NA 4UNPA 5FKJA 4D0RA 4Q4JB 1MABA 1C8BA 2FR8A 1D5WA 2E3JA 4MX8A 3NBUA 5ALHA 1M8FA 3DCJA 2AOWA 4RA9A 4J0JA 4C03A 3HC7A 2HRRA 2TYSB 2G8NA 1HMYA 5E6UB 1UJMA 2Q41A 4KXXA 1SRRA 5ALSA 4ENPA 4BWGA 3CEMA 2ZIUB 3FKSA 4RFSA 2R6DA 4YV7A 3QPWA 3OZBA 4OYLA 4L5AA 4J0KA 4AZ3A 1PE0A 1AKYA 3IQZA 4F3RA 3ENVA 3PDHA 2GM4A 3OLQA 3PF8A 2WJGA 3LGSA 5JSHA 4O2AF 4YPVA 4J1QA 3GXOA 1S3GA 3KB8A 2XGOA 3CZMA 2PH3A 3OFVA 3ZHBA 1A98A 4NCHA 2P90A 1GQRA 2QRMA 4DJ5X 3B3JA 5J2TB 5DO9A 1DGQA 3EMVA 4TQUS 2ZBUA 1TM5E 1PWZA 1XKXA 3FFAA 3GFBA 4FINA 3CO0S 1Q0HA 4KMOA 4O4IB 3L02A 3WYCA 3P19A 3ZLTA 1N2EA 3RG8A 3UW3A 4BWYA 2HJGA 1YA6A 1TM2A 5DM1A 3TBFA 3T95A 4UU0A 3OCUA 5LU9A 4NBTA 3H8WA 1GAWA 1XF9A 1YDFA 2ZDQA 1AXEA 1RQXA 2EATA 4GVLA 3GQBB 4MUGA 2LPMA 4WCVA 3ROZA 4WXRA 5F21A 5BPHA 1ZUNB 1XZJA 2ASEA 3V7WA 3U44A 4CIBA 3WHPA 5IMSA 4Q9LA 4RK7A 5BUZA 2HB6A 2XUJA 3C98A 1AMNA 1LI5A 4RHEA 1BFUA 2WPDA 4IIEA 2XXAB 4H17A 4L6IA 5DLQC 3SLGA 2FPMA 1ZK0A 5ALNA 2VDKB 3DHYA 2WM2A 1W30A 5JNRA 1GUFA 1EIWA 1CYEA 3P2KA 2DKOA 1SMKA 2A9RA 1ZJ4A 2J6CA 3JS5A 1KEPA 3OZGA 5AI5A 5EZYF 4B7UA 4DADA 3QX3A 2JD2A 4LJ9A 4DQUA 1XVVA 1Z38A 4UW9A 4F71A 4BCDA 1EK0A 3PI7A 3KK0A 4G0VA 1DBVO 5GZ6A 1V7ZA 2XSZA 3CXUA 3NHJA 1WG8A 4X6XA 1A7AA 1PSDA 4DLAA 1EQUA 2A1UA 3GFSA 3GPCA 2VZ8A 4I9NA 4TKUA 4YP5A 3IAFA 2R47A 4EMUA 1XEAA 1X0VA 4NMHA 1A8IA 1K7YA 4AUNA 4NXNB 1HZZC 3D5QA 4F9GA 5D5PA 1WTAA 1QOQB 1KVRA 3F47A 1QTNA 1H5UA 1K4MA 3H75A 1PTJA 4JS0A 3OSZA 4QFMA 1CWUA 2IPLA 4GL2A 5BORA 2WB2A 4OX9B 1PQ4A 4B6EA 3DBRA 3W2EA 5C80A 4RGBA 4LJ5A 1XFDA 4UM7A 3NHFA 3UK0A 4XWYA 1KY2A 1KP2A 4BNIA 3ZVMA 1WNTA 1SC1A 2CLKB 1JIXA 1N0VC 5JQGB 1V3VA 3AP1A 3BE6A 1IM5A 1DAIA 4LZOA 1XZEA 4DIFA 1BXKA 4PZAA 4JBNA 3AHCA 4BV3A 3I0NA 5EE9A 1Z2CA 4E08A 1ZLXA 1IIRA 1O8BA 3IDAA 2B1QA 3V2IA 5IX8A 3UWKA 1RU3A 1V4NA 4WIAA 3LVRE 1LW7A 