3KQYA

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-7-ol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqyA00
5K0JA 1IXKA 3KPUA 1VE3A 3KQWA 4RX1A 2OPBA 3FYCA 4WXHA 4YUXA 3G2MA 5E1OA 1AF7A 2NP7A 4QPPA 5FADA 2H00A 3FUWA 2PX4A 3G88A 1VL5A 2UYQA 3UJAA 4GQBA 2ORED 1VQ1A 2H1RA 3OU7A 3T7TA 1KR5A 4HRAA 4KWCA 3TR6A 5U4XA 1YZ3A 3P9CA 3BKWA 2YR0A 3AXTA 3CJTA 4KDCA 2ONZA 1VP3A 3UJ6A 3E7PA 4RYLA 5DRTA 5EIWA 5GM1A 3UJ7A 2A14A 2OB2A 1VPTA 4RVGA 3A27A 4AZVA 1VP9A 2JHCA 3JWJA 5DTRA 2BM9A 2B25A 2OBFA 3EPPA 1F38A 2O06A 5EMLA 4YUWA 1EG2A 1UFKA 2B78A 5HIMA 3HM2A 4ER5A 1EIZA 1RI1A 4PYOA 1SUSA 1AV6A 1KP9A 1FBNA 1X1BA 4CTJA 5LQUA 3B3JA 2LD4A 4X41A 2IH5A 1TPYA 1YB2A 3EVEA 5GM2A 1I9GA 4RWZA 4QVGA 2P3OA 3TLJA 3P2EA 4EMSA 3GGDA 1G6Q1 2IFTA 3FPFA 5HIJA 2YX1A 5EKXA 3P2IA 4YV2A 4BP3A 2QRVA 1HMYA 3MAGA 4E2YA 2G72A 3SGLA 4IKPA 4GUAA 9MHTA 3BZBA 3P9IA 2ZIEA 2Q41A 3CJRA 4PYLA 4M38A 4F86A 2QE6A 3ELYA 2Z6AA 1EQAA 4R6XA 3DP7A 1JQEA 1NW8A 1SQFA 3KR2A 3OFJA 1QANA 2P40A 3NTVA 5H02A 3BGVA 1RJDA 5K03A 3MB5A 3P8ZA 3MCZA 1ORHA 2NXCA 3C6KA 5T67A 1U2ZA 3TOSA 3DMGA 1ZQ9A 2HNKA 10MHA 2AZTA 2ZZMA 1ZKDA 2DULA 2YXLA 3GDHA 1Q0TA 2AOVA 4EQZA 2EX4A 4GF5A 5D1NA 4F85A 1R18A 4FGZA 2IBTA 3KU1A 5K05A 2PXAA 2N47A 3MQ2A 5KQRA 2NXNA 4GOOD 4PYKA 4QVKA 2XVAA 1XTPA 5LR6A 2IH2A 2ERCA 1YF3A 3MERA 1NV9A 3GO4A 1ORIA 2OO3A 3O7WA 4E30A 3ME5A 5HOQA 2R3SA 4M37A 5C1IA 4PYJA 4CKEA 1NT2A 2QRVB 1D2CA 3KQTA 3LDFA 4QQKA 4YMHA 3K6RA 1RI5A 1RI4A 4R8SA 5HZMA 3LGAA 1L3CA 3KQOA 4KDRA 2P7HA 2ESRA 3BWBA 2XYRA 3VC1A 2AR0A 3QOXA 5EEGA 3OZSA 4A6EA 2HTEA 2ZULA 3BGDA 3G7UA 4O29A 1D2HA 5HIKA 4HTFA 1RJEA 3PB3A 1TW3A 2CL5A 4KIFA 1JG2A 1HNNA 1L9KA 2HR1A 3HVHA 5FWDA 2YQZA 4P7FA 3M6WA 3ELUA 4ZTBA 2JHPA 4YUVA 4ATNA 3S68A 3OE5A 2JHAA 2O05A 3DUWA 3HVJA 4M36A 4C4AA 2IPXA 2ZZNA 1B42A 1WS6A 3BXOA 3MTEA 3OZRA 1P1BA 2GS9A 1JSZA 5LQKA 5CUQA 3C3YA 3TPZA 2BZGA 2ZIFA 4GOLD 3PX2A 2AN5A 3SXJA 4ISCA 2I6GA 3LHDA 5LQNA 3DTNA 3HCAA 5DM2A 2PBFA 4ER6A 2XYQA 3K0BA 2UYCA 3KR0A 3DMHA 4E2XA 3Q7EA 3TKAA 3IEIA 1P39A 3HA3A 3OFKA 1QZZA 5E1MA 2XYVA 4G56A 5CVDA 5DT2A 5B1SA 4WVLA 4PIMA 5K0LA 3EVFA 2ZFUA 2IGTA 3A4TA 3AY0A 3P9NA 3LDUA 4NECA 1X1AA 5KVAA 3UFBA 3CKKA 2GAFA 2FYTA 3EEOA 5EVJA 3H2BA 4HTFB 2JH8A 1X1CA 3KPYA 3HCBA 5MHTA 2G8NA 2XBMA 3EEYA 3G5LA 5CVJA 1JG4A 3M6UA 4A6DA 3R6TA 3UA3A 3F4KA 1Y8CA 4LECA 4X63A 5E1BA 2O0LA 3OZTA 2GA9A 1XVAA 4RVFA 2PXCA 4JXJA 4PCLA 4K6MA 4X61A 2F8LA 2C7RA 2UZ4A 4PIPA 5HFJA 5DX0A 3THRA 2ZW9A 3A7DA 3G2PA 2AS0A 2ZVJA 1PRYA 4DM3A 3M6VA 2PKWA 3G8BA 4DCMA 4E31A 5EPEA 1KYZA 1NW6A 1BHJA 3A25A 3EGVA 5CD1A 2PV0A 3JWGA 3SMQA 4OA5A 4OBXA 2EG5A 2HMYB 4RTLA 5K09A 3EMBA 3LBYA 1P1CA 3G5TA 2FRXA 4QTUB 5HEKA 5P8WA 4F84A 2P8JA 5E9WA 5EG5A 3UJ9A 4DZRA 2K4MA 3KPJA 3KQMA 4XUEA 4AZWA 3FPHA 5C9ZA 3RODA 3P71T 5E9JA 1YFJA 2IP2A 4YV0A 4OBWA 1KYWA 1WXXA 3A26A 5DRYA 3I58A 2UYOA 3FUVA 4BLWA 3ANXA 3PTAA 3GRUA 2C7QA 2WK1A 5FHQA 2BR5A 4RTPA 3AWIA 3DR5A 3R24A 4GC5A 1R00A 3U81A 1XDUA 3B89A 4ER0A 2OY0A 1X1DA 2ZIGA 3NVMB 3RIEA 2ZBPA 1BC5A 1KPHA 1NE2A 4C07A 2AOUA 2FHPA 1R8YA 5K01A 3THSA 4CTKA 5DWQA 2CMHA 3EVGA 5EHGA 1N7JA 1Q0SA 3OU2A 5GINE 1QYRA 1G60A 3OU6A 3HA5A 3HVKA 2VDUE 2CMGA 3LKDA 3PVCA 2PY6A 3GIWA 2YTZA 3M33A 4PYNA 3DULA 3UBTA 2P1DA 5GOZA 1D2GA 2FPOA 3SVZA 3C0KA 3FYDA 3UZUA 2KW5A 4H0NA 3GJYA 3HA7A 5E2BA 5BP7A 4MTLA 5JR3A 4DCGA 1UIRA 2ZWVA 2OXTA 1H1DA 4PWYA 3FRHA 5DSXA 5F2KA 2AN3A 3EVCA 4E70A 1XCJA 1EJ6A 1NW7A 2PLWA 2VDWA 2EJTA 3REOA 4RVHA 4FZVA 3V97A 4HC4A 2ONYA 2FCAA 3HCEA 3KPVA 4BLVA 3FTDA 5BW4A 3MHTA 4PYQA 2PVCA 3LSTA 1O9HA 5IH3A 4QTTB 1TW2A 1JG3A 2AOUB 2NP6A 5CCBA 3NDIA 1JQDA 5ICCA 2PX5A 1AQJA 4C06A 1NBHA 3NW9A 1KIAA 3LBFA 3LL7A 2EFJA 1R8XA 3E23A 3BWYA 3JWHA 2HWKA 4V0RA 2G1PA 3I5UA 3L8DA 3P2KA 2Y1WA 2Z6QA 3MTIA 3SX0A 2E5WA 5LQRA 1G55A 1ZGJA 3VYWA 5KQSA 2O07A 4R8RA 3UJBA 5ICGA 3PS9A 2CWWA 5LQJA 5DTQA 3GRRA 4HGZA 2C7PA 1EJ0A 3PLAE 4XCXA 5D1HA 4P7GA 5EZSA 4YV1A 4HSGA 3UJDA 4FSXA 5BXYA 4EK9A 5LSAA 2Y1XA 2NYUA 2PX2A 5DX8A 5FWAA 3T7RA 1M0EA 5C0OE 1RI2A 2YXDA 1N2XA 1FP1D 3GU3A 3QV2A 1R74A 2DPMA 4FT4A 4OA8A 3CBGA 3KQVA 5EEHA 4C08A 5DX1A 1X19A 3ERCA 1VLMA 4PINA 1INLA 3GNLA 2PWYA 2ZSUA 2V74B 3NDJA 3EGIA 4P7JA 1OR8A 4RV9A 1JQ3A 2AVNA 2OKCA 3DXZA 4FSDA 4CKCA 4QDKA 1I4WA 5CVEA 5HIIA 3EGEA 5DXAA 4E33A 3CC8A 2ADMA 5T64A 4ER7A 3GXOA 1FP2A 5ERGB 4Z2YA 3IYLW 3KQSA 4MHTA 3NWEA 3LPMA 2BR3A 1RJGA 1YZHA 3LCUA 2P3QA 3FPGA 3O31A 4OQDA 4MWZA 3QOWA 4IV0A 1ZGAA 4FS8A 4HH4A 3OCJA 3P9KA 2JG3A 3SSOA 3Q87B 3B3FA 3JWIA 4RTMA 3GWZA 3UJ8A 1XXLA 1L1EA 1NW5A 2AVDA 4X1OA 5CM2Z 4KRGA 5K8VA 2ZWAA 1FPQA 1KPIA 1BKYA 2ZLBA 1WXWA 1EAMA 3FTCA 2AOWA 3TRKA 5K0BA 4OQEA 4HGYA 2HV9A 2EJUA 3ELWA 4DF3A 4EVIA 1N7IA 4LWOA 3CGGA 2VDVE 2PGXA 3EVBA 3CVOA 1XCLA 4GBED 4AX8A 3BKXA 5DM0A 3TQSA 3I53A 5G02A 3EVZA 4PGHA 3FRIA 3NVKI 1SVUA 2FK8A 1UWVA 2G71A 2YXEA 3LCCA 3LECA 5FHRA 3UJCA 4CWAA 1G8AA 3HCCA 3PFGA 1NKVA 2FK7A 4FT2A 1NW3A 4V0QA 3HCFA 1O9GA 3DLIA 4X60A 1I1NA 5EQJB 5GP1A 5K0EA 1MHTA 5ICEA 4Y30A 5EHIA 3HCDA 3IHTA 3FUUA 4R6WA 4EKGA 4POOA 