3KQYA

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-7-ol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqyA00
3MB5A 5P8WA 2ZSUA 3C0KA 4OQEA 5FQOA 5HZMA 4HC4A 4RTRA 5E9JA 5EMLA 3G2MA 4PYNA 4A6EA 5DTMA 3EGEA 1I1NA 4U7PB 1YUBA 3GGDA 3B3GA 1BKYA 4RVGA 1XTPA 3QOWA 3NWEA 2PVCA 2BZGA 1VL5A 2HNKA 3SXJA 1NKVA 4KDRA 5C9ZA 3I64A 1G8AA 3SX0A 3BGIA 5EHIA 5CVUA 3FUUA 2YXLA 1XDZA 3LDUA 1KHHA 5FADA 4BY9E 4AUKA 4E33A 5JR3A 4MIKA 2C7PA 4E2YA 1R6AA 5FWDA 5E1BA 2QRVB 2UYOA 1TW2A 2BR3A 4C08A 4YV2A 3IYLW 4RTJA 2O57A 3LBFA 2PBFA 4GOMD 4RX1A 1XDSA 4YMGA 2NP6A 1FBNA 3UJ7A 5K0EA 5G02A 3CCFA 1EAMA 2DPMA 4PYQA 1G6Q1 5CVEA 2PX5A 3NWBA 3SR4A 4EK9A 5HEKA 1EG2A 1I9GA 1ZG3A 3EVBA 3ORHA 5FQNA 3GJYA 5EEHA 3NTVA 4IKPA 4PGHA 3TFWA 3DXXA 4BLWA 1OR8A 4RVFA 1SG9A 3KPJA 3EGVA 1X1CA 3G2OA 4R6XA 1VE3A 3CJTA 3EVAA 1P1CA 2O07A 1M6YA 4YUYA 1X1BA 2PXXA 3LCVB 5EIFA 1R8XA 3KPUA 2G8NA 2H11A 1ZHFA 3EEYA 5DLYA 3A26A 5C1IA 4CTJA 2Z6AA 5DM4A 3GIWA 2O0LA 3GWZA 4FSXA 3BWCA 4P7KA 1QZZA 1UFKA 2ESRA 2YUIA 2QM3A 3P8ZA 1ORHA 3KR1A 4GOND 4M38A 3HA7A 2V7EA 7MHTA 2PT6A 3LL7A 3HTXA 1D2HA 1KXZA 1QYRA 2B3TA 4L7VA 3RODA 5CCXA 3HCDA 4DA4A 5CUQA 3HVJA 3LX6A 5LQCA 3BWMA 1KR5A 3CC8A 3TR6A 3P9CA 4DF3A 3EGIA 1IM8A 3E23A 2AOUA 2NNWB 4WVLA 5E9WA 1NBHA 5DRYA 5DX8A 1FP1D 1XDUA 5CIYA 4HGZA 1SUSA 1ZGJA 5EHGA 4HG2A 2F8LA 4DM3A 1UWVA 2HR1A 2JHAA 1SKMA 3NMUF 1PRYA 2PWYA 3REOA 3E05A 3LPMA 5K05A 1JQDA 3LHDA 4KWCA 8MHTA 4ER7A 3KPVA 3GU3A 2JG3A 3HVHA 1HNNA 3TM5A 3LCUA 3SSNA 3EVEA 4Y2HA 3OCJA 5EVJA 5DPMA 3C3YA 4GF5A 3SMQA 4RTQA 4KRGA 3KPWA 5T67A 3LECA 3KU1A 2I62A 4OBWA 2CMGA 1RJGA 2AOXA 3OZRA 4GC5A 3TKYA 3T0IA 3NDJA 4PINA 4QTUB 4PYOA 2ORED 4GEKA 3G8AA 2QRVA 1H1DA 3KQTA 4PCLA 4QVGA 4YUXA 1DUSA 1MHTA 4DMGA 3FPJA 1QAQA 2ZULA 4FZVA 5T6BA 1VP3A 3G88A 3KHKA 3OFKA 4A6DA 4EKIA 5FA5A 2C7OA 3A4TA 1FJXA 2IP2A 5BW5A 2JHCA 3TOSA 5B1SA 2CWWA 1I4WA 2Y1XA 1X1AA 4HH4A 3R6TA 2P7HA 4QDKA 1WZNA 2IDJA 1SUIA 2OXTA 4YV0A 2I6GA 3P97A 2NP7A 3ELYA 3TM4A 2UYQA 2PKWA 1NV9A 4X63A 4PYJA 5DRTA 1N7JA 1YFJA 3H2BA 5LR6A 5LQNA 2BM9A 2GS9A 2HMYB 3LDGA 4LWOA 3UJBA 3MHTA 4PYMA 1WY7A 2BR5A 2P1DA 2AVNA 3LCCA 1F38A 3BGDA 4XUDA 2NYUA 4M36A 2VDWA 3L8DA 5CM2Z 4E70A 2ONZA 3F4KA 1NT2A 4RTOA 3QOXA 4X61A 4E2XA 3UJ6A 4F86A 5KS2A 2C7RA 2BH2A 10MHA 9MHTA 3MTIA 3V8VA 3A7DA 4FT2A 3SGLA 3AXTA 3KR9A 1DCTA 3KQYA 3GDHA 1EIZA 3KQQA 3I58A 4M7RA 5HFJA 4C05A 2ZW9A 2UYHA 3KR0A 3IEIA 2C7QA 3PFHA 5EC8A 3FYCA 3ANXA 2YTZA 5E2AA 3HEMA 2V74B 4RTKA 3VC1A 5EPEA 1WG8A 1RI4A 5K01A 2BM8A 2XYVA 4FR0A 1ZQ9A 3UBTA 2Z6QA 1Q0SA 2OB2A 5HILA 1AQJA 4G56A 3E8SA 4PYKA 1XJ5A 3CBGA 5JUWA 4QPPA 1KPHA 2NXJA 4OBXA 1NW5A 4GOLD 3K6RA 2FK7A 3HVKA 5FCDA 4AZSA 5GINE 2WK1A 3EEOA 4NECA 4HGYA 2HWKA 5K8VA 3BGVA 3JWIA 5EEGA 2LD4A 5CVDA 1R18A 2B9EA 3PX2A 3ER9A 3BKWA 2P7IA 2ZBPA 3DLCA 2QYOA 3OE5A 3ELDA 5GM2A 4CWAA 5DM2A 3KQMA 1XCLA 2IGTA 5T64A 4CTKA 1IY9A 1KYZA 2FHPA 4RVDA 3BZBA 5DXAA 3TKAA 2A14A 3UFBA 4GUAA 3SVZA 2IBSA 4BLUA 4IWNA 1N2XA 5LQUA 5K03A 2O06A 5DM1A 4BP1A 2AZTA 4MQ4A 2NXEA 4XUCA 4DCGA 2I9KA 5K0NA 1YZ3A 3FUTA 3O31A 1AV6A 2ZZKA 1EJ6A 4E31A 5BXYA 1NBIA 4OX9Y 2ZTHA 1RJEA 1QANA 4ISCA 2IH4A 3MGGA 3FPFA 3LBYA 4MWZA 4DCMA 5E8JA 3AWIA 2AVDA 2VZ9A 4GC9A 2O05A 4QQKA 5EKXA 5EQJB 4DZRA 5GM1A 1Q0TA 1P91A 1JTEA 3FPEA 1JSXA 5IH3A 4PYIA 3HNRA 3HVIA 2UZ4A 1G38A 1P39A 5DTQA 2AS0A 4KDCA 5EMMA 4HTFB 3P2KA 4R6WA 5GIPE 3X0DA 5CD1A 2AOTB 4HRAA 2P3OA 1Z3CA 2PT9A 3MAGA 1AQIA 3Q7EA 3UJDA 4AZWA 3KPYA 4FS8A 2H1RA 1L3IA 1TPYA 2FPOA 2Q41A 4OA8A 4PIPA 3R0QA 5GIOE 4GQBA 2AOWA 4X41A 5MHTA 1VLMA 1O54A 2OZVA 3B5IA 4CKBA 4CKCA 3JWGA 4X1OA 1HMYA 4RSRA 3PT9A 3OU6A 3FPHA 3M70A 2HV9A 1O9HA 3FUVA 4QDJA 4C03A 1T43A 3MERA 1U2ZA 2XYRA 5HIIA 4E2ZA 5HIJA 3DXZA 4XCXA 5HIKA 3CJRA 3KQSA 5DX1A 4OA5A 3NW9A 3P9NA 4BLVA 1L3CA 2OYRA 2GH1A 5K0JA 5HOQA 1EQAA 2P8JA 3B3JA 4PNEA 1QAOA 3GRUA 3TLJA 4Y30A 1L1EA 4RVHA 4V0RA 1MJFA 2YVLA 5K09A 1O9GA 4ER3A 4DKJA 2YXEA 3OFJA 2GLUA 4JXJA 1JG1A 2EJUA 5DT2A 2GB4A 1XVAA 3PB3A 1YB2A 2EFJA 1NV8A 5K0LA 4ER6A 1YFLA 3CKKA 2IFTA 5CVVA 3GRVA 3UA3A 1JG2A 4LG1A 5F2OA 2DULA 1NE2A 4UOEA 2G70A 3DLIA 2WA2A 4KVZA 4V0QA 2ZZNA 3I53A 3OZTA 4C06A 1JTFA 3HA3A 3KQOA 3NDIA 1SQFA 1RI3A 4PIMA 5FA8A 5ICFA 3VYWA 5ICCA 2JHPA 2BR4A 1JQEA 3T7RA 5ICGA 5E1DA 5ERGB 4ER0A 3HCAA 5E1OA 4RTLA 1WXXA 2AN5A 1XCJA 2OBFA 2P3QA 3G7UA 3HCEA 1RI1A 1RJFA 3SSMA 1X1DA 4X60A 3DULA 4P7FA 2I7CA 4RWZA 3P9IA 3PFGA 4C07A 5DM0A 1G55A 5K0GA 3G5LA 3ER8A 3DR5A 3M6XA 4B17A 4F85A 1WXWA 5GP1A 2YX1A 3MQ2A 2AOTA 5E1MA 4ATNA 4WXHA 3RW9A 1R8YA 3GCZA 4RV9A 5EIWA 3SSOA 3LKDA 3M4XA 1L3BA 3THRA 2PX8A 3U81A 2UYCA 1EJ0A 3IV6A 4QTTB 3VC2A 2FYTA 3AY0A 3GRRA 3A7EA 3QV2A 2WA1A 3HA5A 4R8SA 1G60A 2AOUB 4K6MA 3AXSA 3E7PA 4PGGA 3LSTA 4QPNA 3C6MA 3UWPA 3FTCA 2CL5A 5K0BA 4PYLA 2OY0A 2JH8A 4O29A 2AOVA 3FRHA 5LQJA 3JWJA 2PWPA 4RYLA 3GO4A 4GBED 1VBFA 4PCAA 5E2BA 3V97A 1SVUA 2B25A 1KPIA 1TW3A 2B78A 2XVAA 4YUVA 1PJZA 3T7SA 3DOUA 3I5UA 5C0OE 5KVAA 2R6ZA 1BC5A 5EGSA 1ORIA 3OU2A 5EG5A 5EMKA 1V39A 4RTPA 5IKMA 5KQRA 1WS6A 4IV8A 3HCFA 5LSAA 