3KR0A

Crystal structure of hpnmt in complex adohcy and 2-amino-1h-benzo[d]imidazol-6-ol
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
total genus 93
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kr0A00
1YF3A 2YVLA 3FPFA 4M7RA 3HCFA 3DTNA 1XDUA 3MB5A 4P7FA 2NXJA 4BP3A 4YUWA 3EVEA 2GH1A 1XXLA 3OPNA 3P2KA 4E30A 2ADMA 1AV6A 4QVGA 5EGSA 5FHQA 2ORED 2ZWAA 1N7IA 4E70A 3C6KA 3DH0A 3GDHA 1KHHA 4HTFB 2EJTA 1BC5A 1P39A 1P91A 1L3BA 5CVEA 2IP2A 3NWEA 3NW9A 3P2EA 3G7UA 2PXAA 4EKGA 3HVKA 2BR5A 2HV9A 2PXCA 1KYWA 3CGGA 3DULA 3GGDA 1QAOA 1SUSA 5K0EA 4RTKA 4E2WA 5GIPE 3KR2A 3BWCA 4GUAA 4CKBA 3A4TA 1X1AA 1I1NA 2OBFA 1YZ3A 2B9EA 4PYKA 1JTFA 4RSRA 2VP3A 4YUVA 3RODA 3FPHA 1EJ0A 5HILA 3FUTA 5FQNA 5KYGA 1G38A 1RJDA 4IV8A 4ER0A 5K09A 1BOOA 3OCJA 3NDIA 5DRYA 4BLUA 2HNKA 3E23A 1NV8A 1T43A 3B3GA 1X1DA 3E05A 3QV2A 3D2LA 5DTMA 1RJFA 4OA8A 4XUEA 3G8AA 2H11A 3V97A 3TKYA 1QAQA 2N47A 2E5WA 3PX2A 2IH2A 3KQPA 3Q7EA 3MGGA 2DULA 3OFKA 3UJBA 3JWJA 3AWIA 5K03A 2O57A 2ZIFA 4FS8A 4V0RA 2PWYA 1KP9A 3LL7A 4EK9A 2ZVJA 2AOTB 2ZZMA 4BLVA 1EG2A 2O07A 1SUIA 4XUCA 3DLCA 3JWHA 5HOQA 1HMYA 4PINA 2Q41A 5HEKA 1MHTA 3KQYA 4DCMA 3C3PA 3IHTA 3LBYA 4BY9E 3EEYA 4XCXA 1R8YA 3EGVA 1PJZA 3GXOA 3FUVA 4XUDA 3CBGA 1SKMA 3CKKA 3KPYA 1JG3A 3NMUF 3HCDA 2AR0A 5EHGA 5FTWA 3CJQA 1RI2A 3I53A 1FP2A 1FP1D 5FQOA 4C03A 1QZZA 5K0BA 2PXXA 2OO3A 1N7JA 1VE3A 4U7PB 5DT2A 4AZTA 1NW5A 5LQAA 2LD4A 3CJTA 2XYVA 2ZBPA 5EKUA 4CKEA 4M36A 3TFWA 2V74B 3HP7A 4P7JA 2OXTA 3HA5A 2GPYA 1D2HA 9MHTA 4E2ZA 1R6AA 4HGZA 5FUBA 1R74A 3A7EA 3HCCA 4DA4A 2PT6A 5EMLA 3HVIA 3M6VA 3P9IA 1VP3A 2XBMA 1L3IA 3PTAA 3OZRA 4RTRA 1QYRA 5DWQA 1L9KA 4AUKA 3EGIA 4X60A 2OB2A 3PT9A 3LSTA 4FT4A 2IBSA 2HWKA 1D2GA 3HVJA 4LWOA 3SSNA 3PVCA 4HH4A 5CVDA 4IKPA 5E9JA 4QDJA 1KYZA 2VS1A 5K0NA 4E2YA 3A27A 4KVZA 3MHTA 1INLA 3QOWA 4QQNA 2PX4A 3LECA 3CVOA 2JG3A 1M6YA 5HIIA 3SVZA 1O9HA 3BGIA 5JR3A 4LWPA 2QY6A 4KDCA 4X1OA 5FCDA 4OX9Y 1MJFA 1X1CA 4RTPA 1IM8A 1BKYA 3SXJA 1ORHA 2KW5A 1YB2A 3MAGA 5EQJB 3UJ6A 1EJ6A 4KRGA 5DM0A 4EQZA 5E8RA 5DXJA 2G1PA 4MQ4A 1DUSA 3RW9A 1JG2A 2YX1A 5IH3A 3P97A 2ZIGA 3HVHA 4BP1A 2G8NA 5ICCA 5H02A 2AVNA 1ZG3A 1XVAA 2QE6A 