4RTOA 3DH0A 3BWMA 1JSXA 2OB1A 2AOTA 3TFWA 4L7VA 5JUWA 1DCTA 5K0FA 3M6XA 5GWXA 5T6BA 2IH4A 1M6EX 5BW5A 3HTXA 4LG1A 2QYOA 3A7EA 3M4XA 4R05A 3KPWA 3ID6C 2UYHA 3E05A 1JTFA 2IIPA 4EKIA 3I64A 4MQ4A 3TM5A 1QAMA 5K0NA 5DXJA 4GOND 1AQIA 3UA4A 4PNEA 3TMAA 2I62A 3MCTA 4C03A 5DLYA 2I9KA 3LKZA 3KR1A 2AOXA 3V8VA 7MHTA 4XUDA 1ZG3A 1VIDA 3NMUF 5E2AA 4Y2HA 3C3PA 4U7PB 3E8SA 4PCAA 1O54A 2JH9A 2BR4A 5EMKA 5K0CA 3B7PA 5DM4A 5EZQA 1NV8A 2WA2A 1JTEA 3HP7A 4FR0A 4PYMA 2ZBQA 3GRZA 5FCDA 4DMGA 5FA8A 4LWPA 3R9XB 4E32A 3R0QA 3R3HA 3TKYA 4IWNA 3PFHA 3G8AA 1KPGA 1JR4A 3BUSA 3DMFA 1F3LA 1V39A 3T0IA 5EOVA 5EGSA 5HILA 4PYIA 1G38A 2GB4A 2GH1A 3FUTA 3X0DA 1XDSA 2AOTB 4CKBA 1L3BA 3G2QA 5DTMA 1WG8A 4GC9A 3OE4A 1T43A 2P7IA 3ELDA 1M6YA 1RJFA 3PT9A 4U7TB 3EVDA 4ER3A 5FTWA 3B3GA 3G89A 5EMJA 2H11A 2BM8A 3LX6A 5FQNA 5LQCA 3GCZA 2C7OA 2BH2A 3DLCA 4HG2A 1IY9A 5CCXA 3EVAA 5ICFA 1SKMA 3FZGA 5F2OA 4CXMA 1R6AA 1VBFA 1P91A 2R6ZA 3C6MA 5E1DA 5EIFA 5M5BA 3BT7A 1SUIA 2WA1A 8MHTA 3NJRA 1SQGA 3KQQA 1FJXA 2PSSA 3VSEA 3KQPA 4M7RA 4E2ZA 5GIOE 4RTKA 4C04A 4MIKA 1NBIA 4OX9Y 2GLUA 3DOUA 1WY7A 5EC8A 4KIGA 4RTJA 3B5IA 3FTFA 1PJZA 4QQNA 2P41A 2NXEA 3SR4A 3SSNA 5FUBA 4RTQA 2P3LA 3PX3A 3KQYA 3TM4A 4C05A 2IBSA 1JG1A 3CJQA 4AUKA 2OZVA 3KR9A 5DPMA 1XDZA 5CVUA 2ZTHA 1DUSA 2NXJA 4DA4A 2AN4A 4YUZA 4PONA 3MGGA 1KXZA 2P35A 3BGIA 4PGGA 3VC2A 4BLUA 1ZHFA 2IDKA 3I9FA 4GEKA 4E2WA 1L3IA 4RTRA 3P97A 3KHKA 2ZZKA 3O4FA 1KHHA 3LDGA 2PJDA 4YUYA 2PXXA 2QY6A 5K0GA 2PX8A 2PWPA 3T7SA 3FTEA 2ZCJA 2V7EA 1BOOA 3ER9A 1QAQA 5F2NA 2VS1A 1RI3A 4AZTA 3ORHA 4XUCA 2G70A 5E8RA 4BY9E 2O57A 3RW9A 2GPYA 2PT9A 4RTNA 4RTSA 1XJ5A 1Z3CA 2YUIA 3LCVB 3IV6A 2OYRA 3WSTA 3OPNA 3SSMA 4YMGA 5LQAA 5EMMA 5FULA 1DL5A 2B2CA 3UWPA 4DQ0A 2B3TA 5IKMA 4P58A 3M70A 3DXYA 5GIPE 4P7KA 5EKUA 4QDJA 1QAOA 4RSRA 5E8JA 2QM3A 3KKZA 2Z6UA 4KW7A 2CKDA 3GRVA 3AJDA 1MJFA 4BP1A 2IDJA 1G8SA 3HNRA 4GOMD 4RVDA 2I7CA 3CCFA 3DXXA 3NWBA 3D2LA 3EMDA 3AXSA 5FA5A 4AZSA 2PT6A 3ER8A 2ZBRA 3G2OA 5DM1A 2JJQA 4IV8A 4QPNA 3HVIA 4UOEA 2B9EA 1WZNA 3FUXA 1SG9A 2VZ9A 4DKJA 5KS2A 2NNWB 1YFLA 1IM8A 1YUBA 5KYGA 2XVMA 3BWCA 3FPEA 2YVLA 5FQOA 2VP3A 4KVZA 3FPJA 5E9QA 3HEMA 5DSTA 3SM3A 5CIYA 4B17A 3GRYA 5CVVA 4FP9A
chains in the Genus database with same CATH superfamily
3KPUA 2VIIA 1YCGA 2OPBA 3MFYA 2NO7A 3HKCA 1MQAA 1G8YA 1XX6A 1Y4DE 2ZVQX 1W36C 4ZKEA 3SVTA 2ZIZA 3SSAA 1ST3A 2IEGA 2P78A 3E3AA 4NPAA 4K6CA 5JXWA 3M9XA 1ZHOA 4HAVA 1KSGA 1NMSA 2Z08A 1W88A 2FSIA 2K7ZA 3RRMA 4KAFA 1V41E 1IK4A 3IB6A 4EHDA 3I37X 4Q01A 3SFZA 1U4OA 4XPIA 1FNDA 1XHEA 1ONNA 1YXMA 5DTRA 3H1GA 5EMLA 5E6SA 1KDVA 3MJEA 1EG2A 3C8UA 2YWXA 4MRVA 3Q7QA 3UJHA 1AUXA 5AUPB 3ADOA 3DL2A 4EAAA 4ENUA 3TYXA 6CHYA 1N1MA 1E61A 1XZKA 3PNQA 3ZBQA 4ZOQI 3HRHA 4Q4JA 3OLYA 1XXHE 2GN8A 5D3MA 2CDAA 5JRDS 1H6DA 2J3LA 1U94A 5JARA 4DG5A 4RWZA 1VHQA 1VJDA 4KODA 1BX0A 3D7SA 4XSHA 3HWRA 2CBXA 3REGA 3LU1A 4UASA 3FPFA 4J2HA 5D8DA 4ZVNA 2AG8A 2EJBA 4ALMA 3I76A 3TCNA 2W6IA 4EPYA 1HMYA 5LDDC 4ZRNA 3UB2A 4X64B 1IDN1 1YZNA 4I55A 3ELYA 5JZBA 1TKRA 5JNTA 2OOKA 1ULTA 3IUQA 4PLFA 1MTOA 4FYMA 1GRRA 1QHSA 4YAJA 4HDQB 3QMPA 2CZCA 1RWVA 2OLJA 4RM2A 4RKRA 1U6KA 2V9ZA 3P19A 4G81A 2YYSA 4LWZA 1GKKA 3GB9A 1FMTA 3LV8A 3DYBA 3GDHA 3PC4A 3I01A 3NHZA 4GPTA 4JP3A 5D1NA 4M83A 4KQ9A 1E5QA 4HN9A 8OHMA 3V8QA 1E6UA 2NXWA 2HEIA 3MQ2A 4F93B 5HUJA 2CUKA 2BKLA 2ZJZA 4XQEA 4BFLA 3BL6A 1UM9A 4B7XA 4TQ9A 3N0TA 1XU4A 1OYYA 1YS1X 2WTEA 2ZRMA 4AO8A 1A27A 3DWIA 1Q1BA 2OO3A 5JQGB 5K9ZA 4ZZ1A 3LY5A 4OQLA 13PKA 3N05A 1X6VA 1K27A 3CLVA 4XWAA 3B5JA 1KQFA 1A69A 1U8FO 2FVYA 4MB0A 3AUTA 3WZMA 4AMVA 2XMRA 3F67A 1W49A 4R8SA 3VTAA 1XTQA 2PLAA 3DVSX 4GO1A 4I19A 1LK0A 4KLNA 1YA8A 1I36A 3UUGA 4NR0A 3T6KA 3P2OA 3PLRA 1QG0A 3IDSA 3GF4A 2WM9B 1EEXB 1J06A 3IPLA 5KCMA 3T1TA 4NE7A 1VHWA 5D6NA 5KHLB 2X0NA 4AG3A 1MQ8B 2A84A 5KPJA 4ESEA 1FDVA 1OKKD 2PRZA 3EMVA 4QUEA 5B4UA 5HJ5A 1T5OA 2PGJA 3C3YA 1LV8A 1G2PA 3OQ1A 2KWIA 4MCJA 2PDAA 4ISCA 2YIVX 4KFSA 3NU1A 4ASUD 3RBAA 1J7JA 2HKIA 4DEYA 4H3SA 3OE7A 1UJ6A 1DC5A 4G41A 3VPCA 3U4DA 3MF4A 3ZHQA 1Y6ZA 1USUA 4BO1A 4QUJA 1DADA 4G5FA 1SCUA 3FJOA 1N2ZA 4NU0A 2GFHA 3GJZA 3HRKA 3L7IA 1GO2A 1MAWA 5EFZA 3X1WA 3VKGA 2QI9F 1VYUA 3AHIA 1X1AA 1CZLA 3G23A 4PNHA 4ZU6X 3F8WA 4I5GA 3QH4A 3ZWDA 1ZWKA 4OAOA 4O4IB 3F3KA 3T5DA 1J8QA 3AVQA 3H4TA 4LZNA 4B6JA 1OB2A 3GDOA 4FEGA 4XEUA 3C3EA 3L05A 3CX6A 4DDUA 4A6DA 1NZDA 4XVHA 5AT1A 3ITKA 5ELXA 1Y8CA 4JC0A 4QDTA 3KIPA 3S1AA 4I9UA 4R1SA 1OU0A 2ODNA 4R01A 4AO6A 3SK0A 4D96A 4E11A 4IJ6A 3I6QA 3VAZA 2GCNA 1W2HA 4XQ9A 3AVVA 5TE9A 3JQQA 4WJKB 5KPDA 2CYBA 3QUQA 1JEYA 2SKEA 2AI3A 3EY4A 5K4AA 5T8KA 1M2EA 5BYKA 3LP5A 2WUEA 3FR7A 3CRMA 3OZIA 4MUBA 1FP6A 2R1TA 1W8DA 2FP4B 4KH0A 3VHXB 2HU7A 4RXUA 1ESEA 1E4VA 4DQUA 1HTBA 3AJ9A 4TXJA 2PZLA 3NHBA 3O8LA 1JDVA 1T10A 2AI2A 2GN2A 2IKSA 4Q12A 3ZWMA 4PZ9A 4N0MA 2XB6A 3IH5A 2VN8A 2FFHA 4CLOA 4URHA 4J9VA 3TBKA 1Q2UA 1VE9A 2VDRB 4QG3A 1PUIA 3CLTD 3IEUA 3KZKA 2H1LA 4DJEC 4F06A 2FEWB 3TPFA 3OKFA 1ZJJA 4D74A 2NG1A 3KP1A 1I2MA 1MNAA 1Q91A 4HLCA 3IPCA 8LDHA 2O5CA 1VKJA 