3KQYA

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-7-ol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
total genus 91
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqyA00
2YR0A 4PWYA 4HSGA 3E23A 2VDWA 1JQ3A 4ISCA 2FK7A 5IH3A 2VZ9A 2NNWB 3KR2A 3UFBA 4KDCA 1EQAA 4GC5A 3BZBA 4DA4A 4DMGA 4MTLA 3THSA 4QQNA 4PYJA 3ANXA 2B25A 2BM9A 2JJQA 3PS9A 3UBTA 8MHTA 1EJ0A 3C0KA 2P7IA 3CJQA 3EGIA 3G7UA 3AXTA 4RVHA 5EHGA 1R8XA 3P8ZA 3VC1A 1YF3A 1KPHA 3ELYA 2DPMA 2ZIEA 4OBWA 5CVDA 5KS2A 4YV2A 3X0DA 1UWVA 3B7PA 3G5LA 2AS0A 1RI4A 3B3FA 4M37A 3I9FA 3LHDA 2JHAA 4C4AA 5GINE 2PWYA 3DTNA 2OYRA 3R3HA 5EZQA 2XYRA 1BKYA 5K0FA 10MHA 3SR4A 3L8DA 5DWQA 3VC2A 3NVKI 3G8BA 5H02A 3HVJA 4GOMD 1VP3A 2DULA 4RTNA 1AV6A 1XTPA 4KW7A 3NTVA 1WXWA 5EMMA 2IH4A 3G2PA 2ZW9A 3PX2A 5DRTA 2BR4A 4R6XA 5EIFA 3BWBA 2BR3A 3KQPA 3ME5A 3OCJA 3FPFA 4KDRA 3PB3A 4DKJA 1H1DA 5E1BA 2PXAA 3UJ9A 4YUWA 2FCAA 1YUBA 5DSTA 3EEOA 3THRA 4E31A 3GJYA 1R6AA 5K0JA 3FPJA 2Z6UA 2PBFA 1JSXA 3P2EA 5K0BA 4GOLD 3KR9A 3MQ2A 4YUYA 4CKBA 2QM3A 1M6YA 1R18A 1YZHA 4CWAA 4C05A 2PY6A 5EHIA 2ZIGA 5KQSA 2R6ZA 1XDUA 3LKDA 3FTEA 5LQNA 2V74B 5EC8A 1XCJA 4AZSA 2PKWA 3FTFA 3B89A 5ICEA 3GRRA 1NBHA 2GS9A 4X63A 2PX8A 2O06A 2AOXA 2JHCA 1BHJA 1ORHA 5EQJB 2C7OA 3GU3A 3BWYA 1YB2A 2HMYB 3FRHA 1D2HA 3M6UA 4MQ4A 4U7PB 4IV8A 2WA1A 2F8LA 3O7WA 4BLUA 2FRXA 3KHKA 3GRVA 2JG3A 2B9EA 5T6BA 2PXXA 1RI5A 3ORHA 5ICFA 5IKMA 3FRIA 5G02A 3HCDA 5CVJA 2ONYA 5BW5A 4X61A 3MAGA 3GRZA 5E9JA 1WS6A 2ESRA 2KW5A 5EMKA 5E2AA 3UJBA 3EEYA 1TW3A 4IV0A 3TMAA 2ZBPA 5LSAA 1T43A 1NW5A 3LDUA 3CC8A 2P3LA 3SMQA 2G1PA 5DX0A 2QRVB 2ZZKA 2VP3A 3FZGA 5EIWA 4BLWA 2P8JA 2AOWA 4EQZA 2Q41A 5K0EA 4RTOA 3O4FA 1SUIA 4WXHA 3HP7A 2AN5A 3SXJA 2C7RA 3KQWA 3LCVB 3SSMA 2AVNA 3BGIA 5DTMA 1NW8A 2NXJA 3TLJA 3GCZA 2UYOA 3OPNA 3UWPA 2VS1A 3GGDA 3P71T 5LQCA 1MHTA 2O0LA 4E2YA 2ZVJA 1VPTA 1G8AA 4NECA 5FQOA 3D2LA 1VLMA 3KU1A 3BWMA 4PNEA 3OU6A 2AOVA 5BXYA 5DXAA 3T7SA 3UJAA 4QVKA 4RX1A 3P9CA 4GOND 3LKZA 5DX8A 5K01A 3VYWA 3JWGA 3UJ7A 4XUEA 4RTJA 3OU7A 3NDJA 1O9HA 4BP1A 1XCLA 5GIPE 5EMJA 5EKUA 4AZVA 3HVIA 5CVEA 5P8WA 1AF7A 2O57A 1QYRA 4DQ0A 1X1AA 3FPEA 3TRKA 3ER8A 1WXXA 1VIDA 4R6WA 2BR5A 3BKXA 4GUAA 4WVLA 3DP7A 1ZHFA 3EMBA 3HVKA 3LPMA 4G56A 4HTFA 3AWIA 4X41A 3I53A 4B17A 1JR4A 2P3OA 3BGVA 5EOVA 5CD1A 2ZFUA 1JG2A 3SVZA 4GEKA 1KYWA 4C06A 5DSXA 2IP2A 2YXLA 2I9KA 5MHTA 5E8RA 1I9GA 2VDUE 3CKKA 3SX0A 2P41A 4RV9A 4P7FA 2I6GA 2ZZMA 4V0QA 2V7EA 2PXCA 5DM4A 1I4WA 3HEMA 5E2BA 5ERGB 3R9XB 4PCLA 5FHQA 2G71A 1D2GA 5B1SA 4PYQA 5FUBA 3G2MA 3S68A 1I1NA 3SSNA 1SG9A 5T64A 4HC4A 2WK1A 3LECA 3A26A 2ZBQA 3A7EA 4M36A 3FPGA 5GM1A 5C1IA 3SSOA 3DMHA 1JQDA 3C6KA 3TOSA 2C7PA 1RI2A 3O31A 4PIPA 3EVAA 3FTDA 5EVJA 4V0RA 4HGZA 1KYZA 3OU2A 4AZWA 4RVFA 3UZUA 5BW4A 1DCTA 3RW9A 5JUWA 1R00A 1XVAA 3BXOA 1FBNA 5ICGA 4M7RA 1FP2A 3M6VA 2YTZA 1JQEA 1WG8A 5EKXA 4DF3A 5DPMA 1VBFA 4ER6A 5F2NA 3OE4A 4MHTA 2FK8A 2Y1WA 2H1RA 3FUXA 3NJRA 5CVVA 2HWKA 3KQVA 2GAFA 1KP9A 2OB1A 3BWCA 3SM3A 3P9KA 5HIIA 4M38A 1NKVA 2YUIA 2IH2A 1OR8A 3M70A 1JTFA 3UJCA 3OZSA 4EVIA 4QPPA 3HNRA 4YV0A 2C7QA 4POOA 4YMHA 3Q7EA 5LQRA 3P2KA 4DM3A 4EKGA 3HCFA 3BT7A 3CVOA 3KQMA 1PJZA 1P1CA 3EPPA 2AN3A 5E9WA 2CKDA 1X1CA 4OBXA 4UOEA 3DXZA 1KPIA 1ZG3A 3ELWA 2I62A 4KWCA 3BKWA 3CBGA 3GIWA 3ID6C 4E70A 5CIYA 4PGGA 1ZGAA 3PTAA 5K0GA 3B3GA 3FYDA 4EKIA 5K09A 2PVCA 4QPNA 4DCGA 2WA2A 1N2XA 5DM0A 5FHRA 3UJ6A 5D1HA 1JSZA 2NYUA 3KR1A 3V97A 3AJDA 3V8VA 4RTRA 2NXNA 2Z6AA 1NBIA 3A25A 1FPQA 3OZTA 3LX6A 4JXJA 4RTKA 3G89A 5DM1A 2BH2A 2B78A 4GC9A 4GBED 5E1DA 4PONA 4DCMA 1VL5A 4E2XA 1ZKDA 3Q87B 1KIAA 3OE5A 3PVCA 5GWXA 3A27A 3PLAE 4FT2A 2HR1A 4O29A 4P7KA 3HCCA 2ORED 3UJ8A 3HVHA 3IHTA 2ZTHA 5CCBA 2Y1XA 1V39A 2PT9A 3G5TA 2OKCA 4MIKA 5EG5A 2UYHA 5M5BA 1O9GA 5HIKA 3LBYA 1RI3A 3DMGA 3G88A 4GQBA 2G8NA 3TKYA 2H11A 4DZRA 3IYLW 4GOOD 2PT6A 1QAQA 4XUCA 1UFKA 3REOA 2HTEA 4KIFA 3KQYA 3GDHA 1KXZA 2PX2A 1MJFA 2EX4A 3TPZA 7MHTA 5FQNA 4QTUB 4E2ZA 5EGSA 5GM2A 3WSTA 4H0NA 4F84A 1P39A 2E5WA 3TKAA 5KVAA 2YXEA 1R8YA 3M4XA 5FA8A 1SKMA 2IH5A 3GRYA 5EZSA 3OFJA 3A7DA 3B5IA 2ZWVA 4KIGA 4PYKA 2GPYA 3FPHA 3MTIA 3T7RA 1VE3A 5T67A 2EJUA 4ZTBA 3NWEA 1NW3A 1SVUA 1N7IA 3I64A 5DTRA 3T7TA 5HIMA 4HH4A 4CXMA 1L3BA 1NE2A 4P58A 2XYVA 2YQZA 2NXCA 2CMHA 2FHPA 3PFGA 1F3LA 4LG1A 1L3IA 2H00A 4HTFB 3FUVA 3MERA 2IBSA 5DX1A 1AQIA 1BC5A 2JHPA 3DMFA 2P3QA 2ZULA 5K0CA 3IV6A 4LWPA 3HTXA 4LECA 4ER5A 3FUUA 5DXJA 3GRUA 3GNLA 1UIRA 1NT2A 2QYOA 3KQOA 2ONZA 3NWBA 5HEKA 1QAMA 2R3SA 3E7PA 1X19A 2HV9A 2ZLBA 5CVUA 3A4TA 5K05A 1QANA 4X1OA 4RTSA 2I7CA 3JWJA 5DM2A 1VP9A 2GH1A 1ZGJA 1ZQ9A 5FCDA 4E33A 2UYCA 4EMSA 4RVDA 1D2CA 3M6XA 3MCZA 2BZGA 3OZRA 3AY0A 4PYMA 4F86A 4AX8A 5LQKA 1PRYA 4QDJA 2BM8A 2FYTA 1O54A 2AZTA 3EMDA 4LWOA 5DRYA 4AZTA 3EVZA 5E9QA 2IBTA 4A6DA 3G2OA 3BGDA 4X60A 1XDZA 4FSXA 2G72A 4C08A 1L3CA 2PLWA 3NMUF 2AOTA 1HNNA 3C3PA 3CCFA 3DOUA 3HM2A 4QVGA 5E1OA 2QRVA 2OZVA 3KQTA 3MCTA 4PYLA 5LQAA 3P2IA 2IDJA 4BY9E 2ZWAA 1U2ZA 3LDGA 4Y30A 5GP1A 1P1BA 5K03A 4OX9Y 3DULA 1NV9A 4ER7A 2P1DA 2PWPA 2AOTB 