1KPGA 3K0BA 2P41A 3FTFA 4Z2YA 1VPTA 4FGZA 3UJ9A 5DTRA 1N7IA 3ERCA 1JSZA 2VS1A 4FSDA 3DP7A 4P7GA 1INLA 2AR0A 2PX2A 3THSA 3SM3A 2ZWAA 5FHRA 2G71A 2GAFA 2H00A 3GXOA 3JWHA 5KYGA 5LQAA 1VP9A 5K0FA 5DXJA 2PJDA 5EKUA 2IH5A 4OQDA 1XXLA 1RI2A 4EQZA 1G8SA 1JG3A 3P9KA 3G2PA 1BOOA 4H0NA 2OPBA 3KQPA 4KIFA 2AN4A 4P58A 2PSSA 3HP7A 2PY6A 3M6WA 4KIGA 4EKGA 3CGGA 3UJAA 3MTEA 2ZLBA 1VIDA 1NW3A 2B2CA 4BP3A 3G2QA 3GRZA 2JJQA 3CJQA 1Y8CA 3ME5A 1YF3A 5EMJA 3O4FA 5D1HA 3FPGA 3BWYA 4M37A 5GWXA 3B89A 3P2EA 4KW7A 1NW8A 2E5WA 2QE6A 5FULA 5LQKA 4RTNA 1KIAA 2P40A 3MCTA 2EJTA 5F2KA 2IDKA 4PWYA 3HCBA 1NW7A 1VQ1A 1R00A 2FCAA 2IPXA 3S68A 5CVJA 4FT4A 2ZIEA 4AZVA 3KQVA 3UJCA 3BUSA 5F2NA 4LECA 3DMFA 3ELWA 3NVMB 4ER5A 3M6UA 5ICEA 2ERCA 3O7WA 3DH0A 5FHQA 4YUWA 4RTSA 4MHTA 2VP3A 4EMSA 1UIRA 2EX4A 2JH9A 2OB1A 3D2LA 5E9QA 4CXMA 3HCCA 3PTAA 3PLAE 3BWBA 1ZGAA 3EPPA 1D2CA 3LDFA 4POOA 3TPZA 3EVCA 4E30A 3VSEA 3OZSA 1RJDA 4XUEA 1P1BA 3Q87B 2ZZMA 3PS9A 2P3LA 2XVMA 5M5BA 4RTMA 4C4AA 3C6KA 2ZBRA 1JR4A 3NVKI 3A27A 3BXOA 3DTNA 2NXCA 2Z6UA 5EZQA 3R24A 5DX0A 5U4XA 1JG4A 1IXKA 2YXDA 2N47A 3EVZA 1KP9A 5EOVA 4QQNA 3FTEA 5HIMA 1NW6A 2YR0A 3UA4A 3A25A 3KKZA 2IH2A 4P7JA 1FP2A 3HM2A 2G1PA 1X19A 1ZKDA 2AN3A 4CKEA 2KW5A 2ZIFA 3ID6C 2FK8A 3FRIA 3OPNA 3UJ8A 4YV1A 3LGAA 2ZVJA 2EG5A 3EVDA 4HSGA 3OE4A 2QY6A 1RI5A 2P35A 2ONYA 2PV0A 2OO3A 3DUWA 2R3SA 2VDUE 3BKXA 3GNLA 1SQGA 4AX8A 1M6EX 3DMGA 5LQRA 3PX3A 2XYQA 4GOOD 3FUWA 2IBTA 1F3LA 2ZBQA 2XBMA 3G89A 3T7TA 2ZCJA 3EVGA 2HTEA 3EVFA 5D1NA 3UZUA 5CCBA 3R3HA 4R8RA 1AF7A 3M33A 3TQSA 3PVCA 4E32A 3DMHA 2CMHA 3FYDA 5GOZA 1BHJA 4R05A 3RIEA 1D2GA 2Y1WA 1JQ3A 3TRKA 4YUZA 5H02A 5DSTA 3OU7A 3FZGA 4IV0A 4PONA 1R74A 3GRYA 1KYWA 3WSTA 2GA9A 3NJRA 3IHTA 2IIPA 2PX4A 3AJDA 3DXYA 2VDVE 1QAMA 3KQWA 3M6VA 4FP9A 5DSXA 5E8RA 4YMHA 2PLWA 3FTDA 1M0EA 3BT7A 3R9XB 4MTLA 4ZTBA 3B3FA 5BP7A 4EVIA 3TMAA 5KQSA 3LKZA 2PGXA 2ZIGA 5DWQA 4DQ0A 2K4MA 2ZFUA 3P71T 3FUXA 4AZTA 2FRXA 3EMDA 2CKDA 2GPYA 3I9FA 1L9KA 3KR2A 3MCZA 4QVKA 2PXAA 4E2WA 5FUBA 1DL5A 3G8BA 5FWAA 2NXNA 2OKCA 3C3PA 2G72A 3G5TA 3P2IA 4C04A 5FTWA 5BW4A 4LWPA 2ADMA 4F84A 5K0CA 2PXCA 3B7PA 1B42A 4U7TB 1FPQA 1YZHA 5EZSA 3ELUA 4HTFA 2ZWVA 3EMBA 3CVOA 2YQZA
chains in the Genus database with same CATH superfamily
1H2WA 1V0JA 4FKZA 4D4MA 1UT5A 2JLAA 4CM4B 3VTAA 4BNYA 1UBRS 4RVGA 2NSLA 2MMCA 3PNKA 2EZ9A 4CEHB 4YQZA 1NKVA 5KVQA 4WI1A 2ZKLA 3PQEA 3RH0A 4L27A 3HG7A 1ORTA 1N75A 2C8JA 5F5LA 5E7MA 2QL9A 1GZVA 2I2BA 2OCAA 3KHTA 1CK4A 3DE4X 3KJXA 2KX7A 2PS3A 1Z0KA 2OZEA 1YWGO 2MCFA 5FOUA 1GKLA 2IOFA 3E9EA 4JI1B 4Z5XA 4YV2A 5B3LA 4J16A 4EA9A 1CZLA 3EXIB 3BGWA 1RAIA 3HRKA 2NO6A 3LTEA 4DLWA 3CEMA 2CXHA 4JJIA 3D0QA 3TYXA 2FE1A 1A0OA 1I7DA 2IXTA 5JLJA 1J39A 1E7YA 4EG7A 4IGKA 1WHTB 2O2YA 2ZATA 3K0KA 3OOSA 1KI4A 2R6JA 4I4LA 2V58A 4O2AA 4UHEA 4F12A 2QAGC 3NX4A 5IABA 3Q6IA 5JO0A 4K6CA 3ENNA 2R25B 2Z43A 4PIVA 1QS0B 3EVAA 5U1PA 3SZUA 5C8YF 3FWPA 5EIFA 3TQRA 4HFNA 3T5PA 5B1HA 2V55B 4HRYA 4E5YA 1JDSA 3ROFA 1DC8A 3FY4A 3NC4A 4CTJA 5HRAA 1TO6A 121PA 1XYGA 3RRMA 5CLFA 2YRWA 3TTVA 1ZK0A 2EEZA 4KXXA 1N57A 1G7CA 1ISIA 1U2DC 4HWSA 2DTXA 3MILA 3TI9A 5BWOA 4UTNA 4NE9A 2PJUA 2WJWA 4M99A 7MHTA 2V4MA 4EW2A 3PBKA 3RKSA 1E6UA 5CRIA 4NQZA 5HM8A 1OPXA 4D7AA 1JIXA 2YIMA 3NTUA 3L7LA 4PF1A 3MUNA 1XPOA 2V7BA 3KBOA 4IDHA 3DMRA 4CLDA 3TR6A 5AW4A 4OXYA 4H1HA 2AOUA 1OBFO 3W7VA 1T6YA 2YMLA 3WNQA 1I32A 1XNJA 3GEBA 1QH9A 4Q7KA 1ZGJA 3NNNA 3PNLA 1V2GA 1KBOA 2IELA 3DL4A 3I28A 4FI3F 5FNZA 3D2BA 3QWIA 4CG2A 1NN5A 4JBGA 4HVLA 4GU5A 1PJ3A 4IQ4A 3OUUA 2P9GA 4FXOA 3M1YA 5KYTA 4QQRA 2FFJA 1IJKA 1P4RA 2D5CA 3ZWQA 4EBBA 1T2EA 1TA4A 2H6EA 4ZDJA 2P4HX 1M5RA 4GF5A 3PWZA 5J40A 1T8TA 3DOEA 4P53A 4PLGA 1PNOA 3EULA 3GIDA 2F48A 3A6FA 1S7GA 3D6MA 4I55A 1YR9A 4LY6A 1RXIA 1NM5C 1A8SA 4N48A 3MRTA 3B6EA 4MCHA 4REQB 3W5IA 4EGSA 3WL6A 4BE7B 1LS1A 2J9FA 2Q5EA 2QRVA 1W5EA 5DI3B 1DUSA 2RKWA 1EVIA 2QF7A 3GLRA 1DWPA 2VEOA 3FPJA 4L22A 4OLJA 1QAQA 2XIJA 2OWDA 2QN3A 1XIVA 1XPUA 4O3FA 5IF3A 3FDJA 1C41A 4OXIA 5D3QA 5C2JB 4P3YA 4IJ6A 2ZVPX 4MP8A 3UGTA 3E1GA 4JI6B 4XGKA 1LF5A 5L4NA 3GT0A 2BC9A 4EG4A 4LTMA 4XRRA 1W93A 2PKWA 5JJKA 1CUSA 5JMTA 1TQHA 1FSPA 5K2OA 5FYDA 4K40A 3DBHB 1KY4A 3QWBA 4LQDA 1G1AA 3OT4A 4OU5A 4HDMA 4LDRA 1QGUA 4TWRA 3U61B 4M36A 1BX1A 1BW9A 2IU4A 2JCXA 3CHYA 5FOWA 2EZ4A 2ON6A 4I1UA 1W2GA 3ISVA 4ZJUA 3WX0A 3F4KA 5BSWA 1I6WA 3HB0A 4BU0A 3QOXA 3PI7A 3FWHA 1UXHA 1F2UB 4GNRA 1ZITA 2D74A 4WJZA 3GLSA 1PZFA 1U7PA 3O4IA 3SOZA 5IXJA 4D9BA 3H9GA 3A70A 4EGFA 3GLIB 4UTRA 2HB6A 1TZJA 4N40A 5J5CA 4NBVA 3VU0A 1FS6A 2OBMA 4GGMX 4IV5A 3N1UA 5EAIA 2YWXA 4LWQA 4FDUA 4KGVA 2J4FA 2Z83A 3HK2A 5M7EA 4O25A 2ZYDA 3FGPA 2I76A 4MIEA 4Q5IA 5BQPA 5SZKB 4E08A 3LHSA 2QJRA 3UBTA 1ZD8A 4BN5A 5LLTA 1K6XA 3DPUA 3L79A 5JUWA 3VUFA 4D9FA 4E5VA 2Q6LA 4GIBA 1C0LA 3HVKA 3NI2A 1PGNA 2IOQA 1K2VN 1UBNA 1HUQA 4QDZA 3QV1A 2EKQA 3WSVA 1P74A 2ZRBA 4F45A 2XLBA 3PGJA 3A3YA 3ER9A 2LP4Y 4PE5B 4ZOCA 2QBYA 1KR2A 5FLYA 1GGNA 1G1MA 4JP2A 4QARA 2XF2A 4R31A 4IFTA 4ECAA 3TUZC 3MWDB 4C6RA 1N0WA 3R9IA 3JQPA 