2Z6QA 5DM2A 2P3OA 4CXMA 5T67A 2B78A 4OBWA 5GIOE 3LGAA 1F3LA 5GP1A 3LDFA 1SQFA 1NV9A 3UFBA 4C08A 1X19A 3FPGA 5E1DA 5F2NA 1Q0TA 5U4XA 3TKAA 1NT2A 1JG1A 3GRUA 4O29A 3C3YA 3JWGA 2P3QA 3MTEA 5E2AA 5LQCA 5CIYA 2NXNA 1NW7A 4KIGA 5K0FA 3ER9A 3HNRA 4ISCA 4RVGA 2NXEA 3I64A 5G02A 3HEMA 5HFJA 3OU6A 2AOUB 3OFJA 2OYRA 4E2XA 4RTOA 3L8DA 2O0LA 1VP9A 3KQOA 3PFGA 2B3TA 4KW7A 2BH2A 5B1SA 5E1OA 4UOEA 5CD1A 1RI3A 3HA7A 3KPWA 5M5BA 1JR4A 3KQSA 2UZ4A 1G8AA 5EPEA 2XVAA 5CVVA 3SR4A 3TR6A 3LBFA 1TW2A 1YUBA 3FYCA 1IY9A 1WXWA 4MHTA 4KWCA 2AN3A 1KPGA 5E9QA 4X41A 1KPIA 1NW8A 1ZGAA 1QANA 2EFJA 1JTEA 4GC9A 4HG2A 2BM9A 2NP6A 4PONA 2ZULA 4RTMA 5ICEA 3GRVA 3EVGA 2G72A 4E33A 3E8SA 3MCTA 3OE4A 2AOVA 1JQEA 3VSEA 1HNNA 1Z3CA 2FRXA 3PB3A 3DMGA 4OBXA 5HIMA 3KQQA 2C7OA 5K05A 1JQ3A 4KIFA 3UJ8A 3UA4A 4GOLD 2JJQA 2PX2A 3C0KA 5E1MA 1KXZA 3G5LA 3X0DA 1I4WA 4R6WA 1ZQ9A 3U81A 1YZHA 2GB4A 2ONZA 3REOA 4ER7A 4QQKA 2NYUA 2ZTHA 5K0CA 5DRTA 1AQJA 5KS2A 4NECA 2CMGA 4DKJA 3G5TA 3LX6A 1EQAA 2A14A 2I6GA 2VZ9A 1G6Q1 2ZFUA 3BXOA 2PJDA 3FZGA 2BR3A 3PS9A 4R05A 5DSTA 3R9XB 4LECA 3ANXA 1M6EX 1D2CA 4Y30A 4HRAA 2JHCA 5EMJA 2VDWA 3OU7A 4P7GA 5CUQA 2YTZA 3MTIA 4PYQA 5LQJA 2CKDA 4RYLA 5LSAA 2PY6A 4CTJA 2DPMA 1XCLA 3B7PA 2ZWVA 2AOXA 5LQNA 2ZW9A 3FUUA 4PGGA 5LQUA 4QPPA 5C0OE 5KQSA 3G2QA 4PCLA 2I62A 4YUXA 2P7IA 3HA3A 5EMMA 2IIPA 3GWZA 3DMFA 2Y1XA 4F84A 1NBIA 3LHDA 4GOMD 5FA5A 2UYHA 3VC1A 2YXEA 3MQ2A 3LKDA 3KHKA 2PX8A 1BHJA 2EG5A 1P1CA 4M38A 3T7RA 2HR1A 1SQGA 2UYQA 2I7CA 2AZTA 2F8LA 2K4MA 3FTDA 4GQBA 3TM4A 5IKMA 4C04A 2PKWA 3M6XA 2PT9A 4ER3A 3GO4A 4HC4A 3CCFA 2NXCA 1TW3A 4PYLA 3F4KA 3UJCA 4E31A 3M70A 1P1BA 3BKXA 3G88A 3RIEA 1NW6A 1XTPA 1XJ5A 2OZVA 3R3HA 3P9NA 2GS9A 4PIMA 1QAMA 2OY0A 3O31A 2AOWA 1X1BA 2EJUA 1VPTA 3C6MA 2O05A 3NVKI 4QVKA 3EVCA 3P2IA 3SSOA 4RVFA 5K0GA 3H2BA 4R8RA 1FJXA 4PCAA 2FPOA 4RVHA 3UA3A 4ER6A 1L3CA 2IFTA 4G56A 3HCBA 3JWIA 3R0QA 5DM1A 4RTJA 1M0EA 1JQDA 3FPEA 2NNWB 3ME5A 5MHTA 3EVDA 1DCTA 2GA9A 5GWXA 3EVAA 3DUWA 2XYRA 4FGZA 2PSSA 2P41A 4P7KA 4QPNA 5C1IA 2NP7A 4F85A 3THSA 4RVDA 5HIJA 3QOXA 5T64A 3VC2A 2Z6UA 3THRA 1OR8A 4AX8A 3FTFA 4OA5A 3EMDA 2Y1WA 3KR0A 3UJ7A 1VIDA 4AZVA 1B42A 