4RWZA 1YZ3A 5EEHA 1EAMA 3TR6A 3KPUA 1WZNA 1X1DA 4PCAA 4RVGA 3CGGA 5CM2Z 4YUVA 1TPYA 4C07A 1F38A 3KPJA 5EMLA 4MWZA 3C3YA 2XYQA 5HIJA 2IPXA 1Z3CA 4FS8A 1HMYA 4QQKA 4Y2HA 3UA3A 3MTEA 1SQFA 5CUQA 3FUTA 4P7JA 2PSSA 2ZSUA 1M6EX 4RSRA 4GF5A 4F85A 5KQRA 3HCBA 1TW2A 3DUWA 4CKEA 5E8JA 2Z6QA 3HA3A 2IDKA 3DH0A 3DR5A 5HZMA 2OXTA 2PGXA 5BP7A 4YUXA 2AR0A 4RTQA 3GWZA 3G2QA 4PINA 2O07A 3OFKA 1G60A 2O05A 5K0LA 2CMGA 3EGVA 5U4XA 2ZCJA 3TFWA 1KPGA 4C04A 3FTCA 1QAOA 2FPOA 3KQSA 4FP9A 3TM5A 4AUKA 4CTKA 2LD4A 3I5UA 3ER9A 3UA4A 2CWWA 1L9KA 1YFLA 5LQUA 1G38A 3GXOA 3EVCA 3G8AA 1DL5A 2OPBA 4E32A 4FZVA 2K4MA 4HRAA 1B42A 4E30A 5ICCA 2EFJA 2ZIFA 3VSEA 1XJ5A 2QY6A 3T0IA 2GA9A 2ERCA 4RYLA 4CTJA 5FULA 4PYOA 3R0QA 3NDIA 3QV2A 3HA7A 3TM4A 4BP3A 3JWIA 1N7JA 2B2CA 3EVBA 2UZ4A 4ER3A 5FWAA 3K6RA 1FJXA 9MHTA 3M33A 3E8SA 3KQQA 2OBFA 2AOUA 3R24A 5EPEA 4U7TB 5FWDA 3CJTA 3HA5A 3P9IA 1EIZA 5GOZA 5FTWA 2UYQA 2PX4A 1Q0TA 4C03A 4CKCA 3NW9A 2PV0A 4PYIA 1IM8A 5CCXA 3SGLA 3NVMB 2N47A 3RODA 4RTLA 1SQGA 2B3TA 2GLUA 2OY0A 4FSDA 4ATNA 5K8VA 4IKPA 1M0EA 4K6MA 4OA5A 2OB2A 3KKZA 5K0NA 3U81A 2AOUB 3ELDA 4EK9A 3EVEA 2YVLA 2IGTA 1ORIA 3IEIA 1YFJA 1X1BA 1NV8A 1RJEA 2XVMA 3LSTA 4XUDA 4YMGA 4QTTB 2PJDA 3P9NA 4KVZA 1SUSA 4ER0A 1Q0SA 1EJ6A 4OQEA 4A6EA 4YV1A 5C9ZA 4HGYA 3K0BA 5DTQA 3EVGA 1G8SA 3RIEA 3LDFA 3F4KA 1IXKA 3HCEA 2AN4A 1KHHA 2ZBRA 3KPVA 1Y8CA 3EVDA 2VDVE 3UJDA 5FADA 3ERCA 3MGGA 3QOWA 1XDSA 5GIOE 4RTPA 4P7GA 1JG3A 5EEGA 3LGAA 1BOOA 1JG1A 1RJDA 3EVFA 4RTMA 4PYNA 1G55A 4IWNA 2G70A 3KR0A 5HILA 1L1EA 2ADMA 3GO4A 4PIMA 4E2WA 3FYCA 2QE6A 1EG2A 4XCXA 1VQ1A 3LCCA 3E05A 4HG2A 5DT2A 2NP6A 1RJFA 3CJRA 3FUWA 4L7VA 5DLYA 3KPWA 4R8SA 5F2OA 5JR3A 4PGHA 2JH9A 5FA5A 5LR6A 3KPYA 4FT4A 3LL7A 1G6Q1 3C6MA 3P97A 3JWHA 3HCAA 3M6WA 1KR5A 3EGEA 1JG4A 1NW7A 4BLVA 5E1MA 2P35A 1P91A 2AVDA 2EG5A 3H2BA 3LCUA 4R05A 4Z2YA 4OQDA 2HNKA 3QOXA 1WY7A 4FR0A 4YUZA 3PFHA 1RI1A 2NXEA 3B3JA 3DLIA 3DXYA 3MB5A 2IIPA 3LBFA 5C0OE 4KRGA 5KYGA 2NP7A 2YX1A 3AXSA 1FP1D 1QZZA 3MHTA 1R74A 2JH8A 1DUSA 1RJGA 2XVAA 3ELUA 5D1NA 2ZZNA 1INLA 2P7HA 5HOQA 2IFTA 3PT9A 1IY9A 4OA8A 3TQSA 1NW6A 2YXDA 5LQJA 2GB4A 3R6TA 5F2KA 3DXXA 4QDKA 2EJTA 3BUSA 4R8RA 4FGZA 3PX3A 2P40A 2OO3A 3DLCA 5HFJA 2CL5A 2XBMA 1JTEA 1XXLA 2PX5A 1AQJA 2A14A 3I58A
chains in the Genus database with same CATH superfamily
4ZTUB 1O3YA 3EK2A 3WJ2A 1CZHA 5CEJA 4PWYA 1H8HA 2QJRA 4J0EA 3MBIA 1MABA 4L4UA 3V34A 1V26A 1U80A 2ACVA 5E6UA 5JS6A 5TQ2B 1HSZA 3AEQB 3A05A 4EB8A 2IZ6A 5FBRB 2D2FA 3ANXA 2X8AA 4GYWA 4G0VA 4E51A 1U7XA 4DUPA 1U63A 2VL7A 2JIZA 2QVXX 3IRVA 3AXTA 1UOEA 1UPUA 2RJNA 2FUG1 2JFWA 3ZDZB 2WJVA 3OEED 4X0EA 4WZBE 3M7IA 3PUXA 3PC8A 2XH8A 3WRXC 5JISA 5KS2A 4RWEA 4DV1B 4FEYA 3GLIE 5JXGA 5J59A 4G2TA 1Z56C 4O59O 4BAGA 2PAAA 2M98A 1P1HA 2BV3A 2I80A 4QQRA 4HV4A 1VBKA 2Q2NA 4WGGA 3B1FA 4JT8A 4WINA 5ILQA 3EXG2 5DWQA 2L17A 1KO8A 1W85A 2IHZA 2FPMA 1URPA 1SMKA 4MVJD 2O9JA 3B52X 4EMUA 3IOEA 4FLFA 4J3JA 2ZRAA 4PE5B 3S7TA 2NQ8A 2AI1A 5LC1A 7MDHA 2XGJA 1YR7A 1J20A 4LBWA 5IM4F 3OBIA 4RW0A 2H9IA 4OLHA 4R6XA 1W19A 4A8JA 2FI1A 3PI7A 4M89A 1T9AA 4BN5A 1H42A 4ZOBA 4YUWA 2W6CX 2FCAA 4TQGA 5FYQA 1VIAA 1VE9A 1YDGA 3UPUA 4HR7A 1J97A 4FVTA 3HZOA 1K66A 4IG4A 4MQEB 4F5WA 3JY6A 3K6SB 5HDQA 3W5JA 1OXUA 1M5TA 1ULSA 1HRDA 2RBGA 3WYNA 3I9V1 3ZLBA 4GZMA 1CV2A 3IAXA 2OVFA 2YHIA 2NYAA 2P0EA 5UKDA 1SEVA 1E4OA 5ITWA 3VVCA 5ICEA 2HQRA 4V2IA 1WMDA 4JUCA 3G9UA 3ST7A 3ZC3A 3DFUA 4EB0A 2JHCA 3RTDA 2PCJA 3RAEC 3GU3A 2H2HA 4XDGA 4C1BA 3GLGA 1EP2B 2JFOA 4CG3A 3T1YB 4ML3A 2FRXA 1MFZA 4AY3A 1DXYA 5ICFA 5IKMA 3N2GB 4E5MA 3RG8A 1DX4A 2ONYA 4M0PA 1RVDA 3QLJA 3CF6R 3UMGA 4NCAA 3IT1A 4JB0A 3NBZC 3LW7A 3WJAA 4INPA 3LDUA 3OJCA 1O1YA 2QRVB 4CFSA 5KC8A 3BFKA 2M6RA 2OBBA 1KIMA 3MCWA 1A8SA 3QWHA 1SUFA 3SHFA 2JAQA 4JYBA 2X1VA 3V9AA 3FMFA 3ZHBA 5A5GA 2IODA 1YBHA 3EZ7A 5FA6A 2ZUTA 4F1KA 5GONB 1ZESA 1G21B 2XE6A 1JH9A 2HBQA 1W1WA 2Q5CA 1JAYA 1ISGA 3H0EA 4F4FA 2C8LA 2BKEA 2XOEA 4DBLC 4NXNB 3H2KA 3ISVA 3T3HA 1FRNA 5KI6A 1UMCA 2FCRA 4P36A 4ZK2A 3ONNA 3AHFA 2RMKA 5DX8A 4N0EA 4YT4A 2CDBA 1DDGA 3H2GA 4R8VA 4I55B 5JXHA 3FHJA 2PUAA 2BGTA 2OYCA 5EUBA 2C94A 3R6GA 4C3ZA 1D0IA 4HYYA 3BICA 2VTKA 2R7LA 4XGQA 4P32A 5HKLA 2H63A 1Z0FA 3KJQA 4BKOA 3ER8A 2GN1A 4M9ZA 5CG2A 4B83A 2HSEA 1UK7A 1L7BA 2DQKA 4UUQA 4X41A 3TO5A 4HTFA 4G56A 2AJTA 4FYMA 5KKNB 3R5KA 1WL8A 2FLKA 4JLVA 4LZZA 4J1NA 2P3OA 1II0A 2VHEA 5FJIA 2ZP1A 4GMGA 4US0R 1Y1LA 2YYYA 4K46A 1ONNA 4S05A 2A3RA 2PJRA 2VRNA 4A8JB 4ZK6A 2QJWA 3B8HA 5LDHA 1TCBA 3SXPA 1NPTO 3DMRA 1IN7A 5LFAA 4WLOA 5ESDA 4NJOA 1U9YA 2OV1A 2WJZB 5AXBA 1GV0A 1L8LA 3AF3A 4GZ3A 4J07A 4WZBA 5IXYA 2ZZMA 1RZ3A 3M83A 2PXCA 4MMZB 5AW9A 5KYXB 5K0CA 4AI6A 2C5SA 1Y7PA 4RH0A 5B1SA 4ZCRA 1M6VA 4KZKA 1XVTA 4L51A 1BX0A 1DKUA 1EDOA 2ATCA 1Y4ZA 5HOEA 3KDPA 1JL3A 1QH0A 4DEVA 5KJ1A 3S1LA 2FWJA 2HEIA 2XE7A 3K0CA 4BNLA 4QXQA 4MULA 3ILXA 5DOVA 5DDIP 3KYBA 3ITNA 1E9AA 4MDFA 4LJLA 3RW9A 2PKCA 1RCTE 1KTIA 1J8FA 5H1YA 1WCYA 4AUNA 5EKXA 3OPMA 4AIRA 1O8BA 2ECQA 1MJGM 4XUGB 3X1KA 5BMVB 1S01A 3GEIA 4W5RA 1G2OA 2F43A 