3KR0A

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-6-ol
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kr0A00
3C6MA 2ADMA 3DTNA 3FYCA 4C07A 4PYKA 3LGAA 4GBED 1G38A 5K0JA 4EVIA 2N47A 3LBFA 3EEOA 3E8SA 3C3YA 1JSXA 1SUSA 4MHTA 2OB1A 4RVGA 5HZMA 3UBTA 5EGSA 3NDIA 2ESRA 1NW8A 2ORED 2YXDA 1KYZA 3C3PA 1O9HA 1I9GA 2PKWA 3JWIA 4ER7A 1SKMA 5EIWA 4DCGA 2Z6QA 4R8SA 5LR6A 3WSTA 1X1CA 2O57A 1IXKA 3NWEA 2FCAA 3HA3A 4NECA 2XVMA 4RV9A 2JJQA 5ERGB 2ZULA 2XBMA 3HEMA 1EG2A 3EVAA 2IBTA 3A27A 3KQMA 5GM1A 5DM0A 4F85A 3G5LA 4GC9A 5K09A 5EHIA 3LSTA 3GRYA 4P7KA 1OR8A 1NV9A 2GS9A 5ICGA 3G2PA 4EKGA 4AZWA 4OX9Y 2YUIA 4R6WA 1P91A 3LCCA 4EKIA 3ER9A 5KQRA 5JUWA 2AVNA 1RJGA 3G2MA 3GO4A 3MGGA 3R24A 2PXAA 2GAFA 3GDHA 4Z2YA 3TQSA 1RJDA 2BM9A 3M33A 4F84A 3DXYA 1AF7A 3BGVA 4PCLA 3DLIA 3P2IA 4RTPA 8MHTA 5DXAA 2O07A 2H1RA 1RJFA 3MB5A 5LQJA 5KS2A 3G5TA 5E8RA 3KPWA 2IH5A 3A25A 3GCZA 4E2ZA 5C0OE 4QVGA 2O0LA 3I64A 9MHTA 3A26A 3SR4A 1PRYA 3MAGA 3KQSA 3TM5A 2DULA 3T7RA 2YQZA 2ZBQA 2YXLA 3HTXA 5DTQA 4ZTBA 2EX4A 2B9EA 3CJQA 1M6YA 1QAMA 4FS8A 2AS0A 3EEYA 4L7VA 2VDVE 1Y8CA 3LPMA 5T6BA 4PNEA 1L9KA 2IGTA 3P2EA 4FT4A 4OA5A 2UYQA 1QAQA 1NE2A 3LHDA 1XDSA 4PYJA 1R00A 2ZSUA 5BW5A 3FYDA 5FHRA 2A14A 4BLVA 4BP1A 5CCXA 1ORIA 3HCCA 3E23A 3NMUF 3P9CA 5ICCA 5ICFA 4ATNA 3EVBA 3GIWA 1KPGA 4KIGA 5E2BA 4HGZA 1L1EA 1VP3A 2ZBRA 1V39A 3FPJA 4GC5A 1N7JA 2P3LA 2QYOA 1YB2A 4GOMD 4LWPA 2BH2A 1WXWA 2XYQA 1XDUA 5T64A 3DMGA 2B2CA 5K8VA 2G70A 1QAOA 3FPHA 4HTFB 4R05A 3G89A 1UIRA 2OPBA 4PONA 5HILA 3DOUA 5C9ZA 1JQDA 4RSRA 1I1NA 1G8AA 3T7SA 5LQUA 3VSEA 1WY7A 2OXTA 1YUBA 3EGEA 5E2AA 2PVCA 3SVZA 2IDJA 3Q7EA 1JG2A 3G2OA 2AN4A 2ZZKA 4CKCA 3A7EA 3P9NA 5DLYA 3M6WA 1JTFA 4E32A 3UJ7A 4IWNA 4BY9E 4M7RA 1TW2A 2EJUA 2OY0A 3NWBA 4DM3A 4H0NA 3DLCA 1VLMA 4PYQA 4QDKA 5K0LA 1I4WA 3B3JA 2QRVA 3SMQA 3TM4A 10MHA 2IBSA 3GU3A 3R3HA 5FQNA 5K0EA 1FJXA 1BKYA 3UJAA 1JG3A 5LQAA 3F4KA 2PJDA 4YUYA 2OB2A 3AY0A 3CC8A 3GGDA 5EQJB 4R8RA 4GOLD 5K01A 4X61A 4KWCA 3KR9A 2GA9A 1ZGJA 2PT6A 3PB3A 3FUTA 4KIFA 4U7PB 3V97A 2YXEA 2G72A 4YMHA 1XCLA 3EVZA 4QPNA 4V0RA 4FSDA 3EPPA 4LWOA 3CKKA 3HVIA 4CTJA 3KKZA 2JH9A 1XCJA 4PINA 3HCAA 5EZSA 3EVDA 1D2CA 5F2KA 3UJDA 2PGXA 3QOWA 3KQQA 3B89A 3HNRA 5KVAA 5GWXA 1R8XA 3ID6C 4BP3A 3EGVA 4Y2HA 3FTFA 1T43A 5K0BA 2Y1XA 3GRUA 2AOUA 3M6UA 5GOZA 5FA5A 1VPTA 4C05A 4E2XA 1X1AA 1P1CA 1DL5A 2P3QA 1X19A 1EJ0A 5EEHA 5EMLA 3D2LA 5FCDA 4PIMA 3I5UA 3NVKI 2QRVB 5EKUA 4AZTA 5MHTA 3FTCA 2YVLA 3UFBA 2PWPA 2ZIFA 2GPYA 2UZ4A 2JG3A 3LDGA 4E2YA 1TPYA 2UYHA 2PXCA 4ER6A 2AOVA 3HVJA 4FZVA 3T0IA 3CCFA 5FADA 4C06A 1R8YA 2R3SA 5CM2Z 3GXOA 1Q0TA 3PS9A 3RODA 3G7UA 3G88A 4PWYA 3LL7A 3SSNA 5F2NA 2UYOA 2ZW9A 2JHAA 3OZSA 3M6VA 3TRKA 3SGLA 1VIDA 3KQTA 1NT2A 4X41A 5EKXA 2EJTA 1EAMA 3NDJA 5HFJA 5C1IA 5GIPE 4FT2A 1FP1D 3FZGA 4KRGA 3KR2A 3DH0A 2NNWB 3K0BA 3BWYA 4LG1A 2H11A 3MCZA 1EJ6A 4RTMA 1R18A 4EK9A 3B3FA 2XYVA 1YF3A 4C08A 2KW5A 1AQIA 4XUCA 1ZHFA 2C7QA 3BT7A 3BWMA 2UYCA 2I9KA 3V8VA 2NXEA 1KPHA 1KR5A 2OZVA 2P1DA 3OCJA 3OU2A 4E2WA 4KDCA 5LQRA 3NW9A 4PGGA 4GOOD 5FA8A 3FUXA 3GWZA 1RI3A 2QY6A 1KXZA 5ICEA 3ER8A 3E7PA 4YUZA 4GEKA 1AV6A 2NXNA 2O05A 3HCFA 2P7HA 2B3TA 2JH8A 4RTJA 5EIFA 2ERCA 3KQYA 4K6MA 3KR1A 1MJFA 1ORHA 4M36A 3HCDA 3KR0A 5E9JA 4X60A 5KYGA 3G8AA 3M70A 3EVCA 4ER0A 3AWIA 3R6TA 5D1HA 4P58A 4WVLA 4AUKA 4RTRA 5E9QA 1NKVA 3FRHA 3MERA 4OBXA 4QTTB 3JWGA 3PX3A 3VC1A 3IHTA 3CGGA 2FK7A 2IP2A 3ELUA 2PY6A 5DT2A 1NBHA 1JQ3A 1X1DA 2ZFUA 3LDFA 4FSXA 3ELDA 2PX5A 4DMGA 3EGIA 4OQDA 3RW9A 3FRIA 2C7RA 1EQAA 3SSOA 3CVOA 2ZBPA 2QE6A 2P7IA 2ZWAA 3SSMA 3MHTA 4V0QA 2PXXA 5LSAA 1RI5A 3ELYA 3K6RA 3UA4A 1AQJA 2C7PA 4GOND 5CVJA 5K0GA 1VE3A 3KQVA 4P7JA 3OFJA 4YUXA 2Z6UA 5P8WA 5K0FA 1N2XA 5DX1A 3OE4A 1RI1A 2ZIGA 4AZSA 1NW3A 4G56A 7MHTA 3BZBA 2IPXA 1RI4A 3LDUA 3O7WA 3O4FA 4O29A 3DXZA 2P3OA 4PIPA 3HVKA 4M38A 1P39A 4RTSA 2P8JA 4X63A 3IV6A 1NV8A 4U7TB 2IH2A 2WA1A 3EMBA 4AZVA 3B7PA 2CMHA 4ISCA 4OQEA 3AJDA 4PYIA 4A6EA 3NJRA 2ZTHA 1TW3A 2I62A 4X1OA 3IYLW 3KU1A 1SVUA 3B3GA 3C0KA 2ZZNA 4IV8A 4MQ4A 2EFJA 3DMHA 4PYLA 4QPPA 4RTQA 5EVJA 3DP7A 3JWHA 3QV2A 5KQSA 3BGIA 3H2BA 3CBGA 5DX0A 3EMDA 4CKEA 3NVMB 2PV0A 3FTDA 5DWQA 1JSZA 1ZQ9A 4BLUA 2BM8A 1KP9A 2EG5A 2OO3A 2PBFA 4B17A 4E31A 4CXMA 1BOOA 1O54A 3JWJA 3T7TA 4YV1A 4OBWA 3TFWA 3TR6A 3FPEA 1BHJA 1D2GA 3TKYA 4EMSA 2IIPA 5DM4A 3UJ8A 5M5BA 1UFKA 1M0EA 4PCAA 3C6KA 4PYNA 1Q0SA 5GM2A 1R6AA 4C04A 2K4MA 4LECA 3G8BA 1B42A 2AOXA 4HSGA 4HTFA 3P2KA 2G1PA 5DM1A 3KQPA 2FK8A 3X0DA 2B25A 4MTLA 2ZWVA 3KPYA 2V7EA 3ORHA 5E1MA 5E9WA 5EG5A 5GIOE 4WXHA 4GUAA 3LECA 1KPIA 5E1DA 3TMAA 2PX2A 2ZVJA 4PGHA 3TKAA 2IH4A 1ZG3A 5HIMA 3PVCA 2YX1A 3LX6A 5EMMA 3PT9A 5EC8A 4UOEA 2B78A 3VYWA 3PTAA 4RVFA 1L3IA 4DQ0A 4YV2A 2Q41A 3M4XA 4RTNA 2G71A 1JTEA 2JHPA 3BWBA 4RWZA 5T67A 3FTEA 1WXXA 4E33A 4YUWA 1L3BA 2VDUE 4QDJA 3LKZA 5CVUA 1INLA 4CWAA 4RTLA 4ER3A 1SQGA 5DRTA 1VL5A 5HIIA 4A6DA 1XTPA 4PYMA 5FULA 4HH4A 4HG2A 3DUWA 5EMJA 5JR3A 3GJYA 4RVDA 5DTMA 5DTRA 2G8NA 4R6XA 5K0CA 3MTEA 3OZRA 3EVEA 2PLWA 5E1OA 3LCVB 5K0NA 