3L18A 2IT1A 3E4DA 2H2GA 4FD3A 5LBIA 4CKWB 5TGDA 4DV5B 5AI8A 3VU1A 2VBIA 2GRJA 2XTMA 3LWDA 2WIAA 3DYIA 1G2QA 2VA8A 2ZSIA 3FUTA 3O31A 3LP6A 1ZRSA 4D0RA 2ZZKA 3VSAA 1IC6A 2ISQA 1RJEA 2WJGA 2HUNA 1E5TA 1XXHB 3MGGA 3KYDB 2FJ0A 2XEDA 3PTZA 3QLUC 4JLKA 4DQLA 1LW7A 1ESEA 3DA8A 2BHNA 2GETA 2C3OA 3ZJYA 3ICVA 5A2QA 1SJ9A 1RXUA 1X7HA 4EQ6A 1FFDA 2QD4A 3FPEA 3QKTA 1EVJA 2X5KO 4I50B 3WRVA 1DXHA 1QO0D 3IQFA 1KZ9A 1Z38A 2MMGA 1B16A 5JYBA 4N7BA 2I33A 1GTL1 1RAAA 1L3IA 1IHUA 2FPOA 4E1VA 1KQGA 2RK3A 2ZYTX 1GG8A 2WD8A 2QUJA 4PIPA 4OJNA 1W87A 1AQNA 1U3GA 2GEFA 1XX6A 4XA8A 1CBUA 3MMNA 2OCDA 1PVOA 3RRXA 5IJWA 3JWGA 2YVAA 3GZTB 4RSRA 3ZUGA 4MPRA 5BRJA 2EC5A 1IWBB 4QBGB 1I0ZA 4BO6A 2YJ3A 1DPFA 1XMIA 2ZREA 1GNPA 1HDRA 3DVRX 1GIAA 5JSQA 2ZB3A 4HNGA 2I4OA 4H4DA 4Y9TA 4B34A 5HIJA 2NLOA 4BMDA 4B71A 4DZTA 1JDVA 3NIBA 2IEGA 3CRQA 3HLTA 4M9ZA 5C18A 5LZ7A 5AKIA 5AXCA 3TPCA 1J1ZA 1ZMXA 2GCPA 3HB4X 4JDPA 5LOVA 4FIZA 2OBNA 2B6HA 4RVHA 3UC5A 2IHZA 1PFQA 4QU9A 4BQOA 1IY1A 1L1QA 2FDRA 3A06A 4REQA 9LDTA 4B3XA 5JBIA 1W59A 2DKNA 3D4LA 4GZLA 1LPOA 2EFDB 1YB2A 1F20A 2PK3A 2WUFA 1L7PA 4PLPA 4M9RA 4RD3A 1JAZA 2Q9AA 2WJAA 2XSZD 1SELA 3A6KA 4FYKA 4UU0A 4I8XA 4AMGA 4P0PB 4LYHA 3QG1A 3FPKA 2EJBA 3H16A 5F2OA 2J4CA 3N8GA 3ZWWA 2ZZNA 1M34B 1NR5A 1O03A 3RYHB 3AJ8A 4MW0A 3SQDA 4C5BA 1HZJA 5AKEA 3N7TA 4Q47A 2R65A 2WU0A 4UDXX 3UT5B 2PMWB 2J9RA 5KTKA 1JHRA 1NGSA 2D1TA 1ZIXA 2W90A 3K0CA 4M7PA 4WKOA 1LVHA 2H57A 2W98A 3PICA 3QOYA 1Z6TA 1P0CA 1Z8DA 2FOLA 3LKBA 4CM8B 2OBFA 2ZK7A 3G7UA 3COZA 1UJ2A 3G68A 4C07A 3FA2A 5E95A 1ODFA 3ZIUA 5K8UA 1Q7BA 5ALLA 4BB5A 2XPCA 2RG1A 4WDQA 3L7KA 1TMGE 4IEFB 3TAXA 4C0SA 3EXG1 3RW9A 2G5PA 2AWOA 3AL2A 2PX8A 3F5MA 4ROSA 3ZY4A 3VDRA 1YNOA 2CMKA 4QYXA 4EDFA 3V8NA 1C0PA 1UMCB 4R8SA 4KQ9A 4QL3A 3WKAA 4NG4A 1RP1A 5JNSA 3C6MA 3VBEA 3KUDA 5BMVB 2JHGA 3VHRA 3JQ6A 4DLKA 2OY0A 3QXGA 4FYJA 2JH8A 4EWLA 4R84A 1V4VA 4OYYA 4DKXA 1YKSA 1RNLA 4XVQA 1M83A 3IAM1 1R8JA 4Y3UA 5BWMA 2Z8YM 3D4PA 4CEIA 2FPUA 3DJFA 3X43A 2Q46A 3LY9A 1MXFA 5GONA 1KSJA 1UPFA 1KPIA 1H6CA 3H2KA 4H3HB 3FI0A 4X97A 3ZBPA 2EHDA 2QEQA 4QKQA 3K1YA 4R40A 1FY2A 2ZI7A 3G0CA 2ONJA 4BVBA 1CUAA 1DFGA 3K4PA 3IOMA 2CUZA 4FFVA 1MB2A 4TROA 1PJCA 5FORA 3ZHVA 3ERCA 4N6OA 2RAPA 1V11A 2XWSA 4JZYA 4NYIR 2FWNA 4UNRA 3FSJX 3MVEA 5LM3A 1UMBB 2ZWAA 4UKDA 3FCSB 5FHRA 1ELOA 2HO5A 1IUNA 4D8XA 2P6RA 1FOEB 3CW8X 3WXMA 3HP1A 1JB9A 1II8B 1CJSA 3DNMA 4C4YA 2Z8YA 1FVFA 3JD2A 1IHDA 1E6WA 1DLIA 1U1EA 3OKAA 1ZP6A 3KSDO 4CIXA 1VIDA 2O2ZA 1M2VB 1NW3A 2FWJA 2P8SA 1R8QA 1T9BA 2C0PA 4P4GA 3RLFA 5H4HA 2AFHE 1M67A 3CJQA 4YNBA 3QSGA 3WHKA 4AG5A 1R66A 5H82A 1O08A 4DANA 1R0CA 4QSMA 3WLOA 3Q7PA 4DIFA 3KZNA 1RXSA 1R0XA 2E5WA 4QC2A 4I50A 2ZU6A 1IN5A 4FDAA 1FDOA 3WS7A 4U00A 1E1CA 4UBLA 1J2UA 1E1QA 4MS4A 1K4KA 4AZVA 4BV3A 2WPDA 1SKBA 2RKOA 2WYOA 4G4SP 2E5LB 1GL7A 4M49A 2R6R1 1U28C 2FAXA 2XD9A 3H2GA 2NUTA 3KTAA 1X8LA 4DRXB 1IRXA 1A4RA 1Z7YA 4KMSA 4Q03A 3H9JA 1DP4A 1H0SA 3MTDA 2OV8A 3PTAA 3PLAE 2Z8XA 1MPXA 4RMHA 2MSEB 1ECPA 3EPPA 3CB2A 3A4NA 3LDFA 3TPZA 2F1RA 5EPUA 4IXNA 3RYFA 3LZ6A 1MX9A 3UMSA 3D02A 2OZLB 3NUZA 4NR0A 4BLRA 1J8QA 2BBOA 1XTRA 4HT3B 4MVWA 3AGPA 3EZ9A 1TIPA 3KL4A 3VISA 3UICA 3MJEA 2IYPA 4F3YA 5IJAA 2ZBRA 5HJ2A 3GEPA 4MUGA 1SXJE 5FI3A 2ZYGA 5FLEX 3ZZMA 3UY4A 1IXKA 2OFXA 5EOVA 5FBQB 4QQNA 1XI2A 4L78A 2Q3FA 3FYHA 4PHHA 4MQBA 2ZUEA 1YFKA 4LRQA 1UBEA 1KS2A 5DSZA 3C16C 2Q0QA 5I8PA 5KWJA 2VKTA 3ORRA 4K9OA 2ZWMA 3I2FA 3EXG2 2AN3A 1ZKDA 3CEPB 3P9PA 5BW8A 2ECOA 1OZGA 3ZVNA 3FRIA 1NI4A 1Z33A 2QPOA 3W7AA 2EG5A 4FHEA 2FPPA 4GEGA 2DPGA 1V8DA 1NQWA 4WZZA 3N07A 4C6TA 3DG9A 1QX4A 1SVSA 2QRUA 5GV8A 2WF7A 3K5IA 3O3CA 4U6SA 1ECFA 3QPDA 3WGLA 2ZTMA 2Q9UA 2OUKA 2GM3A 1OAKA 2W4IA 3DTVA 3O2JA 1TQ2A 1WLSA 4N6GA 3VNBA 2QBYB 4FYMA 4UW9A 2ATEA 4DMFA 2ZSAA 5JS1A 3LM8A 1EFRD 1LCIA 2WHYA 2WVGA 4OUDB 4CT0A 3SDZA 4E32A 5LJIA 3OG9A 2NU7B 4ND8B 4M1OA 5GOZA 1DB3A 4E6PA 4KR0A 4B81A 5JSHA 4XWOA 3NDBB 4R8VA 2ASEA 3GFOA 1O5TA 2PFGA 3AG6A 3LX8A 3KWMA 3Q10A 4OXNA 5DSTA 2OP1A 1U3TA 1T9DA 1Z2DA 2WMOB 3KOYA 1QZTA 4I1RA 4KWEA 5CFOA 1AOXA 2X4LA 5EP3A 1T15A 4PFKA 2G17A 4F3KA 3DXYA 4JQZA 1D5WA 1FQKA 1OTXA 1QIIA 3GT7A 5E8RA 4BQIA 3ZTWA 4V0ME 2HMVA 2D8AA 4QUAA 4XYBA 3RUPA 4IRMA 3MCAA 2JFNA 6YASA 5LD2B 3MJHA 3T3NA 4KR2A 2O8BB 1H23A 4UDYX 1U3VA 1DV1A 2BGIA 3IRVA 4LRYA 3WDSA 4YJHA 4F56A 4MVYA 1LW6E 1E5QA 3KEFA 3M5WA 2QIOA 2OQVA 3ZW7A 4G0VA 2YNMD 4MINA 5EIHA 3K94A 3IAUA 3QOWA 5ADWA 2VPPA 3QWFA 1I3MA 1N5KA 4YJDA 4B45A 5DGCA 1EK2A 2HLDA 2Q6OA 4YAGA 5A03A 1P2UA 2VNKA 4TS9A 1VE5A 5BV7A 2F59A 2YW9A 3HM9A 1L7BA 4LFBB 1KAGA 2TYSB 1SEPA 2VQSA 1B42A 4OJKA 2WAMA 3FMVA 1ULAA 2AB0A 4DMKA 3IELA 2JIOA 3MB5A 2W2PA 3FVTA 3BMOB 1PEKE 3H7AA 2X0DA 1I1NA 2G9VA 2ZTSA 3UJPA 2I1QA 2RI1A 1GGMA 1XTPA 1QYVA 3DZBA 2PVCA 3QNUA 1T8WA 1R1DA 1VL5A 2O2GA 2ZYVX 3OBIA 3PK0A 4AB1A 1FEZA 2HNBA 5BVHA 1DEAA 1P29A 3HN6A 4OSOA 3E3LA 3HR7A 2M6RA 2CN1A 3O1IC 1VZ3A 3H97A 1UBHS 5DNCA 1TZBA 1QGED 1M6WA 3PGLA 1LEHA 2WE7A 5B7QA 3ZGXA 1R6AA 1I4TD 4I6GA 2X7JA 4NBKA 2QRVB 1L5QA 2J5KA 5DI3A 3VO2A 