4ALKA 2OC9A 5LU8A 1KP9A 5KQMA 1ILWA 3GRFA 2P9JA 1O96B 3PUWA 5L8VA 5JVDF 1WBBA 3ZK7A 1U1DA 3ZY3A 4HGPA 3NM5A 3TTSA 4O2LA 3DKVA 5IVDA 3OZWA 4GICA 1BROA 4QPPA 4LOHA 4FMCB 5DLPA 1P29A 4EKGA 1L2TA 5DNVA 4ZU1X 1CP3A 3PGA1 1NOKA 3GEBA 1R0CA 4B87A 3EDOA 1ZH8A 3KVOA 2XZPA 4DIBA 2QM7A 4D74A 5H3LA 3HSKA 2FSPA 5SICE 2GCOA 4UREA 1IY1A 5IP5A 621PA 3DDOA 5AI4A 2O6LA 1EFKA 3EWIA 4RYDA 4BB9A 5E4TA 1P19A 1JFFB 1J2TA 5CBPB 1QB8A 3QKSA 4X20A 1DNPA 5DM0A 5FHRA 3RUDA 3KT8A 4EF6A 1UXGA 2PFKA 2W5UA 1DBSA 3V97A 3AJDA 4CQMD 2ATVA 3NH9A 2OQIA 1AKEA 3G1UA 4MEBA 5SYAA 2WWXA 1SD1A 1ZPDA 4TTIA 2EBFX 2JCVA 3Q88A 4HDRB 2A78A 1TYBE 2O8NA 1IL0A 1OMOA 1Q84A 1M9NA 3HO8A 3TKLA 1DJMA 4XFDA 3ITDA 4AECA 2PFGA 5BXQC 5ULLA 2JZNA 3UMYA 4BPBA 1VI6A 1AGXA 1JJIA 3CX4A 4QUGA 1C4KA 1Q3TA 4ZWNA 4FONA 4EJ0A 1O6FA 4Z51A 2KS6A 4RFSB 4PO8A 1QO9A 1E3QA 1FYXA 3I9JA 4NF2A 4Q0MA 2X9VA 5ERYA 1TAUA 2ZUWA 4Y2YA 4YJGB 4MHOA 2CK3D 1O9GA 2GF9A 4FFDA 1NYLA 4LE1A 4ZRMA 1RWNA 4U9IS 4ZHQF 2HT1A 2H11A 2BONA 3ZQUA 2FSVA 5M7EA 5LCXA 4NS1A 1TLTA 4IF6A 3LY9A 5T41A 5CFZA 4ZQHA 1C1HA 1OJLA 5T5QA 5JCXA 4FFVA 3PE3A 5FQNA 1XZGA 1NVBA 3GPIA 4F4DA 1W87A 5A2GA 3CUKA 5LB4A 4DUGD 4X7BA 4UEOA 1N6LA 3HHPA 3IMFA 4DLSA 3SICE 2EHJA 3GRYA 4IAOA 2DWOA 1W6RA 3J7TA 4RPHA 3VOAA 4KODA 4IS2A 1J0AA 2P9CA 4TWRA 3R7AA 4E4YA 4P4SA 1X7ZA 4I4CA 1ZRMA 1Q91A 4KH1A 3WAGA 1GRRA 2FPXA 4M46A 1JVSA 1Y7HA 4KOEC 2JLCA 1E5VA 1SVUA 2PUWA 4XW2A 2ZITA 3EAQA 2WINI 2NQ2C 4YRLA 3TQQA 1DWUA 3I73A 4Y6OA 5I45A 5FV7A 3SZ3A 3LC2O 1ULAA 2X15A 3NXSA 4PTLA 4MI3A 3FFXA 3MFQA 1JG6A 2VAVA 2X8BA 5BOVA 3W2FA 2PE5A 1YULA 2X8JA 3K2QA 1GZ6A 4J03A 1DG1G 1Y37A 3ZCXA 2P67A 2F1RA 3QYPA 2OMEA 4XKJA 4LECA 2XXJA 1GYQA 2EV9A 4ZVMA 4H6WA 4MUBA 5LXTA 2A4KA 1R4MB 4LNUA 2B83A 3HNOA 4OMUA 4GPD1 1YL5A 5EXEA 4Q1BA 2B4QA 1OU0A 5F9MA 4NENB 1MX1A 3L05A 4DREA 1V3TA 5J58A 2JLSA 5A71A 1OVMA 2O7VA 1DTWB 3DCIA 4LYYA 3DJFA 3CLRC 3FCUB 4Y0VA 2A6PA 4UW9A 1N1MA 2I03A 5EWJA 3SZGA 4ZJPA 4RDXA 3L79A 4CMIA 2J5QA 1J33A 3F3KA 4G2NA 1Z18A 4S3MA 1Q74A 1JKJB 3PR3A 3G82C 1KO7A 1WB6A 4JYZA 3RRBA 2P79A 1XDZA 5KSYA 2NADA 3N3BC 1V6AA 4P4GA 2PLWA 2QLTA 1EUQA 3UFXB 1J1IA 1KQPA 1U04A 1Z4MA 2LZ0A 2OZVA 3OTWA 4BE7B 2F62A 3AY6A 3IAAA 5AVWA 2Z95A 3O92A 2WNHA 2FSFA 2W6NA 2G1UA 3WISA 1NTOA 4EJSB 4UUOA 3KL2A 2X3YA 4PGFA 1TAGA 2B30A 5FBHA 3JQ6A 1KQFA 1OBFO 3OJEA 2GPTA 5FNVB 3DC2A 4R40A 1GAJA 3OAAD 4PCAA 2P4UA 2VPTA 3CGGA 5CM2Z 2VKQA 1DIHA 1RP1A 1OZAA 3MCVA 5ALHA 3QNUA 4AC9A 1N34B 1ECGA 2IPXA 3WGZA 2AZMA 5FUYA 2V98A 1Z88A 4QQKA 3N2KB 4I8DA 3QE3A 4OHZA 3MTEA 1RYYA 5FFFA 1JECA 3COWA 4JDUA 4UXJA 4KNVA 1CY6A 2IS6A 1Q7CA 2ZSAA 2WLSA 4BLPA 1RYEA 4UQPA 4DQUA 5DBFA 2JD1A 2QV7A 4LDZA 1D2EA 2EZTA 4DZZA 2D1SA 4W1QA 5TQ0B 4IIYA 5D8DA 4WLNA 3PEWA 1P8JA 1MX5A 1KEUA 4Q9LA 4ZO4A 4BC0A 4DDVA 2FN7A 3NUZA 3AY3A 3QUAA 4GVPA 4UEJA 4YNBA 4R7GA 2E4VA 5A3SA 3OFKA 3ZVRA 4ENTA 3T54A 5K8LA 4W9NA 3O21A 2OCBA 4IQ0A 3EPJA 4TV8A 1NP3A 1CZNA 1IUKA 2RH8A 4M9RA 4UE2A 4A0SA 5DP2A 3ZE8A 3IOCA 3ER9A 4UZEA 1YFLA 5LQUA 3VISA 1B1AA 2ID7A 1PGNA 3RS9A 1HFJA 4OFZA 4J1SA 4B5KA 4DRXB 2PYDA 5TB5A 1AKNA 4MS3A 2ERCA 4A82A 2HHLA 4BX8A 4CTJA 1HNZB 2X9QA 1LFAA 3FOAA 3AV3A 5HZGA 1ZMBA 2LCFA 2QTNA 1SIOA 3CX8A 1TKBA 1FPMA 4CLHA 2QZJA 1L5VA 4DKXA 1PGQA 4TZ0A 3GLRA 1V11A 1J1ZA 3AR2A 3UHPA 1FEZA 1K68A 3GMDA 1P2DA 3QKWA 2FW6A 1XCMA 4BQIA 2ZUBA 1P75A 2ST1A 3DAOA 1D8TA 4G5HA 4M0CA 2AI2A 5GOZA 4LNAA 3S2UA 5FTNA 1PG5A 1UOQA 4R1TA 3HG7A 1TECE 2OO5C 1U0FA 3JZIA 3K2IA 3PQ2A 4JU9A 1XV5A 3V4VB 4C7KA 4MAFA 4NBVA 5I9IA 1EKXA 4K9DA 3MMZA 4PFKA 1QDEA 3G9XA 3PCTA 4MGYR 1RWQA 4ZT2A 1BGXT 4FFBB 1JZQA 4F85A 2PUDA 1MO2A 3ZCSA 4QKQA 1MNAA 2HYIC 3LC1O 3CLRD 4FBLA 4DV3B 1P7WA 4B2IA 1VMKA 3D64A 3C98A 3Q3VA 2CJYA 2YXBA 4OJNA 4ED9A 3REQB 1Q1AA 3AIKA 5EHNA 5C7YA 4C4TA 4TYQA 3HUTA 4WOPA 3KTDA 2ZIVB 4OQEA 5C9ZA 3H65A 4UPDA 3T35A 3VPAA 3K0BA 4RD3A 3ZHYA 1G8SA 3MMPA 2WYVA 1DTEA 1JP7A 3ETHA 3I5AA 1T91A 1Q7EA 2CXOA 1AHPA 3OLVA 5GZ6A 2BFCA 2MTBA 4V1CA 3MGGA 2RAPA 2IEAA 1TKAA 1QLWA 1BRTA 3BDAA 3OC0A 4LJSA 2VDJA 2E4XA 1BOOA 2IS1A 3DUFB 1G55A 1LEHA 5KTKA 2GFHA 2ADMA 4L4RA 5LMNB 2PEZA 4LDJA 1QUEA 3UT0A 4DM4A 1Z2NX 4LN1A 5EUCA 3LCCA 4LZAA 2PQ2A 2ZS9A 4EKDA 5J4LA 4MPDA 1EHCA 3B12A 3B5JA 3PWKA 3R5JA 4IDNA 4NCKA 5K2OA 3L7MA 1MIOA 3TE7A 3OM1A 1SO8A 1Y1QA 3JWHA 3CUYA 5LMCA 3ZWWA 1NW7A 2JVIA 2I4IA 4WZZA 4OO3A 1UAAA 1KMMA 2NG1A 2R44A 4G6ZA 2EP5A 1L7OA 5LVAA 4N6OA 3TQHA 1AXRA 2I9KA 2VDLB 1NC3A 2J8ZA 2FLWA 1D7AA 4KRGA 2DPGA 3SXUB 1FP1D 2BMVA 1SXHA 4K6OA 4DPLA 1XPJA 1FFXA 5IDXA 5JS2A 2APJA 1TK3A 3GCGA 1P45A 3TSAA 6GPBA 3QJ5A 4OA8A 1Y9EA 2JIMA 1RYNA 5C4IA 2ATIA 3PJGA 1S8NA 2GJKA 1DIOB 4FGZA 3QSYA 4G5YA 5GV8A 4OD0A 4LOJA 1JTEA 3VZQA 7MHTA 4AXBA 3SZLA 3C1AA 3LLSA 3LRPA 2FR1A 2QY9A 3KYCA 3NHYA 1TUGA 3BREA 1ZD9A 1I7QB 1IOWA 3PTZA 3BWVA 1KE1A 2WAYA 3KQLA 1JEDA 3BX1A 4Q1FA 1MOPA 4UD6A 5E4FA 1BXRB 5HCUA 4C6TB 1GRCA 1WUJS 2IUUA 4PYJA 4YLYA 1M8FA 2VJMB 3OFNA 3MC1A 4CM6A 4QBKA 1DBWA 3UXYA 5LBTA 5GVRA 1XU7A 1Z6YA 5JZOA 2ZI3A 1WBDA 1TJPB 1XL0A 4RY0A 5JROA 2EP7A 2IF0A 1PNQA 1RWVA 