2PX8A 2HV9A 2NYUA 2PX4A 1H1DA 2O06A 2FHPA 3FPFA 5DSTA 1FBNA 2WA2A 3BWCA 5HIJA 2AOTA 3THRA 1XXLA 2BZGA 4RVHA 3FUVA 2BR5A 1Z3CA 2VZ9A 3QOXA 1XJ5A 3FUUA 3P71T 5CVVA 3RIEA 3L8DA 2HMYB 2QM3A 4QTUB 2ZCJA 3R9XB 1KHHA 3DR5A 5DX8A 1EIZA 5FHQA 1DCTA 4DF3A 1L3CA 5E8JA 3I58A 4MIKA 2HNKA 3HA7A 3UWPA 3MCTA 5DPMA 3S68A 3ANXA 3OU6A 3PX2A 4CTKA 1NW6A 3PLAE 3UJ9A 1D2HA 1P1BA 3EVGA 5GP1A 1JR4A 3THSA 2YTZA 4JXJA 5GINE 2V74B 1RJEA 2AOUB 2ZZMA 1XVAA 5CIYA 2WK1A 2AVDA 3UA3A 1WZNA 3BKXA 4MWZA 3OZTA 2CWWA 2P40A 2I6GA 1KYWA 2BR3A 3DULA 3Q87B 1ZKDA 2JHCA 1VP9A 3OE5A 4M37A 3TOSA 1FPQA 1VQ1A 3I53A 5F2OA 5DRYA 1RI2A 2YR0A 4DZRA 1YFJA 2NP7A 4RYLA 1VBFA 2Y1WA 2VP3A 2AN5A 2F8LA 3KPUA 3BGDA 3P8ZA 5DM2A 4YV0A 5LQKA 3I9FA 3HCEA 3A4TA 5U4XA 1JG4A 3BUSA 3OU7A 3GRRA 3R0QA 4DKJA 3CJTA 4FP9A 1G60A 2FYTA 1QYRA 2CMGA 2VDWA 5K05A 2CKDA 3VC2A 4E30A 1U2ZA 3E05A 3ME5A 1HNNA 1F38A 3BKWA 3A7DA 4BLWA 1SUIA 5K03A 3DMFA 4HC4A 4OA8A 5B1SA 3TLJA 2PWYA 3ERCA 2XYRA 2HWKA 2GLUA 2HR1A 4HGYA 3HM2A 1IY9A 1QANA 2PSSA 3UZUA 2ONZA 2XVAA 3EVFA 1FP2A 3LCUA 5E1BA 3MQ2A 3UJCA 3HVHA 5FTWA 5EOVA 5CCBA 5HIKA 4POOA 2LD4A 1NW5A 3NTVA 5H02A 5EMKA 4GF5A 5DSXA 4QVKA 1SG9A 1KIAA 3CJRA 2NXJA 3M6XA 2AZTA 3O31A 4KDRA 1SQFA 1G6Q1 3FUWA 5EEGA 5LQCA 1F3LA 2DPMA 2ZIEA 3BXOA 5FWDA 5CD1A 1NBIA 5IKMA 1YZHA 3UJ6A 3SX0A 1NW7A 3GNLA 4FR0A 1JQEA 4YMGA 1G8SA 2BR4A 5EPEA 2PT9A 3P9KA 5CVEA 1HMYA 2P41A 4Y30A 1YFLA 4XUEA 2C7OA 2OBFA 5HEKA 1M6EX 4P7FA 3KPVA 3AXTA 3B5IA 4IKPA 4DA4A 2AR0A 3PFHA 3HCBA 2GB4A 2AOTB 2R6ZA 3DXXA 4FGZA 4KVZA 3U81A 3KPJA 4F86A 2HTEA 5BXYA 5LQNA 2E5WA 2IFTA 1XDZA 1IM8A 1R74A 2OYRA 4E70A 4PYOA 5FWAA 4C03A 3P9IA 1WS6A 2ZLBA 3OFKA 1JG1A 4RX1A 1ZGAA 2AOWA 2H00A 5CVDA 5HOQA 5BP7A 3HA5A 1BC5A 5FQOA 4XCXA 5CUQA 4C4AA 3SXJA 1O9GA 3ELWA 4QQNA 4YUVA 3MTIA 3G2QA 3LKDA 4AX8A 3KQOA 5EZQA 3REOA 4DCMA 2FPOA 2Z6AA 5FUBA 2IDKA 2P35A 3IEIA 3P97A 5DXJA 5EHGA 1QZZA 2NP6A 3UJBA 3SM3A 4P7GA 4ER5A 2GH1A 3PFGA 5IH3A 3TPZA 1G55A 4RTOA 4CKBA 4RTKA 1X1BA 4EQZA 3GRZA 3OPNA 2NXCA 4QQKA 3FPGA 2ONYA 4KW7A 5D1NA 1DUSA 1UWVA 1N7IA 4IV0A 3LBYA 3AXSA 3GRVA 2FRXA 5BW4A 1YZ3A 4HRAA 2OKCA 2CL5A 5G02A 3HP7A 1PJZA 4GQBA 1WG8A 4XUDA 3KQWA 2VS1A 1MHTA 2I7CA 3KHKA 2AN3A
chains in the Genus database with same CATH superfamily
1U5BA 2DLDA 3PV0A 5FOVA 4LTMA 4PG5A 4QFBA 4GBED 2HGZA 5CYPA 5AXDA 2P2GA 3L0ZA 3R5XA 1EH5A 1P4HA 3BZUA 4AUNA 4GWGA 3EDCA 3WGKA 4G89A 2Z5LA 4ZMRA 3KKOA 4PBTA 5AESA 2M98A 2W6NA 1QB8A 3GF4A 1PGNA 1KF0A 1AVTA 1KDRA 2XUJA 3RNLA 4QLOA 4IHJA 1U6IA 1KP3A 3R6LA 1Q92A 5H83A 4JLUA 2R00C 4G01B 5CLJA 4ZHQB 4DILA 1J0CA 4HAIA 1H23A 3BAZA 5CK5A 3I0NA 4YRCA 4Z49A 1RSZA 2QI9C 3VKWA 5IWCA 5D00A 2ZI6A 2XF8A 4D98A 1Y1SA 5G4LA 2HMWA 1UEJA 1BOFA 3PQDA 2WVJA 1ISHA 2QU7A 2GLTA 2XNJA 3HXTA 4ZEXA 5CFZA 2AG8A 4YJHA 4FGWA 2ZSHA 5K6TA 3UHJA 3A37A 1GG9A 1X8JA 4P93A 3TTUA 1SU7A 3LTNC 1GUDA 2FKAA 2IY8A 2V7QA 4UPVA 1EXNA 1YBVA 2AE1A 3WHIA 4D9EA 2QZZA 1KTIA 3M33A 2JAUA 1NL3A 4MPDA 1VXOA 4U2FA 4B45A 4KR6A 1PCXA 2O6HA 2QAGC 2H0RA 1DO0A 3EDMA 4NVRA 1NIPA 3PEVA 4JX8A 1G9XA 2L2QA 2ZGVA 1PEYA 2WHXA 3EZLA 4GX2A 3VR5A 1FSFA 2VDLB 2Z1MA 1YQTA 3G5TA 5ERYA 4AWBA 4PRLA 2IH5A 2R7AA 4RQTA 4JT2A 3DVSX 4Z4FA 2Q5LA 2SICE 1BXRA 1KO5A 1AHIA 2H92A 2HV8A 3DTYA 3GGSA 5FB3A 4LFCB 1Y4ZA 4R1NA 3K6JA 1BE1A 2DULA 2HA2A 1Q0RA 1W76A 2ZBQA 3NAGA 2B5OA 5LQMA 3DM9B 2E5LB 3L84A 3HKCA 4PLFA 4PPQA 3OLZA 3T52A 3V2IA 1ZAYA 4EPRA 1KQ3A 4Z6KA 2DE0X 5HNKA 2YJNA 4EHAA 4CV1A 3ND9A 2YYAA 3HDVA 2KBFA 4MUEA 1EVQA 4IQ8A 1PEDA 1OU0A 2Z4TA 4IJVA 3GLIE 2G5TA 2HF2A 4H3VA 1OA1A 2WWIA 1R9JA 1KTVA 2A14A 3ETEA 4JC5A 4UATA 5EE0A 5FUXA 1Y3HA 3GRCA 2V3VA 3DAHA 3LZCA 5AJHA 2YWXA 5HP4A 1D1TA 1KPGA 1SIOA 3E84A 4OHZA 1G2QA 2GM9A 2AXNA 3D7RA 1VJTA 4DIKA 2QZJA 4K9MA 2P3LA 1LLUA 4MI1A 5DHFA 1DX6A 2Q7DA 1YKSA 4EA7A 4OYLA 2WAOA 1SXJB 5GZ6A 1WVIA 2BCEA 4HWSA 3WZMA 4ZAWA 1SZDA 3A6EA 1Z63A 3KBBA 4N9QA 2OPBA 1Y7IA 2H9YA 1E9VA 4O25A 1KJYA 1MKYA 2IYQA 1NR5A 2OFWA 3BMCA 3OZUA 3SKYA 4C9BA 4H60A 2BZ0A 3W9BA 4YAGA 4ILEA 1LC3A 3MMZA 5BQFA 2YWDA 4V1CB 4MA5A 1NQVA 4JA0A 5ITSA 1N9ZA 1VE6A 1A2BA 1Z4IA 2FSPA 5CXUA 3K2BA 3FDIA 4MDYA 2XTJA 5JAPA 2AN4A 1U5CA 2GAJA 3D8TA 5DLYA 1Q0QA 4PC6A 3CUYA 2R79A 5TVKA 4R7GA 1CB7A 2HPHA 2EJUA 2NLOA 2D54A 2JJ1A 2R751 1MMFB 4M7RA 3GJXC 3MMPA 4J75A 4FJ0A 2Y9MB 3RTDA 1QRDA 1NFFA 2XIJA 1KOLA 5C8ZA 1NLUA 2PPVA 4LHSA 2DSNA 3F98A 1WHTB 3GUCA 4U02A 5MN6A 3AY3A 2HUPA 2Z83A 3B20A 3GDFA 2IUSA 3R0JA 2C2WA 2WG0A 5EXEA 2H85A 3AFHA 4X61A 4Y2JA 1LPBB 4G4IA 3MT7A 2YXPX 5AH0A 1LDMA 1SVWA 3OFVA 5F51A 3R0IA 1WOYA 4OP1A 1NUAA 5B53A 5LOVF 4FDAA 3EEFA 1DG9A 2EWVA 3I6IA 1M2VA 1Z34A 2BVNA 3D3NA 1V7PC 3L41A 4JYCA 5H7XA 1ZL2A 1N2CA 3CY6A 2QQ0A 5TT1A 4BNFA 1YAHA 2E49A 4M1YA 2FWPA 2HF7A 2CDBA 2AXQA 1XEAA 3U61B 3Q8MA 3IOEA 3ITEA 2OQ2A 3VKHA 1N6IA 2J5XA 4D9HA 1JDZA 2AGVA 2YCLA 3JSXA 5HJ7A 1TA9A 1VRWA 2CV0A 3FOCA 3MCVA 2GFHA 2I4IA 1BS1A 4WKNA 3W2IA 2CXXA 1JNXX 1GCUA 2Q46A 3SZRA 3ORRA 1C29B 2I6XA 2VCEA 2HA0A 3NVKI 4HATA 3E58A 4I2NA 4AZTA 3UFBA 4BNLA 1WA5A 1EUDA 1XP8A 1HX7A 1N7GA 