1GQQA 3DE0X 1NNEA 2WTNA 5JD5A 2AUMA 4W6QA 4Z4IA 4RX1A 1JR3D 5WRFA 1ECGA 4DMMA 2PUEA 1A82A 1C7EA 2JEOA 4LSZA 5SYAA 2F3TA 1NUPA 4FDVA 1TQDA 4KZKA 2Y92A 1N2ZA 5BSRA 4OQMA 3SLRA 4B1FA 5C35A 1Z6YA 1C3VA 4JU9A 1K7CA 4MUFA 1C80A 1G8MA 1YZGA 4F6LA 1FYDA 2AG5A 3QYPA 4IMPA 3NBXX 3HYNA 4AKSA 3VVBA 2P9FA 4C20A 5L3SA 3U5TA 3PUWA 4R8KA 4OJMX 1IEVA 1M6YA 4CDNA 2W11A 2A9VA 2HBYA 4DRXA 1DHRA 1OZHA 4N3CA 2HQOA 5IYZF 3HJFA 4G5YA 1IEWA 3EGXA 2NT3A 1MC4A 4KMRA 1KTIA 3AZOA 1QZZA 3K32A 4AWXA 1DFHA 1LJ8A 3AEQA 4N9QA 4L4RA 1VHWA 2GYWA 2NSYA 4LBWA 2OG1A 4Q4AB 1JFFB 1K4YA 1FDVA 3DVSX 3UGQA 4A2QA 4DW8A 1LC3A 1E3EA 4EOGA 1J70A 1V35A 4L0MA 3MGAA 1EUYA 1KI2A 3ED5A 1AURA 1DKLA 2J7PD 3QKIA 1FP4A 3PF8A 1HKHA 1YZYA 4X3PA 1C1HA 4HG2A 1F5SA 1V47A 1ZGHA 1CZKA 1CUCA 1RC8A 1I7LA 1EK6A 2P79A 2Y71A 3R9KA 4RYDA 4DR4B 2Y1CA 1J2JA 5A4KA 1D07A 4O2AB 3HDJA 3ANLA 4J0IA 4PNPA 4QBKA 2I3GA 1TQ4A 3Q98A 3GVPA 3EVEA 1G3MA 2H1WA 2RBGA 2OBBA 3I4CA 4FMDB 3WGIA 2OGWA 3HLKA 4FYYA 4JP1A 3GLHB 3K2QA 3U39A 3OQNA 3IT2A 2AOXA 2IEDA 1TM3E 2VA9A 1U98A 1FU4A 4Y2GA 2FWPA 1JXQA 4NNPA 3H5IA 2OD9A 3ONEA 3PQ4A 2RK4A 1I2ZA 1XZGA 2GZ2A 3DHWC 4D3ZA 3DHVA 4PCLA 4DR5B 1P4JA 4FC7A 3PT5A 1C1XB 4HN4B 3BIFA 4JZKA 3VH4A 1G6OA 1E9DA 5B5SA 3OPXA 5HTOA 3MWDA 1DRVA 1JAYA 5CLQA 3IB6A 4DNOA 3SMVA 4CT5A 1KZYC 2IP2A 3V7UA 4ND3A 3EOBI 1O94C 1WZ2A 1H2AS 1B0PA 2VJQA 3VTFA 4QGFA 4BECA 1F2VA 3R7LA 4DTIA 1CYEA 4NBUA 3HDQA 2WWVD 3D6VA 1XRLA 4OHVA 5IAEA 3FROA 3JR3A 4IVNA 3IDSA 2VAPA 3O26A 4U9UA 5KYWB 1SBCA 1WXFA 1U65A 1XDWA 2FSFA 2W43A 4OLFA 4R1OA 1TTPB 1GCOA 2CW5A 3EWSA 3G2KA 2OA0A 1NQUA 4QJBA 1XF1A 4G8JA 2GBGA 5ER9A 1A5AB 2QJFA 3CF0A 3EA0A 7MDHA 3A2KA 2FETA 3C14C 5IWAB 3W1WA 4NZOA 5KQGA 4GBJA 3L8DA 2RCYA 3LWNA 3JRNA 3QYJA 4RIGA 4IH9A 3MBIA 2R1UA 1SNYA 1TMYA 3EXAA 3KKQA 2FPIA 3VYRB 4CHGA 3KCQA 1YL6A 4FB4A 1N2CB 1FTGA 1JHMA 1O6GA 4XIFA 2HA0A 3WMGA 3I3OA 1DCTA 5B3JA 2YYZA 3I58A 4WXMA 4C0QC 4P4SB 3CRZA 3RVQA 1FX0A 3O7MA 3PFHA 4LE2A 5FXMA 3EYAA 5EC8A 1JEAA 3ABZA 4BPRA 2F4VB 1KEPA 1R37A 2YOGA 1CSEE 5HFNA 2NO5A 2OORA 4M7OA 3AP1A 4WZBA 1YKGA 1UZAA 4ND6A 4IGAA 1Q0SA 3SC4A 1B23P 3VR2A 5AQEA 5FTNA 1L7VC 1O3YA 1QM5A 3OCXA 1KPHA 3OPVA 4IPTA 3ZY5A 3NC1C 4DN6A 5LQMA 2VJCA 4CCYA 3EAGA 1Y0BA 5IP5A 2AA3A 2XWPA 5FWXB 4Z7JA 1M8KA 4B6SA 1WXGA 3LQQA 3ITEA 4RH1A 1SAYA 2GARA 3IT3A 5K3AA 2QYOA 2W42A 4W8GA 3CH7A 3U5ZB 4P3XA 1ZOOA 1I3OA 2WYWA 4ZFNA 1OLUA 1MO5A 2VHZA 3BZBA 4N47A 1BD3A 3DFZA 2WIFA 2WAXA 3QX9A 4I1SA 1RRPA 1BWPA 3IJPA 2OV1A 3JD4A 5DBEX 5BR8B 1F06A 1PDVA 4XUCA 5A4FS 4HKTA 2IUSA 2W2LA 2Q99A 1IDN1 4F5YA 3THWB 1BAPA 5EP4A 3NANA 1I1HA 3SYTA 1E3QA 3ADKA 4KR3A 1YK0A 2EEPA 5B53A 4AP6A 3OOHA 2QQ5A 1WW8A 2ZWOA 2EQBA 3N8DA 2XT0A 4PO9A 3WGJA 4EJ2A 2H65A 4D3YA 2Q4RA 3JYPA 3PI6A 3G6KA 1KGSA 4JVLA 2EU8A 3KLNA 5FWYA 1HFKA 1PE0A 1ISRA 1CU1A 5AHRA 3HKCA 3EPRA 5DTQA 1OQAA 2HHLA 4Y18A 2VP4A 4I5FA 4CW7A 2W37A 1CR4A 1AQIA 4PXAA 4GZ3A 4H2DA 4EARA 1ZAKA 1QDUA 2OESA 3PDIB 5I7FA 3A9SA 1KAQA 3LQ2A 3O47A 2VSXA 3GT4A 4DE5A 3IKTA 4X41A 1N2CA 3KK0A 4C6SA 4S1PA 2OZVA 2ZR8A 3B5IA 3F98A 3KYDA 2AG0A 3VTKA 3SYLA 1PEYA 3SP1A 3PEYA 5A0VA 1IXRC 3LW8A 4PBRA 3VR0A 2O2HA 3BCSA 5LP6B 3UAYA 5AVZA 5AM3A 5HSGA 4QDJA 2X9GA 3QX3A 1JPVA 3ZIAA 1DSSG 4P0QB 3CRMA 1GNLA 4JJ8A 2HA5A 3KM0A 4M1SA 4ED9A 2IXDA 1PK9A 4GECA 3TJRA 2C5EA 4IMRA 3UKJA 3PZBA 3SYNA 1YDWA 4A82A 4Z7NB 3H8SA 2QLMA 1SXJC 2JGKA 3ADPA 2PH7A 1RLIA 2DLNA 1ZD5A 1KDTA 4U02A 5TQJA 1HEUA 3RSCA 4B75A 1XAJA 4DCNA 2DBQA 1BH2A 1DC7A 2MYUA 1YCHA 4ACAA 3U6KA 5F73A 2PUFA 4XARA 1T9HA 2GB4A 4KQMA 3WHPA 4F9TA 3OVMA 5BT9A 1JNXX 1NL3A 3EDMA 1FFSA 2IYVA 1WSBA 3T1QA 1Y5RA 4DOMA 1RMQA 5AFSA 1YS7A 3L84A 4ILKA 4V0QA 1C1XA 4PSAA 4BBJA 3HDHA 2LKCA 1SIUA 3I83A 1Y4DE 3FMGA 4FFPA 4CM9D 4TMXA 2YW2A 4M1ZA 1JTFA 4B47A 1SQFA 3ESXA 2QE7A 5BV1A 1EUZA 1TK2A 3U80A 1E0KA 1QC5A 4MA4A 3PC8A 4FR5A 4GGOA 4RTLA 1EUQA 1OFUA 1WXXA 4PPGA 2C99A 2NMVA 2ZUCA 3GLHA 1VBMA 1GUAA 2WB4A 5HUJA 3OMXA 2GSWA 5CR9A 3E22A 3F7NA 4P7FA 3R7SA 3GUCA 2E6KA 2XUOA 5F7XA 2BF7A 2CVFA 3BGOS 3ILYA 2CBGA 4Y67A 5COQA 4BBZA 1Z4IA 3ZH2A 5L51A 3Q4GA 4GI2A 1X7XA 2QIPA 4B17A 3WFJA 3E0XA 2ASVA 4QT0A 2FE4A 1Y82A 3OTHA 3SLKA 1SURA 4OAPA 3JRXA 4J91A 3HCPA 3LC1O 3U4QA 3QELB 3ZHBA 3ZVLA 1I6LA 1E6CA 3IVAA 1J2YA 2V4ZA 4N5IX 3RVNA 4JLWA 2I87A 3T1HB 2G8LA 2VYFA 3HWX1 3UWPA 1RADA 2C4TA 1NW4A 2RC5A 3W6NA 2IS1A 1GA1A 3VVMA 1M2NA 1FDUA 1OLXA 1QH0A 1G42A 2Y1DA 4LV6A 3IILA 4O29A 3W2TA 3UMGA 4M1MA 1Z6PA 1NPDA 2D1FA 4Q9JA 1B6SA 2FG7C 4RYLA 1WP9A 4WXYB 5E2BA 3RV4A 4P0TA 2PM8A 3V7FA 4UQLA 1KOGA 2B25A 3JYOA 4L28A 1ZS9A 2CVQA 5K6TA 3JAKA 4BNIA 2QLJA 2FPXA 5C5CA 3ESRA 3VR6A 2GKOA 1F14A 1EDBA 1DTEA 4KLCA 1T36A 1K5GA 4ZO9A 2WHPB 4DQDA 4TYQA 3EBLA 3F6SA 3F6RA 3T3GA 1X3SA 3E1KA 3ZU3A 4EFKA 3OKFA 1Q7RA 3ZCXA 5DE3A 3EQ9A 4MAMA 3CURA 3DP7A 3AKCA 1T5TA 1I2MA 4TQGA 1QH1A 1SBNE 2N9UA 1B8VA 1X13A 4PNZA 2QZSA 3ADCA 3LP5A 4Z4GA 2G5TA 2XQJA 2I1VB 3ND7A 2HHAA 4RJJA 4D96A 3TTTA 3DE2X 1NR7A 1KDVA 3VR6H 1H8EA 1V5GA 1JDBC 3RFVA 1GILA 1IAVA 1JG3A 4XD7D 4YR7A 1ZFNA 1IG3A 4P58A 4NK5A 