1Q15A 1JE1A 3HLKA 1Q7TA 5C52B 2XKJE 3ZEAA 3WKDA 3HB4X 4WCVA 1ISMA 1X7GA 5TLSA 3SXPA 1EA5A 1R00A 1NBOA 2XADA 1WXQA 1XN1A 4XRRA 1WQ1R 4KAJA 2FHPA 3GRCA 3S28A 3THSA 4ZCLA 3T0FA 1HTTA 2PUEA 4P22A 5DWQA 3EVGA 4KX3A 3FKSD 4EKDA 3I23A 4YK7A 2J9ZB 3HA5A 4DVGA 2V5AA 2DFVA 4PE5B 3BF8A 4UBOA 3JVDA 2H48A 2CDRA 3T4UA 5AHRA 5HJEA 2HX1A 3LH5A 1GT6A 3ZXXA 5KVQA 2HF8A 3OP1A 2X6QA 4MSUA 4NFHA 3AW9A 1XZNA 2QTVA 4JA0A 2EIXA 1WMEA 1T6NA 1YRQA 2WYWA 3SVZA 5AK0A 2ZREA 3BHJA 3OT4A 1G8MA 4YI5A 3UH1A 3KYDB 1ODTC 4DT1A 1M54A 4F84A 3GGSA 1Q11A 1MB3A 1GLNA 2Q1UA 2V7TA 3K35A 4LY9A 4TS1A 4OFBA 5G53C 2AX4A 2JD2A 4BNJA 4DREA 5KTNA 2CXTA 5ALXA 2JGEA 3DDCA 4Y1RA 5H70A 1QTRA 4XOIA 3CU5A 1FJHA 3LWNA 4H7JA 4PO1A 3C3KA 4TTQA 2PVCA 1C0LA 3HGTA 3LSTA 3RTAA 3T4XA 3WFJA 4E15A 4BEWA 2AOUB 2RAVA 4KPYA 2JGJA 3AEKB 4J2TA 1SIBE 2PX5A 3EWIA 4BO6A 5B3LA 1GQRA 3IMGA 1NT4A 3P26A 4QBGB 4EYKA 3VJMA 5JANA 4IVPA 4OXYA 3PUWA 5C7YA 3LA8A 3OIFA 4X20A 1GG2A 2MMGA 3UMVA 3QK7A 2G1PA 4L27A 1IZ9A 1ZMTA 4ICIA 1R0YA 4IQGA 4WH0A 5FTNA 4GKKB 5B55A 4UU0A 1FRNA 3SG0A 4WOCA 1GFWA 1V95A 4EPVA 3VMFA 1ZLYA 3CUKA 5BYAA 7YASA 2XCIA 2OXRA 3NCTA 3Q3JB 1JLKA 1NXXA 2R8OA 4Z4EA 1MTZA 3VKHA 4W6ZA 2PMWB 1FTQA 1IPEA 4YV1A 1F4PA 4ZVRA 1Z16A 1UZUA 4WBSA 4F5ZA 2B34A 4OJQA 1UT6A 1AU9A 2B1JA 4FOSA 4R9SA 2GEVA 3BQ9A 3IV7A 5AKZA 4KWEA 5CVCA 1M0EA 2FRDA 2PV7A 3LZDA 4C5BA 4DCOA 3S8YA 3PQ6A 5BN1A 2C0QA 2H4FA 1YBVA 3WV4A 3UUWA 3W6UA 3HKBB 2DFNA 4ZT6A 2R6R1 2YN4A 2PBLA 3MPOA 2I99A 2PGDA 4OI1A 2PMFA 2PWYA 2J0VA 5BQ3A 1HDZA 1U8ZA 2O50A 1VJ5A 2RH9B 4M9QA 4WZZA 1CZRA 2C54A 2EX0A 5EKTA 4AJHA 5DNUA 1AH2A 3N2GA 3UXEA 3H9CA 3ZOKA 2XE7A 3EIOA 4CIDA 1JQJC 1UBTS 1Y8AA 1NIPA 2XUZA 4J91A 1UDXA 5ERGB 5TGDA 4Q7LA 1RWQA 3LPMA 1SXJC 3IE2A 4JA2A 5L3QB 4MQFB 1DMRA 1WMFA 3ETJA 1YIDA 1H9BA 3TW6A 3WLFA 2CYAA 4PRKA 4EYQA 3PEFA 4FZJA 2GHTA 1QX3A 4OATA 4EJSC 4F5EA 4DXHA 4Z1MA 5JTUA 2GAOA 3OCJA 4LYGA 1A2QA 1QGYA 3Q3GE 1Z06A 3V4FA 4ZTUB 3G0GA 4PQFA 2FZKA 5CPBA 1IHDA 1MB9A 2OCKA 3KQKA 1DC7A 2DKOA 1L1EA 5DE3A 2QX7A 3PQ5A 1V11B 4HRYA 2V4UA 1EDZA 4NFYA 3GJ7A 3FOAA 4PO9A 4X6XA 2QBYA 2H0AA 4FR2A 4AKHA 2NACA 2ZJ5A 2Q6KA 3PQEA 1EAMA 4PSUA 3EGDA 4UNPA 3FNEA 3PUHA 4PU0A 1LX6A 3VTZA 1H3EA 2EYUA 4NOMA 4A8HA 3QEBZ 2YQ5A 1X7WB 2GZHA 2Q2NA 4GBED 3BKXA 5JAMA 3I53A 5KNLA 5DLPA 2ZIXA 4LDQA 5ALHA 3RUPA 1X70A 2AMVA 2EG9A 2LGJA 2VDKB 1L1QA 3LECA 2QQGA 3ITEA 4XWTA 1G8AA 1RAAA 1JHZA 3AH8A 3SKVA 4BFUA 4KTTE 4V0QA 1N32B 4R41A 2P6MA 3D4OA 3DLIA 1JJVA 4DA8A 1MHTA 1CG6A 3A3KA 4FFBA 3FI9A 2ZRGA 2DB3A 1TADA 3WLRA 1V4VA 5DW3A 2VDJA 1DIRA 1ZUHA 1I51A 3A9RA 4YH1A 5ALSA 3OFVA 5HUHA 3JQCA 2VNSA 1P0QA 2J8ZA 5KAMA 4YDHB 5EUMA 5AI9A 1V7ZA 1EQUA 1SXIA 2ZTSA 2OFWA 3V8BA 1M73E 2JBAB 1RWKA 4WZAA 4IDOA 2HSZA 2XECA 2UVPB 1JSLA 2J7KA 3DHWC 3GVIA 2ZCJA 1QVAA 4OHZA 4CLEA 2E4WA 1XJCA 1Y1SA 2H1OA 1L5YA 1ZNWA 2XDQA 2YMQA 3BJRA 4PXAA 3KOYA 5K0CA 5G0TA 1Y6JA 4YVFA 2WA2A 3I5XA 3QVMA 5DGHA 1L9XA 2ZBQA 3R3JA 1ZAKA 2FX5A 1FFGA 2PQ6A 2W8BA 1G18A 2ZI9A 3L93A 3OZUA 5K8TA 3HY6A 4ZC1A 1UMDA 3F5FA 4J76A 4D3DA 5HW0A 2QMQA 4ZCPA 1TCAA 1IN5A 1XTZA 2ISQA 4O3MA 3SQXA 2VAMA 2EEZA 2IY7A 3AP2A 1VMIA 2PLFA 4G0NA 4GZLA 4C3VA 5BXQC 2I8LA 3NGLA 4BS9A 1YS6A 1SC6A 1HURA 3EVDA 1E2UA 4AS1A 1H6AA 2ZJ6A 3O90A 3RC1A 1RSZA 1FUYB 4OLBA 1XA3A 2DLCX 2VUHB 3QJGA 4JT4A 4QO7A 3YASA 4OQNA 3LUJA 5CCXA 2F4NA 2Q6LA 1ZM3A 3DE7X 4HBZA 1EX1A 1LY1A 3TW4A 2GTIA 3U6BA 4LSWA 4U4AA 2V6GA 3N8HA 3DYIA 3PXGA 2RGWA 4C7OB 4RQAA 4NJMA 2FEAA 3CNOA 3KZOA 1UPCA 3MK31 4RTJA 4J7UA 1JKMA 1KI7A 1PJZA 4TV9F 3ACBA 1MRZA 2ZKLA 4ESOA 2WSIA 2J85A 2ZIUB 2P9TA 1GV1A 1XNJA 4KOAA 4AUKA 4D26A 3ESXA 1V47A 1QDLB 2W48A 4QDXA 2R97A 3UMCA 1DUSA 3ZNNA 4F5WA 2NXJA 1C9JA 3LFUA 4BZQA 4CKBB 4NOKA 1P75A 3GAMA 2F1RA 5H9VA 4EB3A 4LF7B 2VJYA 3MOSA 1PEAA 3G49A 3K5WA 2CV0A 1PG2A 2ETXA 2ODEA 2PSDA 3FPSA 3P97A 3IVRA 1N6HA 1Y4AE 3CLHA 3UMJA 2Q6IA 4FFVA 2CXOA 4OMUA 2UZ0A 2NUTA 2ZWPA 2XOXA 1XVLA 2EZ4A 4RZIA 4WXMA 1YR9A 4XTRA 2ZBDA 3I9V1 1YR2A 2WOJA 1ORWA 2XODA 3QQPA 4GBMA 1IN6A 2IY9A 4MWGA 4TVOA 2W2NA 4OGKA 4WN3A 3C48A 1HG1A 1L5HA 1SHJA 1SUCA 1EFUA 3BREA 4ZK6A 3W1EA 3T3IA 1UMBA 3GK3A 3LT5A 1F4VA 4R1NA 2OYRA 3VVCA 4R71A 1KA9H 1NVMB 5G0VA 3LP8A 5FULA 1I9CA 4B34A 1M2HA 3A3NA 3B51X 5A4KA 1G8KA 1O0SA 2A5DA 1G7SA 2WJZB 3S2ZA 4DDHA 5HKKD 4QDZA 2VHEA 2O8FA 1GGKA 1COWD 2VQ6A 4MS1B 4YRCA 1CY1A 3FE2A 3LSYA 1ZM7A 3WDMA 3CSUA 1AS0A 3O47A 4CFYA 3LHFA 5M34A 3N76A 4MS4B 3H6HA 2WAMA 5DCUA 3OMLA 2KBEA 1YMUA 2BAGA 3DXXA 4ARIA 2O3TA 5I4KA 3GI1A 2FZWA 5LM3A 2PYDA 1QGOA 1W85B 2BFWA 3M7IA 1F60A 5J4HA 5JNLA 2PIDA 2PZGA 4JP8A 4PLPA 1CF4A 5DM1A 2A1TS 3N0WA 1Y37A 1X7XB 3ND7A 3V00A 2B9EA 2OGUA 1HEIA 3LUBA 2CVQA 2P9HA 4TVKA 1JJAA 1LLUA 2XMZA 1YFLA 3MMPA 5CH8A 4JELA 3TZQA 3PBKA 3WP1B 1XQ6A 3LOPA 1Y3HA 1Z3IX 5A3VA 1PDOA 1MG0A 1LPSA 4R69A 1V5FA 3VGJA 3L5OA 4F96A 4UTPA 4RUKA 2AG0A 2VHXA 1W2GA 2BFEA 4G5RA 2BD0A 3TTWA 1IMOA 1T2UA 1LBHA 1MVLA 4DCJA 1WSBA 1E4OA 1TK3A 3O93A 4PFJA 3TR6A 3V48A 1WETA 3FCXA 1Z83A 3NT4A 3PGMA 1U7HA 2OCBA 1VP3A 4IRMA 4MR9A 3DMYA 4HWPA 4OGWA 3E7PA 