1JHOA 3SD7A 3ZC3A 4B83A 1C4WA 2EZ8A 2ID8A 4QARA 5EL0A 1EWYA 1L7MA 2JEYA 2VP9A 3GRKA 3HA2A 3SVTA 3EW7A 4IDHA 4Y2UA 4JBWA 4YP6A 4L4ZA 1IL0A 2VDOB 3U62A 1KK3A 2QLLA 3WK8A 2W6QA 4UOQA 4X41A 1Q7CA 1NT2A 3DO6A 1JDBC 4ZMBA 5JI3E 4X84A 3ZCPA 2O8CA 2CBXA 4DBZA 4HDMB 2J9FB 4J91A 3DEAA 1NAHA 1W34A 3BSYA 1R18A 5ELMA 5ADWA 1YF3A 3P96A 1GV1A 3IVRA 3WP0A 3B8HA 3OTWA 4IIJF 4RJIA 2EHDA 4M1TA 4TS4A 2XD9A 1H5NA 4KXUA 5IW8A 3QYJA 2IE0A 5BV0A 4E2WA 3NC4A 4PSDA 2CWDA 3EUAA 3WQBA 4B7XA 1UPBA 1TYAE 1EP2B 1VE9A 1WUIS 2P6OA 4BO0A 2B0CA 1KFKB 4BV8A 1Y5LA 2H16A 2JD2A 4NDNE 4RUKA 2RH9B 4QDTA 3ZKAA 1OGJA 4BUJA 4YUZA 1IMJA 3B51X 2GWHA 5AJUA 5CXQA 4YJ2B 3AHFA 4CLDA 4ZOLB 4F97A 5EIFA 4NV3A 4F6CA 1WCIA 1UP6A 5E9JA 2HT1A 3RS2A 3PPWA 3E9YA 2JI6A 3O95A 4R1UA 4OQQA 3RYIB 1YQQA 2JFQA 2P4SA 4P58A 3RVMA 4QEDA 3FBGA 3WICA 3FRHA 1TOAA 3OBBA 4EG8A 3EDOA 2YKGA 5KYTA 4DGQA 4PIVA 1SXHA 4KVFA 1N78A 3HDJA 2AIRA 4AUMA 2J3EA 2WFAA 2OZEA 2PVSA 3L0SA 3S99A 4PN7A 4RSGA 5H81A 2WD7B 4LYAA 4Y6OA 2Z1NA 3FIUA 4R2JA 3V6LA 3S2GA 3BD6A 3QENA 3RVDA 3ZXYA 4CRWB 4EVSA 3HXQA 5A7FA 3PEYA 2OP1A 5L6LB 1IY1A 3RSZA 2GHQA 3WLEA 5JSKA 5LSAA 3H3FA 3TQOA 1P29A 2VTVA 2CVPA 2PCLA 1DIGA 2J6IA 4IGIA 4BGDA 2Y05A 4MLCA 1BRMA 3H2GA 3OLVA 2XA1A 1RC0A 1VLQA 4EJMA 2YC2C 1XTVA 2V0GA 4JLVA 4KJZA 1CRZA 4P92A 5EJ2A 2PNJA 4D8YA 1PK9A 3OMWA 4DGSA 2HLHA 1XVLA 1DKPA 5KYYA 3MLBA 4MGEA 4Q9KA 3DXZA 4PIPA 2WHPA 3ETGA 3QBJA 2ZE7A 4ZI5A 4UUBA 1ORTA 3EIUA 3K35A 4Q9AA 1JKXA 3GUYA 4IFIA 5G41A 2IH2A 3VHQA 1ZCFA 2O1EA 4NS4A 4AJ4A 1YVRA 3H5NA 5CFQA 3ZEIA 1I2DA 3H2YA 4OFWA 2XZLA 1UKEA 1UJNA 2AF3C 3VR4H 1HNXB 2KPOA 1G8YA 3HU1A 1J56A 5CGZA 1DQRA 1YRQA 3GLVA 3ZN2A 2XHZA 4PYLA 3VPAA 4QPPA 1P0MA 1U0HC 1YZNA 4KPFC 3JWHA 2R68A 4HUTA 2C5SA 1MQ9A 1OAOA 1RP7A 2IYSA 5DYNA 5EWMA 3TBHA 4NF2A 2Z2YA 4YRSA 4XQCA 4HLQB 1A96A 4WFIA 4FOSA 2CUTA 1T3GA 4BLUA 4DM7A 1JIUA 1KP9A 1JEDA 1WABA 2PMWB 2I4RA 3LCRA 1BVYF 5GJCA 4AM8A 3CRRA 1DAIA 3BMOA 3CW8X 3BX1A 3MMXA 4MV6A 4GBMA 4AXBA 2GAIA 3P1JA 4EG5A 4Z51A 3HMQA 3L7NA 3KXIA 4AKSA 1HT1E 5H3LA 5C3MA 2ZE6A 5EP1A 3FBWA 3TL2A 1FY2A 3K71B 4PYNA 4Q3AA 2G40A 1SNYA 5GM2A 3IA7A 1P6UA 2JF0A 3OCYA 4PRYA 1WDKA 5J63A 5J47A 2G9ZA 4L95C 3CXRA 3GPBA 4JJ6A 1ZA2A 4QATA 3WIOA 4NESA 1AT1A 3ANSA 3MBOA 3OPMA 4J7CA 4ITVA 3UATA 2WHEA 2Z08A 2ZR7A 2K7ZA 3HLYA 1U2DA 3UJNA 1ODIA 2TSYB 3Q2KA 3RKSA 1WLSA 2NW6A 1P72A 1CEYA 3DOCA 1BMQA 4DLBA 4RVFA 5IT9A 2AWOA 4YV2A 1W8DA 2Q41A 1KOFA 3OE7D 5H80A 3QTLA 3L1KA 4W7IA 3OJWA 4WBNF 3D3EA 1PD0A 1DB3A 3NFRA 1X0XA 2QM7A 3ICEA 1HDCA 2COUA 3BEDA 5CFOA 2Z09A 5BRNA 3HU2A 3T7KA 4ZAVA 2QD1A 2VWHA 4P3PA 4YX9A 5BW8A 5FULA 5BYAA 4NYMQ 3QELB 1SEPA 4PX3A 4E11A 3FWKA 3C24A 5ALZA 5EYPA 2NSHA 1QS0A 4AL4A 3EDRA 2DHRA 3VHXA 2O06A 3UT5B 2KS6A 1V7CA 4BBZA 4CT4B 1ACLA 2JJMA 2NPOA 3TOZA 2VZ9A 3NO4A 1PYGA 2ZYUX 1OJ7A 4UHDA 1JDTA 2ODWA 4R69A 5B3LA 1TU0A 2H1HA 2HU8A 2ZYIA 2ZS8A 4BDSA 3IESA 4IX9A 1BMDA 1MAVA 2EU8A 4HGQA 4U7WA 1JEYA 3I73A 3I58A 3GXBA 5DN6D 1WVMA 3AX6A 2AC7A 3LTEA 3LLVA 4OQMA 4P53A 2GCIA 4B6QA 1ECJA 4OYRA 5IBPA 2ODAA 1ZD3A 2OLKA 2R1TA 5EPOA 4FFDA 1C8LA 2PQ0A 4ZCSA 5KHLB 1ENYA 2YMPA 5FBKA 1NPTO 3BC1A 3TNLA 4WEQA 2ZOSA 2ZJ1A 3ZGYA 5G1NA 2ZBGA 1H2XA 4LFAB 4GMXA 4KIJA 4D9BA 4CM9A 1IHPA 4KXNA 3RFXA 1IOZA 4ND1A 3WWDA 1XAJA 1B8OA 2R0QC 5CA0A 4LDRA 1TEZA 5F2OA 1RXWA 3IULA 1E9AA 1KRWA 2QXUA 1RBMA 3FHCB 3H8VA 3P8ZA 4LPKA 3FHJA 1Y8QA 4WOPA 1CFJA 3GLGB 3I9FA 1OH8A 5LD2B 3HVUA 5AHWA 5U4XA 2E89A 2ZBEA 1GQQA 2MTBA 1XAHA 1G60A 1A77A 1OYWA 1PJQA 3JZAA 4IVQA 4P4GA 4YDRA 4IXTA 3VC2A 5HOEA 4KC0A 3ZU6A 3A7DA 2WU1A 2P2CA 4OHPA 4G1UC 1ST3A 5FBRB 1X70A 5DIZA 1DO8A 1OZHA 2PLFA 3KZNA 1OBOA 3WV5A 1MRSA 2OMKA 3HKEB 1DPFA 5AHXA 3RM3A 3NAZA 3ICWA 4KXXA 4Y2TA 4S04A 2I1QA 3ZKWB 1XKTA 2FMUA 5BWLA 4HNUA 1FVHA 2WZCA 1Q5PA 1UP7A 3HVHA 3ISJA 4A2PA 1CVRA 5DI3B 1D2AA 3COVA 3KDPA 5I7VA 1QU2A 3OT1B 3IXMA 4DMRA 4GF5A 1QGED 4H6PA 2HOQA 3WS7A 1PKXA 1ZM4A 5HKOA 2O3TA 2PBZA 3O31A 3D6NB 2OHHA 3ZD8A 2L17A 3BK7A 2CHUA 5DEIA 5CFMA 2VPIA 3AVTA 3BMNA 4TYPA 3T54A 1VGRA 5HF5A 2X8JB 5KVVA 4FFWA 1P3JA 2HRDA 2JFZA 4G0YA 3PGJA 3N8GA 3NHRA 3FLMA 1FZTA 3HL0A 2HW8A 1ADYA 3T99A 1LI7A 3HCBA 4YRDA 3DFUA 5AKHA 1ZNWA 5TMDA 2HNBA 4IHAA 4QU9A 3GRPA 3RHZA 4E6PA 5HUHA 1E2GA 1CTQA 1Z56C 3FMOB 4D4KA 1LRJA 4DDUA 3UGJA 2PTGA 4ZT6A 1K8XB 2ZLBA 1Y3CE 4O2BF 1IOWA 5D3MA 4QC2A 3ZVMA 2BCJQ 3W9SA 1VJRA 3A2NA 2F2TA 2HAEA 1D4FA 1UDXA 2AW3A 2XTNA 1A8QA 1Y33E 2GN4A 1LEHA 1TFRA 2WIKA 1KE2A 1II8B 2RC5A 3PRYA 2UVPB 2Q3DA 1Y1PA 4J1QA 5D3ZA 3ONWA 1NKTA 1A7AA 3BH0A 4IQ0A 3U17A 1OGIA 4OXXA 1V16A 1SUDA 2G4CA 3A3OA 3HEAA 1N9GA 1G55A 1QE0A 1U2PA 2C5AA 4OQ4A 2JATA 4QFCA 4OI1A 2P2NA 4FONA 3S2EA 3VYRB 2CUNA 4UNQA 4A92A 2JFNA 3HABA 3V4VB 4XVQA 4CI9A 1Z5VA 5WRFA 2BFFB 1ZQ1A 1C9EA 2FRXA 4U5XA 2OKCA 3J7AC 1F4LA 2V9PA 5TR9A 5AVWA 4GPIB 1CUGA 2TMDA 1CUSA 5HQ3B 4EYSA 1MUUA 1S4QA 2GF9A 1HYQA 2PQ2A 1W0CA 3IAEA 4ID3A 2MT9A 3UXEA 3ZE7A 1LB1B 2NUPB 1X6VA 4JITA 4LY6A 5HDBB 2QTCA 4EATA 4PVCA 3IOCA 2NQ8A 2VHVA 3N2ZB 2WTNA 4QQFA 3OEWA 2UV8A 4NKRA 3AINA 4BNKA 4KE7A 4DNFA 