4H1VA 4GVPA 1MB3A 2ORVA 4KLRA 1E4OA 4F04A 1EYZA 1ENYA 2JFGA 3KD2A 1EFHA 1I1QB 3NHKA 1SHKA 4AD8A 1N0VC 5JS6A 4N4AA 4CEJB 2YYAA 1EUDB 1VDZA 2QPTA 3TF5A 4Q9AA 2EW1A 3RS9A 2JASA 1VG9B 2JJYA 1E2QA 2PV7A 4J4BA 3BGSA 2OE2A 2QSJA 1H9AA 3FPGA 2BMJA 4DY6A 1ZKMA 3GHHA 3R0VA 5SZHB 1UT6A 3GVIA 3DKPA 5ICMA 1E64A 1YXMA 3B89A 3L9WA 2I6TA 5LYJF 1GYPA 2R1VB 2REQB 2WHXA 2O23A 2QE6A 4EPXA 1OAOA 3EGOA 3CZ4A 1I8TA 1GCIA 4YJ3B 3ENVA 2IPXA 1D9ZA 4EUSA 4FT4A 4D0NA 1KFBB 5KTOA 5LDDC 1T3TA 3QELA 1H4QA 1GRVA 1RS0A 4PICA 1GDHA 3ELWA 3KHSA 3QFCA 3IMGA 3VYUB 4A2WA 1II9A 2H2FA 2HWWA 3ZD6A 3DH0A 4D99A 4RTSA 4GX5A 1AE1A 4NMXB 2V6MA 4UHJA 4KYTA 5AHKA 2ZYHA 1KJWA 3LBAA 5EUMA 3UF0A 3WLSA 4QUIA 2QENA 3UIEA 4TV8F 1R4MA 2C4NA 4OSEA 3F3KA 3W4KA 2ZT6A 3TW6A 3AR6A 1YDFA 1U3DA 4GWGA 4MQEA 3B48A 3RFTA 3IP7A 3O91A 3VU8A 3J80A 1V25A 3N2NA 1ITZA 2YCBA 2ID7A 4R5MA 1JDUA 1Z39A 2CL6X 1JDPA 2F9LA 2O0JA 5H83A 2CJWB 3OZAA 1K27A 1JR4A 1RWNA 2NZWA 2Y1LA 2I3BA 4FGSA 4R69A 3EXFA 1QIDA 2D7JA 3RB8A 4YJ2B 3WIUA 1G2IA 4V39A 1E2IA 1GTSA 1NBMA 1T1EA 1TLFA 1YULA 3EUFA 2YR0A 1LRJA 1T5BA 2JVKA 3JTEA 3KKZA 4J7CA 4RPGA 1H3FA 1LI5A 3TZHA 4PVDA 2HRQA 4HZIA 1BCRA 3QK7A 1H42A 5BW6B 4YAKA 5CG2A 1SUPA 1R6UA 3D3WB 1A76A 3QHQA 3ZDRA 2XLCA 1ZR4A 3OWOA 4DDHA 1MT3A 1W94A 2Y67A 4WNYA 3SC2B 2ONYA 3NEAA 1THGA 4CPDA 5BMVF 3BKXA 2GZHA 3OP4A 5A1TA 4PLTA 1YRWA 4KE6A 1MVOA 4PHTA 1OLSB 4KTVE 5D8DA 2NU8B 3H86A 1SB9A 3T5BA 1KEEA 3HWSA 3QLVA 3F0TA 4NWIA 3X2SA 3EVGA 5CCBA 3X44A 2X8BA 1ONNA 3IR6A 4C7XA 1JXAA 4JLVA 1NHGA 3PU6A 4YP7A 5IBCA 1ADJA 2IVFA 3V5NA 2GAJA 2IEZA 4XVHA 1C8KA 1GM5A 4NU8X 3WOHA 1VHQA 1PEDA 3U4CA 3EH2A 2E3JA 2W6NA 1KZ6A 2V7QA 3ESYA 2R1TA 4B3SB 1W0JD 4GX1A 4JA0A 2QUIA 1JR2A 2P5SA 1C8BA 2IIPA 3CX6A 3NJRA 4LJ9A 5BYBA 2B0JA 4BNMA 3TMYA 5ABPA 1KDOA 3UV7A 1YQEA 1WBJB 1WETA 3MA0A 1TO1E 1XB2A 2GI4A 2DU8A 4D9JA 1ETUA 4I9NA 4ZO7A 2AC2A 5FEMA 5FWYB 4JODA 1H3NA 4AZTA 5KX5A 2FJUA 3GA7A 1JLLB 1XDGA 2BBWA 1U2SA 4KJXA 3U26A 3K72B 4CG3A 4LJRA 5G0VA 1Q14A 2RGNC 3NIWA 3CF2A 3L6DA 4MAAA 2QE7D 4LVUA 4N18A 1G7SA 3ZLUA 5EJ7A 1EFAA 3R41A 3EVTA 2ADMA 3OAAA 4KUEA 2X0RA 1TYAE 2NTJA 3QE9Y 4XE5A 1D7OA 4JWKA 5DZSA 5GMOA 2J30A 1ACLA 1AN0A 1XHEA 2ZSUA 2G76A 3QUSA 2R7NA 1C29B 2RH8A 2ZB4A 2XCLA 5AW3A 3N2GA 5IUNC 2F55A 1NNSA 2GJSA 5DTMA 3EGEA 4U7PB 1P75A 5EKTA 4M9XA 1CE8B 3B3GA 2Y27A 2CSUA 3DO6A 3PHJA 4IQ8A 4KIJA 3NWEA 4KFUA 2HNKA 1H6AA 1MRSA 2VH5R 3DV0B 4QUBA 3VOTA 2YMPA 1P7YA 3AWDA 3F49S 3G1WA 4LVCA 1XMJA 2OTCA 4YJ3F 1JJVA 3I92A 2HHJA 4EG5A 3BS4A 1LF0A 1YHNA 3CEAA 3HJRA 5JAMA 2HU2A 2WV9A 2OLJA 3EDOA 2I29A 3BJIC 2XXBA 1JIIA 3JD1A 1A98A 3HU2A 4FU0A 4UBMA 3I73A 2CDCA 5HKKD 4LGCA 3L6EA 3JASB 3KAPA 5AI9A 5BQFA 2YFQA 3GRKA 5D2CA 5BMOA 3PE4A 5HHTA 2ZUBA 3RC9A 4L5BA 4IOMA 2GNAA 2J31A 1ESDA 4CMAA 1QVZA 2F3SA 3BN3A 4I50F 4R2XA 2O14A 4ZU3A 1G6Q1 1RYHA 1TD9A 2EFEB 1E3WA 5A1JA 3JQGB 3T9BA 3P52A 1NYLA 1RM4A 1ZK2A 1KS9A 1MC1A 4WKCA 1AZLA 2A0UA 1V11B 5F5NA 5FL7A 3KQLA 3EZ6A 2O1SA 2PIAA 4L8FA 3V4FA 2PXXA 1NY5A 4W5JA 3F2IA 4B5KA 2CNLA 1EXVA 3EEYA 3SXUB 3HJHA 2AXEA 3LXXA 4XSHA 5L3QA 1HMPA 3SS7X 2UUAB 2WVJA 1KDZA 1DJOA 1I10A 4MPJA 3ICCA 1WF6A 5TB5A 1C30A 2ZJZA 1DI0A 2WSMA 2IYSA 3JQRA 1SCKA 4C3OB 1E7WA 3VKVA 1YQTA 3LGSA 3QOFA 3TJMA 4EB3A 1UBCA 1P77A 2UZ1A 2XUQA 5CUQA 4YREA 3KEMA 1OT3A 4LZNA 3BWMA 1KR5A 4TN1A 3RBZA 1HY3A 1TUBB 1Z15A 2Y0PA 3KJGA 3SJ7A 1T2VA 1SUSA 3L6OO 1DRJA 3DFUA 2P30A 1LX7A 4HPJB 2X8AA 3ZHOA 2J6IA 1C1DA 5KC8A 1GEGA 4TSRA 1L5HA 4W4TA 4DGSA 1RFGE 1L5VA 4L75A 1Q83A 3PHIA 3VR1A 3R7BA 3I9JA 1DRKA 3DB2A 2NZYA 2JG3A 2DCMA 3ZWCA 1HQCA 1RQRA 1V45E 3C8ZA 3F6EX 3MT0A 4X92A 4S2UA 2W0SA 4N8SA 2AK3A 4OAQA 5JNRA 1Z12A 3DWGA 5JTUA 2OBLA 4JLOA 2W48A 4PZ9A 4JJZA 2D2VA 1ZXBA 3NDJA 2QXUA 1CDOA 1KDYA 2EYUA 4FWIB 4J1TC 4CEHA 2NPIA 2ID8A 4UHBA 3RSGA 1H1DA 4N7MA 1L7RA 1ZI6A 5DHSA 4CGYA 3RF7A 2PUDA 2XE4A 4U4AA 1CUUA 4CKCB 3IUNA 4K6KA 1OBOA 1IM2A 2VAVA 4DMGA 4AP9A 5I9NA 1KOJA 1VP3A 3KHKA 4TTRA 3I62A 1I4OA 4O4JB 3VX3A 5B3JC 5JIBA 1RZ3A 2Y68A 3CR3C 1N6PA 2YASA 4FONA 1JT2A 1NTRA 4LNUB 1K86A 4R98A 4CCAA 4YROA 1Z5VA 3KVVA 4JT2A 2AMFA 3W9YA 3WWOA 1SUIA 3WYNA 4YV1A 2I6GA 3P97A 1G0NA 5ETJA 1ID1A 3D1LA 4ZT2A 3HZOA 4HQKA 1P4AA 1KP2A 4QNMA 1OV4A 1NZJA 2POQX 3OX4A 5HW0A 2J4DA 1WR8A 3HVRA 2AW5A 4LWOA 3IEUA 5B6IA 5HZGA 1JWBB 2F3UA 3OJOA 1QYDA 3K0CC 1YVPA 4EGCB 1F12A 3KUKA 3FSGD 1RWQA 4S2EA 5HE9A 1C9KA 3I72A 2LCIA 3LX4A 1X8KA 3FB4A 5K20A 4ZYZA 4EUHA 1IN1A 3MTBA 4BLTA 3LQRA 1Y8ZA 4RKQA 4NSNA 1D2RA 1NVGA 3ZV7A 5I7WA 1Z4MA 1DAHA 5KCMA 1H2BA 1AZWA 2I22A 2R8PA 3NAQA 2WMYA 4TM8A 4EA7A 1JQAA 1EIZA 2V8BA 1TVMA 1NJ5A 4MLCA 4FFDA 4Q02A 3GW8A 1GFSA 3VU9B 1OFIA 3HDGA 4N0DA 1DVRA 1M3SA 1UJMA 2Z09A 5SZJA 3L8EA 1Q1EA 5E2AA 3T7DA 1RQ2A 4LC9A 1DWOA 4H1WA 5EPEA 5T41A 4H27A 4A6PA 4NH4A 3SI7A 3WLFA 1WQ4A 1LI7A 2QTNA 2C77A 1L4HA 5IAJA 3RF6A 5L3VA 5AH0A 3CRVA 4N3AA 2VHQA 5EWJA 2C4MA 4NMWA 5SYMA 2NU6B 3JQ9A 1QBGA 3IP8A 4P31A 2H4HA 4XDYA 2HCBA 3SICE 1PTKA 4QOFA 4FHFA 4PG5A 1DCFA 4ENPA 3JWIA 5K8VA 3K71B 3EX7C 4EG3A 1DZIA 4KFSA 2PX3A 4RORA 3ROZA 4UVIA 