3BA6A 1AKTA 2PSFA 3FOCA 4AMZA 1OZHA 1LI5A 3QI2A 1E9SA 2G07A 4DDKA 4F9EA 1EQUA 4DV4B 1IZYA 1BOFA 3ZGXA 3JRNA 4LBZA 1PNTA 4F7DA 3N8DA 2ZREA 4B2PA 1COZA 2EDAA 721PA 1KI3A 3JASA 1WZUA 1MA3A 10MHA 1ZINA 2ZTUA 1GUDA 3KV3O 3F67A 2F1OA 5AVQA 4EKNB 2YNMC 2J3KA 3WMFA 3ZXSA 1Q17A 4EP1A 1AZLA 5KOIA 1YIOA 1HDEA 2REOA 121PA 3EOZA 4OQNA 5LJIA 3ADOA 3K4PA 3E15A 4JI3B 1GPWB 2HU5A 4R3WA 1PYDA 2ODAA 4BTLA 4RHEA 3ZWNA 2BFFB 3KZ1E 4PAGA 4O08A 3VJRA 2X22A 1ORDA 1UMDA 4UOZA 3KSRA 3PT5A 2O3SA 5AHKA 3MSXA 1WHTB 3DDCA 1PLKA 4ZAYA 3N0TA 3OOHA 1BN7A 2DHEA 3SYTA 3PQEA 3U9TA 4ZHSA 1TT5B 1U7TA 2BFFA 1ISPA 2VCEA 3K09C 1E2LA 4O25A 4UBKA 2AJDA 1XMQB 4NMMA 3PNLA 1R15A 1L5MA 1MGPA 1XQYA 2GS9A 4GR9A 1ZNYA 3U1TA 3JQDA 3LY7A 1KVTA 2O06A 3MEQA 4OMDA 4Y8VA 4HT3B 3SIRA 2OZEA 4DA8A 2Z2YA 1E0JA 4OBBA 4Q39A 4KRXA 5F78A 3ZWAA 3EE6A 1VJTA 3QLVC 1ZL0A 2WWVD 2MSKA 2P4EA 1BU5A 1XMPA 5G02A 2RSLA 1ZAYA 2N42A 2AGVA 2QZSA 1TQ4A 2EDCA 3E6AA 3H8SA 4NY1A 5E9JA 3T34A 4J0QA 2O8DA 3HFJA 1QRAA 1UM9A 1ZR2A 1IUPA 1JZTA 3DHWC 1UWLA 2TSYB 3EUFA 5T8KC 2CGEA 4DM7A 4IV0A 5GOTA 3TMAA 5ARBA 1PK7A 3R5XA 2WEKA 2G1PA 4Y2SA 5BSWA 3L7AA 3EZGA 4RPJA 3BMOA 2Q6TA 3K72B 3NBAA 1XMOB 4LZOA 2TS1A 1NJ6A 2ZYTX 3FKSD 2FPLA 3RYHA 1T1JA 2YWJA 3GCZA 4P81A 1YHNA 4CMCA 3OPNA 3AM4A 1FLNA 2CLFB 3CNHA 2H1HA 3S2ZA 1JDNA 3SKVA 4U63A 1IE3A 2BOVA 2QZPA 3GZNA 4PHFA 3KU1A 3W77A 1KRXA 4YAUA 3FJ1A 4EX6A 2OMKA 5A1JA 1Z6AA 3PXEA 5HVNA 2P9HA 4HB3A 3UJAA 5GJWC 3P9RA 1KP3A 1OGIA 1IBMB 1RZUA 2IYSA 5KYVA 1K98A 2H1CA 1U8ZA 3G8DA 1O9HA 2R1UA 5BSHA 5CXUA 5AHRA 5CVEA 1YRLA 3DVQX 4NYJR 1XTIA 4AN0A 1AF7A 1GVNB 4J1TC 2ZT8A 1HDYA 3R6LA 3INYA 1FDVA 4PANA 2ZR0A 3A1NA 5JSUA 2J4FA 2JF0A 4JR1A 1UQTA 2VXBA 1DRVA 3D8BA 4WBNB 3A0UA 2F3PA 4BNUA 1CIVA 2AC7A 2FUEA 1B0ZA 1Z62A 4XTCS 1DPGA 1H8ED 3JYPA 5AK6A 4QOFA 1YQUA 2DKFA 2H4HA 3CLTD 3JQFC 3HCRA 4ZOQI 3RIGA 5BRJA 1AK1A 1AJEA 1SB8A 1DV1A 4PM4A 3TNDA 1ZJJA 1W0CA 3I72A 4RQUA 1I9GA 3QBEA 5AMXA 5DHFA 3SX0A 4CLOA 2P41A 4GOXA 3ZD6A 2PUFA 4EO9A 2GRAA 5AUOB 3G1WA 3RD5A 5A4DA 1MIOB 4B85A 5AT1A 5BVGA 1MCZA 3LYUA 4PYQA 3G2MA 4BGDA 1VHDA 1DRUA 1RKQA 1SKYB 2J08A 4HC4A 2HGZA 1BMDA 2JA1A 3RABA 5IDWA 1UEIA 4HBZA 4KWTA 1CYEA 5IUKC 4NQRA 3UQYS 1UDRA 1JB9A 1NUAA 3AZPA 4MQFA 3ECCA 3U4GA 4W99A 2V0GA 3AFGA 1XVAA 2V7BA 3AEZA 1N5OX 3QXSA 2WKPA 3ZU2A 5CFPA 3DBRB 2XA2A 1KEEA 3UPTA 5TQVA 1T3ZA 4FYWA 5HQ3B 3F0TA 3COZA 1AD2A 1T5OA 3FUXA 3TLAA 2LNDA 3UK6A 1IXZA 5GMOA 1FS4A 4DE5A 5HIIA 4BE9A 4RADA 4REQA 3W2EA 1IHYA 1EVEA 3EG9A 3BD6A 4J6FA 1UBKS 2VYQA 1WUIS 2GPJA 3QK7A 4POOA 1GDTA 3N6RA 2VHXA 3P4YA 4B4WA 3ZQ4A 5COQA 4Q1AA 2AN3A 3FHLA 3K16A 1IXRC 1X1CA 5EYPB 3JV7A 1KFBB 3WWPA 4A8PA 4B0OA 1JEQA 4B3XA 1WE2A 2RB5A 1NBMD 2QNBA 3FI0A 4HADA 4R1PA 4WFIA 3IAS6 4PSCA 4E70A 2Z2JA 2CEKA 3A6EA 3EIEA 3B3GA 2ZRHA 5JJLA 4DMMA 4AJOA 1E3JA 1C2TA 3KJHA 2ZIWB 2QKYA 2FFQA 4ND7A 3UC9A 5IMBA 4KPEC 1C50A 1JSZA 3MJCA 2FKAA 4EATA 4QZVA 2V7QA 1IAVA 3G0GA 2JAPA 2NXNA 3WAJA 3G3EA 2J3EA 4IZHA 3KXLA 3HU2A 3Q7IA 4ND4A 1N9KA 5PGMA 3U7EB 3NT4A 2BH2A 1GKYA 2P0AA 3EXAA 1QYCA 3GVPA 1VL5A 1QORA 1J2JA 3PVCA 4EUKA 4EVQA 3KTFA 2XD9A 4Y9DA 3W7VA 4O29A 1FNCA 2PH3A 4B3FX 4NCXA 5GONA 2Y66A 1XZLA 3GYGA 4UJ3A 2XTAA 3JRXA 3HZRA 3QTLA 1KMQA 2JDID 3PLNA 4IDDA 4TQ9A 3VYTB 4J0FA 1OFTA 2J9FA 4JSTA 1ONBA 1DFHA 1ML4A 2O0HA 2ZTSA 4NSNA 4N39A 2P9TA 4N5LA 3SF8B 3OOYA 4Y1EA 2W2TA 5GJVC 1X0VA 1Y1PA 1T1GA 1ORWA 1NVVQ 2FETA 3LSYA 3NAZA 3MOIA 4IJUA 3U80A 1JAIA 2FFBA 3OBBA 4PAOA 3FBWA 3CV3A 3I6IA 1S9HA 2FE1A 3BK2A 4FKZA 1SHJA 2FWIA 3AIOA 1FFCA 3V8RA 3GROA 1WSDA 1FDUA 1LBHA 2HYDA 1XL1A 2OHGA 4PZPA 3Q8KA 1LPOA 4OUDB 1JVBA 4DV0B 5EZSA 3VA7A 1D2RA 1X1QA 2ZWVA 4ZCMA 1D2AA 1GNPA 3V4RA 4OLAA 3EHEA 3BD7A 3H97A 3EGXB 5JJIA 4L3VA 1WJGA 4Q1EA 5TJHA 2GFIA 4JKOA 4IUDS 5HQJA 5L45A 4U7DA 2I71A 3TZKA 2P0YA 1ABEA 1DKPA 3C4JA 4Q18A 1PEKE 2WZDA 1N7IA 2HLDD 4PW0A 4PHGA 1MEEA 2X9LA 3P27A 1BDHA 3QUCA 4EG3A 2GRJA 1NOIA 2H17A 4FEGA 2YQZA 1QKJA 3QYFA 1PLJA 2J0UB 3BHJA 5CK4A 2J87A 1M7HA 3QU7A 4TS1A 5CPBA 1BVUA 2JLXA 3VH2A 2GEUA 3LJKA 1MZPA 1L1RA 3MERA 2QP4A 2ZULA 3DMFA 4R1UA 3ONVA 5BR7A 3HTXA 2FPIB 1CUSA 3I4FA 3IPRA 3V8NA 4I4NA 2G0NA 2QYOA 4RXMA 3AJ9A 1KAEA 3KQOA 1W1UA 3ENWA 4B44A 1A95A 2R3SA 3VYUB 4ECAA 3J80A 2QI9F 4DOMA 1C9JA 1OWOA 4OGLA 5HRCA 1M6NA 2BBOA 4HOYA 4PLWA 5EE0A 2A67A 3WFJA 2Q5QA 4EF4A 5B7PA 4IVQA 3H5VA 5JT1A 4MMYB 1R6XA 1QO7A 4XDHA 4YJFB 1R6VA 4G36A 3K0AA 3TNYA 5CH5A 1V5WA 5FORA 4C7VA 5C8ZA 5HM8A 3VUFA 1Z63A 2R751 3N2IA 4DR6B 4XTRA 5HRAA 3N5CA 4MKRA 4TOIA 2PFSA 5LMZA 4KAJA 2ZSHA 3NHLA 4AF6A 5MN6A 3W5SA 2DJIA 4UAJA 4Z3KA 4REMA 1SJ9A 4NP6A 5F1YA 1M8JA 5AVJA 2ZWAA 1U2ZA 2DUWA 5J1SB 4AY4A 1L5QA 3Q6MA 1J21A 2DLNA 4ER7A 2GM5A 2WIGA 3AVWA 5L7TA 2GPWA 2X77A 5JAOA 5DNYB 2B7BA 3OZDA 2G09A 5AXDA 1WZNA 5J2TA 1Y3IA 1Q7GA 1W2HA 2QRGA 1H1LB 2JI6A 2NU9A 3BRSA 1ZD8A 4AKTA 1GKIA 2H1OA 4YXFA 1ZICA 2XB2A 4XWAA 1N75A 2VH5R 1HMYA 4I5EA 2QL7A 1RQLA 1UIMA 3L0CA 4RELA 4H7IA 4HX2A 1FTNA 1X42A 4I5DA 2ZSUA 3IUPA 3CLVA 1A9SA 2IHTA 4AN4A 3KCQA 3DOIA 1HYBA 3D5QA 5AKGA 1YXMA 5HWSA 2W2LD 1FVHA 3U7FB 