4NYIQ 1ND6A 1BE6A 3ZCUA 1MABA 1ZMOA 1I9GA 2A88A 2JFPA 5EXDA 4XVUA 1SKMA 2VG8A 5C7OO 3OQHA 4IMPA 2GZ2A 3MLAA 3CN9A 4YN3A 4ZJZA 4KLRA 5DFAA 4G4JA 3DFIA 1S3FA 2JJQA 1S8NA 4EYQA 3GMIA 1GZ7A 1RYFA 4JJAA 5FNVA 4BRSA 2XJ4A 4R5HA 4DC0A 1E3QA 3KD2A 4PLYA 4TKUB 1B23P 2V3WA 3H42B 4F85A 3C8UA 3NFYA 1TK3A 5IYZA 3HJHA 2WG1A 1YL7A 2MSWA 4L1KA 1GNQA 1ACJA 4JDPA 3DPUA 4R6WA 1Q1NA 1P91A 2ASVA 3AEKB 3PDIA 3HN2A 5IDXA 4OXRA 1IHOA 1YB4A 2PL1A 3FF1A 1L6RA 1ITZA 3G2MA 5IDWA 2JH3A 1YRWA 4NSNA 1AF7A 1Z2EA 4ZO7A 4G0NA 2AW5A 2VI5A 1OKKD 2A0XA 1O5OA 4M9UA 4TKVA 4B4KA 4LBZA 2BM1A 2R6DA 4V02A 4RHTA 3TG8A 2OLEA 1JA1A 3QX8A 4ZYZA 1THZA 5E8RA 1KZ6A 3CLUD 2WSSA 1USIA 3GAMA 4V3BA 4QVGA 1BX1A 4U39A 5L4SA 3A26A 2F9FA 4J0QA 5B58T 3UW1A 5JY1A 2FSSA 1XPUA 3ADCA 2Z0MA 4G5FA 1GNPA 3L4JA 2RHLA 3IT2A 1QO0D 2C3PA 1VIVA 1JG6A 3TLYA 3FPSA 4CLOB 2UUPA 3Q98A 4Y0VA 3ZTWA 5T6BA 4L4YA 2FE4A 4ZCPA 4D5EA 5BR1A 5BXQC 4Q4AA 3EBLA 3ZDRA 1YQDA 3P2EA 4PC2A 1N2CE 3QXSA 1NXWA 2YHAA 3BJZA 3VU1A 2O7RA 3BSWA 3E9DA 4XPIB 3P0FA 2D7JA 5BW5A 1QUEA 3BD9A 5FBLB 2RHWA 1DQZA 4MLZA 4C6TB 3GGJA 5HXAA 5A2QA 4WOKA 1EESA 4KQCA 3EGXB 5ALNA 5ICCA 3HEBA 2ZP1A 4BKQA 3NPMA 4XGNA 1RZUA 1W36C 5F76A 1P4JA 3KLMX 4LWPA 2R7MA 1YA8A 5IVPA 2ETVA 1E2QA 1QIJA 3IFSA 1D4ZA 1Q74A 2RGNA 3EPRA 3N1UA 2VUIB 1GN9A 4KMMA 3RBVA 1SCAA 1YCHA 4D99A 3KSBC 3B6MA 1Q19A 4HB0A 2H2GA 2IDZA 4P82A 5CH5A 3DOUA 1SO8A 3CMCO 2DLNA 4FYMA 1JEEA 3U9SA 4I0WB 5E6SB 1VJ5A 4A8TA 3UHOA 2OECA 2WDZA 1E1DA 1IFXA 3NEYA 4PHHA 1F1BA 4CLXA 2B20A 3ZOZA 3WL3A 2IDJA 5KTNA 1KJZA 4KI0A 1PJSA 1L4NA 4JIGA 4TYYA 4OHRA 2ZTMA 3M6WA 4QUGA 4E32A 4IWNA 1IRXA 4OYYA 3L8CA 3UGTA 1URPA 4L5JA 3PT5A 1SIWA 1PGPA 3EXIA 1GOTA 3KZ1E 3NWBA 4IQGA 5LZ7A 2VPZA 4H1WA 3Q8LA 5K0LA 1I4WA 1XX6A 4WQMA 5DO9A 4L0MA 4UDOA 5FQNA 3P5SA 1BKYA 4HS4A 3UM9A 3ZWNA 1K1EA 3TB4A 1U7UA 3WIBA 1LSOA 1R4NB 3AZQA 5AVSA 2XCOA 4UNIA 1ESNA 4NJMA 2EC5A 2CXTA 1EVKA 1Z4LA 3K9FC 3VQTA 2WG2A 5I8WA 4Y9RA 5LP6C 4RW0A 3T1OA 4M99A 3KJNA 2Z9BA 1LQTA 1NU6A 3GUZA 4N0MA 4UAJA 4D02A 2P0EA 3N70A 1O94C 1TZ2A 3NHAA 1G1MA 1E8MA 2CLIB 2VATA 4RK4A 4ZK6A 1PG5A 4KGDA 1H66A 1ZSNA 1IIBA 4JR2A 5FKJA 1MHPA 5GWXA 3HO1A 1PZEA 2R1TB 4REQB 4ZO6A 1FF9A 1G21E 4IW3B 5KNCA 1DL5A 1EE9A 3L7DA 2ECPA 4JGIA 1EXWA 4KSCA 3SF8A 2QI9F 1MNQA 4BV9A 1XTTA 2N42A 4LX0A 1CZNA 3QVGA 1X1EA 3Q3HA 2GBCA 1GA6A 2EQAA 2TRSB 3PDHA 5JIBA 2AFIE 4K3VA 3VR2A 2ZIFA 5SYMA 4UTZA 4E2YA 1YR9A 5AK4A 2IY9A 2OESA 1EFPA 1XJ0A 2YJZA 3CCFA 1V8ZA 4ANFA 1ODKA 2Y27A 1V16B 2WR8A 3CWZA 3G7UA 4NAHA 5T4BA 3IQWA 3SSNA 5BUCA 1ISGA 4MJXA 4NMHA 4RZ3A 4WFKA 4BB9A 3IELA 3V1MA 4QXPA 1R9NA 6NULA 1GQOA 2JCGA 1TM5E 4LDZA 3TQIA 4BWYA 3IT0A 3FW1A 2OORC 2O59A 2I03A 3JAKA 2OQRA 4NQZA 3Q9SA 4J90A 4ZJPA 4IMRA 1NF3A 4C2AA 2ZS7A 2X7HA 1P2DA 1XZDA 2W2XA 5CLIA 5F7JA 2I3AA 5C8YA 1CY7A 3VPFA 3EMVA 1FFDA 3NHBA 4QUEA 1YXMA 4HBZA 4LHEA 1JVSA 2P1DA 2GPBA 2ZXFA 4OAPA 5CAEB 3FYTA 4Y2SA 1WZUA 5FA8A 4JT8A 3NWOA 2Q49A 2W7TA 2IXEA 1RQXA 2P8SA 1EINA 4YY3B 1F6WA 5CAEA 4DSZA 3DNPA 2OCPA 2VJBA 4QOIA 4WLEA 4YRFA 5JPDA 2FJPA 3UOAB 1DARA 5LFAA 4PXAA 4EGAA 4J0GA 2VHEA 3CZAA 4WFQA 2OR3A 3JQAA 4EQ6A 4MVJP 5A3QA 4K6MA 4ZVVA 4L3VA 3RH0A 1MJFA 4ZT2A 2XT9A 3M70A 1KH3A 3H87A 1GKYA 4QOFA 1OWPA 1U7ZA 2X2FA 3EGDB 3GJ6A 4HGPA 2PGLA 4G8JA 4XA8A 2C2HA 4A5SA 1QHHA 1R7RA 1JFFB 2QZ4A 2ZS9A 4NDZA 4PE5B 1G5HA 2V6JA 2OXRA 4KQXA 4EYGA 4EI8A 3F4LA 4UU1A 5H4GA 1MQSA 2X2PA 2IP4A 1Y4SA 2XMBA 2AFIB 1UAGA 2Z5GA 3B1WA 1Q2XA 2P7IA 4M8SA 5TF4A 3IEPA 2WV7A 2XECA 3FCSB 5KVAA 3SPXA 2GESA 2FW9A 1RYDA 2PXXA 1OH7A 4WKOA 3TLZA 2PL5A 3DTVD 4RKFA 5JH7F 2POCA 3BIFA 3H99A 2XWPA 4ZRDA 4AWXA 4D3FA 5IZCC 1JBQA 2OBNA 4IIBA 1EK6A 5FTJA 1RLIA 4MJ3A 3DYBA 2O4UX 3BZBA 3FM9A 4L8YA 3GG9A 3O7WA 4X9XA 3NHPA 3R0XA 1GCOA 4F3TA 3PI7A 3NASA 5DF1A 3KSDO 4PU0A 4BEWA 4KITB 3FKSD 3PNQA 1OF1A 1QLHA 3NR2A 4W9RA 3UYLA 3T1VA 3N0XA 3TLEA 1D2NA 1L7BA 2W83A 1KYIA 5AKKA 3W6NA 1NATA 2HMSA 5BQXA 4QAQA 2WPDD 5KWJA 3ESXA 4C2TA 3F49S 1P5FA 2QTVA 1RWNA 5FD8A 1J7JA 2PK3A 4LDJA 1Z33A 2JAPA 2R4QA 3W3ZB 2ODPA 4O0LA 1DCMA 1JLSA 1M8KA 3CLVA 5CXSA 4JMPA 4MCHA 4OV6B 3TMYA 1EUZA 3RROA 4F9FA 4DDWA 1GDTA 3WWCA 1MABB 5BNIA 3HDHA 1J2YA 1DIOB 2R85A 1Q0LA 3C8DA 3UTDA 3G0HA 3SEQA 1Z45A 3BIXA 1P1IA 1SURA 4M4SA 4TMWA 2VNAA 2P30A 1FDRA 3JYOA 4UAVA 3IKLA 4IYJA 1B14A 5JHHB 4PCAA 2B8JA 4HNGA 2DERA 1IWPB 5IRCD 4URFA 3OTIA 3STXA 4E51A 1WTAA 4EPWA 1BKSB 4XVRA 3OTOB 2CXPA 2YV5A 4JOSA 3H2JA 5KYKA 1QS0B 5TEVA 4BO2A 4M9CA 4Z8XA 2P6NA 2UYYA 3IQZA 1NQXA 1ZG3A 1B0ZA 1QLWA 4OUDB 2D7CA 1VOTA 1QHYA 3BD7A 4GKKB 1DJMA 5HW0A 4ACAA 2FFBA 4YCJA 4ENRA 4J7AA 3KALA 4MKGA 3NBUA 3K8QA 2JLRA 5KNDD 2JD0A 4IJQA 4DQ0A 3JX9A 1HDGO 1MGOA 1K6JA 1X7ZA 3JVIA 4CMAA 3KOOA 3QJYA 1V37A 5KDDA 4M9QA 3E8MA 3CX6A 4DR7B 1RS0A 4RSHA 2XPCA 2BMDA 3D3KA 1INLA 1WKCA 1T5HX 3AFMA 3BD8A 5CTJA 3TYXA 3WNVA 3WRWA 3S29A 2WTBA 4FINA 1RYBA 2AT1A 2OVFA 4BMSA 3UPUA 3DUWA 1P2TA 4KPUA 2OV4A 3IPYA 1H8ED 1MG0A 3WAJA 2ZT7A 3B5EA 4KUGA 4ETWA 1N5KA 3DW1X 3EVNA 4RY9A 5G40A 5K0NA 2QY9A 3K92A 5KJ1A 1X8LA 2E4YA 2WUEA 1JW9B 1G1AA 1B7GO 