1ETHA 5I4KA 2O3JA 1KRXA 4HFMA 3VXKA 3KJNA 1GQ2A 2W2VA 5ED0A 3RK4A 2FH5B 4MI9A 2GUGA 5CB4A 1RHKA 1F6DA 1YJXA 1R12A 4RA9A 2A4MA 1P0QA 4LV5B 2WIJA 5BSVA 1L4FA 4LXTA 5H59A 1V48A 3ZX5A 5BXYA 1NBIA 1NF2A 3AM4A 1MPTA 1W47A 4HWKA 2AK2A 4IIVA 5ECDA 4DEXA 1J7KA 3FDXA 3UXHA 2CHEA 1SWWA 4KN8A 4D1YA 1TK9A 5EKXA 4KODA 3WMWA 4ZK2A 1WUIS 4FE4A 4LVNA 3MWEB 4XWKA 5DWDA 3RAFC 3BL6A 3ZCTA 2DZDA 4MEAA 3PA6A 5KWSA 4DLUA 1W5BA 1RQXA 1XQWA 2X8JA 3H9QA 4UQPA 3GLQA 1ZHHA 3I9V6 2ROQA 4R6WA 3UANA 2VJPA 4QEDA 3ZDZB 5GIPE 4HL6A 1HLDA 2P1ZA 4LZLA 4QBIA 1FC0A 3QVUA 1DX9A 4CKXA 4KMOA 1JR6A 1TOAA 4W5RA 2CXUA 3DEYX 4IVQA 2HBQA 2YWGA 3C48A 4RK7A 1EHYA 4WGFA 2QPAA 3W6UA 5HQTA 2XR1A 3VMFA 4DSZA 1SD2A 5KNLA 2E87A 3GYGA 1USGA 2FSUA 5F9MA 3T9CA 4BKQA 5DLDA 1YO6A 3KVOA 3DZGA 2A7XA 4X0EA 3GDWA 1XAHA 2O8VA 5K0TA 1PP4A 1IAQA 3P2MA 3WLPA 2XGMA 3OOJA 4KUGA 4EAQA 1L6IA 4HDMB 2XYRA 4QZVA 2BV3A 4H7PA 2CWDA 5K9ZA 1L9XA 2HMTA 2O5CA 5CXXA 3EUWA 2GFHA 2JJ1D 1P61B 1RZVA 3CJRA 5A9SB 3WAJA 3IPRA 2V8OA 3CLSC 1MABB 3K20A 3LHIA 2ZRCA 3OHMA 5HK9A 5K0JA 3FE2A 3ZY2A 1EQAA 1JIQA 5JASA 2B98A 2JFUA 4KPYA 1JDBB 1XMOB 4FGJA 1L1EA 5DHRA 5E6SB 3ADBA 4JJEA 3DGFC 1T1SA 1AXRA 3MIIA 2V6FA 5IKXA 3CRRA 5J4VA 2O6HA 4E4YA 1QOQB 2R68A 3CX3A 1OPRA 1T9AA 3F47A 4FD2A 2BMAA 4IXWA 3GELA 5CMLA 5CM9C 4XOUA 2OENG 4MVJH 2V6JA 3S6JA 2C3YA 4KBGA 1NYQA 2DPHA 4BUZA 3DDZX 1TEHA 4LG1A 2O3RA 5G0WA 1QRSA 2O9JA 1PWYE 1WZUA 4J1QA 2KE5A 3MMXA 5C8YA 1N6OA 1V5EA 1WDLA 1CY6A 1VJ1A 3LDAA 3WXBA 2WU4A 3N8KA 5ARBA 2SECE 4UJ5A 4EUFA 1OXUA 3BL5A 1SRQA 1ZN7A 2BR4A 1NAIA 4H6PA 4IH1A 3DOJA 3ZCQA 1HA3A 1V4BA 2YICA 3JWPA 2GM4A 3LL4A 4P93A 2H7YA 1ZM7A 1WY5A 5I7VA 1M2HA 3HWRA 4X60A 3SSMA 5EP1A 3CWQA 4YLEA 5BN3B 1W1IA 1E79D 2YVQA 2VQEB 5JAZA 3G5LA 4UNNA 3A04A 2UZ1B 3R7WA 3IUQA 3NHZA 3MS2A 4FQ7A 3OA0A 2PU7A 1U0NA 3L7DA 1HG1A 1N3BA 3WZ2A 4ENQA 2HNAA 3INRA 5IU6A 3LXUX 2YZ7A 5F78A 2C7GA 4BAUA 4KQEA 1GQSA 4JUBA 4HDNB 1IWOA 1QIGA 1Y4SA 2QU7A 2XVZA 4A92A 4JEHA 4KXLA 2EZUA 4FPXA 3PE3A 2AR9A 4ZP1A 4NZPA 5INTA 1GXSB 4RS3A 2QL7A 1JUDA 4OO3A 1OTHA 4F8EA 4NXMB 2BSAA 4ID3A 4WY5A 1ANKA 2X9VA 3T4XA 5CFRA 3DLHA 3HFRA 3GEMA 3PWTA 2GA8A 2ZUDA 3GO4A 1HE2A 3DAPA 1TKCA 2CF6A 3CY6A 4UTVA 3S8EA 3O8BA 4ALLA 5K6AA 2YJTD 4MRSA 4G2NA 5D01A 2XB2A 1M8JA 1RRKA 3NETA 4I7EA 5LFAA 4G8BA 4QG7A 3P9SA 1GAWA 4X64B 1OOEA 5IKMA 3AI7A 1V37A 3ABIA 4E4TA 1XZAA 2Z4TA 4QHYA 3KS9A 3CW2A 4BVFA 1OW3B 2QT1A 4JMPA 5CYFA 4TOIA 3WGGA 2FG5A 5A4AA 2ZYSA 2CDAA 1PFVA 3A1NA 2L69A 2P2ZA 1T34A 4OQXA 4L4SA 1X7ZB 4YGYA 3ICOA 5JXJA 1QYXA 5LYJA 1KFCB 1P9WA 1AUOA 1FMCA 2GM5A 4ZOAA 4EATA 4NHEA 1EWKA 1HX7A 1TGVA 3MTQA 3SFTA 8LDHA 1U0EA 1XXLA 4XGRA 2I7DA 1ZEMA 1E6LA 4O2BF 1LDYA 1U0LA 2JLZA 3KQPA 3FCOA 4EVRA 1R0ZA 2PSSA 3HP7A 2PZFA 4R51A 5KJEA 3CZRA 4AJEA 3NHLA 2PL5A 2I67A 3CLTD 5EJ8A 1OASA 2CDRA 4WADA 2B2CA 4XKJA 6Q21A 3NBQA 2IUEA 5BN5B 3Q15C 1SOUA 4ZCRA 5EMJA 3O8DA 1YI0A 1O95C 1FFXA 2XMGA 1VRCA 3IP6A 2ZAGA 4FTWA 3AERB 1P31A 3QEJA 1XZNA 4K88A 2OYSA 3VZBA 3OQIB 3R8CA 4QXRA 1MHPA 5UKDA 3S55A 1X94A 1Q15A 2ZE6A 4Q3LA 2X22A 1SXIA 2F67A 1H66A 2DHQA 1E59A 4LXHA 3WWEA 5KTPA 1Y4ZA 2XY4A 3GUZA 4L6IA 3DE6X 5EJ4A 1UMCA 3C41J 4RCVA 1WUYA 2NYAA 5MDHA 1YQXA 3B20A 3DMFA 3WNCA 5BWBA 4JXZA 4RQBA 5AIAA 3DD5A 4JLUA 2VQFB 1AKTA 2V96A 5EJ6A 1TYBE 5IJZA 5K3EA 1EBUA 3WJ1A 2DFTA 2JH9A 2OB1A 2PZLA 4JVSB 4EZEA 2HO4A 3K1JA 1EVYA 1QLHA 1KI3A 3B1KA 1CZOA 4H0CA 4JT9A 3A4MA 2F9FA 6LDHA 1CDZA 4MOWA 3R09A 3G9ZA 2GCGA 2CY0A 4IDOA 4RK1A 2YXBA 3TQTA 1ZU4A 3KFLA 3S2ZA 2B21A 1WVGA 5ELMA 3CMCO 3H18A 2XKKA 4L02A 5E9AA 3AJRA 3OO0A 4KXVA 4S3MA 1N2GA 1CUEA 1PT9A 3RJTA 4JB0A 3UAOA 5CB6A 2AZ4A 1CNFA 2FWBA 4UTZA 3UA4A 4K1LA 1Y6GA 2IYRA 1X39A 3EN0A 4MDHA 4ZD6A 4F0JA 1QRAA 3COVA 2C98A 3PJEA 3QE4A 4Q7MB 1FXUA 2QRLA 4P7JA 4D9NA 4KRFA 2Q0HA 3BDVA 4BGIA 2O8DB 2JFBA 1HNWB 3A05A 2JGNA 4H1UA 1UKBA 2FK8A 2IYEA 3GJ4A 1GFZA 3HXLA 1TI7A 3I45A 3QIVA 2ZVJA 3FAZA 3R7AA 4H60A 1XHFA 2V3CC 1PNRA 3K0FB 1CUDA 2FWAA 3FIJA 1U81A 4BO2A 1EU1A 2M9MA 2P35A 1P2SA 2TMDA 3WZMA 5JEDA 5ALEA 1VG1A 4F5WA 3HI6A 3CH5A 1EI9A 5D6NA 3T1YB 1RCUA 3THYA 3LYHA 1JL3A 4O3MA 1QG0A 2JJ2D 4I2NA 4LC0A 5LP6F 1OTYA 4RKEA 5LQDA 4AULA 1E2GA 4ZQEA 2G9QA 2QN6A 2CXTA 3T3OA 4JJ4A 4YJ2A 5J47A 3QFFA 3UFXA 4GRIA 4Q82A 1TCCA 1H9CA 4LZPA 3ZLBA 3MTGA 3PVCA 4NCNA 2H07A 1UPBA 1UP4A 2XT9A 5A3RA 5DBOA 2ZI4A 3UAWA 3VR2D 4A03A 5BWNA 2B6NA 3L4EA 4HB3A 5L4LA 2R8RA 3V7NA 3COJA 5ADVA 3DHEA 4UBOA 1BVRA 5D3MB 4AMYA 1FTSA 1DIHA 3O3NB 3GV0A 4Q6BA 2F3PA 4CMEA 2BMWA 1J00A 1HSZA 1UFRA 1YJBA 2QK4A 3RG8A 1KO8A 5EJ2A 2H2HA 4P34A 1ZCJA 4PQFA 4Q9NA 3TNFA 4MTLA 4HNVA 5JCOC 2Q50A 4EVIA 1FZQA 1WMFA 3NOXA 4OLHA 2OC9A 3TE7A 5I6DA 2PMCA 5C5EA 2C0QA 3EMDA 3L02A 1SOVA 3RU9A 4Q9KA 3IUMA 4Q3DA 1E2DA 1T3LA 1ODLA 4UFOA 3FX2A 2IPLA 2WIBA 2J41A 2VYVA 4ZCIA 1IDOA 4UDOA 2ZJAA 3H5LA 3MK31 2BOVA 2OKCA 3INNA 4LGVA 1M34E 2I1LA 3HNOA 4JJAA 4LWPA 3UB2A 4JI7B 5AQ1A 1KORA 3L49A 2NADA 3B7PA 1ZN2A 3L07A 3GNSA 3I5XA 2PUJA 2GX6A 1HE3A 3R0IA 5LA6B 2A86A 5EXSA 4JR2A 1PVDA 3AEKA 1WEHA 1OU0A 1AKEA 1XQVA 1WW2A 1BWRA 