5TV2A 5ECGC 2F9FA 2P9FA 4GE0A 1YA4A 1EG2A 1UKZA 2H08A 2ASVA 3HWX1 1GZ6A 3QK7A 1XU4A 4JODA 4LNUA 4F5YA 3HPRA 3KJFA 1U8YA 1GPWB 1VFPA 4KC0A 1O9GA 2C7PA 1CVRA 1I7DA 2EJBA 3EYAA 5ALPA 2O3JA 3UB4A 3V7NA 4MVJD 3WHLA 5G1NA 3CQ9A 2QR3A 3W4JA 2GHQA 1FU7A 2Y0BA 1U8FO 1CEQA 2HLNA 3IH5A 4XYMA 3ZI4A 3DFIA 1ILWA 1NVEA 1DC6A 1LA2A 2BKLA 4KQJA 1FXWF 1W87A 2HM7A 2VIIA 2FAXA 2VS1A 2FX5A 2NYRA 3U4HA 5HUHA 3NOQA 4DS3A 2OZKA 1SQFA 2VJPA 2AN4A 1UIRA 3Q1KA 4RVGA 3ZD6A 2J9GA 4FYWA 4IRXA 5KWIA 5BSMA 4I8XA 4HQKA 2E4YA 3T1OA 5JH7F 3J80A 1NUHA 2NSLA 3GVCA 1V48A 4MH0R 2QTFA 1I01A 3OEEA 5JCJD 1G7TA 2BL4A 1TTTA 1YO6A 3V4RA 4EGAA 4JAVC 1QWOA 3ZJ5A 1CQPA 1H4SA 1MFPA 1IHYA 2GEDA 3B7PA 4BO3A 1CY0A 1GZUA 1CJVC 1ZD3A 2C4KA 1M2FA 1X7XB 4FFVA 4M9RA 3E23A 1N6HA 2PLWA 2ZRAA 4HXYA 2HH9A 5JSUA 4TXJA 1U7XA 2R62A 5T7BA 4KX3A 1DBQA 1TZ2A 4I1IA 4W7SA 4CU5A 1V4BA 3AUUA 4F97A 2P9HA 4QAQA 4RACA 4JLNA 3NGXA 2OO5C 1JHQA 2J5RA 1N6NA 5DF1A 1EDEA 2FEKA 3IHWA 4JA2A 4Z9BA 1QIJA 2XQFA 1ZXLA 5F64A 3AOEA 3AERA 1XR3A 2WP0A 1KI8A 2WV7A 3T52A 3AI2A 4BO5A 1YCFA 2C2YA 4E12A 5H59A 4LRSB 2BMDA 3Q40A 2OXTA 2Q3CA 2XECA 5JFTA 3MWDA 5AHOA 2ZS7A 3LY9A 5FTJA 5G4LA 4H35A 2N3ZA 1KI6B 4LMBA 2GPBA 3BF8A 3BA6A 3JY6A 2ONYA 4DLWA 3JR3A 5AVXA 2QQGA 1CRLA 1G1AA 3BBPA 4HWOA 3GRZA 1T5TA 1AHHA 1VPDA 3KU4A 3KOMA 1DDOA 1XTIA 5IZCA 1HZJA 1EFPA 1P2SA 1E7WA 1T9ZA 3K4QA 3N58A 1N5IA 4F11A 5I5EA 8LDHA 2SBTA 2BH2A 1LU9A 2WKRA 4G5YA 4LNHA 1P8JA 2I6XA 4P58A 1D6MA 3A26A 4U9HS 1C9KA 3MTEA 3RC7A 1J70A 3H2GA 3RK4A 3SZOA 4F93B 4QXPA 1XX6A 5HIMA 3A1SA 2AA3A 1OA0A 5DIZA 2I6GA 1KZ4A 2WICA 4JKYA 5L40A 4X20B 4OGWA 5B6JA 4DIOA 5DK4A 1E3MA 2PKQP 1KYQA 3QTLA 3PXBA 1K88A 3FZQA 2Z5FA 2Q2WA 2Q27A 1GPDG 3KHUA 4Q37A 2QA5A 1E3JA 1CR1A 3PRJA 3F3SA 2JFYA 4BAGA 1DOAA 4N4AA 4ER3A 3WJ1A 1KO7A 4MUEA 1EFRA 5CYPA 1PFUA 4ZVSA 3VPFA 