3DWIA 2AHRA 3IAUA 3PCTA 1W30A 4HB3A 2BFPA 3O8BA 3U3RA 2PLNA 2FDCA 4B3SB 4RJTA 1NW4A 1S8AA 4W8OA 1HGXA 3DMNA 4JI8B 2IWHA 3URMA 2BE7A 3RIEA 3G7SA 2ETXA 4WADA 3RS9A 4EA9A 1W5SA 3DR5A 2G6BA 5FHQA 1ECCA 2BT4A 2D4AA 3IP6A 2WZQA 1RIIA 1TKRA 5LUAA 3L7YA 1ZJZA 2O0KA 2OAGA 3E7XA 3WRYC 1COZA 2TMKA 3V4RA 4FVTA 2QN9A 1W85A 5LU9A 2EEZA 2HH9A 3RSSA 3PJEA 2G9RA 1TVCA 2BEWB 2DPYA 3AKCA 3KEGA 3L06A 3MS2A 4R8LA 1XOIA 3THSA 3ZBTA 4FOLA 3BYZA 4I5IA 3ZCRA 5B1EA 2RGRA 2NVOA 4UHKA 4FIDA 3RAGA 2YOHA 1W88A 3CEMA 4AVYA 3ACDA 3WLMA 1V45E 5FL7D 2PBLA 3E1SA 3JQGB 1C14A 1OTYA 4OQPA 1WOMA 3ZHSA 5EXXA 2VBGA 1ZKDA 2G9NA 4ZPJA 1FPQA 2O2DA 3Q3JB 1KORA 5JWHA 3V80A 1L5MA 2RKWA 1N2ZA 1YFJA 1Z7WA 5TMBA 1AX9A 4BP9A 2WNIA 4OQYA 2XSZD 2CL0X 3RFFA 1JQAA 1LTQA 2PS3A 2WKRA 4YA6A 2EFHB 4R2HA 4GBGA 1BAPA 3BUSA 2P9HA 2XOKA 3JWEA 1YL6A 1OX4A 3WGIA 5TJHA 3HGQA 3LXMA 1Z0FA 4IGEA 2BDEA 2J7PD 1F38A 3ZLBA 4K9PA 1N0VC 4R1OA 2X76A 3QH4A 3NBAA 3DMFA 4CV2A 3GEEA 4TS3A 5JDIA 3TF5A 3G23A 4AU1A 2DT5A 2WYWA 1ZZGA 2DCUA 5A7GA 2Q28A 2AMVA 2GEVA 4OB7A 5K7SA 2C5FA 4YH1A 1QANA 4F2GA 2CEAA 2J5KA 1V6CA 1FP2A 2NO6A 4R3UC 1K9VF 5EKSA 5H9VA 3T3PB 3FTNA 4YT5A 1EVZA 3UWSA 4L5AA 3G59A 3FDJA 2TS1A 4PV7A 1F48A 2H0AA 2J32A 4D8VA 4MKRA 1U04A 1AM4D 3LUBA 3FUWA 1GSAA 3IUQA 4IDOA 1ZXLA 3A6LA 1RQPA 3CE9A 4QEZA 1G3UA 1OQAA 2X9NA 3UJ6A 4A73A 2O8FB 2IZ5A 1G8SA 1NN1A 1QYDA 1N3LA 4O4IB 5B3KA 1WXHA 1W5TA 2PT9A 2XMCA 3P9KA 4K87A 5G4KA 3T1TA 2Z3WA 4HRYA 2AF4C 2C78A 2R87A 4L4SA 4CR7A 1XEFA 4FGZA 4IO1A 2L19A 5CNIA 2P2SA 3PU6A 5JH7B 1QVWA 1RWXA 4OI4A 5GY7A 1IHXA 1WMBA 1WS6A 1QR2A 3Q12A 2XUOA 4MV0A 1TDJA 5AHRA 1N92A 1ZRSA 2FSUA 4GLFA 5TS2A 3ZY4A 3MTIA 3G2QA 2O3RA 3B5JA 1YT5A 5A3RA 2C97A 3R23A 1JHVA 1Z6XA 3P5BA 3ABSB 1P44A 2ECQA 5TV2A 2CC2A 1VCNA 3VSCA 4WKPA 3RU7A 4CI0B 4RK5A 4D0NA 5BUSA 4AF8A 5B7NA 3PD7A 5KOJB 3QMMA 5F1YA 5IJZA 4MW4A 1V43A 1HORA 1T2VA 1RWPA 3HB9A 2QMUA 3DBVO 1R5JA 3O1LA 2NV6A 3HPQA 3DDOA 1UBGA 5JLJA 1E0KA 4KQ9A 1AE1A 1E92A 2FUEA 4D97A 1C1HA 1YZ3A 1AG9A 5F21A 1MG5A 3TOCA 3U26A 1OFHA 4C4TA 5ETJA 4ZVLA 4EZIA 3FAZA 4D3YA 3C6MA 2AI3A 1UMCA 2W11A 4I4TA 1FCJA 4O4JF 3UT6A 1US8A 4NBTA 3L0DA 1DSSG 3IKVA 3QJ5A 1I6MA 4HDKB 4R2IA 1E1NA 1JSXA 2RB4A 1ZZEA 5DE3A 1AGPA 1U8FO 2GCPA 1MB4A 3NDIA 4JB3A 4PZDA 3PIIA 5L45A 1KO1A 1I7NA 1H5UA 2VDWB 4XVHA 1DS6A 4JJFA 3DC2A 3EFOA 1MEJA 4NFLA 3CO5A 4MB2A 4LSGA 2IF2A 3BOSA 3ZWDA 4B2PA 4NC9A 4YI3A 1Y34E 3AUJB 2DFLA 4ETNA 3ENVA 3K4QA 4QXAA 1EG2A 2IBTA 1GVHA 1M2OA 4R3NA 1SU8A 4WXEA 2RDMA 2YWEA 3O4RA 4U7JA 1GGFA 3SI7A 2ZU6A 4GC9A 4YAUA 2XMDA 4H7JA 1XO1A 2FEPA 1M0SA 3QLVA 3SQDA 3OWOA 3PXCX 1JE1A 2ORIA 3AFNA 2IEBA 3IQGX 5EPUA 3N87A 3SY8A 2O20A 3SIRA 3GUVA 4WSOA 1PI3A 2G06A 3EZYA 4CLOA 2AVNA 3PJDA 2AG1A 3G82C 1T9DA 3O2JA 4NZ9A 4RDCA 2W2PA 1EFRD 4BLPA 3WAGA 2H07A 2HWWA 1E5TA 3IHKA 2B7LA 3LQYA 1U7OA 1VI2A 2Y1OA 4OBEA 4Q5IA 2G04A 3RCBA 1GXSA 2I87A 2RH4A 3OI7A 4V3CA 4AY6A 1WUKS 4FEGA 3CA8A 4RZHA 4WESA 3IGFA 3EBPA 4IKEA 3LXXA 5LQJA 3AKYA 2G9UA 4EKEA 3K9WA 2JGEA 2W6JD 4EG3A 1G8FA 4CKBB 3W6ZA 5ILQA 3GLRA 3SZLA 3D8BA 4Y1RB 3U3DA 4G36A 4C1NA 4OCZA 1L7DA 2W6OA 1SCNE 2CHVA 3LC7O 1P1JA 2VF5X 1YAJA 1I2BA 1L4KA 4EO7A 4B33A 4MW0A 3K0CA 5IDVA 2FZ5A 4QWWA 5HS6A 5IN5A 2PO5A 2AI2A 1ZR4A 2VDMB 4KLAA 1QQ6A 2AS0A 2JGNA 3P2JA 1G5IA 3VPHA 2QVYX 4QGSA 3TEJA 4URUR 1W4RA 3DSRA 4F5WA 3GLGE 4YP7A 1QAQA 1DV1A 1HWYA 1UM9A 1YRAA 2DKOA 2X5JO 5P21A 3BJMA 3LDHA 1YDHA 4QJ5A 1NFRA 3HSYA 1GKIA 3HP4A 4DUGA 5KINB 5COBA 3QTTA 3BE5A 1GSOA 2JASA 4XPZA 4FUQA 1TZJA 4U4AA 1H2RS 4I1YA 1L1EA 3EAQA 4UHHA 3VUEA 1G63A 1EVLA 3A04A 3FHLA 1PVOA 2BH2A 5D86A 4BMOB 1JJIA 4C5BA 1E32A 4ENSA 3LPAA 1XDUA 3MTBA 2BM0A 3AY6A 2WMNB 3DYIA 2B4QA 1PP4A 7REQA 2IRWA 4FDVA 3VPBA 2ZRLA 2W6ZA 5HILA 3WYDA 1PQUA 5B2FA 1K2WA 2AN1A 1AKRA 3THOA 2AFRA 3OQ6A 4MDEA 3X1WA 3NCTA 3AEQB 3RDPA 1N5LA 3QOYA 2E85A 2OMEA 3ILXA 4GVPA 3B48A 3Q9NA 4WZAB 2X5KO 4EY4A 5DNCA 2Q27A 3KB2A 1XNJA 3G2OA 3WLIA 5ALDA 2LTAA 1G8JA 1XELA 1XZPA 2PFGA 2XQJA 3NH6A 4I81A 4JJIA 4P1ZA 1XZEA 2WNSA 3W8EA 3AU8A 2GZMA 3EGXA 3GVHA 3VZSA 1Z4MA 4QDKA 3L46A 4H6XA 2KM1A 2CLHB 5LBIA 3TFOA 4YMWA 4UASA 1WMAA 3FMIA 1K7YA 3G6KA 4XX1A 2A9OA 1Z4NA 4AZ3B 2W0SA 3R4VA 5EKTA 5CMLA 2M6SA 4M2LA 3UHFA 3TGPA 4MPJA 1CQWA 1XD8A 2HIHA 2Q5OA 3LWZA 3K9NA 4V0RA 4Y9TA 3VVLA 3HWRA 1U94A 5BSKA 3HVIA 4KE9A 1T1RA 1OBCA 1J9GA 2QYSA 5TQ2A 5E0OA 5C80A 1P33A 1EDOA 2OENG 4G1VA 4GQIA 3DL4A 3X43A 3DNMA 1U3GA 4Y2HA 4KLNA 5K0BA 3DONA 2JFWA 4HN2A 4PXSA 1P1CA 1RWBA 3H7AA 3NU1A 1EJ0A 4ZAGA 5J59A 1FFHA 2VF7A 3DFZA 4NBWA 4E6EA 1TQ4A 3DZ8A 3BMQA 2WFLB 1U28A 3COPA 5TQJA 5KNDA 1ZI8A 4N5HX 3B2EA 3NOOA 4PHTA 4TOIA 4HDAA 2YVLA 3MOSA 5FUQA 1BGXT 1ZIPA 3B1XA 4O4HB 1H2YA 3X3HA 1M66A 1N4AA 4I3HA 1J07A 1Y6ZA 3BTVA 5I9IA 4TRRA 3NHFA 4CMEC 5IKEA 1ZFNA 2QQGA 1RADA 3A3KA 3IQHX 3T4UA 4D9MA 1NHWA 4QD3A 2RI6A 5F77A 3BXHA 4PPGA 3C8MA 3PL1A 3MILA 1M8FA 1RJ9B 3LXRA 4RHCA 4XGIA 2Q7XA 2I34A 3OM1A 4RD6A 4TSFA 3WHPA 1ZD1A 4CIBA 2Q45A 5AXBA 5JXGA 2IPMA 3P0HA 2IYTA 1BEEA 3B38A 4KKXB 2NU7B 3BFPA 3PC7A 5CJPA 2NNLD 4LG1A 4AI6A 