3GVXA 3AR2A 3IFSA 4PEVA 2PTHA 3B1WA 3KE9A 3ETGA 4LXXA 3BXFA 4CDMA 4DIEA 2HJGA 3LY8A 5GGXA 4O59O 5LZ5A 3WMFA 1BE8A 4K8RB 4CM5A 2BGGA 4I1IA 3L0IB 3WLIA 1QB8A 4MJ7A 4PG8A 4YRQA 4YP9A 4JYPA 4LHSA 4PM4A 3FUUA 3LY7A 3T41A 1BWQA 4ZN6A 2HA2A 5FADA 3GL9A 1WVMA 2H5LA 1S8AA 5LC1A 4O2BB 4E33A 5CITA 1CB7A 2J3QA 1M2GA 3QENA 2GERA 3H8JA 3GEIA 5E1BA 1WUTA 2RGAA 5JARA 3TG2A 2WF5A 1U0FA 3PUKA 2I99A 4UASA 4YRFA 3LBFA 1KZ1A 1RD4A 1PNTA 2ADFA 1DCKA 1XDSA 2HCTA 2O2SA 2NUPB 2VDPB 3CIOA 3GNQA 3UJ7A 1LQTA 3CLUC 3A1WA 3SE0A 3W2EA 4L72A 1VMEA 2FWRA 3LPAA 4OI1A 5FNVF 4EK9A 5C4GB 1Q57A 1XF9A 2QRNA 1ACJA 2HMSA 4J16C 3STYA 2DQ4A 4BMVA 1KBZA 3BE6A 3ICPA 2B7CA 5KJ6A 3GG9A 5FAXA 1A88A 1OFUX 1OXXK 4EEZA 1HETA 2W2KB 4Y6OA 1L5KA 1U7OA 1PHPA 2O0KA 4TTQA 4X1IA 4ZRNA 3GFSA 2ISCA 3G9UA 4W63A 4S1NA 1BE0A 1YD7A 4XIJA 1DBRA 3N87A 5TVGA 4FSXA 4J2HA 1RHQA 2FTKE 3T3HA 2ESRA 1M8GA 1KYIA 5TY0A 3TAUA 3ZWVA 5EJ9A 1XTKA 3CNEA 1AB5A 5HR5A 1KFKB 1H8HD 1T0BA 1UL1X 4JR1A 4TTSA 3B9QA 2YY6A 2F6RA 1JKJB 5CLHA 2XWJI 2ZIVB 3IULA 3ZTTA 1QV6A 4F9FA 1FFXB 1PX0A 4LPSA 4JUDX 4NDNE 4IR7A 3ENZA 5AM2A 3EGIA 4QXOA 4UARA 1ZH4A 3NAMA 5E9WA 1ODSA 3ECSA 4YPVA 1WWKA 1F0YA 3IJ5A 2YJ4A 3LLSA 4PX2A 4NE2A 5JZBA 1DAGA 5JD4A 4RD4A 3NVDA 2F8LA 2HR1A 5SV2A 1LFAA 4UMDA 4ZALA 2CD9A 2ZT8A 2H2AA 4DLBA 2PMEA 3CG4A 4URFA 1KO1A 2COUA 2JGDB 3JV7A 4YAEA 4L9AA 2X8LA 3WO1A 4U1RA 3QF4B 4BNLA 2WWGA 1LVUA 4L76A 4Y2HA 2WT4A 1FMTA 3OCJA 4J75A 5TDHA 1KOFA 4EB0A 3U7GA 4XFKA 1U2DA 2OGSA 2H2WA 4AG3A 2BCGY 2WABA 3PJRA 1I6KA 2VNIA 3IGFA 4HVAA 5A5EA 5AKXA 3AYZB 2I8CA 3AB3A 4YMWA 1EXNA 3SD7A 2ZAYA 1B8OA 5GPBA 1QSGA 3F8WA 2IIVA 1K4MA 4QVGA 1VJGA 2PLNA 2ZITA 5HZKA 1JFTA 1I5OA 4CQMB 4CGZA 4UEOA 4DC1A 1BROA 3QXHA 3NHYA 1FRFS 4ID9A 2YFKA 3T9DA 1JQ5A 5KREA 2QMUA 1GPAA 1KVQA 1XKQA 3LUDA 3RSZA 4EJSA 4RPHA 3G1TA 3KUCA 4OHMA 4BMXA 2HJWA 2ZRPA 4EFDA 1N6LA 5B1SA 2CWWA 2SHKA 4RHUA 3B5EA 5H5JA 4F3CA 1V8FA 1HLPA 4KFTA 4BFSA 3L06A 4U2EA 2BY4A 1Z06A 1TK3A 4LJ4A 1NUSA 2QG4A 3ANSA 3R23A 3SC3A 1XKXA 2AL7A 4MQMA 4L3OA 2EKDA 7YASA 3LDGA 3V4OA 2FI1A 3L77A 2DKOA 3FF4A 2XWBF 3D8BA 1VKRA 2M1XA 1C8VB 1MG0A 1TJ5A 1U8CB 1VE9A 2OEPA 1P8AA 1YK1A 4PO1A 1QR6A 1DQYA 4MW6A 2YFYA 1UKZA 2GJ9A 3JALA 1MT0A 2V54A 3FYUA 4MW4A 2JD1A 1PR3A 1ARZA 5A3QA 4Z7OB 3DBRB 1NVKA 3IURA 3GLGB 2X9NA 3SGLA 1D09A 4QHSA 1C1YA 3QP9A 3OIDA 4WY8A 3R5HA 1P2GA 4K6GA 5HF6A 4KP7A 4QYTA 5ITSA 2FZCA 5KYNA 2Q2QA 1KL7A 3F74A 3HSYA 4KXMA 5F2EA 1C3LA 2PSHA 2FOXA 1VLZA 2G6TA 1I6MA 3DZIA 2AE2A 3C7CB 3TLKA 1UZUA 3MOIA 2X0JA 4M0UA 4UM8B 2O1EA 4FR0A 3T9AA 2B37A 2EBUA 2H4ZA 3E8SA 2IE8A 3DC7A 1GPMA 4E4RA 4LY3A 1WDTA 3MAJA 1YZLA 3RRZA 5HVNA 2BEWA 1DFIA 1OZ0A 4NMHA 2B9VA 2ZS9A 3VKHA 1Z0AA 2I4RA 3D54D 3P0JA 5E6RA 3KQMA 1T5LA 3VDMA 1JJIA 1RXVA 1KI8A 2YOFA 1AXEA 3TQOA 4BGEA 2EWMA 4E7OA 3UTDA 3COYA 2SCUA 4P92A 1P73A 2B30A 1JECA 2ZYRA 3PVZA 1FU7A 5BSTA 2AZTA 3QVGB 1JDNA 1PQ4A 1NBMD 2BWJA 4M1WA 2HYIC 3V55A 1IXSB 2ZAMA 3WNDA 2GD0A 1GPBA 4HUQB 2YV3A 1WF3A 4M4SA 2J45A 3IR7A 5HF9A 2GPTA 1YTUA 3G2LA 5B58T 1XRPA 2OQIA 3K5PA 4DZRA 1A5SB 1RE0A 5A9RA 4HX9A 2BP7B 4EVSA 4DJ5X 1JSXA 2QT0A 5AUQA 3OF2A 1CR6A 4X66B 3O75A 1FFCA 5DDIP 4LZOA 1TAHA 4Q1CA 5JVDA 3AB8A 1G3QA 4R5HA 2D13A 5CM8B 1YB4A 1LSSA 3M34A 3L1JA 3NR2A 4HRAA 4NULA 4CIYA 1EK0A 5HPYB 4LF8B 2ZYUX 1WD5A 4C43A 4AJ2A 3QQ5A 2VWHA 4RK6A 5IJ0B 2FFRA 3WAGA 2AOWA 1XN4A 3M2TA 4JJFA 5IF9A 2PZJA 3I2YX 3WGTA 2QW1A 1PJQA 3C3KA 1UXOA 1KC1A 2WU3A 4UM7A 4GPTA 4X1OA 3ESQA 4X3OA 2ONCA 3U2QA 2HZ7A 2VJDA 2ZDQA 3KOUA 2Z0MA 4FMCB 5TT0A 1A9TA 3ZD8A 5B1YA 2A0FA 3AZQA 3ZVMA 5C1PA 2Q1UA 4IDDA 2COKA 3WGYA 4B9AA 2FG6C 1U0OC 2H59A 1LBSA 3B2NA 4DMHA 2C1ZA 4UCXA 2V03A 1OIWA 1Z0FA 2NZXA 2VDOB 1V1MA 1TT5A 3K96A 3KQSA 5DX1A 3ZHUA 4ARIA 2XHZA 4BN4A 3A28A 2FMHA 2A5JA 4DMUB 1NOKA 1Z4QA 5I7SA 2BM0A 2Q6IA 1H1TA 2ZAIA 3GJTA 3RK1A 1K97A 4N5HX 2R8BA 3I76A 4MR9A 2Q3HA 4ACBA 1UDCA 2JZNA 4WCDA 2IHNA 3WYDA 3NHPA 2PWBA 2RI6A 3HYTA 5JRZA 4V38A 3TSCA 2WA2A 1T4CA 1XRQA 1QCDA 2BGMA 2VHTA 1FNMA 3AIKA 3BSWA 3IIIA 1V71A 3PNPA 1GUYA 4OHUA 5JDCC 2WD9A 2WSYB 3HA3A 5FA8A 4XI9A 2O7RA 4N8EA 3LY5A 1MENA 1D5CA 1UJ5A 2PQ6A 2ZQYA 3BERA 5ICGA 1L8AA 2RC6A 4ER0A 3ZBUA 5E1OA 4CMJA 2P91A 4AY4A 1UOEA 2BGNA 4UUOA 3LHFA 3J81k 2XVXA 3INTA 3VVLA 3CT4A 1RJFA 4RY2A 2EIHA 2WNHA 5AK0A 1RHMA 4L95C 4C4SA 4I0WB 3ICQB 2WTXA 1KKUA 1QFXA 1SXJA 2I7CA 3GY0A 3KWFA 1N0UA 1WMAA 3LRPA 1E9FA 1A4UA 1JTVA 2QUKA 2X9QA 3GN2A 4OP2A 4CQMD 1BH6A 3M6XA 4M0LA 5GY7A 1UUFA 1XAGA 5EHNA 4ATNA 4BEWA 1RU3A 3H0CA 3GP8A 1R8YA 4YJKA 1U8ZA 2O7VA 1B1AA 5H70A 3ZU2A 1WSWA 1L3BA 1RYEA 3O4JA 3WTBA 1IH8A 2AN9A 3WTCA 1HFJA 3RVSA 1OWMA 1T29A 2FYTA 1ULZA 4D3DA 5CJPA 4TWIA 3TK1A 3FLAA 5C52B 1CV2A 2J3HA 1WCYA 2CHUA 4F92B 2PZBA 5F3RA 3L1VA 4BO7A 1U99A 2JCSA 5AK6A 4MW1A 1MO6A 1SCIA 3N7AA 3GMSA 4IZOA 4GLOA 3FTCA 3ZJ4A 4JI0B 4Y2JA 5KNDH 3A2NA 3L0OA 1KJZA 1GZSA 5FOXA 4GE0A 3WGVA 4KWTA 2CXXA 2P4UA 3MSXA 1V3UA 3OZWA 2G1KA 3G0IA 1OWNA 3KSAC 4E09A 3VOAA 2BP7A 4TKUB 5JAPA 2QMHA 4UZSA 3NH6A 1BC5A 2MOKA 1IY8A 1XO1A 4TSKA 2J8ZA 5EMKA 3KJFA 1Q1GA 1DG9A 