4BB0A 4PGAA 3K71B 2C9YA 3ZHRA 1U6IA 4OQZA 5CLHA 1QGYA 1RLTA 1RWQA 2AEMA 4MIKA 3GQVA 5TDHA 1PKEA 4HGNA 3K0SA 1GL7A 5A9RA 4J76A 2IX9A 5L4NA 3RAEC 2E4WA 3CKYA 3UJDA 5H83A 1M5RA 2EKBA 4JMLA 1WB6A 5KAPA 2NUAB 2GDZA 2XMDA 2QGNA 5JS7A 5KTPA 3VPSA 3GWGA 3WSVA 3S70A 3V1LA 4JLPA 2P4HX 4JCOA 1REQA 2QLFA 1JSXA 1Q7EA 3F3KA 3GFTA 3IR7A 1JTFA 3BEDA 4JI0B 3KTDA 1HL3A 3PE4A 3NHRA 4MB2A 2HLHA 3KKEA 2X14A 1NJ8A 4HCJA 2MR6A 3PDIA 1WS6A 4DQXA 4KPUA 1J8DA 2PH1A 1W0KA 3PHBE 4W1SA 4NJMA 2VPYA 3HQ4O 4KPFC 2A7XA 3TMYA 2ATCA 2ABWA 1AKQA 2PUTA 2V97A 1ZP6A 4X1YA 1LSJA 1SG0A 5G3YA 1ZH0A 3DDSA 4II7A 3EPHA 1DU4A 1GU0A 1BQEA 1W73A 3K9HA 1V1MA 1EP2B 4FMDF 3K70D 4KO4S 1VJGA 1A0OA 1JKIA 4B46A 1VE5A 5EIBD 4MO9A 3ZK9A 2NU6B 5AHWA 4DXAA 3FYTA 1QC5A 3OUTA 2I6UA 3VJLA 1KR2A 4KVZA 2F3RA 3S27A 4QYTA 2NUPB 2PX4A 3S1SA 1EA5A 1PUXA 3LKBA 5FI1B 4RC9A 4ZZ3A 1GPLA 2WKSA 1SKUA 1IM2A 3G7NA 4HN4B 5BWBA 4UCQA 4M0CA 4EG1A 5C7IO 2D6FA 2R6HA 2WSYB 1QB8A 3K05A 3LX4A 3P2YA 2OMKA 3EZGA 4MI3A 2Q7DA 5J4HA 2CMGA 3MJEA 4ZOCA 3VU8A 2QTAA 4B84A 4BBAA 5FPKA 2QNIA 1T4GA 2H4WA 3AKCA 1AKWA 4ZI7F 1N78A 2WWHA 2FE4A 1EGQA 3KSRA 3SKVA 3RRNA 4B17A 1TYAE 3D0QA 3MGGA 4PNPA 1OBFO 3P45A 1CQZA 1DDGA 2BCJQ 1A4XA 1TEHA 3DOOA 4LPSA 2YWGA 4EENA 2AX3A 2YR0A 4WDQA 3EQ8A 4JL5A 1V41E 2AF3C 1CE8B 4I4CA 2V7UA 3T7DA 2IE0A 4WESA 1L5FA 4J7XA 1IN7A 3LLMA 4WBSA 4EY5A 3RUDA 4BZXA 2EYQA 2PUBA 1CUAA 1UMDA 4HNRA 4MLPA 2XQVA 1K6XA 3MERA 4FEEA 3KL4A 2JIPA 3BH6A 1HLGA 4MKZA 4Q7LA 3NWJA 1RLJA 1T6NA 3RYFA 2IH2A 1IFXA 2EP8A 4J0HA 3T38A 1MBZA 4Q9HA 1N2XA 6LDHA 5COAA 4DR1B 2QTZA 2CYCA 3E8XA 3H5IA 3TIFA 1LEHA 2HNKA 2NN3C 4I19A 2YV2A 4D42A 4YAGA 2GCNA 1CUJA 1IAVA 3L7LA 4FEGA 1YVEI 2VUUA 4KQMA 4Y6LA 1DAOA 3H19A 1U3UA 2FFJA 1SELA 3MPUA 1AY0A 3VI4B 3CCBA 5IASA 4MA0A 3OZAA 4QUAA 1HDRA 3NYQA 1QE5A 2WSMA 1RWWA 3PWSA 5A2QA 