4B3GA 5EQFA 2QG6A 3CLSC 2A0KA 3ZYCA 2ZUEA 2EGGA 4YFVA 5GZ1A 4GPEA 3IXQA 1S8FA 2J31A 4JJKA 2EV9A 2FW1A 3N6VA 1U1FA 3OCJA 4PTLA 4ROTA 4C0XA 5DHQA 3A9VA 3JYHA 3QP9A 3G5UA 5AVZA 4HQLA 1TIPA 4EIWA 3R9WA 1J0EA 2LE0A 3BTSA 4BX0A 1RI3A 1W46A 2QPOA 5EJFA 5ICEA 1PQPA 5F64A 1CY1A 2WM9B 2P75A 1B8NA 5NULA 3V2UA 3BTOA 4AQ7A 3EIHA 2RHMA 2Q7OE 1UK8A 4EPXA 5CA0B 3GJ7A 1AO3A 4G8DA 2CE7A 1S2IA 3ZIAD 3VNUA 3UTCA 3JQ8A 2FMXA 1ZINA 4GE0A 4PTZA 2QT9A 4MP3A 1ORHA 1SXJD 2NSLA 3RARA 2XQVA 2ZUWA 2RCNA 3H2HA 3MRSA 4HDQB 3DKPA 4BNZA 1N2EA 4R9RA 3R6TA 2I80A 2WTUA 3A1SA 4OBXA 3V5NA 3BCHA 3GGCA 2XT0A 3JQCA 1NXQA 1HDRA 4UREA 3T3MB 4F0JA 4J0KA 1Z47A 3CGGA 5F73A 4QRIA 4NXNB 3BMOB 2O5EA 1TQ8A 3HHEA 4F12A 2YJ3A 4RMNA 4WIAA 2J0SA 3U0BA 3GCXA 1V47A 3ROXA 3HCRA 2X7JA 3DTVA 4B3DA 3OM0A 1XWWA 1IQUA 2I3BA 2IV2X 4ZYYA 3G5MA 3H5OA 3I39X 1V96A 2X8AA 4FBMA 4F21A 2G63A 3L05A 4GI3A 3SIPA 4X65B 5BNZA 4X6LA 4FDUA 3ZD6A 2QMQA 3V4PB 1RI5A 3ELYA 3K6RA 521PA 1LNSA 3EZ7A 4B09A 4OH1A 4P34A 2CNOA 4PFJA 4DDHA 3G17A 2EFYA 1MAUA 4JR1A 3T5AA 5FL3A 5DX1A 1J2EA 4HGRA 5LUBA 4H3KB 4BVEA 3UC9A 1AY0A 1T8WA 2GCOA 1T2UA 1IZ8A 1J42A 1GPJA 9ATCA 5FFNA 3PPXA 4GQAA 4V0KA 3T95A 4G0PA 2X6TA 3C97A 3EMBA 1DV2A 1EX7A 2JK0A 4YJ3F 3L5KA 4PYIA 3O38A 5G0UA 3V48A 4QGGA 2IS1A 1ZU4A 3HS3A 3WYNA 1CQIB 5KKNB 4H3SA 1N36B 3P9SA 2I2CA 2OFPA 1AKTA 1IY2A 1S5PA 2PGIA 2QUZA 3C5HA 3Q0EA 1KI2A 2QG9A 3M83A 3MW8A 3CUKA 1ZH2A 1O1YA 3QYPA 4I50A 4RLFA 1EBFA 4E21A 5EJ5A 3ESCA 1Z8HA 1E9DA 1T25A 3BERA 3B3AA 3CS3A 4HEA6 5FO0A 2KYRA 2QRQA 3LSYA 2FOXA 4N5NA 3WJ1A 4YMUA 1C9DB 3MUFA 3D6HA 1PWZA 3T3EA 4I1OA 2C94A 1SD2A 3FPEA 5L7TA 4HXGA 5LA6A 1GAWA 4BFYA 5DYTA 5C18A 4GPZA 3RREA 2G1PA 4HDCA 3DBLA 1YOBA 4C4PA 1H1LB 3CRVA 3H2SA 4IUYA 5ER9A 2TMYA 1LQ2A 2PYDA 3A9WA 1EI9A 1LDBA 3PNYA 2YHIB 1Y6JA 2C8JA 3G9TA 1JGTA 4GG1A 4ID9A 4Q1BA 1J97A 1JLRA 2Z4SA 4RQAA 4K0RA 3T7DA 3PHHA 4BQPA 5FO1A 3M4JA 4C5AA 1EUQA 2BEUA 2HRQA 2CFIA 4ND8B 4ZC8A 5KHOC 3W7AA 1U2TA 1Y1LA 2VTDA 5AVXA 3PT9A 1N6LA 4BNTA 4BDTA 3VAYA 4UOEA 2X22A 1KGSA 1T5LA 2QRNA 4MEJA 1Z0ZA 1VHLA 3I6BA 2CNWD 3N9IA 3DAGA 4YRLA 5BR4A 5DZSA 3JPYA 1FU4A 2JHPA 1GFWA 4RVNA 4I1PA 3CKMA 3BJIC 2WSBA 1U3WA 2X9GA 5D5PA 4XZ3A 3CNQS 1M54A 4QGHA 3KEQA 3IE0A 3G0CA 4QJBA 1VL5A 5EIBC 1JVBA 3U4IA 2O8CB 1XTPA 1JDJA 1RACA 4PZPA 4HAXA 1GNLA 2GHRA 2PS0A 7REQB 4HCJA 2W37A 4BFZA 1RYNA 2BISA 3EY4A 1QK3A 2FX5A 1I5OA 3T0GA 3KLNA 1FP4B 2HV9A 1ZIOA 1NZFA 2YH2A 5KO2A 1R6DA 1QQAA 4I5EA 4S12A 4DVJA 2BMEA 2BZGA 4RE5A 3MOIA 1HFEL 3CCCA 3RG2A 1OZFA 2IEDA 2VEDA 3QEOA 2EAUA 3ZE8A 4KMSA 4QNRA 5BOSB 4L8VA 5AVQA 1Y3AA 2P6PA 5E6UB 1KFBB 1OAOC 1VE7A 1B3RA 2FOLA 2W2KA 3NHYA 4HDRA 5G1PA 5JU6A 3VTFA 2XEDA 1TEHA 5K8IA 4QDXA 5IU6A 2FPIA 2J8ZA 2W6ID 2HSEA 2JLXA 1DTSA 4KGXA 4QOSA 1P1BA 2JIBA 4AKGA 3FYHA 3ONFA 4Z0PA 3WNDA 3JD1A 2XX3A 1GILA 3GP8A 1JECA 3DLTA 3WB1A 1KEUA 4R9VA 2WFZA 5C5IA 5A4KA 4TVBA 4DUPA 3BN3A 2HGSA 2JLQA 2ZXUA 2SBTA 4RANA 4JWTA 1QC5A 3QBDA 1PR1A 2J08A 1N0WA 4RYLA 4TL8A 2VP3A 2F8LA 4I3GA 2RB5A 4K1LA 3L3BA 3PDCA 5LQKA 4ONEA 3RTAA 5A4IS 3OU7A 4WLNA 1G4HA 1C30A 2OP0A 2WYOA 2JJYA 4LISA 1USVA 3OHPA 2IJGX 2XE8A 4ZCRA 1T3ZA 5FA6A 4R40A 1ZBQA 5T3UA 1GNSA 5JE8A 3RS7A 1BDIA 2NWQA 3S2IA 2DB3A 5JS2A 3HMKA 2F4NA 3IXLA 1R16A 1WCYA 5LLSA 4O4IA 4CKCB 5I47A 1JDNA 1I36A 3C3WA 1D04A 4QPZA 3THYA 2FSVC 3ZDBA 4UMEA 4G0XA 1MC8A 2GZ1A 3EQZA 2YIJA 4HGYA 1QQBA 2ONZA 1VSUA 5E1BA 4LOIA 2ATXA 2QLFA 2CV1A 3HR7A 4P81A 3TNFA 1GGNA 2H59A 1CV2A 5FTKA 3NTVA 5DXFA 3O84A 2XCIA 1SB8A 2E55A 4N4AA 2AWNA 2IOFA 1KMMA 3NV7A 4NBKA 2HLDA 4Q3NA 3HI4A 3ZBUA 5I45A 1YGYA 4BQOA 2UZ3A 3FI9A 3Q9UA 4EG0A 3F3SA 2RK4A 2G17A 1TCCA 4RDIA 3ROEA 4PO9A 5T4EA 3NM5A 3UFXA 4EFLA 3W5CA 3ECAA 2VRCD 5EPEA 4CG1A 5JCZA 4C4RA 4Y30A 1YFLA 2CNNA 4BQEA 1DADA 4R1TA 1NBEA 4YACA 1M6EX 4P7FA 3KPVA 4ZA2A 3B5IA 5KEIA 2A86A 3WNBA 5LQNA 1JLLA 2PUAA 3SXUB 2CVHA 4G6ZA 5A0FA 1CY2A 1Y1KE 1BWQA 2OYRA 4E70A 1PV2A 1V95A 2EZ9A 2DAPA 4IJMA 2AC4A 2Q4OA 3N2GB 3S2ZA 3UJPA 1LD3A 1IY8A 1BKDR 1J2RA 2CUKA 2XSZA 4JQOA 5DI9A 1K89A 3SXUA 4XYLA 4DIOA 3LFTA 4H3HB 1K8QA 4BMVA 1ST2A 3IEUA 3I1IA 2QVCA 3R3XA 4EGCB 2P35A 1NNEA 1ZONA 4IDPA 1RJ9A 4BLOA 4ES6A 2JFVA 5JADA 2W6JA 3FVRA 1OH5A 4RTOA 3TPZA 1RBZA 5CCEA 3OD1A 2VDPB 5SY6A 1V71A 3T1YB 1NQUA 3ZCVA 2QORA 2QXYA 1EG7A 2ONYA 3B1ZA 1BW9B 2VSFA 4MITA 1SPXA 2EYQA 3A4LA 1OXBB 3EF0A 5EJIA 5IVDA 4Q4HB 4C14A 3IP8A 4NBRA 3IB3A 1UKAA 3L9XA 3H5VA 4BMCA 2QLMA 4KX3A 1SXJC 4Y6SA 2DG2A 1EA7A 1Z0KA 2OUIA 2QL7A 3IE2A 3D2BA 5IAKA 3R20A 2AN3A 4AJOA 1PFWA 1MR3F 1N4DA 4H7HA 4ZVMA 5HVNA 1JXQA 3F46A 1ZHHA 3DMRA 3HXKA 4H4DA 1RYHA 3JYQA 3MLEA 4M0KA 3SZUA 4GKAA 3H97A 1L7OA 1VECA 1JAHA 1P5HA 2JKYA 5EGSA 5ICSA 3AR7A 1RQRA 4LBYA 3LBNA 4LTNA 1F17A 4HZGA 1BFDA 4OXNA 2JRLA 1M1UA 1PF7E 2ESRA 3AILA 4XQGA 2FQYA 1MH1A 2A2ZA 2VPXA 1TXGA 4RMHA 3ENNA 4R9SA 1JU9A 2PKQP 3QMVA 4G9GA 4JBLA 1LBTA 4MX8A 4BNJA 2KWIA 1R0YA 1IXKA 2XLCA 4NECA 2IZOA 3KFLA 3RVRA 1J8YF 3A27A 5AJXA 1O6FA 3MAJA 4UNNA 4CG3A 3RTBA 3RWBA 2HQOA 3G5LA 4FOOA 4DJFC 4GI7A 1OI2A 1WQ1R 3A10A 3K5IA 5EHIA 1KU0A 