3ELUA 2PLWA 5K0JA 4ZTBA 2JH8A 1NKVA 3UWPA 7MHTA 1G8SA 4GEKA 1RJGA 4OQEA 5EC8A 3IV6A 3SM3A 5EKXA 5HIKA 4FSXA 1VLMA 5K0LA 4C4AA 4RX1A 1U2ZA 3EEOA 1WZNA 3BZBA 1IXKA 3KQMA 5EG5A 4QTUB 2IH5A 2CMHA 2P40A 3AJDA 3A25A 3LKZA 4RTNA 3I9FA 3ORHA 3KKZA 3OZSA 5ICFA 4R6XA 4Z2YA 1FPQA 4X63A 3EGEA 4PIPA 1N2XA 3B3JA 3P8ZA 2PVCA 3BWBA 4DM3A 2HTEA 4C05A 3OU2A 3A26A 4X61A 5D1NA 3EVBA 3WSTA 5EEHA 4YMGA 2GLUA 4DCGA 2ZBRA 4IWNA 3BGVA 5EMKA 3ID6C 2IPXA 4DF3A 5BW5A 5DPMA 3TQSA 4A6EA 2OKCA 2ERCA 4YV2A 2V7EA 4MWZA 3VYWA 2IDKA 4ATNA 3UBTA 5GOZA 2CL5A 3UJ9A 4FSDA 3TRKA 1KIAA 2XVMA 5GM2A 5BW4A 3B5IA 4PNEA 2VDUE 2UYOA 1NE2A 1ZHFA 3PFHA 2BR4A 5T6BA 2P8JA 5BXYA 4BLWA 3GRRA 1TPYA 1WS6A 2ONYA 1VBFA 3KQTA 3BWMA 4Y2HA 4MTLA 2P1DA 3UZUA 2AOTA 3BWYA 1G55A 3KR9A 4FP9A 5DTQA 3AY0A 5FWDA 5DSXA 2EX4A 2FHPA 4LG1A 3HTXA 1F38A 3EVZA 3KQVA 4ER5A 1SG9A 1O54A 2FK8A 4PYOA 4V0QA 4RTQA 2IGTA 2ZIEA 3R24A 3ELYA 2B2CA 2H00A 1EAMA 2JHPA 4EKIA 4WVLA 5FWAA 3SGLA 3GIWA 5E8JA 3SX0A 2H1RA 1UWVA 3SSMA 4L7VA 2G71A 3OZTA 2ZZNA 5EOVA 5KVAA 2PX5A 3FYDA 1PRYA 5EIWA 3GJYA 5F2KA 3DXZA 5FADA 5GM1A 1YFJA 1NW3A 3DLIA 2FYTA 3EVFA 3PX3A 2ZCJA 5LQRA 4RV9A 5DTRA 4AZSA 3KPUA 3IEIA 2Z6AA 3ER8A 1VQ1A 5DXAA 5CCXA 1UIRA 10MHA 2C7QA 1WXXA 3TM5A 5GINE 3GNLA 3G89A 3DXXA 5E2BA 2AS0A 1UFKA 1XDSA 3KPJA 3MERA 3MCZA 4YV1A 2QRVA 1O9GA 3HM2A 4JXJA 3FPJA 5C9ZA 4DZRA 5E9WA 2AVDA 2P3LA 2ZLBA 2P7HA 3LCCA 3B3FA 4YUYA 1XCJA 3LDUA 3LCVB 4C06A 5DX8A 3NVMB 3R6TA 2O06A 4IV0A 4YV0A 2PV0A 5FULA 3K0BA 1YFLA 5LQKA 2QRVB 3DOUA 2FCAA 4P58A 3T7SA 3G2PA 2GAFA 3S68A 3BT7A 3I5UA 3CC8A 4C07A 5EZSA 1XDZA 1L1EA 3FTCA 3DMHA 1AQIA 3LCUA 3BKWA 5EZQA 4E32A 3AXTA 4FZVA 4PYNA 4FT2A 4F86A 1SVUA 2P35A 3FTEA 5HZMA 4GOOD 2WK1A 3M6WA 5ICGA 1JSXA 4PYIA 2YR0A 1H1DA 1JG4A 3FRHA 1Y8CA 3IYLW 3P71T 2BM8A 4QDKA 5DX0A 5FA8A 1R00A 3LPMA 3TOSA 3ERCA 2G70A 3DXYA 3NJRA 2QM3A 3KU1A 3LDGA 4DQ0A 5BP7A 2BZGA 3OE5A 4GOND 5D1HA 2UYCA 1RI1A 3O7WA 1WY7A 2PWPA 3TLJA 4DMGA 2ZZKA 4MIKA 3GCZA 3UJAA 4PGHA 1JSZA 3M6UA 4WXHA 5EEGA 3TPZA 2I9KA 1RI5A 2VDVE 2PGXA 1EIZA 1V39A 2YUIA 3CJRA 3E7PA 1KR5A 2YXLA 2ZSUA 3BGDA 1ORIA 4GBED 5ERGB 4YMHA 3FRIA 5KQRA 4CWAA 3A7DA 5DM4A 4PYMA 