2B7BA 4EFMA 3K0HA 1IVSA 2A86A 4ZOCA 2QVLA 2OB2A 4TS4A 4PN3A 3F90A 2O54A 4UEOA 4MTCA 1M1YE 3W77A 1QRAA 5JSZB 1N33B 1F6BA 3Q11A 3IDFA 4DY4A 1X9IA 1IVNA 3BCSA 2BMEA 2C5HA 5JLAA 1XXHB 1UZMA 2PKRA 4O4JF 3ENQA 3L0ZA 4D97A 3F4LA 5JJBA 3CUTA 1KS2A 2R6JA 4IUCS 1GTRA 1QKIA 2UXCB 2ZXUA 4ZDKA 2ID4A 4M1TA 1KYXA 4LTDA 3U40A 5A9SA 3QWBA 1J49A 4JDPA 4MYDA 1SUBA 2QNIA 3QPWA 1GEEA 1ZIPA 1R0RE 3K9FC 3M6AA 2IS6A 5DK6A 5FFNA 1E63A 4A0GA 1AXRA 3G0BA 1EFPA 2OSVA 3HEAA 3AF2A 4P80A 1W35A 2RHGB 4YHBA 3RSSA 1Q0PA 1X39A 1HL7A 1QFZA 5LOVB 3D3NA 3B7WA 3HB1A 2VHJA 1O8BA 5KQPA 1AZLA 1JV2B 1USKA 1RJDA 4PZUA 5K03A 4XGIA 3I9NA 1DFHA 1ISJA 1YJBA 2YMMA 3KT8A 4GE3A 2C20A 3ZLVA 4B6EA 3W8NA 3P9QA 4KNWA 5B58C 3FOFC 1QFJA 3FNBA 3I01M 2HWXA 3U3XA 4AF8A 4EBFA 5DW0A 5HR5A 4C1NA 2Y68A 4BLRA 4TUYF 1ZISA 3KU4A 2IBTA 2PXAA 3G59A 4G9BA 5JCOA 3FIUA 3IQXA 3P9RA 2DQSA 3L77A 4AJOA 3ICQB 3QUSA 1TEXA 1XVIA 3HQ4O 1QUFA 1XU7A 2PUWA 3BB1A 4RULA 3ILYA 5LZ8A 4R2WA 3T99A 3VR0A 5B7GA 1GPDG 2NU9A 4ZAFA 4CG0A 1HQKA 2WFLB 2C3MA 2FR0A 3IOBA 3O8DA 1TM1E 1LX7A 5CHEA 3SCZA 4U2BA 4FUTA 1D2CA 2IEDA 1OQAA 1HH4A 3FGPA 3K6RA 4POAA 3PXEA 1JJIA 1MV5A 3VC1A 4MVJI 3X1XA 3PQ3A 4MP6A 2V0NA 2C83A 1CEEA 5B5SA 3W1WA 1TT5A 2C1ZA 3I34X 1EDBA 4IJ5A 4YASA 4D8VA 4KN6A 3ROMA 2HDHA 3EFBA 3SQDA 4TL9A 1MCZA 4BYMA 4ZTBA 1XPUA 3A58B 3N7UA 3UTDA 1H9CA 5EP4A 1BFKA 2JHAA 2YXPX 4JQCA 2IODA 3R9WA 2JATA 1EG7A 2V3VA 3OZRA 3MM4A 3BZWA 1BQ4A 1RHKA 2N75A 2WF7A 5BV2P 4PVCA 7MDHA 4C9BA 1UAYA 4LOLA 3NASA 3IEXA 3LHDA 4HOYA 1CZKA 1GDTA 1A9SA 4JYBA 4KLCA 1PYOA 2F8MA 2RHMA 3WMEA 3AVPA 3KOZA 3GEHA 2FE1A 3AJEA 4FLMA 5DO9A 3DOIA 3OURA 4JKOA 3TLXA 3UK1A 2YICA 4FWTA 4AMBA 3M81A 1Z6GA 5B1SA 3BF7A 2ZUSA 3EVFA 1P77A 1U5BB 2CKMA 2J5XA 5DB4A 4EO9A 4PLGA 4XDHA 3UIEA 1EUCB 3BL5A 3E7XA 3QXXA 2IU0A 5LB4A 5K6RA 3UFBA 4BAZA 3EEOA 2M6KA 2VJPA 3G82C 3ZWWA 2JLXA 4YRJA 4L4YA 2Q1YA 1YU9A 3EEYA 3M6UA 4M76B 4YEDA 2LIVA 3R6TA 3WXMA 2O8DB 3MT7A 2ONCA 4C20A 2GA9A 1EVLA 4K0RA 3D6MA 2J46A 5K4HA 1QO9A 3S1SA 2JANA 3KHTA 1T4GA 3BFPA 1U7DA 5BR4A 2Z5VA 3P9ZA 4AP5A 3ZXUB 2UZ4A 3I09A 1GAXA 1SIWA 3CH7A 1GCAA 2ZYHA 4B6OA 2IZZA 5F98A 1VPVA 4IGKA 3PP8A 4TM7A 5JSHA 3MWFA 3D6UA 5I9IA 2H59A 4A1FA 4D56A 3DQZA 4EHJA 2XYPA 4KMRA 3PEYA 1H85A 1KZYC 2AFIE 3OF5A 1TTQB 2FEPA 1ZSVA 2FRXA 3G5TA 3HS3A 3I2KA 1Y8QB 1UZAA 2Q2QA 2FRVA 4WW0A 3GEEA 2K4MA 2O2DA 3TEFA 3EA0A 1AHNA 3PUZA 3VI3B 5H80A 1E6WA 1T8RA 4FDLA 3BEOA 1I24A 2HZ7A 3C6QA 4ZI7F 2RGBA 3ZU4A 5J23A 2R4TA 2IP2A 2A67A 4H6VA 2B4KA 2IE8A 3D6FA 3DPUA 4LZLA 3X1KA 3ZHOA 5CBKA 3FMOB 2AXNA 3LIPA 3IEVA 1EWRA 1J42A 4ZQBA 5AOAA 2X42A 2GPJA 3KJZA 4G5YA 1WF6A 4ZP1A 4CU2A 4H35A 4TMWA 1UJNA 4UBNA 3LKBA 3A0RB 2YZGA 4PV7A 3LQKA 1JAZA 1XEWY 1QHXA 1I3MA 3L7KA 4GC5A 2IKQA 3G6WA 2C0CA 2R7LA 3B9PA 1BKDR 5HYVA 3NVMB 3CW2A 1T6XA 1TO1E 2OHOA 4I4LA 1DAIA 4URUR 5D3KA 4LZOA 4H60A 1Q0QA 2V97A 4KJZA 3OQIA 4BQQA 3RIYA 3V33A 4ZGWA 4BO2A 5B4VA 3FIJA 2QN7A 3C5HA 1K97A 3VVBA 2BGKA 4JBHA 1XLTA 3DAYA 3N86A 1SU4A 3GAAA 2REQA 2Z1NA 2AKAB 1W46A 3N0RA 4JGIA 4B3BA 4ZCIA 2WF5A 2WB4A 1RLJA 4XDGA 4CV3A 3C7AA 2WVJA 2NADA 2HSJA 1NXPA 1AXEA 3ADPA 5ABPA 3ZDBA 1BYIA 2CMFA 2XCTB 3O4GA 5EWLA 4LTMA 1PGNA 1B26A 4J7CA 4HNQA 2J0UA 1LDEA 2AEMA 3PNYA 4JJ8A 4LJKA 4PICA 4MHTA 2YHIB 3OC6A 3VBEA 2IUYA 3AP3A 3OESA 2B82A 2FB9A 2FWRA 1Y3IA 2VOJA 1ZK0A 1L5FA 2ZRPA 2RK3A 5IXSA 2NVUA 2HLDA 2VBIA 3GFVA 4W1SA 5BW4A 2AKEA 1WB9A 3W6ZA 4DA4A 2IIQA 1Q19A 5FV4A 1XC7A 3QKRB 2GN9A 3CG4A 3CVYA 4LZWA 3VZBA 3R4VA 3WRYA 4C06A 4DJJA 2D1YA 1KIAA 4MYTA 1UDAA 2BF7A 2AWOA 1Q3TA 2MSNA 3LBFA 4UTNA 5JWRA 3N28A 3ZDAA 1Z4NA 4V0RA 2HREA 1RJ9A 2O2ZA 3L8DA 2X0RA 4NV3A 3DC2A 4YA6A 1YTUA 4MQEB 1G7RA 1HT0A 1M1UA 2VYCA 1E1YA 1XNHA 4OVKA 5IKEA 2JGKA 4S35A 3A6HA 5KMGB 1T1GA 2JEYA 5LZ4A 3HH8A 3C1TA 2WNSA 1TO6A 3F8SA 5CMLA 1E1LA 2ICAA 3B9RA 5CAEB 4PC3A 4RHEA 1THZA 5BVHA 1JG7A 4JCCA 1MX3A 3ZCQA 4ERNA 3G8DA 3MIIA 3OPMA 4FSXA 1QU3A 2Y1XA 1B6TA 2GXUA 4BRWA 1GR0A 1HSZA 1RWNA 4UXIA 1DQNA 4FHCA 4GKJB 3QV2A 4XLZA 4DSOA 1WOMA 4WY5A 4YCLA 2JC3A 3K16A 5JEDA 5C53B 2OV4A 3BMOB 2E3JA 3FDZB 4P7JA 5HHTA 1C2TA 2G6TA 5HM8A 1FSGA 2RGCA 4TWIA 1YVRA 1IY0A 2ODQA 1GTVA 1CP2A 4RAQA 4C7JA 3C24A 3RYCB 3W06A 4ZVUA 1GPBA 1GPH1 2VF8A 3G13A 1PWZA 4LIPD 4TTVA 1SEVA 1VL2A 1N2BA 1BS1A 1L5QA 1BMQA 4QJBA 4D6PA 4E3ZA 2PKQO 1W7AA 1Z5WA 1E1QA 3STUA 1SA0B 3ZY2A 3KSAC 3ROZA 1DTWB 2XAUA 3FKQA 2PRJA 4JL8A 3SSOA 3ZHXA 2RHWA 5L3ZA 2PAFA 1PNRA 1G16A 4QAJA 3FXAA 1OOEA 4MDYA 4PY2A 4DIMA 2F9MA 4LKOA 2H08A 3IKTA 4DIBA 4F8JA 2NO5A 5AKJA 1HFJA 1QCYA 5AUOB 2ILTA 4Y3UA 4AJIA 2QAGC 3PWTA 4CM4A 3HO6A 1A4RA 3VR5A 1T5BA 1CRWG 2P9YA 2P9CA 3LVQE 1F0NA 1Z8FA 1AN9A 4XD7D 1ZICA 2QZJA 1RLTA 3V4OA 2WP8J 4L5AA 4R31A 3TQSA 3L7AA 4COOA 3BN3A 3DLPX 2Z1MA 1U3WA 1JQLB 4GW3A 1G8GA 3RVPA 2NQTA 3HJHA 3UWMA 3WY9A 4E1AA 2GGSA 9LDTA 1ENZA 4HRXA 4NPHA 2R44A 3Q9SA 3ANTA 5E7QA 3LXXA 1YA6A 4YY3B 2EQAA 2GYWA 1RHJA 1XEXB 1PKEA 4LV6A 4YGYA 3CH6A 2OB1A 3D54D 2ZAIA 4IX1A 3QHAA 4L8YA 1JXMA 1PNTA 3G2HA 2XD4A 4N3AA 2FUEA 1GEGA 4RZHA 5GWXA 1C7JA 4BO9A 2RIRA 1MNQA 