3IKLA 4BJ6A 3IEMA 3DMRA 1QSGA 2R751 3PC8C 4QT0A 5AVUA 2WF7A 2IPXA 3SN6A 4K8RB 3ZUGA 3B1FA 2VPQA 2JI8A 4BLRA 5DOZA 3C3PA 1CP2A 4PEVA 1F3LA 4CBVA 1D5CA 1WMEA 1MUUA 2ZREA 1IZYA 2C8LA 2REXB 2EFGA 5TNXA 1QQBA 3D7MA 2NVUA 1UZNA 3W9YA 2PJRA 3KOYA 1RZRA 3LXRA 2GN1A 4LA4A 5ICMA 3BILA 3F6YA 3M4NA 1CY8A 1XLTC 1YR3A 3MCAA 1G41A 1T5BA 2IU4A 4ABYA 2Z1MA 1VPLA 3BH7A 2O54A 3TQHA 1VCNA 4QSMA 5AJXA 2IEIA 5H8WA 4BNUA 3DDCA 3R3UA 2GBLC 1HEIA 3QOXA 1X74A 3H1AA 5BW8A 5JRZA 5LD2B 3RVNA 3O95A 4KGZA 4RK6A 4ZEVA 1P33A 1NN1A 4UHJA 1VJCA 3L8DA 4FOLA 3RWOA 1U9YA 1RXSA 1TE2A 3E81A 5CMLA 3RSCA 1X1TA 2JNWA 4L0MA 4NZNA 3MFYA 4PLYA 4XJVA 1S8NA 5HYVA 1UEXC 2Q4BA 1GRVA 4RO0A 1RYYA 5A3JA 2BGLA 4Y6GB 3DZCA 1PW7A 3Q0TA 3AM5A 4WN3A 4QNNA 4XSVA 3H7IA 3DXZA 4EHAA 3FYSA 4PE5B 1N7JA 1NF9A 1ZKMA 2C1XA 2R65A 4RPJA 4L28A 4QQFA 5C34B 4UULA 5C4MA 2XUPA 3UK2A 4C3ZA 5KTMA 4B3DA 2CXUA 3FJYA 4I66A 1JE1A 4LXGA 4EJSA 1U2TA 3F78A 2DQKA 2XZDA 1W25A 4XDGA 1ZRNA 1ZSNA 1BMDA 1EFTA 3DEHA 3EIEA 1FXUA 3GQBA 3QKTA 1SVUA 5CTJA 1ZX1A 3GBPA 3IP1A 5DGXA 1U63A 3H9JA 4UUNA 1J21A 1QOZA 4NL4H 1YRBA 2X9QA 4P53A 4TL6A 2PMBA 5ES3A 3NI2A 4C89A 1HKHA 1VRVA 1CC1S 2W90A 3V8NA 1BZYA 2GBCA 5JVDB 3C4QA 3SY8A 1JQBA 2VKQA 2XXAA 5AUNB 2O1EA 4M99A 2QTHA 2X5XA 5EY5B 1H3EA 2Q5FA 3D0OA 1PNQA 3VAYA 5GJVC 3PL5A 4W1QA 3PQEA 3H11A 4ROTA 3RFUA 1WD5A 1V0JA 2VNJA 3BWVA 3ZWKA 4C2UA 1VSVA 4G8CA 3CLTC 5K01A 5JXHA 2E4UA 3EYWA 3H3XA 3B1KA 3GEBA 3MC1A 2A86A 5A5DA 6YASA 1N36B 3NBQA 3GDFA 2H00A 3ILHA 4KAXA 2I71A 4WCFC 4IG9A 1H69A 5EA2A 8ABPA 2F7SA 2X1MA 1AQIA 2VPXA 3KLOA 1DMRA 2XT6A 4ZAYA 1Q1BA 3E7XA 2CXNA 3BL5A 1F0KA 3RB8A 4X90A 1XRQA 3WLAA 4A2PA 1QQ5A 3VU1A 1WV1A 1QF7A 1TZJA 2ZR8A 1HE1C 4FCVA 4KAJA 4LSZA 1Q7BA 4JP2A 4WLNA 1OYWA 4GLOA 4OYRA 1O6BA 1K8YB 2NZWA 2EKLA 4CODB 2OV4A 5E95A 3DUFB 1S89A 1ZR4A 1P5ZB 