4CKCA 4U7TB 4RTSA 4PWYA 2JH9A 3GU3A 3I58A 4HTFA 2FK7A 2IH4A 3B89A 2C7RA 1G60A 1WG8A 4K6MA 1Q0SA 3DP7A 4EMSA 4RTLA 3P9KA 1AF7A 2AN5A 2CWWA 2YQZA 2YXDA 3DR5A 4POOA 4KDRA 4M37A 2AN4A 4CTKA 4YUZA 3KPVA 4R8SA 3SMQA 5DLYA 5P8WA 2B25A 3M4XA 3FUWA 4FR0A 4QTTB 3EPPA 5CVUA 2ESRA 5DX1A 2OB1A 4A6DA 1DL5A 1RI4A 3TMAA 5K01A 3O4FA 3GRYA 1ZGJA 2R3SA 2R6ZA 3HCEA 5F2OA 5K8VA 1I9GA 3T7TA 3EMBA 4H0NA 3T0IA 5FHRA 1RJEA 4B17A 1KPHA 2AOUA 3P9CA 4RWZA 3ELDA 3G2OA 3FUXA 3BUSA 3ELWA 3K6RA 4HGYA 4PYJA 8MHTA 1ZKDA 5LR6A 2IDJA 2XYQA 2ZBQA 1FBNA 3HCAA 4OQDA 1R8XA 5JUWA 3AXSA 2PBFA 3NWBA 4EVIA 3NDJA 3UJDA 3KR1A 4HSGA 5CVJA 1VL5A 3M33A 4AZWA 4GF5A 2C7PA 5EVJA 2WA2A 2QYOA 1NBHA 3G2MA 5E1BA 4GC5A 3PLAE 2HMYB 3G8BA 2WA1A 3V8VA 5EIFA 2OPBA 5CCBA 3Q87B 2JHAA 2IBTA 5EHIA 3NTVA 3GRZA 3KQWA 1R18A 5CM2Z
chains in the Genus database with same CATH superfamily
3KELA 5CMLA 3DMRA 3S99A 3KQHA 4EM6A 4JC5A 4H0FA 5D6OA 5TARA 2I54A 4URHA 3TW8B 1RYHA 1XZJA 1C8VB 3CX8A 3FVRA 4MKXA 2DOKA 4Q1EA 2ZWAA 3R5HA 4YXWD 4Q4JB 1DX9A 3DFFA 1CFJA 3QKRA 4HNSA 4R8LA 2QT0A 4OB8A 1JAXA 3FF1A 3AU9A 2OTCA 1T2DA 4PO9A 3SNHA 2O48X 4C7OA 4QNMA 4BBZA 3RABA 2PXCA 3ZLUA 2HO4A 1PDVA 2GD1O 2H2AA 3QHPA 5J2TB 1JKIA 5GIPE 4K86A 1RPTA 3CZ9A 4EUNA 1XWIA 3OHSX 4IHJA 1YA8A 2VKQA 4WIAA 2EQAA 3T5MA 1OB2A 3SIWA 1R12A 4QHYA 2E6UX 3B82A 3A1DA 5FLXA 1KJIA 5CCEA 3GJ5A 4QFDA 4TS9A 3EYWA 1PLKA 5ELMA 4H60A 2C84A 1V8FA 1SC1A 3ESQA 3RVQA 1C5KA 4YR9A 2GJ9A 4YAWA 2BYTA 2J0SA 4YMIA 1CNEA 1V37A 1BE6A 4UMEA 1WB4A 4W1SA 4HQKA 5GONB 3I1YA 1PJLA 1O4WA 3P0FA 1I24A 1IJEA 1O2DA 1U0FA 1I0ZA 1U7DA 2JFOA 1KP9A 3H7IA 3Q6NA 4BASA 4U2DA 3TZLA 1ZK4A 4FX2A 4R2WA 3WMRA 2P90A 1MB4A 4KGXA 2ZXUA 2WD9A 2AQHA 4LYFA 2P8SA 3BQNB 5KWIA 1R0SA 1EFRD 2XTAA 3PEWA 3JRXA 3MT9A 4TWAA 1GA1A 3OO0A 1XRJA 2X9VA 3IQGX 2HL6A 4HWKA 1UADA 2PS0A 5JIBA 1TIKA 1SEPA 2CYAA 4P1ZA 1KOFA 5EHXA 3RC3A 5HIAA 4AKIA 4XQCA 3MILA 3H18A 4MV1A 4MZDA 3HZOA 1GGFA 2JLWA 1JFFA 1L7QA 4GQAA 1NRJB 4IW3B 1ICEA 1TT5B 2IHVA 3BWVA 2PFKA 1CW2B 1ECFA 1V45E 1V16A 4FI3F 4GYWA 4TTJA 4F46A 3UMYA 1EUYA 1OTYA 5H81A 1IWOA 2H0AA 1LLUA 1XVVA 2CLSA 3THXB 4OFWA 3R7SA 2A92A 4DG8A 2HMVA 6ADHA 1TM2A 4HTAA 