1A96A 1MG5A 2RARA 1HL7A 3A4MA 4PN7A 5U4QA 3IEUA 4G5RA 5BP7A 3OT4A 4M1SA 4LHWA 2B99A 4HNAA 2XQIA 3RVKA 3CLUD 3EGVA 1KVQA 5E6SA 2LUOA 1IQUA 4Q7KA 1P2TA 3COVA 3FTCA 3GAAA 4YK7A 4EFLA 5JOQA 3R0JA 1VLQA 2RHTA 1XZIA 4GI3A 3B1JA 1QXSA 2BCGY 1NLZA 3NWOA 3WZ2A 3V1KA 2WM9B 5B3LA 1O6BA 2R8ZA 3D1JA 4Q4CA 1E4YA 2ZTMA 3VPFA 4D9NA 1B42A 3I6ZA 3GDGA 2HPHA 2VT3A 1W4AA 1ZBDA 3WDLA 3C6YA 4ZO7A 4CMHA 2IYRA 4X24A 4TL7A 4KC0A 1T1EA 4PYOA 1SVOA 1JHAA 5FULA 1CD5A 5K3AA 4ENSA 3UHOA 2D2XA 1NVEA 3QV2A 3ZD9A 4GT1A 1N7JA 5BSUA 3JASB 1JU9A 3JALB 4ER3A 4YAIA 2QTAA 3F9IA 3PQ8A 4YPOA 3TGWA 4F3TA 3D1LA 4LJ9A 4C0JA 1KYTA 4S2EA 1ISMA 4RQTA 2VBIA 5JTTA 3L4BA 2J45A 5KHAA 1XFDA 2IYNA 2UV8A 4Y67A 4G1VA 1NXSA 1PS0A 2VBCA 4ITRC 1SQGA 4G84A 1RLMA 2G67A 2X0RA 3JAWB 1XX6A 3SZMA 2HU8A 4NDZA 3BFXA 4IW3B 1ACLA 2OB2A 3PHJA 4X6YA 4WCFC 4I6GA 2ECPA 2GHRA 3LQ1A 1N0WA 3AHIA 1E18A 2YVLA 3KSMA 4Q66C 5TT1A 3IEIA 1E1RA 1X1BA 2W90A 4J4TA 5T4EA 3H5WA 3KYCB 4KOAA 3ZY2A 4BVGA 5KYTA 3TF5A 5ADUS 4DA0A 5KNBH 1G19A 4KVZA 4K8RB 1YMVA 5EIEA 1C30B 2FP4A 2YUTA 5B1HA 4YV1A 4IEIA 3HKDA 3OOWA 4MS4A 4MVJI 3UN1A 2JIRA 3IQEA 2C58A 5TMEA 2XB8A 4ZVLA 1RHQA 3B6MA 1AURA 3F9RA 3M49A 3PF9A 1B16A 2PRYA 4NMXB 3TVDA 3WWEA 1NSFA 2LCIA 3C7TA 3LVFO 4N7RA 4UNIA 2FG7C 3FXAA 4HAZA 2JASA 4PYNA 2FJUA 2Q5HA 2ODTX 3TGLA 2A1TS 1KQOA 4NARA 2QWXA 1YTUA 1H9CA 3F6EX 5H3CA 4JASB 3X1DA 1ZLXA 3DNMA 3HCOA 3E05A 4D0NA 3FM9A 3UANA 3LC7O 3LRTA 3TSOA 4W5NA 4B1FA 3DBVO 3E18A 3OQBA 4R8SA 4QODA 3NTRA 4DMRA 3TFQA 1FOEB 1IM5A 3KPYA 1M54A 1P4JA 2B8NA 1T4BA 2CUNA 3IAM6 3THWB 3C5WP 1PK9A 2XZTA 4EKEA 4EJFA 2JATA 3SYKA 2BKVA 3QIVA 2QUJA 2VPWA 4X3CA 5JSYA 2AMJA 2OCAA 4DSAA 2AVDA 3P4UA 5DYNA 4CIBA 1R8QA 1M2JA 4JJ4A 2LCQA 3WJ7A 3NC4A 1JNYA 4OJTA 4PRZA 4CFYA 2ZJ5A 3CUSA 3IT3A 1XTQA 2A9PA 4B80A 2RG1A 3D3QA 4M0EA 2O8EA 4WNAA 3NBKA 1CE8B 1JR6A 3C8ZA 2C7VA 3AO0B 1DEKA 2CMDA 2P5TB 1IXYA 2FDRA 3NYRA 3NB0A 4HEJA 4GR4A 4DHEA 5HJ5A 1SQ6A 2ZYAA 4R31A 3N2ZB 1Y5IA 5BQXA 1J00A 5DBOA 2XUAA 5JJKA 2E6KA 5E3HA 5B5SA 1CY2A 3SQOA 1PT9A 3I58A 1EE2A 1JVNA 2NPFA 4CHTA 2QDKA 1SZCA 1XJCA 3L0ZA 1KZ4A 5I7WA 3D2AA 1VL2A 2NNWB 2NU8B 2DSNA 1CBUA 3ODPA 4MOWA 5BN5A 4M76B 4UTPA 2G5CA 3DFMA 2PSHA 1FS5A 3AHHA 3KO8A 4RD4A 2XRYA 1X94A 4NFLA 1YUMA 1K6XA 1WXHA 2Q5LA 3H8WA 2JI9A 1Z8FA 3G7UA 1HT0A 2G80A 2PG3A 2LBPA 3ELYA 5HNKA 4GG1A 1DOHA 2WPDA 2GK6A 1OQAA 1X7WB 3O3NB 4EL0A 4EPYA 3L07A 4MYHA 4BB5A 1M1YA 4LF5B 1B41A 2Q4OA 3I9FA 1AHIA 3DOOA 2I2AA 1NFQA 2ZWIA 3D02A 5SY6A 3UYKA 3UAOA 2V9ZA 2Q49A 3VZBA 2O7QA 5EZQA 1FE8A 1ESEA 4I66A 5AVZA 1E77A 3DVRX 5F1OA 3GRKA 1VCHA 1GNVA 3KSZO 3SR4A 3UK0A 1B76A 1BMFA 1FA9A 3R41A 3GDOA 3D81A 5HS6A 5CT6A 4D9CA 1GTVA 2LDXA 1L4LA 4OAOA 1HDGO 2Q50A 3M2PA 4FJ1A 2JGDA 2Y1CA 5TRTA 4BJ6A 3K6KA 2F64A 1T29A 2XHEA 5JNRA 2B36A 5A4FS 1QWSA 2X4IA 5F5LA 4X91A 3W90A 2VUSA 1UK9A 4MVJF 2G6BA 4L95C 4UULA 2ZSIA 4HDMB 2FPRA 2A8YA 4NXMB 3EUAA 4HLCA 2QLLA 1NWHA 1R18A 4HQ6A 1HFKA 4CWAA 2HF7A 3FBGA 2D1YA 1HBJA 2X7HA 2R6ZA 4DARA 1LUAA 2GBPA 1CRQA 2J0VA 2Y0EA 3LUCA 4GS5A 4ZDWA 1FSPA 1IEWA 4Z3DA 3G6KA 1QBKC 4OKSA 3R6DA 2R4UA 1KK2A 2Q4RA 3A3YA 3EMKA 3OEHD 3TNLA 1IBRA 1MT3A 3VU3A 4EUFA 3HJNA 3IIIA 4INZA 3TINA 3KZKA 1YJ8A 3BWYA 3O3CA 3T5AA 5CM8B 2V7UA 4Q1CA 1K0FA 4OHXA 4BLUA 1WABA 2B35A 4YYZA 2XCUA 5ALVA 2WWYA 3PQ7A 1W85B 2B9EA 3EEBA 1PEYA 3IQWA 1GPBA 4TTJA 5GV7A 3V1MA 3GLIB 3OTHA 4JK3A 5BW5A 2H65A 4PZ0A 3IQDB 3GFVA 3ZW7A 1E1KA 1ZUWA 2CFRA 1WS6A 5JH7B 1YCHA 4FHEA 1A8UA 2BEKA 4A26A 3UJBA 4E5DA 1I4LD 1K75A 1TW3A 3A6GA 4R2LA 4CQMA 5F9HA 1GSIA 3AKYA 3T1VA 1D4OA 2C59A 4DUZB 2ENWA 2WHYA 5EJMA 1A88A 2JGEA 2Q41A 4QLOA 4EI9A 2JJ1A 3FR8A 1B6SA 2XMZA 2O8DB 1XQ9A 2XUDA 4WKCA 2YYZA 5FBVB 1XLVA 2QIOA 1E3EA 4BO2A 1JEEA 1JKJA 4HMPA 5AWFC 2JGLA 2ZU0C 1SHTX 3EDQA 3HDHA 1NVKA 4JLAA 5C51B 1A9YA 2OBNA 2X86A 4OM7A 2ZVJA 3ZIAD 4AJPA 4UAUA 2GJ8A 2Z4TA 3WGVA 3TZQA 1GGJA 1N33B 2XB9A 5JG7A 3BPSA 4PNEA 1DTWA 1ZY2A 1BS9A 5AK4A 3RIYA 4AS3A 5IYZA 2EARA 1ZD4A 3AV0B 3H4IA 1UBOS 4J0GA 5AJUA 3JQGA 4ZHQA 1OV6A 1U65A 1VE6A 3L92A 4CQLA 4RTJA 1NMYA 1A1SA 3TDMA 1EK1A 2ID9A 3C3WA 1Z3IX 2CB0A 3OURA 1EE1A 4QASA 5EKUA 3UAZA 5B1YA 2H1WA 4B75A 2YZ2A 5KJCA 2NV6A 2I6TA 1GILA 4FW8A 3P9ZA 4DSNA 4NBRA 1N5IA 3OFND 2HO5A 3FPEA 5DYIA 4DQ0A 5CDHA 2B4AA 2Y99A 1WHTA 4B6OA 3V1NA 1E79D 2Q3CA 4GUAA 1X8LA 4KNWA 4L02A 1I32A 4CIAA 3K09A 4YY3B 1ZHFA 2Z56A 3HVKA 4PPFA 1QM5A 2W8BA 1EWRA 1VM6A 2A9RA 3D6NB 1JR4A 1YI8A 3GEDA 3LL4A 3NORA 2M6SA 5SZKB 1FNNA 3FWHA 4WKOA 5CD1A 1O89A 2VP2A 4JC8A 3LWNA 3DVAB 4CZ2A 2WWHA 4R0VA 3QKRB 5KSPA 1HEIA 1L5HB 4JZKA 4FS3A 5MHTA 1QGAA 2EIXA 4MIYA 1OFGA 1XVLA 4P4SB 5IW8A 2XCRB 1NX9A 3FHTA 4DA6A 5HX7A 2YFYA 1O2DA 3LQQA 1LJLA 1I4WA 4RLSA 1OBHA 1L1FA 3W6PA 1TT7A 3VC7A 1DSSG 3KEMA 4FHZA 4X62B 1NP7A 5CYOA 3OVMA 1JA9A 2ZI7A 3PGKA 2XY4A 2LPMA 1YHZA 1P4HA 1VMDA 2AXPA 2NTNA 3D6VA 3GPCA 4EGCB 6NULA 1JQDA 4II3A 3VOBA 1PK8A 1IJFA 4YMWA 4W5OA 2Z3ZA 2V97A 5DCYA 3WGTA 2WV7A 3RKUA 1M66A 1H65A 2IDZA 3DE4X 3IKVA 1A5ZA 1NKTA 4M83A 5JUWA 2HQ1A 5JLAA 1IPFA 1T6XA 4M7RA 5KVQA 3USES 3KUDA 1JQEA 3OHPA 