3FSGA 2H7YA 4AUEA 3KC2A 3M4XA 1ID1A 4ETMA 3LT4A 4E22A 2P2YA 3MJDA 4PLVA 1O0CA 4TV9B 3PYLA 1VLLA 1VMDA 3LKZA 7MHTA 3I0MA 3NV9A 121PA 2I4IA 5LD2C 2F1KA 3CTPA 5JSQA 3DV0B 4YMSA 4HNAA 4LXXA 5IMSA 4F6RB 1UDWA 3AFIA 1CR6A 4BO4A 2WWXA 1A8QA 3A6KA 2XWBF 1ISSA 4JBYA 4JI3B 1DJMA 1G8FA 1U8UA 3OLWA 1DT5A 3EIUA 1EHYA 4G0OA 3ZWKA 3THXA 2WKPA 5CYPA 1XAJA 1U3GA 1NUPA 1RXIA 3G8AA 5DGTA 3G8YA 2FZ5A 2IXEA 4AXBA 3THYA 1ZUNA 2GVNA 5GV7A 5I7HA 4MYHA 2WWFA 2OGSA 3A06A 5FUYA 1UAAA 3R44A 2HRZA 3QXCA 4JL5A 5BOSA 3H11A 1IY2A 1GDHA 2P7IA 1PTJA 1XRRA 4EF4A 1MA0A 1RBZA 1BJTA 1DDOA 1RCUA 4IIJA 1RHRA 2GTHA 3INTA 3KD3A 1WD5A 2HK9A 3DVAB 3WMFA 3IJPA 4HYEA 3SHFA 1QQAA 3E35A 1JPUA 3VOTA 2XRZA 1VLZA 3EG9B 3CLUC 4G0VA 1LNQA 4I4CA 1P9OA 5AVYA 1VOTA 1JMYA 1U8TA 3GD5A 4YJFA 5AO9A 5CBPA 1P19A 4RFSB 1TYCA 4U7JA 3LS2A 4RJ2A 2ZE7A 2C84A 1A72A 1T2NA 4M0CA 1NNI1 1Z0JA 5E6UB 2AZDA 1UZNA 2BTOA 2EBHX 1OBFO 1T13A 2C2YA 3H2ZA 3LF2A 4OKIA 1F8FA 1OX4B 1W4LA 2QL6A 1V1MB 4LDRA 3EHEA 1EP9A 1NXTA 2IPOA 3T3EA 2VRCA 2FPGA 4M2LA 3UENA 2VYND 5BURA 3K7EA 4RIGA 3FYUB 1T0PA 5CT9A 5EFOA 3WA7A 3CZ5A 1H93A 1EK6A 3ADBA 4E5SA 4NPCA 1ULHA 1YL5A 1L7QA 4LRUA 2AN4A 2F62A 1NASA 1E77A 3A1UA 3HDGA 1LB1B 4MV4A 1KXZA 4PONA 2NZYA 4UTOA 1DE0A 2HPVA 2QYSA 3I9FA 4WAUA 4QLAA 2IX3A 1QCZA 5KDOA 4KZPA 3VTKA 4I8IA 3UW1A 1YBAA 1GWNA 2G82A 4ZWNA 2HOQA 4OHPA 5K7SA 3QE9Y 4MW0A 3C8DA 4YB8A 4ES6A 2WNHA 2OKGA 1I14A 1U8EA 3QKUA 4QULA 4ESVA 1LWOA 3EXIA 5CVTA 2JIPA 3IMFA 4S12A 4ZZ3A 3NRJA 3MJCA 4TV8B 3A6DA 2J9RA 3ABZA 2PT9A 2QUBA 1XJ5A 1Z3CA 5DI9A 4Q3AA 2MYTA 4JLOA 1KRHA 3FNFA 4H6WA 3IP8A 1K88A 1UXJA 3LX5A 5IKMA 4EX6A 3M70A 3L06A 1G4HA 3SHTA 4D4GA 4G3XA 4MO2A 3EF0A 3LGSA 4BYGA 5LWHA 4BN5A 4KX5A 4O4JB 1FFCA 2CMDA 1KI6B 4HSEA 2Z4SA 1TIKA 2HRQA 1BH2A 1UXGA 2QRHA 3PWSA 2ZSAA 3R5SA 3MSXA 4GOMD 3R7NA 1Y80A 1OLUA 1GU0A 1PVOA 1U7PA 1XKXA 4TLCA 4NU6A 1MEOA 3HL4A 5ITVA 2YV1A 4WERA 2F3TA 2ZK7A 4K86A 2XT6A 2I2XB 1B93A 2BGGA 3DYVA 2DTEA 4IV8A 4R8KA 4RZQA 2C2KA 2F2TA 1M5RA 1BVHA 3X1JA 4BNWA 1A7JA 4MULA 4UMEA 2XVMA 2YVLA 1LDMA 2VXYA 3UN1A 2B0JA 1M1ZA 1ZY2A 3GA7A 5AW8A 4LXTA 3DTTA 3A4MA 3HEMA 1FP7A 1H0KA 3OHPA 4MI6A 3AL2A 4UCQA 5DSTA 1L5ZA 5G40A 4RSGA 3COYA 4R0VA 5DMXA 1AK1A 3QUCA 5FR1A 3TZ6A 3E1GA 3DQQA 4PGAA 3U26A 4GX1A 1K4YA 1TA0A 4BNUA 3IP1A 3L7OA 3MS2A 1A9OA 3RNLA 4CM3A 2BFDA 5BPFA 2C96A 1JTVA 4TUYB 1Y6RA 2CY0A 2H1RA 2NZ2A 4FGWA 1XFDA 4R2LA 1IN7A 1WRBA 2C03A 4UM8B 1YZGA 4C6TB 4EKNB 1G0OA 4MYSA 1ESMA 4YAEA 5EVCA 5EIWA 3VU9B 4BWVA 1M1YB 2ZB4A 1Q7EA 1IDOA 5LYJF 3ZVKA 1D1QA 1WUHS 1O03A 3WYFA 1IATA 1FNNA 3HN6A 3R8FA 4HVTA 3AVYA 1TEHA 2B78A 2FR8A 1G5IA 1S02A 3B1YA 3HM2A 3M2TA 4NY1A 3VHRA 3RS4A 1MOPA 4F45A 5JE8A 1IWBB 3C4QA 2CNNA 2P9ZA 4YCBA 1H0HA 4LCEA 2WD8A 3RJ9A 4DG9A 1R6VA 2AQKA 5LZ2A 5F7ZA 4X41A 1QWSA 1N6PA 3SJAA 1YB2A 5LQDA 1RYEA 3CWZA 3NANA 4LJYA 3UPUA 5IJ0A 3PV0A 4QGSA 3GGDA 2Q2OA 2AX3A 2BMDA 1VB5A 2P6PA 3NEJA 4KXNA 3VJLA 4ZYXA 1K8RA 1Q7CA 4UAGA 3IHLA 1Y3DE 2Q4EA 1JUDA 1UXOA 2PLRA 3IT2A 3Q4GA 1RDFA 4RDIA 3P9XA 1DT3A 3OFJA 4AT1A 3U44B 1NVVQ 3EZ7A 2H4HA 3VNAA 2H1CA 1SVOA 3OZAA 4BWYA 3VSBA 1NJGA 1NQAO 3ISVA 3K20A 3L4SO 2QGNA 3H4IA 2PWZA 4XRGA 2X15A 4ZV7A 1ZJ5A 1IAQA 1J99A 1ZOIA 4J6EA 2SCUB 4NZNA 5HDBB 4ARZB 1Y7TA 2A7XA 4QUHA 1Y3FE 4KMSA 1Z6YA 3AHEA 3AUSA 5AKXA 1PLKA 3LD9A 2J5RA 4RVCA 5TT0A 4DSTA 1RLIA 5K51A 3FZQA 2WYHA 4IXNA 2OEPA 4M1QA 2QM7A 4JU8A 2IDZA 2NO0A 2YRXA 1X80B 3GO4A 1Z4QA 5CM8B 2UYYA 3BSFA 4JJ6A 5HM6A 4LXQA 4PR0A 4CMGA 5C5CA 3QX8A 4Q3LA 2G1AA 3AUYA 1I0ZA 4J9UE 2YY6A 3FR8A 5AJHA 1SHKA 2GCIA 4LX8A 4AMUA 5BN3B 1NSYA 3WGLA 2YS6A 2ZBFA 5DHPA 4GD3Q 1HDGO 1LDGA 5EI5A 2AR0A 3WIOA 4B4VA 2O7QA 2Q27A 5AKYA 4AG5A 1XVVA 2ZULA 5IK2A 4FE7A 1SU6A 2PNJA 2W2XA 3CMCO 1D7OA 5HIKA 1PUXA 1MU0A 2RGEA 2GN6A 3BXZA 3LPAA 4J1NA 4RIIA 5SV2A 3S6JA 4BKMA 3CWQA 5LNK1 4BRSA 4HAUA 2YQZA 3C5WP 4RDHA 1ZMOA 2G0TA 2GBLC 4KYUA 4F4IA 1BO6A 2QP9X 5K2OA 4UPEA 2WD9A 5EPOA 4NAVA 3EAGA 3HBNA 1JYSA 3H8WA 2VHUA 1E3QA 2OO7A 3F5DA 3LC1O 1DLJA 5DM60 4BC0A 4U3JB 3D81A 3FMGA 4NRDA 2EKZA 2XVXA 4JT2A 3TTUA 1SFRA 3PVZA 4MEJA 2AN5A 4EL5A 3KSBC 2XMDA 5AJUA 3WLLA 4UNRA 3GUYA 4ZI7B 4EYOA 2I55A 2WUFA 4AICA 1ID8A 1FYDA 5A62A 3R0IA 1TJ4A 3HA3A 4WESA 3F6SA 4CQMB 5E1MA 3CYFA 4PIMA 3C6XA 4YP7A 1PDWA 2ZFUA 1UBMS 3M49A 1QZ3A 1UK6A 3HDYA 1KK0A 2X40A 4GZMA 4YRLA 3RFCA 2BBTA 5H82A 4HVAA 4F72A 4GR5A 3AOEC 5KIAA 3GUCA 5HCNA 2R8BA 4JNCA 3MZ0A 1BCRB 4RPJA 3GT3A 5ALPA 3RDPA 5T4FA 3I9JA 5BY2A 2JCXA 2NN3C 2OZEA 3R09A 1G3QA 1SO8A 1MV8A 1NUUA 4TT8A 3TUJC 3AFMA 4EARA 3J81k 1JHMA 1MLDA 3EEFA 4B4UA 3NOOA 1AGYA 1D2MA 2DJ5A 3L41A 5KUTA 1Y8ZA 2XQGA 1YO6A 5GADl 1XVAA 1AKTA 2HRBA 2PXCA 4K6MA 1L4LA 1P4RA 1RRKA 1YRYE 3QQ5A 2Q50A 4XX0B 4ZQHA 1X1QA 1BEZA 1ESCA 1WTCA 2VP5A 2X8JB 3RRZA 1WQ3A 2PJRA 1CB7A 4WUTA 1KQGA 4Y2XA 5J4LA 2ZI4A 2AFIB 2M98A 2BI4A 2M1ZA 2NTVA 2XF8A 3GZNB 4ZYZA 5KX5A 1G9TA 5CDTA 3SYTA 2GLTA 4OA5A 1O95A 1BNCA 4PYRA 4ZYUA 2G1JA 3DC7A 3LBYA 2CC2A 2D4AA 2JDID 1FFDA 3UJ9A 4WKPA 3ROPA 2ZUDA 3HRIA 3OSZA 3UWOA 1G5QA 2OHJA 3FPHA 3K8QA 5EXPA 3PENA 4FYIA 