5DT9A 4ENQA 3CEMA 2J0VA 4CGZA 1E3TA 1DKNA 3UO8B 1ADYA 4HGZA 1R74A 1J8QA 2AHRA 2D4AA 1GZUA 3L0ZA 3RVMA 3IAEA 4QO8A 3NQ41 3SC4A 2GNOA 1UBLS 3HKCB 4MEJA 1ZGCA 2IT1A 1JZQA 3OZRA 4IQFA 3B5EA 5DTIA 3N7UA 5HF5A 3E2MA 2DBVO 3PR3A 4LJ9A 2IV7A 4RQUA 4EYKA 4HDOB 1IB0A 2CD9A 3HXPA 3MCWA 3Q5DA 5IKEA 1OH8A 4JQYA 1ZNYA 2FXIA 1L1FA 2IU0A 3PVCA 4KQEA 1ECBA 4A2WA 1NR7A 3GROA 1RMTA 3K31A 3Q9SA 4KC0A 4REQB 4KVZA 3U0VA 4BO7A 1GKUB 1IBCA 1E2EA 4TV9A 3SEFA 3OFSA 3NBMA 5HIIA 5L53A 2QLJA 3TQRA 2K2WA 5CW1A 1EVKA 1SVIA 5CXSA 2AL7A 4H3HB 1ORHA 3UK0A 4B0OA 1E60A 4FKMA 1N8NA 2GZ3A 5AM0A 4EW1A 5BV0A 5BQFA 2C4UA 2D3WA 4U2EA 4PG4A 3H1GA 1HQKA 3D8BA 2I65A 3GMIA 2WF6A 3NEYA 3M7IA 3NHRA 4GMKA 4DEYA 4H7FA 2P3OA 5BV1A 3UANA 2B78A 1P5HA 1SBYA 1V3TA 4G2NA 2F3UA 3ZBUA 3GVHA 4QU9A 3AQIA 3QJ5A 4O59O 2FDCA 1R8JA 3QW2A 4YJHA 3PE4A 3MS2A 4HFNA 4LK2A 1NT2A 2FJ0A 4JOQA 3TOVA 2H2GA 3JZMA 3E22A 3EEFA 5CPBA 4LZPA 3RANA 221PA 4K26A 4IP0A 1JBEA 1JDPA 1L1RA 4DC0A 2Z5LA 2X0NA 5CT5A 3ZV7A 3CX6A 4NRDA 1TA4A 3OA0A 2VBGA 2W6ZA 2BH2A 3P19A 4K28A 1T4CB 3OFND 2Y1DA 3VPDA 5KU1A 5L3RA 2ZKLA 1CRLA 1AM4D 2GAJA 2L18A 2Y92A 4PHFA 1TW2A 1IWPB 2GHTA 2WJ4A 4L8YA 4FILA 5KYXA 3V1TC 5E9QA 2ATXA 3A4VA 1ZWKA 4MUMA 1RIFA 2BEUA 1S7CA 3EC2A 2CCGA 3IMKA 2VYND 1MAHA 2WG0A 4BNFA 3GJXC 3NRBA 5BRAA 5KOJB 4OI0A 1C7JA 5C34B 2W4IA 3KFLA 1NJ6A 1D1TA 4QUGA 2XT0A 3QEMA 2R9VA 4X3PA 1HNNA 2W2MA 3G8DA 5A5FA 3RGGA 2I4RA 4KZPA 3S2GA 4X6YA 1TX4B 4KIFA 4UVHA 2GAOA 3MJHA 4YJ2A 1JLSA 3C0KA 3D1VA 3HQ4O 5FV7A 4P35A 1PR5A 1DLJA 3GNQA 3S2UA 4D26A 5PGMA 1PGJA 3V4FA 1ORRA 4CV3A 4Y1RB 2NPOA 2VWPA 4HVAA 4YDQA 5ED0A 2O7NA 3OKFA 4S24A 5EKTA 5F35A 2IPLA 3E9MA 5JXIA 2GM4A 1B8UA 1JSCA 1M6EX 4Z1MD 2HA7A 5JAZA 4ZT5A 1W52X 3E03A 3F2IA 2VDWA 2XGOA 5AK0A 5T4BA 4TL7A 4CQLB 3TXYA 1VXRA 2C9ZA 2SCUA 3L07A 3GLGA 1KY5A 2BCGY 4UBMA 3ANTA 4BNWA 1HORA 2P4EA 3KZVA 4FS3A 2BZ1A 1TADA 1UJBA 1XOIA 2GLTA 4B31A 1Z9BA 2G1JA 1FDRA 2BUCA 3LY5A 4MWGA 4YUXA 3HA3A 5K8LA 4RH0A 5LP6B 1KRXA 3WISA 1NU6A 3A9WA 4GOMD 5CJ2A 2UYHA 5CB0A 3AFGA 4OQQA 4BIIA 1ST3A 4WCFA 3KHKA 1E2UA 3ABQB 1FRQA 1YQ9A 2E55A 4B9EA 5AW0A 4YDRA 2UYQA 2I7CA 5JLJA 4DMLA 1NWHA 3NM4A 5FOSA 2MYUA 