5TT1A 1VHWA 4WBNA 4OMDA 2C8KA 3L6BA 3CJRA 2W48A 3QJ5A 3TLGB 3HM9A 4UMDA 4YRDA 1S0UA 2UZ1A 1TJPB 4BCBA 1KTIA 2EZTA 1F5SA 2P5TB 4X60A 5IXJA 1OT3A 3G89A 4OGKA 2GSWA 4BY9E 2WUDA 4PO3X 1WKCA 4H6WA 3WWEA 1B4DA 2QG4A 2Q1SA 2IZ0A 3UB2A 3IAAA 4IIJF 2FHPA 3BFPA 2VP2A 4HWSA 4UUBA 4PSVA 5BYJA 3R3YA 5JOQA 1LVGA 3HDYA 2GLTA 1SCUB 1JAXA 2AIRA 2DTXA 1AKNA 4H7EA 3LKDA 4PZ9A 4DA9A 2NYAA 3I2HA 3GEGA 1ACLA 1EXNA 1M2GA 2CLSA 3NETA 4XLTA 4B87A 4HN2A 2MOKA 4C3VA 1X94A 3IVMA 4MULA 5CBPB 1C0PA 1JQAA 3H16A 4XVHA 3T7AA 4JOCA 1CF2O 4QO7A 3TINA 3L4KA 2K6GA 3L6OO 4GKKB 3DEIA 4MWGA 1Q57A 3OOSA 3HVUA 1IY2A 3RANA 5E2BA 5DHPA 5AW4A 2VXOA 1RHKA 1TNDA 3I5MA 3X1KA 1E9RA 1T9DA 3AHFA 4Y9TA 5FCDA 5TQ2B 1Z6PA 1F60A 3VO1A 4BKMA 1ORWA 2JDID 2BGRA 3E1GA 3LG2A 1T3GA 1YBMA 3H5AA 3D3WB 4RIEA 3TQCA 1YI0A 1JJAA 3T3GA 2DE0X 1TIBA 1JH9A 3TKYA 2JJ2D 2O3RA 3GCZA 4KUGA 3SF8B 1FQWA 1LV8A 1Y1QA 2AFIB 5TS2A 2PD4A 1Q3HA 4NF2A 16PKA 1AQUA 1NUSA 3GP5A 4L07A 1QMPA 4UEJA 3I05A 4XCXA 2IHKA 4HFRA 3SPXA 4JOSA 2O0JA 3HB7A 1OUMA 2RB5A 2Z98A 4BNLA 3QV1A 1KK0A 4FZVA 2JFZA 2R6JA 1JI3A 3HCDA 1UZUA 3ADOA 3WLRA 4BGDA 3T1HB 3ZE0B 1DAMA 2J3QA 1RADA 4DEVA 1FDTA 3B9BA 2HDNB 1LPMA 1AB5A 1UM9A 3LL4A 4LJ4A 2BKVA 4KSCA 1O1YA 3ROPA 4AO8A 2QL6A 2Y2VA 2GTPA 1BVUA 2HXYA 1CDZA 4J0GA 4Q4LA 5DHSA 2VHVA 4Q9KA 5IARA 2FPGA 2G09A 5CVTA 2XUHA 2GAAA 4OJQA 2BM8A 5IDXA 1OZHA 3EPJA 4B31A 4LW8A 3JVIA 3AILA 3KJHA 4JC0A 3GELA 3UFBA 4CIXA 3WGGA 4BMCA 1CIJA 1PI3A 2ENWA 5SV2A 3WG9A 4DDWA 1BXGA 2AK3A 1GZVA 4B82A 1SUDA 4XLLA 1CUGA 3TQIA 3OEHD 2BHNA 2UZ3A 5FL7D 4AZTA 4C0LA 1PGQA 2JI7A 4O1HA 4N54A 3VR4H 1NVMB 2OFXA 3INRA 4G0QA 3PUIA 3RYHB 1II8A 4M46A 4PHCA 3GDGA 4YJ2A 4BFSA 4FXPA 1XQVA 3MCVA 2P9ZA 2E9SA 4FI3C 2I3BA 1VDZA 4Q1VA 2G77B 2V7WA 4Z3DA 2X4GA 4Q1BA 1KNXA 1M0WA 4KZPA 3PEFA 4RGVA 1WUTA 3SLKA 5GP1A 1T6BY 3DZHA 