3VHQA 2P1ZA 1N77A 2ZATA 2W43A 1K06A 3ZU3A 4AY4A 1SR8A 4BMDA 4YV0A 1KYWA 1T3GA 1YASA 4BKRA 5LCXA 2UYOA 3OUUA 2DHCA 4P4SB 4DLWA 1UM8A 5AW6A 3PTAA 4G67A 4NG4A 2C7QA 4FNAA 3EYAA 2IV2X 4NNJA 1Q83A 2EGHA 2QL9A 3OX2A 4Q37A 1LRLA 4E46A 1XMXA 5FBVB 2IHKA 1IOLA 1TTHA 3EGXA 3WRWA 2EERA 1EM8A 2VRNA 4LPKA 2A0YA 4YWJA 4D1YA 1X1DA 5HZGA 3EWNA 2VWQA 2C04A 3EAFA 1K8XB 2IXFA 4AY3A 1U1EA 2FETA 3KJXA 2YHBA 4OI0A 4Y2YA 4DQVA 2RHCA 4GI3A 3RYIB 5GJVC 4OI4A 2O2XA 1E1KA 1N7JA 3GPCA 1B8PA 1SKYE 3I8XA 3OI7A 3R0ZA 4ML3A 1GZ4A 3NIBA 3OLVA 2ECPA 4FSHA 4QNNA 5I48A 2C77A 3DDUA 2VDUE 1Q6YA 3LKDA 4L6IA 1ZESA 3EY9A 3ZUPA 1JX6A 2YC2C 4DKXA 1EFVA 3FPAA 2CLMB 1Q20A 5GAJA 1R9NA 3KALA 3W5IA 3UZUA 4NCBA 4OB7A 5M7EA 3T1QA 2ZWVA 4CKWA 5H16A 4J1TA 2FFBA 4RY2A 3WX0A 3L8MA 2Z83A 2O2HA 3MB8A 3LQQA 4KWHA 1ES9A 3RVRA 4A0RA 3IO5A 5IAAA 3EZGA 2P6UA 3JY6A 5LXTB 4D4IA 3H65A 2RBGA 1P6XA 4TKMA 3V97A 1ZOSA 2ONYA 4M1OA 4BLVA 4L5CA 1CR4A 1O9BA 2BW0A 3V46A 3WO1A 1O9HA 2X86A 4DMHA 5CTJA 3ESAA 2VNKA 2XXAA 5EA2A 2OC9A 4WBNF 1SUDA 2P90A 4UPVA 1TKAA 4QARA 2MIIA 3F6RA 5ITSA 2PS3A 5K20A 4KR3A 1CBUA 3ZCVA 1E9VA 1HE2A 3P2KA 4RTRA 1MT0A 3IUPA 1XHFA 3HYRA 1ZRNA 1ELOA 1V5GA 3RANA 3HSSA 4KQEA 4PX9A 4GKVA 4R1MA 5KNCA 4R8RA 4HQKA 2CWWA 4BO3A 4BCBA 1CZHA 1GG9A 1UDBA 1YZYA 2AR9A 3NQ41 5AYVA 3O8OB 2C7PA 2W2MA 2ZP1A 3ODPA 1XYGA 5IJ9A 4M1YA 2HDOA 5D1HA 1RWXA 2W6ID 2H4ZA 4UHDA 1D04A 1B0ZA 2ZDQA 2XUJA 3A28A 3A14A 4JC8A 4H7KA 4HI0E 5DX8A 3OD1A 2GILA 1DDGA 4LUCA 1SXQA 2YXDA 1B16A 1D5CA 2FWNA 3TLBA 3ZLUA 3JAMA 4X71A 2CJFA 2CEAA 1VLMA 4EFDA 1I5OA 3ABSB 3U48A 2CXPA 2H65A 4GXQA 1FPMA 2ZSUA 3PIDA 1CY6A 2C2WA 2KLHA 4GGMX 1KDTA 5CX4A 2QD4A 3NNSA 3A6PC 1P0CA 3OJOA 4FSDA 1U9CA 4UQLA 1JE0A 1QZTA 16PKA 1R6XA 3DPSA 4IBOA 4QBTA 5FPQA 4JLAA 3HI6A 1PUJA 2CB0A 3TW8B 3IVCA 3RHTA 3A1NA 2ZI3A 4JJGA 4RS3A 2IXAA 4ZOLA 4Z2YA 1JZTA 4LS3A 2QT9A 3PPYA 3P96A 2PVPA 4Z4FA 3GJ0A 3EW9A 1BCSB 3CNEA 3V7NA 4IDHA 2QG4A 3EXHB 4PPFA 4A0SA 5EIEA 4DV5B 4D98A 1JGTA 1ADBA 2GBFA 1BWPA 2IHVA 1N6RA 2IXTA 2Q7XA 2JAPA 1XK6A 1FNMA 4FS8A 4HH4A 4WLOA 3S29A 4FE4A 5BMOA 4AN1A 3IIIA 3RS8A 3GWZA 3UJ8A 5JJCA 1DBSA 3NBAA 1TA4A 2QDXA 1PAUA 3PZRA 4N0PA 4OBEA 3DWGA 1Z0FA 3E4DA 4W9NA 1BS9A 3GCGA 3T7JA 4D0SA 1BKYA 3OFNA 4GXTA 1Z74A 4WACA 4MCIA 1VPEA 5ALIA 3NATA 1RXWA 3FYSA 5JYCA 1YZQA 1VSQA 2XA1A 3CGGA 5T6MA 1NI4A 3EVBA 2QSYA 1XDBA 5DI3B 1P73A 3AZOA 3AL3A 4JUIA 1Z22A 2Q5QA 5ESWA 3WQQA 3L49A 1HX7A 3VPGA 8ATCA 1PFKA 1A8HA 2PTHA 2E48A 3F2IA 4LSGA 5F77A 3SY8A 5L95A 4X65B 4O4HA 3NVKI 4H3KB 4MKZA 4BE9A 3LCCA 3GELA 2QRNA 1UBHS 1VKNA 2R7AA 3O92A 4JLKA 4YPFA 3WKBA 3D5EA 1QONA 3IBCA 3QYPA 4BNNA 1O9GA 2CNWA 3QI2A 3KZCA 3ZJUA 3MTQA 2WAXA 4K2AA 2IYEA 3F8TA 3BWMA 4KVGA 4MJXA 4Y6LA 3VKVA 1N2OA 3OE7D 5K0FA 3SNKA 3PDIA 1ZITA 3JQ8A 2R2AA 2DT5A 5DWVA 3FZEA 1M6EX 5BW5A 3D7LA 5HXAA 1DRUA 1ILEA 5JW6A 1YGPA 1QDUA 4TXNA 1UCFA 4EHFA 2UYHA 9ATCA 1D6MA 2CK3A 1RT9A 5TEVA 4MQ4A 1AQNA 3O2NA 4HB4A 3TX6A 5K0NA 2FLKA 4GOND 2Z56A 3H1AA 1B7GO 1GJRA 4NBVA 2HCTA 1MQSA 2I9KA 4UM9B 3OD5A 5HE9A 3F5SA 1T9ZA 2GOYA 4OMDA 1TTPB 3CX4A 2MR6A 3GP3A 5HE8A 4DRYA 3WGIA 3D2AA 4WNAA 3GCDA 4OJNA 3RK1A 3KFLA 4XJTA 1RRCA 4BXOB 1KO5A 7ADHA 3P20A 4Z7OB 5AHKA 1SBHA 1UBUS 5FCDA 3AU9A 5JJ5A 5SYNA 2OPHA 1MZPA 4I50A 2ZJ8A 1TC2A 1QU2A 4L0DA 4OHMA 3JXEA 1VKRA 4X95A 4CCYA 4L5IA 2PBRA 1CUJA 1LTKA 2Q46A 2RJ3A 3HUDA 5LYYA 5KC8A 4EH1A 5IANA 1NN5A 1CF2O 1OLSB 4TLAA 3KCNA 2ZPUA 2Y9PB 2GH1A 2M32A 2OCAA 2ZT5A 4FBGA 4D99A 4URXR 1XR3A 5K6AC 2AI1A 1E7SA 2QL5A 4PZEA 3ELDA 1NOIA 3PT9A 5I01A 3FSRA 2OWDA 5F52A 5FYDA 1ECLA 1Z6PA 2IRWA 2Z2JA 3HYSA 3IUMA 4QXMA 1P0FA 5ECWA 1XTIA 1E64A 2WB2A 2Q9AA 2GF9A 3H5NA 1USWA 4BNDA 4GSLA 4HH0A 3EXG2 3CGWA 4CXMA 4W9MC 5JFOA 5FLXA 2CUTA 2HQ1A 4U5XA 3BT7A 2FZGA 5BVGA 5HA5A 5BSUA 1JLSA 5KOJA 3VSEA 3GEBA 4TLMB 4YJ2A 4I08A 3VGPA 3Q12A 3DEJA 1XZAA 1PJAA 1NBIA 4LFCB 3HR4A 2ZS7A 4IQ0A 4NDAA 4S1TA 1JFRA 1YCFA 4R7TA 3M1LA 1YGYA 4QEKA 3AUUA 5C1OA 2POCA 4DCVA 2PGOA 5F3DA 5IBQA 2OL4A 1X7ZB 2PUHA 1WZCA 5CVUA 1NSFA 4FYKA 1F48A 2WU0A 4FCTA 4JIGA 4PNPA 1SZCA 2FQWA 4L16A 5CEFA 4Q3BA 1QGUB 1R15A 4HFRA 3CKYA 3TSOA 3ECAA 4BX0A 4MKIA 3IAS1 4FX5A 4LY6A 1LBQA 1HO3A 3C39A 2PWPA 1U2GC 4M1SA 1EVQA 4CGZA 2D1RA 1DV2A 3R75A 1TCBA 2R5FA 3C70A 5DYIA 3VNVA 2KPOA 3LUPA 1EUDB 5BWBA 5JU6A 4DAOA 3WRXC 2I80A 2UUOA 5TQ2A 1IRIA 1L4YA 2YUIA 1N1EA 1OXMA 1V7QA 2O2YA 3JRNA 4RLFA 1GGFA 1SCAA 2CD9A 3EWSA 2B2CA 4DRXA 2PQ2A 3MUFA 1FE8A 1LK7A 3LP6A 4I5FA 5LYJB 3HJCA 3DXYA 1KO8A 4QGFA 2Y92A 3PXCX 4KPUA 1XZ8A 5PNTA 1U81A 5E8JA 1KARA 1M74A 2O8BB 1GZVA 1I4EB 2ZSJA 3KKZA 3DVQX 3KXDA 3FMPB 4PLWA 2OGZA 3TZEA 3L7JA 4ECEA 4KNYA 3DKIA 1I5EA 2VSQA 4JI4B 3QJ5A 3QKSA 4G5OA 1Z08A 3JQBC 2FPPA 3EF1A 4ZCSA 5H81A 4OUDA 1YOVA 5TGTA 1OC2A 4O2AA 4DLSA 4IIGA 1OXBB 1JXOA 4HQFA 3KSRA 3QBDA 4QPNA 4R1TA 3CZ9A 5D2CA 3ZE0B 4D3FA 3HVIA 5C4MA 3NEPX 3Q7TA 3ANLA 1IJEA 3D3KA 4NABA 4OQMA 5F1KA 4F3RA 4CHGA 3TEJA 1HC7A 4AW9A 5JXHA 3T3DA 1Y6GA 1GQSA 3BWCA 2Q2VA 3Q2IA 4TROA 4C0KA 2HF9A 2AC7A 1Z4KA 2WHEA 1LBIA 4E4RA 4MMXB 3ST7A 4G4SP 3INGA 5A5EA 