4YRMA 2WD7A 5K99A 4LQDA 5SV2A 3SDZA 2YHAA 4HC4A 1RQNA 5IJXA 1ZOPA 1GNSA 2HIHA 2WJWA 3CLVA 1PZXA 3E0QA 3RS4A 1T34A 1K5PA 7AT1A 3RIEA 1MABA 3BIJA 3ZVLA 1EXVA 4D4KA 1A8QA 3KTDA 1KKUA 3FYUB 4L4SA 2GCGA 3CVJA 4BLQA 2FZVA 5FPPA 1PI3A 2JAXA 1IN8A 2OM2A 4YRTA 4ZU1X 2WF7A 1HKHA 3MGKA 4RVFA 3SDSA 2GHIA 3ICVA 3Q3EA 1X7HA 3EGOA 4ER6A 4RTJA 1WSDA 1R0BA 2SKDA 4XD2A 5BRJA 4CEHA 1JQDA 3K5IA 1Y4DE 4UXJA 1WV1A 4ZOLF 3FTNA 4RXUA 2XUGA 2HA5A 4DLBA 2J9XB 4PC6A 3I28A 3KAQA 1JRLA 1NJ8A 3VM6A 2YV5A 3THRA 3Q98A 3BJMA 2Y1WA 2Y0CA 4U2GA 3RYHB 1DQZA 3TI7A 4M9XA 1UBCA 2XTZA 3DE6X 1QS0A 1HF3A 3IKJA 1NNLA 2FRVA 1SK9A 3B9PA 3WQQA 3W8EA 4MX8A 5ALMA 2DH5A 4EI9A 5IAGA 3W9UA 3CG4A 4KQHA 3T9EA 3V1UA 3DHEA 4KGZA 4Q19A 1L5MA 5J3JA 2YVKA 5GJBA 1QR2A 1R0WA 3D6FA 3E8MA 3IOBA 1PFGA 1ZJZA 3VISA 3U0BA 4M0KA 4GLOA 4LSGA 4HNUA 5IHXA 5KBYA 3TQHA 1J39A 1IFXA 1NX9A 2HMTA 2Y4OA 3A1SA 4XR4A 1FZQA 3V4SA 4AWAA 2QPOA 2AUTA 3VBCA 3GLGE 1VFPA 3W2HA 4TL9A 3BF8A 3LKZA 2DECA 1EEXB 1JEDA 1K06A 3RFXA 2HK9A 4IG9A 5DCUA 4DV7B 3BAFA 4Z2YA 1WPRA 1CSEE 1U4OA 3EGDB 2WJ3A 1NRXA 4C9BA 1UJ2A 1EEHA 1CRPA 1FK8A 1NJGA 3B3JA 3K5PA 4YFYA 1O94D 2V65A 3SI7A 3AY6A 2CDBA 3LWDA 5ENVA 5EEHA 3TLKA 4DCNA 1E2PA 1J97A 4DCGA 1L4LA 3DM5A 1M1YE 4Q9KA 2YV3A 4OMFG 4EO9A 1OC4A 4I5EA 1RZUA 5HMMA 2NQ2C 2E1PA 4UFPA 1OBOA 3EPRA 3WA6A 3KVRA 4ZOAA 3TL3A 1KJ9A 1UBSB 4QQ8A 5U9CA 2G8LA 1A3CA 1XTQA 2VL7A 1Y6ZA 3AB8A 3R5TA 3WLJA 4A2QA 4EYEA 4BGDA 5BYAA 2CJWA 2ADOA 1XEAA 2UKDA 2WHYA 3WQSB 5ALJA 3WIUA 1DU4A 1XNHA 3L7LA 4YO8A 4XVHA 3CLRC 4LG1A 1T3TA 2QE7A 3JD0A 4TLDA 2OCIA 1SD2A 3Q8LA 4V0QA 5ESWA 1PFWA 4MYRA 1FQOA 3R24A 4IILA 2I6QA 3TI9A 1EAMA 4HJXA 4JU8A 5EL0A 5BSTA 1R4MB 4GPD1 5E8JA 3W2IA 2ZZNA 4JCOA 2V3VA 4JSTA 4L27A 4L9SA 5CB6A 1QF6A 5FLKA 4EZBA 2RI1A 4G9GA 4UCWA 4I6JA 1UFRA 1V5WA 1JXQA 1CUWA 3K0CA 2HSWA 2CYBA 2FYTA 5AK6A 3KDSE 3PWKA 3MUOA 4DCJA 4Q4DA 4Z4QA 1F8FA 3I9V6 2WM9B 1OXSC 1P45A 3H42B 1HYGA 4AX4A 4YQZA 5DM60 4QDZA 5IH7A 4M8NE 1MORA 2R7MA 4MDYA 4ME6A 3RU2A 2LGJA 2W43A 4JBIA 3JYPA 3D2AA 3MXOA 1EP3B 3IVXA 5C9ZA 1F48A 4QOFA 2Q3FA 4R54A 3ZGYA 4LY9A 3LCCA 2I2AA 3AF4A 4FSHA 3RJZA 5B36A 1J2YA 4CKCB 4LNAA 1BMFD 5TJ9A 2A5DA 