3O3OB 1O95A 3KQKA 5FPYA 3CR7A 3DDOA 1DX6A 2OM2A 3I6MA 1EPUA 2GK4A 2H1IA 3BULA 3N3BC 1A2QA 3WFIA 1JSZA 1IVNA 3ER6A 4BNFA 1P19A 5EIXA 2WM8A 1GZ7A 2GQ0A 5IH7A 1W2HA 3ND9A 2PA3A 4KSYA 4NENA 4B85A 1EX9A 4NJEB 1YIAA 2FN7A 1X15A 2NV6A 2XCUA 3FR7A 3WWDA 5BRAA 2EWWA 2PJDA 1S4QA 5DXFA 1JEQB 2QA5A 1ZAYA 3Q6NA 1KVRA 3ZDFA 5DI9A 3JQ8B 1MJNA 4DXHA 3J7AC 4HVCA 4TSFA 5EWLB 1C7RA 1W4CA 1C1DB 4H0NA 1UANA 5C80A 2C4KA 4KIGA 1YBHA 2PD6A 3OECA 2QRKA 1EGHA 4I66A 3Q8WA 5F1KA 2J48A 4A1FA 3L7JA 1PDOA 3OCYA 4AURA 1K66A 5CLJA 1MEEA 1ULTA 4BO3A 5J3JA 3ZHSA 1IHPA 5HIAA 3N59A 2FRVA 1JAXA 1FDRA 3IUEA 5GWXA 1O0SA 3FMPB 1EFCA 2J1LA 4KIWA 4Y98A 4C0JA 1KIAA 2GK7A 3BQ9A 4ZYVA 2PJRA 1NHWA 1P7WA 1J6UA 2KBEA 3BWXA 1ZA2A 5CVJA 1YOVA 1QFZA 4HO1X 4D9IA 3G79A 5IT5A 5KVCA 1EHCA 1JIUA 4OHPA 2FLKA 1U8XX 3I12A 4RIHA 5DW0A 3UYLA 4E11A 4ER5A 4EYSA 4TV9A 4HQ6A 4H7KA 1I3LA 4HXFB 5HGXA 4UPDA 2RHJA 1RBQA 1XZFA 1RWBA 1FK8A 2A3RA 3EBPA 5JMOA 1CIPA 4ZVOA 3OZSA 1OX6A 2QV0A 3M6LA 3ET4A 3PUXA 2E85A 4LOAA 3NAZA 3BXPA 4YJFA 3DCNA 1C81A 1SC6A 1H6DA 2ORYA 4CTOA 1W48A 3COPA 1RLOA 4ZU1X 5F33A 1JHPA 4PZAA 3VHQA 5BYAA 2PX0A 1V41E 4HTAA 3PNOA 2WFLA 3VFDA 5DIZA 3OTOB 1AJEA 5A71A 1TCBA 2GYYA 2YXDA 1HE1C 2PZAA 1YZFA 3A14A 3UMJA 1Z6GA 4JEUA 2O7NA 5KIAA 1EJ2A 3A36A 1H5QA 4DR1B 1Y6QA 5CB4B 4F9GA 2QUHA 4IHJA 3CNOA 1X1EA 1A9RA 3CV3A 2K5UA 5LKAA 3E9MA 1FP2A 1LWNA 1AQ6A 1Z18A 1ZYUA 4BFXA 3MMPA 1GA6A 2DECA 2O20A 4PRYA 4NEHB 2BIFA 3FZEA 5JZMA 1PR1A 3E48A 5MFZA 2ONKA 1ZSNA 4JKYA 3A4IA 5K3FB 3AYXB 2VDUE 2V9ZA 3D6NB 1G19A 4CV1A 2YC2C 4PN7A 3C3MA 1SO8A 4ZHQA 2G77B 5A4MS 1P7PA 1NP3A 3K9WA 5GZ1A 5IJ9B 3QMMA 2GMWA 2ILVA 2C3UA 2ZRLA 1DC6A 1FNBA 3B2QA 3O8CA 3THXA 3EVFA 5B7NA 1A1VA 1YQUA 2YYSA 4MIOA 1ULUA 1NWHA 3DMHA 4MUYA 3EDQA 3T5CA 1FLAA 1T26A 3NVAA 4J94A 4LOIA 3ZNOA 2I4TA 2XCIA 2DQSA 2QJOA 2V59A 1W44A 5HFAA 5IJ0A 3V7WA 3GRYA 5JXIA 5GZ6A 2YV4A 4EZIA 3HFSA 4X1KA 2GA9A 2Y0EA 5MN4A 4TYWA 1AHNA 2F8MA 3KDAA 1UWLA 3AJDA 1I3KA 3ESAA 3U3ZA 1WA5A 3ZWXA 1VPEA 3K70C 2QI9C 2WJ6A 3FHTA 2JW5A 1QE5A 4HLUC 1B8UA 5BYKA 2PANA 2VCHA 4LEIA 4N0MA 5KQSA 4MSUA 5CGQB 2YJNA 4OU4A 2FN3A 3PG5A 3CPEA 3PGKA 4W1RA 3I32A 4X6YA 3WKBA 5FAKA 4DEVA 4K3UA 5AVVA 1NMZA 1D1PA 1D8TA 1MO3A 2AQKA 5FNVB 1ICIA 1YQQA 1E9VA 2NWQA 2XSZA 3EEQA 1L8OA 1TO2E 4II3A 4E2WA 1BMQA 5BVGB 5JALA 5G40A 1DL5A 1QRRA 2VYQA 4OGKA 1C9MA 1VKNA 3L2OB 4ZICA 1E18A 5IXSA 1Z8NA 1DC3A 1HTWA 5LKRA 4G1EB 4R8LA 3WLJA 2FMTA 3OQ1A 4UQOA 1CXZA 4C21A 4EI2A 5KC9A 2CZQA 1ZJ5A 1JW9B 5IVIA 4JCOA 2A33A 3IEPA 2R1TB 4EFNA 4PYNA 4WESB 1YUBA 2QZ9A 3GCGA 3UUEA 2GDJA 3KSRA 1BIFA 4PFQA 5CEJA 4FOPA 3P4XA 3VKWA 1AM4D 5LDHA 3FCCA 3VOBA 2PGIA 4NYMQ 5DNAA 4CL3A 1G8AA 3QUBA 1FX1A 3SX0A 2R1ZA 2NSHA 3DBLB 1BCRB 2GSDA 3WIDA 4EUKA 5IYZA 4FCTA 1S8OA 1M1UA 2AFIB 2QM8A 4GMGA 4BCCA 1XJCA 2GK6A 4EHJA 3HJTA 1CVIA 2J3EA 2HX1A 1KTVA 1PSZA 4ZGBA 1A8HA 3HA2A 1SGWA 5ALYA 3RSLA 3LUHA 3ILHA 4O2BA 5LDGA 2HT6A 2HRZA 5DB4A 3SF0A 2BR3A 1YR2A 4KQWA 4PO3X 3AHFA 1NJ2A 3TGLA 3EXFB 1SC3A 4GOMD 3MFQA 5CT8A 4DS3A 2CJWA 4YN3A 3HN2A 4NV1A 3ROMA 3BK2A 3I42A 3GF4A 4Z8YA 3UHOA 4DMRA 3B8HA 2ZB2A 1O96B 1WCV1 4NV0A 3TFWA 5J4KA 3F3MA 3DXXA 4F4IA 4YAUA 4BLWA 5DNUA 2ZB7A 1XVIA 2DF8A 3CO0S 3I9V1 3WLEA 3M4YA 3I2HA 5CPBA 3ILVA 1DIAA 1VE3A 3C6XA 3CJTA 1CD5A 2NUAA 4N0PA 2IV2X 2O07A 3D8TA 3LCVB 4JD5A 3V9AA 1CEEA 1AKMA 1I14A 1W5AA 2G67A 5DBIA 2HCRA 5DLYA 2D1QA 3E4CA 2R66A 2ZG6A 3EEFA 4LDQA 1V1RA 3V8RA 2GF2A 3CLHA 5DGDA 2ZJFA 4HDKA 3D7NA 1O87A 2NTNA 3DKIA 4QUEA 1SCQA 2I65A 5FPHA 4M6WB 2Z5GA 3PSHA 3ZLVA 1M0SA 1XZQA 1K0FA 2R1VA 5JJIA 2PWZA 4AZ0B 4BNNA 1EDZA 4F4JA 3E3MA 3AR4A 3D5QA 1S2DA 4ZAWA 4PC3A 4JI3B 3UWKA 3LX6A 3VPXA 1G20E 1YA6A 4M76B 1QQ5A 2YMMA 3MGBA 1V6AA 4PFJA 4G4GA 4Q18A 1E79A 2G1JA 4QOGA 4W6ZA 1NBHA 1RWWA 2CNBA 5THKA 2J0UA 3FLEA 2VQDA 3HV2A 4PZZA 2G63A 4HGZA 4PVCA 4QQ8A 2B61A 3PGXA 5EE9A 5H9VA 1GUDA 1MUUA 1YJAA 4IDGA 1E1YA 2OR3A 2P4EA 1QXSA 1YUMA 1DAFA 4L5IA 4AUNA 5J5VA 2AFHA 2YWDA 3RT7A 4F5DA 3Q9NA 1JRLA 2R97A 1RQLA 2ORWA 2CLOB 3NORA 1RKXA 5BV8A 1VIMA 3HVHA 2YIJA 5IXYA 3LCUA 1QV9A 4J2OA 4EJSB 1MN6A 4R01A 5EVJA 2ODQA 3F90A 1HE5A 3T95A 1S2IA 4IOKA 5T4FA 4D8VA 3K73O 4I1OA 1CCWA 2EP8A 3FB1A 3M1AA 3ZHCA 2JLBA 1H4TA 4E1AA 3GXBA 2QKYA 1T5IA 3S28A 4YWJA 1WKCA 1N6IA 1RBMA 2EERA 3X1XA 1HDXA 2YZNA 4YAFA 3P1JA 5ALVA 4BO9A 2WILA 1AO3A 1YIDA 2ZE8A 2IEYA 2BBTA 1Q16A 3I9NA 5L40A 3RVOA 1FW6A 3GWGA 1XZCA 5JD6A 3UMVA 4XM0A 2GZMA 5T6BA 5JAHA 3BC1A 2WOJA 2MINA 3A4TA 2GPBA 2ZPAA 3W7BA 3EZ7A 4CVNA 3FJ1A 1NRJB 3ASYA 4G84A 2JHCA 1CVLA 5C31A 3CKYA 2I6XA 4HRVA 2BEKA 3RKUA 5HCNA 3TD2A 3DPIA 4OQFA 2W22A 1Q0RA 3HC7A 1E8MA 1FFEA 2XYPA 1IIBA 2QX7A 4INPA 3K0HA 3C6YA 4MUAA 5A0FA 3SCZA 1JR3E 3WLLA 3BTOA 3ZWAA 5BR4A 4U7WA 2G5CA 2ZXUA 2FUCA 1SPXA 3N8HA 3FDZA 1VA5A 3GJ6A 3OTWA 4NVRA 3EEBA 4RCZA 4X5OA 5CVCA 4GBMA 5AXAA 3MWFA 2A92A 2EX1A 4L8YA 2J7KA 4MP3A 2BKEA 2C8VA 4Z9XA 3SJUA 4X93A 1YDEA 4Y1RB 5FD8A 1A9XA 1FFYA 4O1HA 4Q66C 2I2XB 4KVAA 3C15C 3KU4A 4AKTA 1T35A 2C84A 1JZTA 4IDNA 2C3PA 4RJIA 4E70A 5BSEA 4AC9A 4P9NA 1IOWA 3EWIA 5KS2A