4K9RA 1NQ5A 1JHXA 3CF0A 1I0ZA 2EQBA 3RC3A 2BEUB 1XNQB 1S3SA 4TRNA 3HR8A 3OPXA 1DJQA 3DWEX 4AZWA 1FOEB 3UMRA 3IP1A 4WAUA 4EKIA 3DLAA 4R3WA 3QZUA 1KI8A 2VRCA 1LVHA 2VXYA 2ZUSA 4HQ6A 4LI0A 1E2NA 1CP2A 1NN5A 1T8YA 4Y9DA 1KP2A 5FI1B 4RU1A 3TQSA 4CMIA 1IHYA 3DXYA 1FYEA 1SOWA 1U9IC 4MV7A 1LDNA 2NSJA 2OGUA 1Z88A 5MF6A 4PCLA 3SYMA 3PFBA 4KNVA 4AROA 4MV1A 3ZWMA 4DEYA 4RTPA 2EIXA 2XGJA 2GUGA 5DHUA 4OSOA 3A1WA 1LPSA 3E22A 3MB5A 4Q3BA 5CDYA 1UQRA 3JU3A 3ZDFA 2FMIA 5C0OE 2H4ZA 5JCOC 2J33A 3D0QA 3ES9A 2C2ZA 3CX3A 3JD3A 3EGDA 4YJFB 3FFWA 3R7DA 2EZ4A 3K1JA 1RABA 1BDBA 3CBQA 4H18A 3ZWPA 5B1HA 3CXUA 4DJ5X 2FX2A 1YRLA 2NGRA 3KEMA 3QPBA 4F5YA 3R3ZA 1P60A 3UWOA 2EGHA 3EEYA 4D46A 4GMDA 2VR1A 4H7FA 4CCAA 3LPMA 4AWAA 1KJQA 3NZEA 5J43A 3CURA 3EARA 1JDBB 2IKQA 2VSNA 5IUKC 3OOHA 1MPXA 3D8SA 1VI5A 3F90A 3GPIA 4BGUA 2BKXA 3CNHA 1LCIA 1I2AA 1CCWA 1FUIA 4LXQA 3D1VA 1L1FA 1L0BA 4BLVA 1GPLA 4EAQA 1FDWA 2ZUBA 3UPDA 5CCXA 5I01A 2VHXA 1M5TA 3PPYA 5DTJA 3VX3A 3HP1A 3K3PA 4LZPA 4A8HA 3L7KA 4B8WA 1QDEA 5E7MA 1G7TA 1NRXA 2HWXA 3NTRA 1RU3A 1NJSA 3A4VA 1U7DA 2QDKA 3O0TA 4P3KA 2Q2QA 4QJ3A 1T1SA 4AN4A 4G67A 5GVSA 5ADUS 4EGQA 4OAOA 3D7NA 3LAWA 4LS3A 3CE6A 5JMPA 5BN5A 1PDVA 1ESZA 3CV3A 3PUHA 4R8KA 3OZAA 2JL1A 4YDHB 3OFSA 1YHNA 1CUJA 3V7WA 3VKGA 3QY9A 4IEEA 2AR9A 4EUSA 2N1MA 3TQCA 3VDXA 5IEBA 4AD8A 1PSZA 5M34A 2YV1A 1DBRA 3HB0A 4CR8A 5BW6B 4HHEA 3CZPA 2M9MA 5E2AA 2GN0A 3LHFA 3RNOA 4OI0A 4LNAA 2OCXA 1L9XA 2UKDA 2WWHA 2LXNA 2QRLA 3O8DA 4G37A 4CBVA 5JD4A 3A6PC 3CH4B 3QEMB 2I6SA 4MROA 4G0VA 2QSZA 1XA3A 2BI4A 3D7SA 4Y7CA 1D1PA 2X6QA 5ILGA 3UJ7A 5L8VA 1RAHA 3H86A 2IYLD 1X7DA 1ADGA 2R2AA 4TQ9A 5JYDA 2DR2A 5K0EA 3RHFA 4X20B 3G7NA 5BVHB 1XU7A 1JG3A 3QKRA 3NNSA 2CYAA 2XCSB 5LYJF 3HY6A 1JR3A 3PYXA 3WL8A 3SLRA 4H7PA 2GN8A 2VF8A 1T9GR 3SEZA 4DCVA 4G9EA 1JHUA 2VDRB 1SHUX 2ZJFA 3EWSA 3NEJA 3PB3A 2ZYHA 3QIVA 4RF2A 5ECGC 3ZWQA 5KNCH 1ESEA 1PVVA 3W2TA 5C8YB 4DY6A 4G0WA 4EY3A 1SEVA 4AFNA 3QELA 4L8LA 3ROMA 2JH9A 4YREA 3CUVA 1F2DA 5AK6A 1E6MA 5ALOA 1PGOA 3RJTA 5JXIA 3UOWA 1ZUIA 3ZQ4A 3D6JA 4U63A 4N8SA 4BP3A 1KWGA 5DLDA 2VL7A 4EB8A 4O2RA 4MV9A 3PCRB 4L9RA 1QRTA 4KQJA 1ATIA 4OSEA 1QTQA 1IXYA 1YS9A 2DECA 4XRRA 2C2GA 3DKVA 4PIMA 1GTJ1 2VO1A 5FRDA 2QWXA 4QTYA 2PUDA 1RD4A 1E94E 3TAHA 5ADVA 1JDSA 4JP2A 4KMRA 2UXCB 4ZDKA 3CWQA 4B40A 1WU7A 3TW8A 3WISA 5CB4A 1IDN1 1GQRA 3KKEA 1JAYA 2EARA 2RGEA 5KTMA 1PQ4A 2UYHA 2VHWA 1CZRA 1EXMA 1W9MA 4CIWA 3NVAA 1CNEA 3LW7A 4Y1EA 1AK9A 4KR7A 2CZCA 1PW5A 3E1KA 1K8YB 1QCCA 3EULA 3LP5A 4V2UA 1BGVA 1J9ZA 1YDMA 3PFNA 2BMVA 4G4SO 2HF9A 3ZBPA 5FI0B 5IANA 1RQNA 3HV0A 1QE3A 1DAHA 1FP1D 4MVYA 4GRDA 2WWVD 3DKIA 4MDFA 3QVKA 5U1PA 2G8LA 3K0BA 2C5EA 1I3NA 3PFFA 3KOUA 4I5GA 3HXLA 3DBHB 4MQLA 4NNPA 1JN0A 3BWMA 2A1UB 3B6JA 4FWIB 5IJ0B 3E4CA 1HEYA 3HUFA 4A2CA 3T3NA 1FDSA 2X9QA 3GRFA 3WFZA 5JFOA 3AJ8A 4AS1A 3B7GA 4N1AA 2VAXA 4W5JA 3URKA 4ALLA 2QTWB 3EEIA 4E5MA 5KQGA 2K7FA 4LZNA 2D0IA 4MIYA 4HQOA 3B36A 2RBEA 3LA6A 1MP0A 1T0HB 2D59A 3F3MA 1RC8A 1ZLYA 2MINB 1J39A 4NE9A 4J8PA 2GEDA 5CK4A 1YZVA 3M4YA 4DS3A 2FNAA 3MD0A 1IB0A 3P27A 3MD9A 1RRMA 3EVCA 3O8LA 2XTMA 1RC1A 4B46A 3AUAA 5LPNA 3AHIA 4DJJA 4XGQA 2DUNA 1R9GA 1ONNA 1M8GA 2JI4A 1EQ2A 2CF5A 2FMKA 3K94A 4HEQA 4MVJM 2YFHA 1D6MA 1ZOOA 3K0CC 2C2YA 2G4VA 2FP4A 5EXTA 5FXMA 2JS7A 3ETNA 3L02A 4CV0A 3Q3GE 1TD1A 2PA3A 5J2TF 3HYTA 2ZBPA 3KTDA 1NDUA 3LHKA 4V0QA 5CB4F 1QTNA 4I50B 2FP4B 1HZJA 2HBRA 4TUYB 1G59A 1DBQA 3D8RA 2GFQA 4NJOA 2EERA 3GUHA 2BTQA 1DRVA 1A4XA 1QPGA 2ZPUA 3FI0A 3WA7A 3ZQJA 2VTBB 4QBIA 4Q15A 4RE6A 4JJGA 5F9FA 1K92A 4G65A 4LKOA 4UHBA 1VYUA 1PYOA 2REQA 2AJ8A 2X8WA 3CGWA 5SZHB 4C0JA 3WFJA 3KQNA 2QQ5A 2XXJA 1PFKA 4O4LB 4XDHA 4ZDJA 4UXIA 2ZM6B 3I5XA 1UM9B 1RR6A 2CLOB 4JX9A 4JI3B 4ZI7F 3D6VA 4U7TB 2WWGA 5ALXA 1YZUA 1ZW1A 2C1EA 1Y48E 3AJDA 3VBEA 2E48A 5AQEA 2J09A 1KO7A 2VXBA 1M67A 1TW3A 1W93A 3OKAA 4Z3DA 4AULA 4UUOA 4D3SA 2GRUA 1VZ2A 2ZTVA 4Q3OA 5IAAA 4EHNA 4HDOB 2HDWA 2XE6A 3E9MA 4Z54A 3HK2A 1HUQA 1X2EA 2FAXA 2W6IA 1VHTA 2XLBA 2H54A 2XKAA 3IOYA 4R8MA 4XX0A 1WB9A 3I9NA 1TMOA 4MQBA 3SR0A 3EAGA 3FTDA 1VSVA 4JZYA 1UEXC 1W5EA 1XDWA 2HCRA 2R6HA 3ENZA 1X86B 3L9WA 1M6VB 2OXCA 3NXSA 4U2BA 3WJ2A 2YY7A 4CXMA 3MBKA 5BN3B 4IUDS 2Y3IA 1WCXA 3EXHC 1BHJA 4EA6A 1XZLA 5JSYA 4BNXA 1CUXA 2MYPA 3IHLA 1R4ZA 3N2YA 1PNRA 1E5XA 5KWVA 1KNQA 3O8NA 1CUEA 1VKNA 3P2KA 4V1CA 4R1LA 2G82A 2TYSB 4WEOA 3T1QA 3RBXA 1BHO1 3PHGA 2IH4A 3P32A 3V46A 3PHCA 5SZIA 1I4OA 2BHTA 1CUIA 2QKYA 4N3GA 1S3GA 1TCVA 4U8HA 2PZMA 1GR0A 1W581 3T7AA 3FOFC 3QUCA 2O2JA 3A36A 1IOLA 1M34B 1T9ZA 1HEIA 1XIVA 1LX6A 1ZRMA 1AQLA 2ZITA 3ONEA 3TIIA 2J3MA 4BB5A 2OV2A 2YCBA 4V2IA 5I4CA 2FR8C 4EHBA 1P3DA 3KEOA 1JQKA 4NX2A 4JUFA 5AKXA 1CUVA 1K7EB 1L4BA 1W48A 5TQ0B 2VC2B 3D6MA 3LXUX 1UZAA 4IAOA 1TVMA 3EHEA 1U7HA 1C0EA 1YIAA 2GTIA 5ALYA 2FGJA 1E3TA 5DTRA 4R6XA 3OZRA 2C4VA 1BE8A 1Q84A 1WWKA 2OGWA 1YB5A 1A82A 2X4GA 3RS5A 2HLDD 1UXJA 1UMCB 1D6JA 2BKAA 4X3PA 1Y8RB 4YJFA 2YWFA 4OKNA 5KVCA 2VA8A 2K2QB 1AU9A 1E98A 4TSFD 1WAMA 2GLXA 3ASZA 3DEKA 1T24A 3ENWA 1KZ4A 5COAA 3WSWA 