3VV3A 4AG5A 2G9NA 3C3CA 1OB5A 4AKGA 4OQPA 5F7OA 1RCFA 1R5BA 1GFSA 4C07A 1ESCA 4TKLA 4H15A 3DMHA 1KQOA 3LCUA 3BKWA 5CDFA 2BEKA 4YPVA 4PYNA 3D1JA 2HD4A 2ZKIA 4CEHB 1JFVA 2A8YA 4MVJD 4WLUA 1X39A 1XMOB 4A6EA 4MUAA 5EUMA 3E48A 5KTMA 1YUMA 4K6KA 2QRJA 4RC9A 3R75A 2X0JA 3U7QB 4F4FA 4I0WB 4ZHQA 2CUKA 4F9TA 3VR4H 4D4MA 1ISJA 4FBLA 1O5OA 4EB6A 5LMUB 1LSOA 2Q5JA 1GKKA 3W4JA 2OO5C 4WECA 5B5SA 3BA1A 1KO4A 3BIOA 5G40A 3R76A 4GOKA 4WXHA 4XGNA 4B3FX 3F1LA 1MO2A 1GTJ1 2QRZA 2HYIC 3EZ6A 2ZBFA 3HNPA 4GBED 3LFUA 2V3WA 1TJ3A 3KTFA 4DMMA 4LJRA 1VZ3A 3FI0A 1W0KA 5TC4A 4KRFA 3DMYA 4JJ8A 4G4IA 3V4VB 2O19A 16PKA 1JLHA 4DUZB 3IVMA 3R4CA 3LDHA 3DEAA 2CJWB 2JLXA 2OUKA 1PR2A 5IAAA 3USZA 1KZ1A 2O20A 3L8EA 3PEUA 1U0EA 3L0IB 4RIHA 3GFRA 5KOHA 3DOCA 4MW6A 5DI9A 3I1IA 3S7ZA 1QGZA 1V1RB 3HJGA 1E32A 4KBGA 4CKWB 5CITA 4FC7A 2Z2KA 1FNBA 4H6PA 5C4GB 3HJRA 1XB2A 3M2PA 3QF4A 4LISA 2V8OA 3UH1A 5DX1A 2VXBA 1HZZC 4B5LA 3BRCA 3IALA 2ZTLA 1G42A 2YJ4A 2Z3VA 5EN4A 2C3PA 4UFOA 1RRGA 2F00A 1BKSB 1N7GA 2F8MA 3K32A 3OZGA 1XZNA 2ZRLA 4C0KA 3ESDA 4EI8A 1VKZA 4NPCA 5FPYA 4QT4A 2BPOA 5CGZA 4AYTA 3DVRX 3FB1A 4DLRA 1AU9A 4OQDA 5DN6A 5AUNB 3NTQA 1GKYA 2CDRA 4WK6A 1M6VA 4JODA 1L4YA 1YKGA 1DHTA 2P9BA 4IDBA 4DG9A 2FPPA 1VL5A 3PPWA 2HC9A 1PW5A 1ZJJA 1ULSA 3H13A 3NTXA 2GAAA 5ILOA 5EZYA 2JDID 1OAOC 3T1YB 3F9IA 1DG9A 3L79A 1IM2A 2BL4A 2WU0A 1G9SA 3TL6A 1FQKA 1NXWA 1RM3A 1KYVA 1E62A 1PJAA 2FW6A 5H83A 3F5MA 1UJ4A 3NTVA 4EA7A 4BVKA 4DDWA 2C03A 1IHOA 2MR6A 3OPNA 5T3YA 5AVXA 2G7ZA 2ZTMA 5BUQA 1R50A 1KVSA 3VU1A 4L50A 4DTIA 4PSAA 3WGZA 1IIRA 2ZTVA 4YUWA 5I01A 1GYQA 3ESYA 2ECPA 4MUEA 2VF5X 1Y7IA 2ZUCA 5GVSA 1PLJA 1TK2A 3PXEA 4QNRA 3FOBA 4XM2A 4G5XA 4FZ3A 1TI7A 5ENZA 5BSKA 3A0UA 2JFVA 3AHJA 3K6KA 5FHQA 5AVTA 2TS1A 3DAPA 1DC8A 3L0PA 4IFBA 4IKOA 3U4QB 1XD2B 2XTMA 1N5IA 4AZ0B 3AYXB 3EZYA 1P18A 3DFZA 3TTXA 5HVNA 1E77A 1JJAA 3VDNB 2Y2VA 1Q1AA 1W46A 3DWIA 1UKBA 3FI9A 1U0TA 4W63A 4E2WA 2XLCA 4FYIA 3I8XA 5JS7A 1H0SA 3DO6A 1A9YA 4KMRA 4XJTA 1BXKA 1QG6A 5ALXA 1T36A 3AKYA 1E4OA 2ZVPX 4AJ4A 4CTOA 3ZJYA 4MDFA 4JJIA 1LC0A 1I6LA 1J8YF 1MTZA 3DR3A 2G28A 3RLFA 3RS5A 4CN8A 1HO3A 1RR6A 4MB0A 3G0BA 4BFSA 1OGIA 1SM4A 4ER0A 