5KTPA 1A9XB 1C1DB 1L4KA 4L2IB 1P6QA 5AXBA 1C0PA 2Q0QA 3I2YX 1PJLA 4L0MA 2W70A 4S05A 4MNTA 4WXEA 2PPLA 5LUAA 1Q22A 3G2MA 3VPFA 1YZVA 2MSEB 4PC1A 1CY4A 3MSCA 1X7HA 4LJ7A 4Q93A 4OHRA 2F9FA 2WUVA 4HDCA 4HRAA 3TZKA 4CMAA 1R7RA 2VT7A 1GHTA 3U3RA 1B1CA 1GRQA 4PSAA 2WUGA 2IVFA 3FLAA 2GX6A 1K89A 4JLDA 1QK3A 1NTRA 1ISHA 3F1KA 1J33A 4FDMA 1ANKA 5BN4A 2JHCA 3JWJA 2O3QA 3A6JA 2UDPA 4LJ8A 4ILKA 5F73A 4LNAA 1C3OA 1V6AA 2DH6A 4PRLA 1MAUA 2PQ0A 2BGMA 4QFMA 3H84A 4UULA 1AV6A 2G6BA 1SUSA 4IZ6A 4LFAB 4Z1MD 2IC5A 3IKMB 2XW6A 1WCWA 5ERXA 2Y4NA 2CLEB 1I1HA 4MQ6A 4P38A 2IFTA 3B6IA 3HV2A 4QYWA 3RQIA 4DYHA 4WECA 1FLDA 1VZ3A 4V39A 3O0DA 1KO1A 1R66A 1ZONA 4I4IA 4NJEB 2IUSA 4DV4B 4CETA 1JZSA 2BFPA 1X86B 4PGFA 5CHYA 1ZH2A 5BSGA 5C5DA 4ZQCB 3F6PA 4J7XA 1BKSB 4MQMA 1T2VA 3C7TA 4DJAA 3NTVA 4MYUA 3I04A 3LLVA 1GFZA 1JLMA 1XNGA 2I4RA 2W83A 2Y27A 3BGSA 3JD3A 3DWEX 1EZZA 3MB5A 4AWBA 4ZYYA 4V3CA 3ZV4A 1DRWA 1NKSA 3IAM1 3NOQA 4F12A 1YB6A 4TXMA 4BB9A 2O1EA 3CF2A 4PZAA 1QH1B 3QVGB 4FTWA 3K0FB 5A1JA 2FMXA 1D6NA 3CNQS 3D7MA 3VI4B 3ZQUA 4UQPA 1LQ2A 1W96A 2L69A 3DTYA 3MHPA 5BMVA 2AB0A 5KQRA 3T3MB 2E9SA 1VPLA 3ROGA 5LJLA 1JR6A 2UAGA 1N0WA 3HK2A 4JR1A 5JSFA 1KIMA 3HEBA 7REQB 1RPZA 1TX4B 1IPFA 1TEZA 1PGQA 4BWGA 4KGDA 2Y1DA 3CW8X 4YR9A 3SIRA 1XAIA 1N6IA 1RZ3A 5EHZA 2QP4A 2JLQA 4WOPA 2Q45A 2VDOB 2VF5X 3KLOA 1ABBA 3WR5A 3U7QA 1RI4A 3BOSA 4FC6A 4QRIA 2P0YA 1OAAA 1VMEA 2P7HA 1O4WA 2YC4C 3FMIA 4LVOA 2QD3A 2ODBA 2RAFA 5C7LO 2GD6A 3C3AA 5THKA 5C5EA 4Q3NA 1AQYA 2NVBA 1Y34E 2O2SA 4QHYA 3W78A 4BX9A 1QVWA 1E1CB 4Z4CA 3KTAB 4YGXB 1VJ1A 3K1JA 4YROA 3IALA 1N3IA 3OE5A 1C4OA 2O05A 2AUTA 1LW7A 1W1WA 2MOKA 4DQXA 3ORSA 2YHAA 2GS9A 1A8SA 3KT3A 5CUQA 2ZM5A 1PN3A 4EDFA 1ICIA 4B4WA 1SURA 1N2IA 4W4TA 3B8EA 4U2EA 1CUEA 4C30A 1F6DA 2I71A 3BEDA 4N5NA 1Z6XA 5LQNA 2QV7A 3ZDDA 1PR0A 4CFSA 3HGMA 2PL1A 4Y2SA 2MSDB 4LRYA 2W37A 3ZGOA 1KYVA 1C8VB 1RMTA 2IZ1A 2QNRA 1XELA 5HMMA 3G79A 1AUOA 4DR5B 5CLHA 4MARA 4B6GA 4CKEB 2A58A 1O6ZA 2M9MA 3VZRA 1O94A 3HC7A 3DDZX 3TQTA 5JFTA 3M1AA 4IS3A 1Y7PA 2RHRA 3C41J 3P9NA 4KK4A 4LQCA 1LBEA 4NEQA 3CPEA 4X20B 1D4ZA 1GITA 1E9SA 1QZXA 3OPYA 3E0QA 5AJWA 3DMNA 2R6AA 3G2IA 3RU2A 1KZ1A 2JA2A 4Y9DA 1NF3A 4WKBA 3OCCA 1HYHA 4L8VA 1Z28A 1H4QA 1IH8A 5MHTA 1WL8A 2V7BA 3G68A 3OA2A 1YRWA 3RK4A 4D79A 4WKGA 4M9CA 5AI5A 2A78A 1SNYA 1C80A 2BBSA 1WPGA 3MJ4A 2XD9A 3P45A 4KQHA 3DF9A 4QFBA 3STHA 3K15A 6NULA 4UBLA 2C99A 1E89A 3AEUB 5JRZA 5EMHA 2JVIA 1M33A 3EOBI 1MFPA 1XV5A 2JFWA 2E4ZA 3PEEA 4K9RA 2C9BA 4O4LA 3HCNA 4X3PA 2OQIA 2WHPA 2ZTMA 2FUNB 4KIWA 3GFPA 3ZUGA 3T5AA 4AU1A 5C1BA 2G67A 2Q7DA 3SMQA 2X1HA 4KC0A 2HF2A 2PA0A 5LA6A 4UNSA 2RK6A 1VE6A 4L3OA 2C5AA 4MV9A 3F71A 4R2IA 1T9AA 5CT4A 1E58A 1U98A 4JUCA 5TMDA 3LIIA 2PSFA 4UHBA 2C57A 2X3UA 1DJLA 4LYJA 5COAA 3HFRA 1LPNA 4J0FA 4P5PA 1FYXA 3PWZA 4QSHA 1RVV1 3WL6A 1KXJA 4YX9A 1FMLA 2ATIA 5BNWA 1OGJA 1AK9A 1QORA 1U8XX 4ND2A 4WBNB 1PZNA 2HK7A 1TJPB 2IYVA 1ZN7A 2BZSA 3PPIA 2IF0A 2PZAA 4R5HA 3TJZA 1L8XA 5KYYB 3BK2A 1CUDA 1KC1A 1Z0AA 3NBMA 4PTZA 4C4RA 1SG0A 1WCIB 4OJTA 4CIBA 1LF0A 4HB2A 3JYLA 2BT4A 2AJTA 3V1YA 3X1ZA 1UFVA 1PS8A 4L50A 2VQDA 1D1SA 3K92A 1V43A 2YL2A 3JASA 4OH7A 1SKYB 3HU2A 3H16A 3CZRA 4KXYA 4MUFA 1FY2A 1DKLA 1V8DA 1MVNA 3OU2A 3CEAA 4GOKA 1YNOA 5AFSA 1WBDA 1K63A 4N8SA 4N18A 3HUTA 1GV0A 4F2WA 1JDBB 2XTNA 4RDCA 5K0SA 2PY6A 2ZYIA 3VAAA 3NAGA 4NX2A 5DNDA 4RKWA 1XPRA 1HBJA 3SHQA 3H6KA 4QIHA 5G1PA 1P0MA 1CHDA 3ZKWA 2QRQA 4JB3A 3STTA 2Z9CA 3GJYA 2HK6A 3O1IC 3UAWA 4LRXA 1ETUA 1OAOA 4IS2A 4U9IS 5TV2A 3FI0A 5BSVA 4M8IA 3JSAA 1QIGA 2WYIA 2XCQA 4G0UA 1WDKA 2XQJA 4FFBB 2AWNA 4WNIA 2YZMA 5BQ5A 1XZPA 1NQOA 5ECYA 1E2LA 4DMKA 4KXVA 1PG5A 3I6BA 1FSZA 3W7BA 1B8OA 4INOA 4ZAVA 5M04A 1H42A 2QVCA 2R5WA 4KPGA 4R3WA 1JB1A 2R5NA 1S1MA 3KUCA 3HCEA 3NBXX 1CD5A 1F06A 1RQLA 2H9AA 2IBMA 1Z25A 3FTDA 3QG5A 4AZ3B 2A9JA 2WIBA 1ZJYA 4QTTB 1M2KA 3NOVA 2BFFB 4M9ZA 3DQPA 3RHFA 1I94B 1T5LA 1UPBA 1YDFA 5JNSA 3S99A 4IP0A 1JFSA 1ZW1A 2P2ZA 2X2OA 2H54A 3PE3A 4URZR 1DI0A 1R8XA 1QQ7A 3BE5A 3IFSA 3KG2A 2C2HA 3R3ZA 1C9YA 1RQPA 3SI7A 3WBBA 4Z7QB 5IFLA 3MTIA 5JI2E 2G1UA 3BQNB 3MXTA 2WSBA 1SBZA 4B0OA 3BXHA 1IPHA 3AEQA 3KUXA 2IX9A 1IUPA 1YRHA 4E13A 2Y71A 1E4EB 1D7AA 5IN4A 1QO0A 1OASA 2G06A 1UAGA 1SK9A 5KJFA 4Q9HA 1MJGM 1TU4A 3EPKA 1VCHA 3D2BA 3K9CA 3WP0A 5EZSA 5FBKA 2WNIA 1L2TA 1EXDA 4X54A 2I2BA 5EWJB 1DB3A 2QU8A 4EUHA 4HLDA 1USGA 4CM6A 3LOUA 2PKXA 1N2XA 3U7FB 4DUGA 1WABA 4OO3A 3CBGA 1Z38A 1YRLA 4GI2A 4WZ6A 3SJCA 4DIUA 1K68A 1NLUA 3AFNA 2V98A 2SNIE 4B2IA 1S4QA 2WJ6A 4UM7A 4HF7A 2NMVA 1T36B 3KO8A 3E70C 1RD4A 1DC4A 3SVLA 4ZMSA 1N2HA 3PUKA 4A9AA 3CF4G 3ZCSA 2XUAA 4P5DA 3BDVA 1DINA 1GZ6A 3RAFC 4WX2B 4Y2UA 1CLEA 2QQ0A 4GPZA 4IHJA 1YS2X 1RPAA 3SC3A 3MXOA 4ZO7A 3NWEA 5BQPA 4IIHA 1M6VA 3B2QA 4FFNA 1B41A 4UM5A 2P3QA 3Q6MA 4NZPA 1L8QA 4JI5B 3RC2A 4LXUA 5CNIA 3H3XA 5ELMA 5IFKA 3RIGA 2I1WA 4I5EA 1M1XB 4JR0A 2EYQA 1XZCA 2GNOA 2HMUA 1E2GA 1NLZA 2J9FB 5JAHA 2JG3A 1PD0A 4RK0A 4A5SA 1FJ2A 4URFA 2X5KO 2WWRA 3O4RA 4RA6A 1GNQA 4U7FA 3AFOA 4QA9A 1NW5A 4LRTB 1FP4A 3AJ8A 