3G5AA 1YVEI 1L5HA 2HK6A 4TMYA 3NWPA 4FW8A 4D4LA 5HF8A 3L8DA 4L57A 4D80A 2EATA 4FYKA 5KTPA 1EIZA 3MA0A 4NZYA 3QPVA 1GEEA 4YLEA 1Z0JA 3W4KA 4IOMA 3DV0A 3JWPA 1MXFA 3OMXA 2QLJA 4LBWA 4CKYA 5JQGA 3UUWA 5KKCA 3VNVA 4H1VA 4M8IA 5L3QA 1ZK1A 4EB0A 2GN9A 2O5CA 4LYDA 1R8JA 2YTZA 5LZ9A 2Y2VA 2QVZX 1MRNA 4A8PA 2Z2JA 2JGFA 4GUDA 2PT5A 2QRMA 3H5IA 3Q7IA 4QYTA 4TWJA 4BVGA 4MIOA 4YPFA 1WZNA 3HO8A 3R1IA 3EBOA 3CW2A 3K96A 2DKNA 3ZI7A 4AY4A 4O1HA 3F5DA 3ZI4A 1QV6A 4P4SB 1ZPDA 3WB9A 1U8ZA 2CLCX 2C4UA 2FPPA 4KACA 2X9LA 1YMVA 2D2XA 3LUAA 1GUAA 2BELA 1ORDA 2NOAA 5IM5A 3BSSA 3WLLA 3N7AA 5EHQA 3TPFA 4YV0A 5T7BA 1CZKA 3GAAA 4AZ3A 3GG2A 2Z9CA 3TX2A 5IT5A 5I9SA 3PTLA 1PBTA 2ISSD 5I5EA 4JXXA 2XCQA 3KOWA 2CDRA 4ZO8A 1LFAA 1JPJA 4EYOA 1M75A 5JC1A 3BREA 3INGA 5AXCA 2C54A 1V2HE 2PFSA 2EW8A 3ND5A 5JFTA 4MUBA 4B4OA 1BD3A 1T4BA 1YOVB 3HB7A 1LKZA 3VNBA 4BIIA 2W2LD 5ED0A 1QGZA 2VT2A 1K6IA 5CEEA 3RK4A 4YCBA 2J41A 5ECDA 5AR1A 2ONJA 4EELA 2JAHA 4CCSA 3OIGA 1JU3A 1LS6A 3GFPA 1CR1A 2ERXA 2GKOA 3HU3A 2J5QA 5EWJB 4YONB 3TE6A 5CR9A 2X5OA 1TJYA 2G1UA 3R7LA 3ZZUA 3LPDA 3DLHA 4NEHB 2W6PA 2DLCX 1SHLA 1WEHA 2G67A 2PWAA 1CT9A 4MCAA 4D8UA 2LCFA 2W90A 1EFKA 3PFIA 3GP3A 4FE3A 1Y5NA 3JYLA 1QH1A 3TB6A 2PZJA 1FU8A 1CUHA 3R3VA 4FR0A 5FPHA 4NU0A 1IMOA 3K1AB 1RWWA 2G7MC 2ZTLA 1GCIA 3W2FA 3B2QA 1T8TA 1RRVA 1ULZA 5ANRB 1SZPA 2PO7A 4IQFA 1FRNA 3FOEC 2O5VA 1JKJB 2ODQA 2Z2ZA 5E4YA 4Q9HA 2NZXA 2BTOA 2XMGA 5TSDA 2RGYA 4Z9FA 5TGTA 1T5BA 4BU1A 4EO9A 1M2NA 1NFQA 2BN4A 4L4XA 4NV0A 3V1LA 4GXTA 4CCYB 3HBJA 3REOA 1W2WB 2BTQB 1QKKA 4DCMA 2M1ZA 3L1IA 2IDKA 3TI9A 1IXZA 1MO3A 4JCOA 4L6CA 3S1AA 5MN5A 3NEPX 3ZNNA 3EQ2A 4BE4A 2AG0A 1L5KA 1XNRB 3SFTA 5BN4B 1JQ5A 2NXCA 5A2GA 4XJSA 2XDQA 4WK2B 3Q7RA 3EA0A 2M32A 1EGAA 3X2SA 3AXSA 1Q1BA 4GWLA 2OZLA 1UMBA 3PI6A 4HRAA 2B2XA 4TKVB 3RRNA 5KIAA 4GQBA 1Z73A 1AKMA 2WW8A 2ZIVB 3MFYA 4UHCA 1W2GA 2CCKA 4TKMA 4Z7OB 1UAYA 2C2BA 3SF8B 4D3DA 3PNPA 4BVHA 1KA9H 3F3YA 4KXVA 5JCJD 1YBFA 4YQFA 4B3MB 2PXHA 4MUAA 2XNKA 2QF7A 4OSPA 4XWGA 5JZSA 2UXDB 1Z4JA 4KVGA 1L4FA 4BFSA 4K7JA 4KXQA 3PJGA 1U2RA 1MW8X 1BXGA 1MLDA 2VF4X 4CKEB 2O0MA 4W7HA 2BI7A 5F52A 4K05A 2FPUA 2PKWA 1D9XA 3HQ4O 1NLYA 4TROA 3JASA 1E1QD 1F2UB 2HZ7A 4JB0A 3HWWA 1A5BB 3AW8A 3BRWA 3K31A 5JRDS 2A58A 2EW2A 2FHSA 4UZFA 1T0PA 1QK5A 2XVMA 2VKQA 4G9BA 3MS4A 3WGHA 1OHHD 3G2LA 5T5QA 1SAYA 2I4NA 2Q8NA 5B7PA 2V7UA 3IIKA 3I62A 4L72A 3UJ3X 1IUPA 1Q1AA 3LSTA 2LPMA 2WOJA 3HJAA 2B0JA 1B0AA 1L5QA 2IYEA 1R3DA 3SX4A 4BYGA 3D6AA 3QA3E 2IUUA 3W4JA 2J48A 2NQ2C 4FE7A 3WE7A 4TZKA 3RS0A 2HY7A 3WGZA 4F1WA 1UPCA 2BMFA 5KYXA 1QKIA 3AJRA 3SCZA 2QIPA 1B2RA 2AK2A 2DFVA 1SBCA 2OC9A 2GJ9A 1TK2A 3TBKA 3B2NA 1D9ZA 1PL6A 3TLMA 4CUKA 4L74A 4G1EB 6REQB 5CJ2A 2WF9A 4ADSG 3U1TA 4DQXA 1GRQA 2CNDA 3EN0A 2JGAA 1FRQA 3T15A 4FQ7A 3UK7A 3WJAA 2QQEA 3RC2A 3A06A 4RLSA 2Q4DA 3FRJA 1FP6A 1NYLA 4DA6A 3A25A 1OZ0A 3VZQA 4DMFA 1Z18A 4M55A 3L6EA 4QIHA 2O0LA 5DWVA 2CLFB 3IEKA 2ZPTX 1PRYA 1J33A 3BVPA 3CCBA 2H1IA 1QCDA 2OM6A 5EE1A 3INNA 2VNHA 3OE1A 3V4OA 1QJ4A 5TQVA 1V6AA 4X66B 3A6GA 2NPFA 4B47A 3K8YA 1Y9AA 1E3DA 3OQPA 3NKLA 3K8ZA 1IBMB 1H4QA 2FRDC 1U3FA 3DDUA 4W5HA 3SLKA 3U13A 4C0LA 1Q83A 3LHDA 4PO1A 4RPCA 4XI9A 1XDSA 2IOFK 4YYEA 4A26A 1XCBA 5LQSA 3ICOA 3EYWA 3P9PA 5FP0A 2BCGY 3NB0A 4KWHA 5TARA 3HCCA 3NDBB 3Q9LA 4NYJQ 3LK7A 1C8BA 4S05A 3AR3A 2OHXA 3PLNA 2HPVA 2BKUA 4MNTA 3T5MA 2VYCA 4JEUA 3W6UA 2X1HA 1TC1A 3LPNA 1Y8AA 1NRJB 1W49A 2F1RA 3DE2X 3OO0A 4OJKA 3PGXA 2FPPB 3BDIA 5AKZA 2B2CA 3NWJA 3TR0A 1CJKC 1CJCA 5BORA 5LMNB 5BNWA 4BNMA 3QWBA 1OPRA 3CZQA 5EP2A 3V8MA 4CMHA 5FLXA 1MT0A 1NBAA 1ZBDA 2VP6A 3E48A 4RFLA 5D3KA 3C1AA 4A10A 2AJCA 4FFRA 3GGPA 2Q9CA 4L76A 4Q3LA 1ZLXA 4KK4A 4KL8S 4LJ6A 1TTHA 2EGUA 3DEJA 4HV4A 1WPXA 4NCXA 5DU2A 3DZIA 2GBLA 2PVCA 1GPAA 5KSPA 4C3VA 3OSUA 4IM7A 2HA5A 2WUWE 5A4FS 5ITVA 5K20A 3IILA 4WHMA 5EIOA 4FZ5A 4Q4JA 5DNAA 5AQ1A 3DOFA 2DPLA 2GO1A 1HKHA 3IAFA 4OP2A 1JTFA 1SZCA 2QTNA 2ZUDA 2BOVA 3TLGA 1SMKA 1XKQA 2X9VA 1CQXA 1Z38A 4MEAA 2FVYA 1JKMA 2ZE8A 1OX4B 1UWCA 4K1XA 3CR7A 3PG5A 5KWEA 4FYVA 1QP0A 2QN2A 3VZDA 4ZXPA 1EMDA 3PUYA 2Q2VA 1JTVA 2BBSA 4WCFA 3HKBA 4EX6A 4TZ0A 4U7PB 1Q44A 1Y5IA 2YXEA 2PKQO 3O03A 1PTJA 1JXAA 1FLVA 3CKKA 2QVXX 1SK9A 4US2R 2Q8QA 4OXIA 1L5LA 4LJSA 2PGXA 5FT9A 4B2YA 3PQ8A 1ORVA 4WCFC 1IONA 1ZCZA 3STHA 1DIHA 1T43A 5B58C 1AKYA 2J3HA 4U0KA 2QPLA 2D0DA 4CODB 1AGNA 2GF0A 3VM6A 3KJXA 1OWNA 5A5EA 3H13A 1M8PA 4YT8A 4OMCA 4P8RA 5TRTA 1H1TA 1T26A 4MEBA 3RIYA 1KFJB 3G6WA 4NHOA 1YACA 4LTDA 2FMFA 3O74A 2VJCA 3PWZA 3SJUA 3N2KA 4B32A 2D1TA 3B7WA 3BTUA 4RH1A 2QNRA 3DE4X 3Q3CA 1QNFA 3T0IA 3GOHA 4A15A 1NNUA 1FNCA 1KI7A 2C9ZA 4HXYA 1UFOA 3IVAA 4PWYA 1K6EA 5GMOA 2OA0A 4EJ0A 3QVTA 2V7TA 2XWBF 4JLKA 4WK0B 3GK3A 5JJIA 4FFBB 1UBMS 4MV8A 1QF7A 3M6VA 2FEOA 2Q5CA 3E1GA 3AZPA 3AWDA 4BZXA 1BDHA 4YCNA 3KZCA 2IHTA 2Q6KA 4KRGA 5FUMA 3PXAA 1DGQA 2BLLA 4BLRA 3H9CA 4B6RA 1ONPA 1I80A 4E46A 1LI5A 1A5AB 1B16A 4MRSA 4JD5A 3VJLA 2ARKA 3GZJA 1YU9A 2AG5A 2GKGA 1YB7A 3FCXA 3ILYA 3QE3A 1IWBB 1Q11A 1CUFA 1U2GA 1WM1A 4FMDF 4I8IA 2Q1SA