1K6JA 5BNZA 2C5AA 2JLQA 3GJSA 4AU1A 3PJDA 4G97A 5LZ8A 4RZSA 3DB1A 5CXQA 2HLNA 1GV1A 3PIDA 1SXJA 4IIBA 2CJWB 4HUQB 4YCBA 3CUEF 1ZN9A 5KKCA 1CR0A 1GDDA 4BS9A 3SM3A 1KSHA 5A9SA 3M70A 5BV2P 3KHTA 1G8HA 1PS9A 3OZSA 3QPUA 4G5QA 3ZHUA 4CM4A 2PKQP 1YOVB 3BT7A 5FFMA 3AEKA 3K70D 2UUBB 4JEMA 5E9WA 3N8IA 1QFMA 2CKDA 3QENA 3MTJA 3ROZA 4J16A 3CR7A 3WQHA 3ELWA 4GE3A 2WM3A 3TTYA 2QD5A 6REQB 3M6LA 4IMRA 3ID6C 2V03A 2JRCA 2AFHA 1T9GR 3FYDA 4IVNA 2YV3A 2H4JA 1SGWA 1FFXB 2WA2A 3LPNA 3W1WA 3CNOA 1Y3AA 3OJWA 5DBIA 3CZ4A 5FBWB 4NE7A 2I99A 5HZKA 4QBGB 1J42A 4BQEA 1AT1A 1Y9JA 1UC4B 4UNNA 4R7ZA 4NYIQ 1FP6A 2MSNA 5K1ZA 1JB1A 5IYZB 1V0JA 1FJGB 3U39A 4PONA 5LUAA 1SZDA 1MRNA 3EJWA 2G25A 3C5EA 3H9CA 4V3BA 4EHBA 1Z0IA 3AUJB 1V41E 1WR8A 3HCCA 1MW9X 1FYEA 3K9QO 4TLMB 1D4FA 1WPRA 1LK7A 5E7JA 5JADA 1WCXA 1V39A 2XTMA 4KLCA 4MIKA 4Y6LA 4RK0A 1T2EA 1E0DA 3PIIA 8ABPA 2YDXA 5HQ3A 3GJRA 1PJ3A 2G8NA 3TWOA 3ZUGA 2G88A 4ZDJA 4FDMA 3PDJA 4XUCA 1ZCAA 3KQYA 3ZE2B 2H0RA 4TTVA 4J16C 2QF7A 5ALKA 1JEAA 3EOAI 5KB3A 1USGA 1EUDA 1M8PA 3DAHA 1GGKA 3EDMA 2JIZD 9LDTA 4F2PA 2CV0A 3DEAA 3GJZA 3QVUA 4F3YA 1LTQA 1XTUA 4YRSA 5TY0A 3GLIA 1BE1A 2FEMA 1KSFX 2WG2A 2YXEA 4KBFA 5I01A 5IPFA 2CLDX 1WPQA 3A7DA 3LXUX 4M60A 5DI9A 3FPHA 1U0SY 2CD7A 1ZJ6A 4O4IA 1OU4A 4I2VA 2XDWA 3C3AA 5KYXA 3SZRA 2IEBA 1V8PA 1TVMA 1UEJA 3U7JA 4INJA 5DYTA 1OLXB 4UBMA 2ZSFA 1L3BA 1NASA 2HDHA 2Q9AA 4TKMA 4X1IA 1JSLA 4QULA 1ACMA 2I4RA 1NRWA 1ZIYA 3P7MA 2Q27A 2ZUVA 3HEAA 3VNRA 3VX4A 4CVNA 1JBQA 3PFGA 4MRPA 4DY6A 1GUZA 2AMYA 3K9GA 2PD6A 1YR8A 3VTKA 5HM6A 2FW1A 3H5LA 1FQWA 4Y2JA 4PAQA 4H1TA 4FQ7A 1BC5A 2RHWA 4U3JB 4KR6A 2NZWA 1ZSYA 3OZIA 3QKTA 1Q1GA 1AGNA 1GXSA 1GO2A 4LRWA 1U8FO 2W6JD 3C74A 3GRUA 5B58T 4BX9A 1LDNA 3OWOA 5M3BA 4HAYA 1NL3A 3S99A 3S81A 3TG2A 2G5GX 8LDHA 1YRWA 5K05A 5CU7A 5EMHA 3JYQA 2ICAA 4KFRA 1Q22A 1UUFA 1OPXA 3FWYA 4RUKA 2GXAA 1SBIA 4WKPA 1CDZA 4DBZA 4TKVB 2YWGA 4UTVA 3N8GA 1OD6A 3CPJB 4ZAVA 3WYGA 1YCDA 1L4BA 3A9CA 4XPZA 5K3DA 4AKSA 1TIPA 5HR5A 2O0JA 3E22A 4PIVA 3GLKA 1A04A 4FW9A 4JSYA 4H27A 4B84A 3VQTA 3L5KA 3V80A 4EH1A 2BP7A 1JWBB 4TX1A 2O2EA 2OP0A 3H04A 1KP2A 4LSWA 1JIKA 1DT3A 2MSDB 2J32A 4LISA 1U1FA 4RSGA 3SQWA 4C7OA 2AI3A 4HGQA 3FDIA 2V9PA 1BU8A 2Q9CA 2B4KA 3E4DA 3ZV4A 4R71A 3I61A 2C2YA 2P1DA 2D2IA 2Q3HA 4PZYA 3T94A 1KI9A 1WDTA 3TZCA 3B51X 2I7TA 1B6GA 3RTAA 1LV8A 1GL3A 2FZ4A 3KPJA 2GM4A 1V8FA 2DCMA 1M10A 4OXIA 3JQ9A 3ZHRA 3HB7A 4MO2A 5EKSA 2D0PB 3MWFA 4EW6A 4BLTA 3BHIA 1G8PA 4I1YA 1H05A 1DBPA 2VNIA 4NATA 5H7XA 1JEJA 1GQ2A 2RJ3A 2NO1A 2YW2A 1VL8A 4P7JA 4E15A 4OP2A 1WNTA 2Q1XA 2GR9A 4YCNA 4RENA 1R64A 4RV4A 2F55A 2E82A 1YV9A 3AFMA 5KYNA 5F3DA 1V7QA 3VHXA 3D3NA 3OHMA 3JQPA 4IMIB 4WNAB 5CB4B 4CM9D 1HO3A 4M1EA 4XQCA 4YB8A 1LNSA 3EF1A 4R9UC 1ST2A 1SOWA 4U6NA 1G60A 3GVXA 5U4XA 1TCCA 1DFGA 1SCIA 2SKCA 3A4YA 2VF4X 3AR4A 4I3HA 4RF3A 5DHRA 3OI7A 1P9WA 2WWFA 3O1JC 3VMFA 1ID8A 1KFCB 4B45A 1JQAA 2HBZA 3OG9A 1ZRNA 4QUAA 1G38A 4DGSA 2HF2A 3KVNA 4CL0A 4FZVA 3VPHA 2E0IA 4MV4A 5L4SA 1C80A 4E5KA 3UOGA 3VSEA 1HRKA 2YN4A 5CMLA 4GI7A 3SLRA 3QVMA 4OSPA 2GA9A 3C3EA 4BO1A 4YMUA 1U3FA 1E32A 2X1HA 1VRCA 3PUIA 3ZNOA 2IE0A 1Y4DE 5JRZA 3CNBA 1FW6A 4J75A 3DZKA 4GLLA 1LDBA 2I2XB 3O84A 4G4IA 5AK0A 4DRYA 3L6UA 5BWLA 1EK6A 2R86A 4BMNA 4YAJA 4F3KA 3K6RA 3OLYA 4NENA 4UVGA 3GUHA 1E1NA 3AETB 1GR0A 1YAHA 5PNTA 4RLFA 4ZMBA 5CLJA 2N1MA 4IIGA 1R4MA 2DBVO 3ZDYB 1I6KA 3F3MA 3N2EA 5IDQA 1ZCBA 3SKXA 2ZXUA 1X74A 2GO7A 4UTRA 2IF2A 3AM3A 1N6IA 3K9NA 3NW9A 3R77A 3L5OA 1IXSB 1ZC3A 5ENZA 3G0DA 1ECLA 5ARDA 4TYYA 3IT0A 4K03A 4E21A 4LFAB 4BPRA 5A04A 4HLQB 3Q3CA 1XMXA 2EERA 4OHKA 5ILGA 4BO6A 2WVJA 1A1VA 2I0FA 2YKGA 4CEJB 3OCUA 4H0CA 3SR0A 1IMJA 3FNIA 3R7WA 3WE7A 4YMGA 4FJ0A 1VSQA 4ZYWA 1A72A 4BZPA 2R5NA 5FH9A 2G0AA 3L01A 5F77A 4HEQA 4I0WB 2FF7A 4CDNA 1FJHA 3T7AA 2MINB 5DTQA 3I5MA 1FU7A 1ZMTA 1E3MA 4YJ3F 5B1DA 3CTPA 3HCEA 3TLZA 2ZBRA 2P5SA 1S4QA 3M9WA 4OUKX 4JNKA 4QWWA 3ZDQA 5FADA 3X1MA 1SXPA 3ICEA 1M1XB 2R6AA 3ZJ4A 2PU5A 5KYKA 4RTPA 1IK4A 3GJ6A 4WVFA 4C20A 2Q5FA 5ALPA 2QR3A 4BGUA 3W5IA 5IBQA 1YB1A 3TMKA 1QP7A 1V1RB 2I22A 3EXIA 4DCUA 2VXYA 3L06A 4Q9IA 1U8YA 4C0SA 2H51A 4DJ5X 1JEYB 1ZJWA 2VUHB 3V6LA 4JEUA 4H1HA 5JPCA 3AMVA 1AQ6A 1VB5A 1MOQA 2JIDA 4UZFA 5JS7A 2AKEA 2WTBA 1CF9A 1F17A 2FSIA 1E2FA 3SC6A 3EQ9A 4NOLA 5LR6A 1RCUA 1EX6A 1VLLA 3CEHA 5FWNA 1G4AE 2GZMA 5MDHA 1WKBA 3PQ5A 5KCZA 3FHOA 5CXXA 4BGIA 5B7QA 2R7KA 1Y4AE 4BNDA 1T13A 2B34A 2ZANA 2JI7A 2OR3A 2XAAA 2VHTA 4KIJA 4MGIR 4JQZA 2JAWA 1N32B 4PZAA 2FG6C 2ENUA 2I76A 3C1UA 3K1AA 5F7JA 5TMDA 3RUFA 3TSZA 2V58A 3GT4A 5C0OE 4EB6A 5G0VA 16PKA 5GPBA 4M3NA 1QZZA 2RI6A 3JTMA 3NEPX 3VR5H 1MZVA 1PYGA 4QJIA 1P7PA 4X20B 3W7BA 3OTOB 2P7HA 4DSOA 2UXDB 3OPYB 3LBNA 4LX8A 4B7CA 5JALA 1AA6A 2QVLA 1ZUIA 2FW0A 4KQKA 4EB3A 4MI1A 3KYDA 1JJBA 3HHEA 4N7JA 2ZTVA 3PX3A 2AQ8A 4M2LA 1O5IA 3KOMA 1N3BA 4IO1A 2H6EA 3JQ7B 2MMCA 4E11A 3NBMA 4Y2PA 5EE3A 1T4DA 3NVDA 1THMA 4KZPA 3GA5A 4F91B 2WFLB 1RM3A 2H4FA 2FWAA 2IP1A 2JZOA 4WZAA 3IMEA 3VH4A 5SYMA 1CZUA 1C7IA 2IKSA 4MGKR 4QSMA 3QE2A 4GL2A 3WDKA 3QKRA 