3RTEA 4DEXA 3HJUA 1H4VB 1N6LA 2TRSB 3WLMA 2HSGA 1HORA 3HZOA 4ZC8A 3PFKA 3UJPA 5DBGA 2V6MA 3NUQA 4LEIA 3JARB 5G0UA 3FF1A 5BVHB 2OHVA 3TIIA 3JQPA 4EG5A 2YY5A 4JROA 4RD4A 5MFZA 5BN5B 4K9DA 4OH1A 4W5JA 2WHXA 4TL7A 1NOKA 4P98A 1JLLA 1CQJB 1XZJA 3QOYA 3WFZA 4RAOA 4EPRA 2XWPA 1CVLA 2B1RA 2X0KA 3QLUA 4YS6A 1EE1A 2XIQA 4Q7JB 3O4IA 5TVKA 2RC6A 3D59A 2ZUFA 3PQFA 5LA6F 2GYVA 2FF7A 1A04A 1EVKA 3AF5A 3HCDA 5F35A 3RREA 4MKFA 5EZ5A 4CN8A 2DC1A 1KZ4A 1RACA 4TGLA 4WCFC 2VPZA 2O4CA 2JGRA 1PHRA 1XKQA 3NHWA 4QBKA 1B00A 1Z5OA 3E9QA 2SKCA 2PUDA 2QP3A 1BROA 2I3ZA 3CLSD 1VI6A 2IIPA 4TKLA 3O9MA 3TNLA 4V1CA 4BNMA 1H2BA 4B71A 2F8SA 2HB6A 2FLVA 4FEYA 4HQ6A 4ROTA 3R6WA 4UDNA 4F3CA 3CT4A 5JQWA 3DCIA 1CUZA 2HUNA 1NG9A 4JVNA 4MVJG 1BU8A 4DLBA 3KOOA 3L6EA 5HX7A 1VRWA 2VT3A 3L46A 4LZAA 3B12A 4URVR 2GO1A 4LSZA 3G0OA 2VF7A 1H1LB 4G1VA 3NJ4A 4NCIA 1RRMA 5A5FA 1EFRA 2F3QA 3RKSA 4HDSA 3TIVA 3E48A 2DR2A 1YDHA 3JYPA 2VDPB 3L02A 1UQRA 1E0DA 3LCRA 1YE3A 2XMGA 2XE4A 3WADA 2ENWA 3NR2A 3CE6A 4Y0NA 1YR6A 1GADO 2Z4RA 3OIDA 3OY7A 3FUTA 5A05A 4C7BA 1FDRA 1U63A 1MAVA 2EW2A 1XZIA 1OI4A 2XRMA 1W59A 4D82A 3NB0A 3PRHA 3S2FA 4OHWA 4ZOAA 1J5EB 3JAWB 5L6MB 3IQEA 2XB9A 4GSKA 2VOEA 2IYFA 1EU1A 3N75A 4GFDA 4DFDA 5GVSA 2YDXA 3STYA 2X2PA 4R3UC 3AR7A 1X38A 2H2WA 3LYAA 4A10A 4JBIA 5TQVA 4PRYA 3CH5A 1V16B 4R51A 5CXQA 3OZFA 1KSFX 2OQVA 1N5MA 2A9VA 3AG6A 4OJYA 3ONEA 3WIBA 3ZE7A 2HU2A 2QLTA 1IJFA 1M2JA 1MP0A 1GDDA 3QWIA 2PSSA 3W7AA 3Q5DA 2UVDA 1PBNA 5K45A 5AVTA 1IK6A 1CK4A 1XJWA 1ZJZA 5DNVA 4KIGA 3SZ3A 5KSYA 2WJYA 3ZBTA 4JLPA 3PJRA 4NENB 1KAEA 1ODLA 1UANA 2NXEA 4UU7A 4N6GA 3SR4A 1KJ8A 3VM6A 4F8EA 3MPUA 1K5GA 4QOGA 1UK9A 2OZVA 3KR9A 3RR2A 5DPMA 1WXDA 1KI4A 4B44A 1S3GA 1KQ3A 1PK7A 3TCKA 3PF8A 3K73O 1H5QA 2H4YA 2JIQA 1ZK3A 4U2KA 2DUWA 2P35A 3VKWA 1FDIA 4DLRA 3PR1A 2ACWA 2DLDA 3CQ9A 5IYZF 3AUJB 3WOHA 1PW5A 1JSRA 3MELA 3OP4A 4DNPA 3VPBA 2TMYA 5SY4A 5K3EA 3GMIA 3BMNB 4M8SA 4Z0TA 5KJCA 2C2ZA 2JHFA 3RFFA 2CFOA 2V7EA 3D8BA 3QW4B 4R0MA 1XMQB 1HKHA 3HE3A 4IJVA 3QA9A 4CFZA 5DP1A 4QGGA 2YCLA 1FDUA 4EJMA 4DIFA 4B3XA 1FZQA 5TPWB 5IU6A 3O03A 1U1CA 1DKNA 1FQOA 3WYCA 3WSTA 4YMGA 1Q1GA 3U39A 5IDQA 4NESA 3IVGA 5IP5A 2HLDD 4RV5A 1LCIA 5FORA 5ICMA 4MGHA 3P1JA 5C35A 8ABPA 1ZOOA 4LXHA 1FMCA 1PJ4A 2QM3A 1WKBA 3PHCA 3MMSA 1NW4A 4LZPA 1I8TA 4ND4A 5E4YA 5KYTA 2G0NA 4U1RA 3H2YA 1TT7A 1SD2A 2PYIA 3ROKA 4RQBA 4BP1A 5I5GA 2P27A 1JMVA 4HCJA 2IHBA 4A15A 1C0EA 3IT0A 4AWAA 4BVKA 4G9EA 2LCQA 4E08A 1ODFA 5IT9A 5FPTA 1N2CE 2YVUA 3AI2A 3QLTA 5ERYA 2WEKA 3K0AA 5IDVA 5IJXA 4BQOA 1FRVA 2Q7OE 2ZIWB 4RXMA 2J5BA 1IM8A 1XLUA 1WV1A 2YJTD 3TTTA 2VQFB 1KL7A 1LF5A 4ZVLA 2R6DA 4F5DA 2PMCA 2VP3A 1EHCA 4I66A 2OK8A 1R6UA 3O38A 4XLTA 2PLNA 4DNXA 3OWXA 4RD6A 4AQDA 4FP9A 1MFZA 5IHPA 4J8PA 2PNFA 3EGCA 5EP1A 1VPWA 1W93A 3FGNA 4PX3A 2HK8A 4E07A 4PC6A 5FADA 4KQJA 3G88A 2YYYA 2E82A 4JS0A 3QZUA 4JEUA 5A6SB 1SKUA 3CUVA 4Y1GA 3OEHA 3UPTA 3L0SA 3AM4A 3BKWA 2YR0A 5JS7A 1J5XA 1OV4A 1R0LA 3ASVA 4KDCA 3O0TA 2I7DA 2DM6A 2LXNA 1C4WA 3RD5A 5GM1A 1H69A 4FFLA 3ZH2A 5BORA 2EATA 5IXYA 3TRDA 1JXAA 2RCYA 3Q3EA 3KXKA 3EPPA 3QWAA 2WFZA 1C9MA 5LZ5A 4L07A 2JLBA 1CX9B 1DUIA 1EXWA 3FOEC 4A0HA 2ZGVA 3CXRA 1W8IA 3G9TA 3RUCA 1RI1A 2FY8A 3Q3CA 1E1QD 2ZR7A 1E2QA 1HWYA 2V45A 3AQ4A 1KH2A 2W93A 5IZ4A 3SHWA 2IUUA 2J48A 1C8BA 5MGNA 1K08A 4C0LA 5HQTA 4O08A 2P3OA 1J1IA 1KK3A 3K70D 4Z3OA 5BWCA 2VL7A 2Q2WA 4EELA 1QX4A 5HJ7A 4YQZA 1YA4A 1J7KA 2JFFA 1NR1A 4NZ9A 1NJSA 4EYGA 1U9IC 1XTUA 2QPLA 3SGLA 1XRJA 4GWGA 2P68A 4Q15A 1KI9A 2WABA 3MW8A 1IIRA 4M38A 2RGGA 3OCVA 3VR5D 3W5JA 4BBAA 1E3DA 3O2JA 3R20A 4DYVA 4ZZ0A 1BDJA 4GWKA 2H4JA 3K9HA 1KTVA 2ZETA 2G04A 3Q8WA 5HS6A 3BGVA 2C9OA 4RPIA 3P8ZA 4G01B 2JGIA 1JMKC 4K9KA 1RCFA 4WL0A 4JGBA 4H7DA 1RCTE 1U2ZA 1DQSA 2HDWA 2FQYA 2AK2A 1F9AA 3ASUA 3M0EA 4RLHA 2QTAA 1M9NA 2YXLA 1V0JA 1DQPA 5CYGA 1Q0TA 4MAFA 5DASA 3MINB 1R18A 4B4KA 2WICA 2B1GA 1L7NA 4DWJA 2NVWA 2NUPB 3TTYA 3UJ3X 2GRUA 1C1YA 1E2IA 1Y9DA 2NXNA 3VTFA 3W8DA 1UKYA 4XX1A 3A04A 5AXAA 3FSGD 3AMVA 3I2FA 3NEAA 2EKDA 3DBLA 2Q6OA 3NT2A 1WX1A 3IPYA 4ZMBA 3IKLA 4QM7A 1DG9A 3H1TA 5HF6A 1TVMA 2WZDA 3L01A 1Q74A 1NT2A 2HY7A 4UU1A 3EH2A 3OH8A 3UT0A 3L0CA 3TI9A 1L3CA 2GN1A 2ABWA 2ORIA 1XCMA 2P9BA 2IYOA 1XTRA 2V7PA 3C87A 3DBHA 1HDCA 3L8ZA 4TXLA 1M34E 3F9CA 3PSHA 4KXLA 4WRRA 3WYBA 1I3LA 1WU7A 3CBQA 1E92A 1QNFA 2BHLA 1YIOA 2HMTA 2VO1A 1MAAA 1V9CA 1PK8A 2UVQA 2FZEA 3B1XA 4LOKA 4RZUA 4D9BA 3CV3A 1A71A 3EQ8A 4M36A 3AKZA 1X15A 1QLWA 3BFKA 1XKTA 2POQX 3KTOA 3AIKA 4II7A 4JMLA 4O0MA 5AVXA 1Z4MA 4CKYA 4B4DA 6AT1A 5K0ZA 2VCYA 4YT5A 1K2VN 3SXUB 1T8YA 5TC4A 2BGLA 2EFYA 3VISA 2J1LA 3GLKA 1HT2E 1C9EA 3I83A 3UGJA 2XMBA 3AUKA 4N5DA 1N6KA 2X19A 1QRSA 2WSLA 5EZYB 2FP4A 4E2XA 1R4ZA 2PZJA 2Q4TA 4P83A 3VHXA 1I7SB 4ROSA 5KYUB 1JR3E 4NCKA 3Q3IA 3G1TA 3TB4A 2QIPA 4TS3A 1RYNA 3OEEA 3R6GA 3RT1A 3FCEA 5KNDA 1ZZGA 3TLGB 4NECA 3LDUA 1USVA 1TI7A 2J59A 1T8SA 1F5SA 1MO6A 4MA4A 5AR1A 1G6KA 1V26A 1QCDA 4HTFB 1RQ7A 2ATCA 4PS1A 2FW1A 1VYTA 1RYYA 2VRCD 3N5CA 4AUMA 4E5DA 3GJRA 1KI2A 4HHEA 1B8NA 3F4KA 3OJCA