4MGEA 1CJUC 1O94C 1Q1GA 3CVOA 2EKDA 3MHTA 4W7IA 4AYTA 3R40A 1C2TA 1PJAA 2B4TO 1EM8B 4LGYA 1LK7A 5FA6A 4C7XA 3TNYA 2LP4Y 3TG2A 1IOVA 3CX8A 3AY3A 3IAHA 2ZJ7A 4C29A 2QM3A 4XASA 3UH1A 4MA5A 1SBZA 5E4TA 3OOWA 1QIEA 3QKRA 3BSSA 5C5EA 1EWVA 3OLVA 1WMAA 3WQRA 4BJHB 4D9GA 1WW2A 2XCRB 2HSZA 3HCFA 4FYHA 2BBTA 1R6VA 1GFWA 1OLXB 3JQAD 3PK0A 4V03A 5T67A 2WTAA 4RH3A 4ABTA 1EEXB 1CFJA 2DZDA 3WI7A 2RBKA 3I09A 1MX1A 2X0RA 4JBWA 2VP5A 3F5MA 4UUPA 4XE5A 1VKJA 4C6HA 5DTMA 1WTCA 2F17A 3J7TA 1CJMA 4HDRB 4ITVA 4YCBA 5HKOA 1ODFA 4WK6A 2FPLA 1IK6A 3S1AB 2JEZA 5HVNA 5EUCA 1ESCA 4KVFA 5JD3A 4AY6A 4RTMA 4X5OA 3L0SA 4E33A 1NYRA 3TAHA 2VSQA 4IVRA 1XTRA 3QU2A 3DTNA 1OH8A 3ETEA 3AZPA 2XYHA 3W6NA 4YMHA 2BRUC 1HG1A 4BVFA 4EY4A 3U80A 1PN3A 3NYIA 3OJXA 4MVJP 2R97A 4XJTA 4XM2A 2OXIA 3ZTTA 3O4HA 3TDNA 1KARA 3CUWA 4UUOA 1GZ3A 3TFWA 2IWRA 4GHWA 4H60A 4L4ZA 5ILQA 1G21E 2WG0A 4AECA 1E2HA 3AWIA 3VSAA 3QXCA 1C5KA 4JLSA 4DANA 1KYTA 5A7GA 5KIAA 5B4TA 3ZGYA 3G9XA 2X15A 4ZJYA 1DP4A 2NUPA 4G4IA 3V1KA 3ZZ0A 2OSBA 4BLQA 1CR2A 4M0UA 3SWWA 3D1LA 3AONB 1VHDA 2WM8A 4PC1A 4XOIA 1V8PA 4BNVA 1GGVA 3VTZA 1QFSA 1JFTA 4JT4A 1A9SA 5AM4A 1JG4A 1KZ6A 1D4AA 1R0KA 3GEIA 3MK31 1T8RA 2WJIA 3P4XA 1Y1LA 2EW8A 3WGOA 5M7EA 3OLCX 4QXRA 3FKQA 1TQDA 2EX1A 3PQCA 2ZIZA 4DMCA 4X45A 4ESEA 1RPZA 2P6MA 4I5DA 1JDUA 5G4KA 1S8FA 3KBBA 4OHYA 3O3OB 2N46A 1JH8A 2A1TR 3U7IA 3DKKA 1U02A 3FOBA 2QLTA 3A1VA 3VPGA 1JHOA 3EVCA 3T5CA 5FPYA 3HXPA 3AL3A 3N1UA 3R9XA 1J5XA 2JAXA 2O7QA 2ZZKA 5IK2D 4NZ9A 5H02A 3GU3A 4CMHA 3F46A 1MJ5A 4LHWA 2XUAA 4R8KA 3DNFA 1LBSA 3T12A 4UOEA 4NCIA 4XWGA 1XL1A 3SC2B 4EYOA 4BFTA 4OHOA 1CW2B 2GPWA 3KJQA 3TEFA 1NQXA 3LGAA 3TOZA 1Z33A 5I4IA 5IYZB 5K0ZA 1JLSA 2H48A 2RAUA 4LFBB 2IYSA 3WL8A 4AJKA 1L5HB 3K0HA 4P32A 2Z3ZA 3IP6A 4IJMA 1XEWX 1IOZA 3PR1A 1L4MA 4P84A 4WJKB 5L3QA 2COEA 1K66A