1N7GA 1RM4A 1W8DA 8MHTA 2JFUA 2WVGA 4QQNA 4A92A 3AQIA 4PLYA 2Y3IA 4EG7A 3GVCA 2JAHA 2VCYA 3SJAA 5BWOA 3FWKA 4WZ6A 1KPHA 2W43A 2EZ8A 2FPPA 4PZUA 2NZUG 4KE8A 5CVDA 3ZWVA 4EY3A 5DN6A 1QU3A 1W4ZA 2XNCA 3GA7A 1RI4A 2CFIA 2VDMB 1OFHA 2EXXA 2NU6A 4C7BA 2HIAA 1Q5PA 4V0MA 2RGXA 4C4AA 1J8VA 5JECA 3LHIA 4H4CA 4C5AA 3JWEA 3NRCA 4LY3A 1W36B 2IZ1A 1RTKA 3CT4A 1GRVA 1MAAA 3QIAA 4RMNA 4TKUB 1C0IA 3IB6A 5E7IA 1M73E 1PV1A 2AZDA 3WTCA 2C9ZA 1ESMA 2HN9A 1T6ZA 2IXGA 2ZETA 4O2AB 1EIWA 1SCUA 2G1JA 3HBNA 3PGVA 4M7PA 4MR7B 4WCFA 3V32A 2ZRKA 1XJ0A 3C3BA 3LFTA 1NG9A 1TJ5A 1HX7A 2VPYA 2FKNA 2Z6VA 4KH0A 3RNOA 3WP0A 3H9EO 3WQSB 1H0KA 1IG3A 3MG9A 2OM6A 1W7AA 2QQ5A 2PN1A 5DTJA 1OZGA 1P2FA 1W5BA 3P2EA 2HKIA 4FMDB 1B7GO 3T9CA 4P4UA 2X2OA 2X5JO 3HJCA 1QHHA 2PRIA 2VNHA 2DWQA 4QFCA 1P9RA 2HZBA 1YC2A 2OAGA 3M89A 4A6XA 3FTEA 3HDQA 5BYJA 3DBHA 4HZUA 4YRCA 1DJOA 3ZWBA 2H7YA 1ADFA 4L1KA 1YZLA 4YAEA 4H7KA 4F04A 1SH7A 3WLNA 3Q8LA 3HJGA 3LA8A 5KHLB 2A0YA 5I4BA 4B3MB 4UFOA 4WKNA 3WHPA 1Z5OA 3L0SA 2OLEA 4W9RA 1G7RA 3NATA 1D2HA 2VQFB 1DBIA 4TYPA 5T4HA 2MYUA 3O7WA 2VOEA 2VIIA 4BBZA 3IHKA 3RO7A 4Q3EA 2PXXA 1NVUQ 1RI5A 2FRDC 2OM2A 3ORHA 5T6BA 3RSHA 3X1ZA 1X38A 4WXYB 4NYJQ 4X61A 4MUGA 3IVXA 3QX8A 3I05A 4FOOA 2ESRA 2YIDA 3WK5A 3IL2A 1W94A 4RVUA 1DAFA 3HWWA 4WNYA 1DAIA 3QY9A 1RXIA 2HWYA 4DJEC 1Z12A 2XE4A 4Q6WA 4HH3C 3IDZA 1SBNE 1F6WA 1XRLA 3ZWPA 5EIWA 1FFWA 4ITVA 4G9EA 5JAQA 2C7RA 7YASA 2Z09A 3I8SA 5B12A 4C7OB 1MIHA 1GG9A 4YFVA 3BGIA 4JOCA 4EJSC 3B1VA 4ZVQA 2Z4SA 2JFNA 1H3NA 4QAQA 5AP9A 3HKEA 4BX0A 4XGRA 3GP8A 4P4LA 4PZCA 4A0QA 2IUTA 3LPCA 3DDZX 5ALTA 1LS6A 4Q5IA 1RQGA 4F5DA 1MJ5A 1NJGA 5BXYA 2F4NA 2CLIB 1XAIA 3BFJA 4QVKA 4RX1A 4EABA 2ZM6B 3NBFA 3RFCA 1UKCA 3H6KA 2C0CA 2J46A 2QLMA 3NDJA 3QSGA 1P81A 3I8XA 4H6PA 2IW1A 1LJ8A 1NQUA 1Z0ZA 2IHUA 3HV0A 3KTOA 3WGJA 4GM4A 1Z4IA 5IJ9B 4Q7EA 1FDIA 4TV8B 4QDZA 3SHQA 3LPMA 2ET6A 1IEVA 3NBQA 1N0VC 3AF4A 1A5AB 1C0EA 3E3NA 4WESA 1ENOA 1JAHA 2HPVA 3DOHA 4YT8A 1JG2A 4HLUC 1X7YA 3KE9A 4YRRA 4AXXA 2A9QA 4NYMQ 1FDOA 3MGAA 1FRQA 1WMSA 1QK5A 1QNLA 1UBRS 1WQ4A 1FLVA 1WF3A 2Q4BA 2QRNA 3FYUB 4TRJA 4EVSA 2I1WA 3THXB 1VBMA 1QHGA 1WCIB 1ZITA 1D4ZA 2RAFA 4EYOA 3C43A 4MWEA 5TVKA 1NW9B 2QGZA 1I2CA 2H7XA 4OAQA 4FR5A 5F76A 2GXQA 2R6DA 1AB5A 1F1JA 2DF8A 2OTCA 4UD2A 2P77A 4RESA 1Z0JA 3RYCB 1AH2A 5EHXA 1THZA 1IY2A 1YK0A 1CY0A 2CEAA 2RGUA 2QIPA 2ZSEA 3R0VA 4KR0A 1BEEA 4MVWA 5AD1A 4X7RA 1CUCA 1J5XA 4N12A 1G5PA 3NYWA 5JO0A 1TJNA 4ZGGA 4FFOA 3SFTA 4EUNA 4JOQA 2I34A 3OZGA 1SWWA 1U4SA 1YRQA 3H8JA 4DF3A 3CEJA 1KMNA 1VE1A 2IOYA 3O1IC 4RKEA 1K4MA 1OGYA 1U2PA 4C0QC 2B6NA 2CXRA 3GJ3A 3MFYA 4IHJF 1YIAA 1Z6ZA 4F72A 5BV8A 1PJAA 1AZTA 2VEOA 4ZIRA 2YJ3A 2R00A 5DHPA 2BMFA 1JTFA 2ZRPA 1Y3BE 5JWHA 2FW8A 2BISA 2V59A 1KI7A 3HNRA 4YJFA 1AO3A 4X8MA 3DOEA 1WD5A 4JT4A 1J8DA 4J0CA 4M9QA 3KQMA 3LLUA 4KDEA 4TS3A 3QLVA 4HDKA 4G5OA 4ZT5A 2P6RA 1JJ7A 1ZG3A 2C9DA 2QYSA 5C5DA 2FV8A 4CM5A 4XVCA 4YWJA 4DDHA 1Q77A 1ISRA 1F0PA 3JCZA 3Q72A 2IU3A 3CR8A 1RACA 4C6SA 2G77B 4QPNA 4CT4B 1GU1A 2PVSA 5AUQA 3HU1A 3N87A 4Q9NA 3E9QA 4FILA 4AROA 4B3BA 1AGYA 4LIPD 1YR1A 3GUYA 5JVDA 2VJOA 1OWLA 4TVOA 5KWVA 4XSGA 5B4TA 2DPLA 2Z08A 2P3SA 3JSXA 2MT9A 4MJ3A 1J99A 2GCIA 2BJVA 3LP8A 1VSUA 1SOVA 4TLCA 4HRYA 4GBED 4MS4B 1TB4A 5BQPA 3NIGB 1BG6A 3PLAE 5L6MB 2CVPA 1O08A 1SU8A 3K8QA 5BO5A 3KOOA 3RJ5A 4IY1A 1DXHA 2WF7A 4FINA 1L4EA 2XCOA 1NVWQ 4G0UA 3E5RA 5LLSA 4WK4B 3KSUA 3NHBA 1SVLA 2JFVA 2WLTA 3AFIA 3ETJA 3DWGA 5AYVA 1NOJA 2PT6A 3C16C 3LDHA 3WNVA 3WK4A 1KO5A 1QTNA 4WLFA 2IEDA 1HI9A 1EFUA 3ZEIA 2YWDA 3GDHA 4I50F 3HMKA 4CKCB 1YI1A 3IEVA 1NZFA 1H2HA 2VDOB 5KNCH 3FSRA 2NIPA 3L0BA 1COWA 3A58B 2EJCA 1WXGA 2H06A 3R09A 4NMLA 2O6HA 1R8YA 1PG0A 2P4SA 4G23A 5IDYA 2R62A 1MC4A 3QEMA 4CN8A 5HKKA 3NG1A 3R8XA 3F3SA 4FUQA 4DYVA 1ZHOA 3DG9A 2PANA 4E6PA 2J9GA 2QBYB 2CXQA 3B36A 4YAWA 2DT5A 3VR5D 1RAFA 3U4IA 1K4YA 2WMOB 2XUPA 2XWBF 3PNMA 1WA5A 1JFRA 5JYBA 4YGYA 1V25A 1UPTA 3G8CA 4FCTA 3NALA 4HH4A 2GTPA 2GQ0A 3ISJA 3KLNA 4ZYUA 4I9NA 1E1QD 4J0JA 1R0YA 1OX6A 1F2UB 2PL5A 2NXCA 2W6JA 3CF2A 2BWJA 4Q02A 5IVKA 1LQ2A 2IC5A 3PPIA 4HTFB 1I94B 5K8UA 2C42A 2HRRA 3GMIA 3PEFA 4NESA 3PDWA 4QELA 1DAEA 3FTPA 3NWBA 2ONZA 1BHSA 1RNLA 3IRUA 1QAMA 1SU4A 3M1YA 5HEKA 2OE2A 1G20A 1T9DA 1Z6GA 3T41A 1R0WA 1TGYA 3A4TA 2HU7A 1HWYA 3LT4A 2QAGC 2BGIA 1C1XB 1DZ3A 1KGSA 1U5AA 1VP9A 1O97C 3D3EA 3H17A 3T99A 3VGJA 5BYKA 3DE6X 1I36A 4YDRA 2B4RO 2MINA 2R48A 3IC5A 2Y9MB 3FPBA 3ZBPA 3D0QA 3KB8A 2XIQA 3KM0A 4D7AA 1EEXB 3JQFA 4AX8A 4F86A 5IU6A 4L8WB 1BXZA 1K4KA 3MWLA 3IXQA 2VDNB 4R9RA 1SHZA 4J2OA 2IL1A 1Z5VA 4WXEA 3TB6A 4A6DA 3Q0EA 3S3TA 4N8DA 1IUNA 3AQ4A 1DKOA 1TFRA 2ZIXA 1L5OA 3EX7C 2L2QA 3HV2A 3GHHA 3WLSA 3VSBA 2BZ0A 2ZCVA 4UBJA 3TIXB 2Y1FA 5JSHA 3LNTA 4PYLA 5J2TB 1U2DA 3H84A 4BY9E 1FNMA 3ESQA 1QPBA 3MWDB 4P86A 2IX9A 2G04A 1M3SA 4O5AA 2AOTB 2PBRA 2GGSA 3I6QA 3F47A 4HCJA 5EXDA 4WFQA 5E7QA 5F9FA 2DFTA 4WSOA 3H9BA 3I1YA 4KWIA 1XWIA 2GZ1A 1T9BA 4ARBA 2WF8A 1N77A 3UCFA 5HMMA 1LU9A 5DGCA 4BO9A 3C87A 5JH7A 1Z8HA 4DR3B 2FWBA 2V7VA 1LTKA 1NONA 1UKYA 2GAAA 2I6QA 4FS8A 3U9SA 3VV2A 4H6VA 2BFMA 5CUQA 3H2YA 1ISHA 2HZ7A 1RDFA 5JNWA 2PSSA 4N76A 5AJYA 3SBXA 2J9ZB 4RSRA 4GF5A 1WCWA 4OKIA 2WJ4A 4FQ5A 3MM4A 1OXMA 2UZ0A 3KXPA 4TTPA 4IKOA 3A06A 3MWKA 2OXTA 4LMRA 1GCAA 2NWQA 4AJ1A 4CF6A 5T8KA 3NFYA 2J48A 1QHYA 3ZWQA 4B31A 3RTCA 2E37A 1A7UA 2PKYX 1VCOA 2XUQA 3OF2A 4D8TA 1DDOA 4TUYA 3OMLA 1JDVA 1ZMRA 1XRMA 4MQEA 4DMLA 4EEKA 1M1UA 5J3JA 3H1FA 2V6GA 4JBXA 3WLJA 1ZK4A 1U94A 5CB4A 5LZ4A 3WYFA 2W2PA 2OPBA 1GUAA 3KYIB 3D6AA 4NU5A 5D5HA 2D7JA 2C83A 2K4MA 5FLEX 1Q50A 1CJUC 1JPJA 1GTRA 3R0XA 3W8EA 3PEYA 1W36D 5TLSA 1QYWA 1RZVA 1EFDN 1XCBA 4MR7A 5CT5A 4O2AA 2X5OA 2RH4A 2VN8A 3TAXA 3HPRA 3OEWA 3G9ZA 4M49A 4DJDC 4PV7A 2E55A 1U6IA 2YV5A 3GIDA 4IL5A 3DD1A 3GT3A 1G42A 4BV3A 2JKVA 3HRKA 4FI3F 1AZWA 5LDGA 2CE7A 1WMFA 1BDMA 3FGNA 3OJOA 4UPEA 3AFHA 1QV9A 2AOUA 1A5TA 1ES9A 4U7TB 3KNZA 1NXXA 4KQCA 3ILSA 5FTWA 1U9CA 2HQSA 1M1NA 3LUFA 2JGMA 2IHYA 2WYUA 2VLBA 3B6IA 3VSDA 4CKBB 1AKMA 2AHOA 1S3FA 2VT6A 3EDRA 1M1YB 2JS7A 4PR0A 5FX2A 3ZW9A 2H07A 1X7WA 3QNMA 1YJCA 4PHHA 2ASEA 2QW8A 1U2GA 4K6MA 3U81A 4JLOA 4US2R 2PLAA 1ZXLA 4N40A 1DRKA 3I42A 4DV7B 2C9YA 1FUEA 1BAPA 2UUAB 3IMCA 1G18A 4PLVA 5K51A 3LSTA 4C4YA 3MWJA 3IDFA 4X45A 2EAUA 5HDBB 2JLWA 2J5KA 4DC1A 3ZIDA 4R84A 2VSQA 1JSCA 3CLSD 3KJNA 3LT2A 5FRDA 1FDRA 2IY8A 4BQPA 3U5ZB 3EBOA 4KAXA 4I7EA 1BW9B 4NFHA 4YIHA 1M34E 3EVDA 2XCSB 3QEOA 5HE8A 1TMGE 3W4JA 3ZU4A 2F3RA 2K7FA 4KMRA 3U1BA 2O1WA 3F7TA 1SXQA 1L0BA 3LGAA 3DDNA 5LZ7A 5JDIC 1ADJA 4IWNA 2B20A 2EF0A 3VR5A 3ML1A 1CB7A 3ACBA 1R5JA 4E2WA 4R8LA 3L6OO 4PR3A 1VKZA 1Z4NA 3FUWA 5DM70 5CEEA 5HF8A 3X2EA 4HVTA 6AT1A 4YJ2F 3LK7A 2HRDA 4BO8A 2O0MA 4MS3B 4AWAA 3GW8A 1AMOA 2GCNA 1PN3A 1KR5A 1RAEA 2HMTA 1Y6QA 3SLGA 1D6SA 5CLIA 2MYNA 3STYA 1O5TA 1WMAA 2QRKA 2PMWB 3I01A 1UPAA 2X0EA 4B43A 3H18A 3QG1A 4MDEA 1J4AA 4YVFA 1N5JA 1KSJA 1YB5A 4GPIB 3PFHA 2CXHA 1JEOA 3BMQB 3F9CA 1EFTA 1EP3B 2YIVX 4KO2S 4UAVA 2XJ4A 5KCMA 1HEYA 4IIXA 3A1SA 4KQIA 4Q4LA 3NH6A 4GLOA 2DFVA 2MHCA 3CWZA 1GA1A 4U39A 1GLGA 5E4YA 5HOQA 3EQ2A 3PT9A 4WEQA 4BMPB 4JDPA 2H2AA 1PW7A 1ZJ5A 4JEHA 2XA9A 4XZ3A 4WASA 4ALIA 3LH5A 4UVEA 3HCWA 4F93B 5L7YA 4KDFA 2IYWA 4WX2B 3SVTA 4B7AA 3D1VA 3MXTA 3QF7A 4BB6A 3LDAA 4PBSA 1AXGA 5LP6C 4DLWA 2P75A 3LX5A 3N2KA 1JALA 2UYYA 3DV2A 2VJYA 4ISCA 5IH3A 3CKMA 2B21A 2VLIA 3QPBA 4B3GA 3S27A 1SXJD 2GZHA 1BQ3A 4D8VA 3GLFA 1U2RA 3N7AA 1I33A 4NH4A 3ROPA 2B25A 3VO8A 5J5VA 4ALJA 1D1SA 3R3SA 4IJ5A 3WMGA 1EFVB 2GLXA 2FUKA 1RRGA 2VF8A 4I2NA 1H2ZA 4UM8B 3D6JA 3SCZA 3VC1A 1YF3A 2X5NA 4ZICA 3ZJUA 1CNEA 4NBSA 4ZCSA 3MUNA 4QT0A 1H5UA 2QG6A 3MQ4A 4FYKA 4HK4A 4M37A 4RNDB 5KHOC 3PFKA 2B8JA 3D3WB 3UJHA 3M4YA 2GLTA 1AUPA 1KYXA 1VHWA 4TT3A 4WUTA 3R3HA 4ZU3A 2J30A 4YAOA 3T7CA 1NZJA 2C29D 1VIYA 2GOYA 1ABFA 1TM7E 4G3XA 4QECA 2KX7A 3K7EA 5AHWA 3VR1A 5JAUA 1YJQA 3IJPA 1OAOA 3PSAA 4JLUA 1VJDA 3B6ZA 3OFSA 1T8RA 1LQTA 2OT3B 1W0JD 2JIQA 3OOJA 3K6JA 2O2XA 3H1GA 2AEEA 3QZUA 3TL2A 2ZW9A 2Q4EA 4XYGA 3FPCA 1E2GA 2BR3A 3K2EA 4DIFA 1ST3A 1L6RA 4IDAA 4LC1A 2SECE 3HC7A 3MVEA 3GX1A 1XP5A 4LRUA 2OO5A 4BOYA 2CMKA 5A9TA 3HK2A 3CUUA 3QLUC 2P9FA 3C5VA 3JQAB 3THRA 4PZEA 3ET5A 3SC2B 2Z6UA 3C1OA 3KR9A 1N2SA 2E49A 2WD8A 3FKJA 4TRNA 2GETA 2WF5A 4HVAA 3GVHA 5LQNA 1CUVA 2NPOA 3CT6A 4K9LA 4AZSA 2VPZA 2XNSA 3F98A 4J0DA 2I8CA 3VO1A 1TJ3A 2JZCA 1GCGA 4AO6A 4PPNA 2JVKA 5K3CA 1TRKA 4W1RA 2NTVA 1GT91 1X7GA 4MPPA 3TPCA 1RZRD 3BGSA 1NLUA 4QTXA 3QYJA 3DMPA 2OP1A 3SHWA 4EPWA 5A6SA 1VGVA 1JBEA 3TL6A 2ZS7A 5EIBC 3C39A 4DQVA 1LCIA 1HM5A 1WCIA 4H18A 1MD9A 4IV8A 2AB0A 3AI2A 4CODB 1CRWG 3AHJA 5HG0A 4LHXA 5B6IA 1QSGA 1VECA 3X44A 5IX8A 3PL1A 4F2GA 4OIFA 1II8A 4WCDA 4I1VA 1F60A 1ANKA 3CCBA 3GJ8A 3O2JA 5EMKA 1K7EB 1P4GA 1YQWA 4Z0HO 3GEGA 3Q1KA 5IAJA 4M87A 5E2AA 3EZ9A 3HB5X 3L0IB 2NLOA 2J6IA 1QG0A 3JVUA 3KWFA 4JLWA 4ZI7F 1QIIA 1SC3A 3N76A 2P3LA 1RYZA 3ZOKA 4IIFA 3WLEA 5KTOA 1TD9A 3GRCA 3QQPA 2CKMA 1GAWA 5JD3A 3V7UA 4WXHA 5A7GA 3HLTA 4QTYA 5ARCA 2RGEA 3NKFA 2HCBA 2AVNA 1JPNA 2XBUA 5AKJA 2X7JA 1R4AA 4AJLA 2AG1A 2IXDA 2D2VA 3AUUA 4LRXA 4M4SA 5AHXA 3FG9A 2H2FA 4E2YA 4XGNA 4DG9A 1AX9A 2CNBA 1T2VA 4DRXA 5EIBD 3V9PA 4TKVA 3D4BA 2Y68A 1XRQA 1LLFA 2QLBA 1N3IA 3CUVA 3LKZA 2PBZA 3BCRA 2IUEA 1APBA 1E79A 1RS0A 2VK8A 4LF7B 3MWYW 2NW6A 1XMSA 2F1JA 2ZQYA 4EPTA 2P90A 3E61A 2I3ZA 3V7FA 4S2UA 2QPAA 3EPRA 2G4LA 2SCUA 3F4LA 2I4NA 4R6WA 2PMKA 3BIFA 1RXYA 1XBTA 4D0GA 3E7WA 2OD9A 1LQUA 2XI4A 3CYFA 4QOEA 1LV7A 1CR1A 1NNI1 3AYZB 5IKPA 4LI0A 1T5LA 4QBTA 2HK8A 1MN6A 4C6HA 4GOKA 4JJFA 3OUZA 2L18A 3KYJB 4FYJA 3RT9A 4BNYA 5AIBA 1OLXA 1N92A 1ND5A 1LRLA 3KAKA 2R1TA 3A1FA 2IHKA 4BHTA 1TU4A 2C99A 3IPXA 3FNEA 2G82A 4O4IB 1PW5A 4RJLA 3VAZA 1JW9B 5KTNA 1Z15A 2GDZA 1AGPA 2V7EA 3F8TA 3AEUA 1J56A 4PLPA 1QR6A 1JHPA 2WIJA 1MH9A 3M4JA 5AVXA 2WP8J 2BI8A 1EUCA 3IMGA 1UJ2A 3EJ6A 5KDLA 5L3QB 2IELA 1EM6A 2PD3A 2R8YA 2AEMA 2DQZA 1WNFA 1FXWA 1QWOA 3VPGA 4D6PA 4H1WA 4H7EA 2A33A 2IYYA 3C6KA 4IQ8A 2VHVA 3FTDA 5K6AA 4HGZA 4RVFA 3RSQA 3UZUA 3S2GA 5EFZA 1R00A 1SCQA 4HDMA 5AJTA 3RS4A 1MDFA 2I1VB 3MD9A 1YVDA 4KI7A 1SKYE 3OE4A 1GFIA 4OJQA