4DR5B 3IOEA 1L6IA 1ZNQO 2PGOA 1L4EA 4R01A 5TX7A 4GX0A 3DOHA 2YRWA 4WWHA 1B23P 5DTMA 5T4HA 2X77A 4NVRA 4ARZA 3U40A 1OWOA 1GHTA 3K4QA 3TKYA 4MH0R 3W2GA 2E5WA 1IYZA 5CA1A 1Z0KA 3QFCA 4HRXA 4NMWA 2P79A 3A04A 4NABA 3WBBA 3EXHA 1FQJA 1BFDA 3D1LA 1VE9A 3DBHA 3LXRA 4XYEA 3ZI4A 3TMYA 1USVA 2ZZMA 4WTOA 1EG2A 3FYHA 1FQWA 2DWQA 3GCGA 3AOEC 4CL8A 4N8SA 1AKTA 1O77A 5T41A 4YRQA 4A8JC 5HEKA 3A6DA 4YAEA 3UFXB 3T5GA 3WFJA 1SD1A 3JR7A 3REQB 1UEIA 3MT8A 4S0XA 1J8MF 1Z62A 5IANA 3PFFA 1GWNA 1CIJA 3EQZA 4QU0A 1UMBB 4AVYA 5FTWA 3VGPA 4DR4B 3M9WA 3QK7A 4OXIA 1GD1O 4O4LA 4XUGB 2H57A 3LQ1A 3JD3A 2RKOA 5J5CA 3RSQA 1EB8A 5JSUA 3IV7A 2QSZA 4D8UA 2A35A 2BJWA 4PXSA 4BO3A 3FBGA 4P36A 3H5IA 3LBIA 3MG9A 1NMEA 4OHFA 2G82A 4M36A 3T12A 4DDHA 2R6CA 1WJGA 4RMJA 1WIWA 2Z09A 3L1JA 4MVCA 3L6EA 1ECCA 4M7PA 4WINA 2HIMA 3EARA 5CH3A 5E7IA 3M81A 4BOYA 4MQBA 1CDEA 1N1EA 2JAUA 1RIIA 5IVHA 4O1MA 3MMSA 4OG2A 4PG8A 4CLOA 3JALB 3PF8A 4ZQHA 4RCZA 3NHFA 1O8CA 3DCYA 2RGCA 3FNIA 3HCOA 5CH5A 4C3OB 3G2LA 1EHCA 1RBYA 5K4AA 3RYCA 2MJLA 1CJCA 1Z6PA 2ZSHA 3A6GA 2RH8A 2JKYA 3PXAA 3A27A 3SF8A 3HZHA 4Q34A 2OVBA 5I3CA 4BN4A 1H9BA 1T24A 2V54A 3AG6A 4MRMA 1ETHA 4JGBA 2BFFA 3LRTA 3AF0A 2JD1A 3DKVA 1E4VA 1HDOA 4MVWA 1X7YB 3MAGA 4GX1A 4YH1A 3CW8X 3V42A 1K8YB 1LW7A 1T0IA 1SVLA 1VLLA 2EKQA 3ILXA 2F4NA 2BFAA 2F1IA 3FOZA 1OF1A 3KQNA 2W2QA 4L16A 1JH8A 3QVJA 2FQYA 3BORA 3Q7TA 4C7VA 4UAGA 3ZE1B 3HGTA 5K3BA 3WGMA 2Y1EA 4OHKA 1T9KA 2AVNA 1XC7A 2ILVA 5D5PA 2QW1A 5DM2A 4ZOEA 1FVXA 1XRLA 3IEXA 5HQTA 2FE1A 1N2SA 2J09A 3OZUA 4LXIA 3CH4B 4B87A 1L5VA 2Q49A 5BQOA 4URYR 4CL2A 1X86B 1PSDA 2FXVA 1QX4A 1VRCA 1WXIA 5AVVA 3H4MA 5IYZA 4HOYA 4IJMA 4WY5A 5CM8B 1HNXB 5DJ5A 2WKPA 4JLJA 4EEKA 4MUGA 4Z7NB 1NN0A 2H9IA 5B58C 1P2SA 3V1MA 4MIOA 4E2XA 4Y2YA 3TGWA 3O9ZA 4ZV4A 3O8RA 1ODLA 3PCXA 4J4HA 4KIUA 2VHXA 3AILA 1QRRA 3OQHA 4DLXA 1V95A 2C97A 1G3UA 1RI3A 4EOGA 5IJ9A 4CKZA 2Z4TA 1CLEA 4PYRA 3F3YA 3KT6A 5I48A 3G6KA 1O5IA 1P2GA 2H1LA 1NMSA 4GM4A 4HB0A 1GL7A 3LT2A 3GJZA 3RO7A 2D7CA 2XDWA 4QOJA 3I9OA 2AN3A 3NOQA 3STUA 2GCOA 3WLSA 5LWQA 5EJ2A 4C4ZA 1FSPA 1WB5A 1UMDB 1MQ8B 1ODFA 2FEWB 3MLBA 2F4VB 1U28A 5G4KB 4YYEA 3ZY4A 4OQLA 5D5HA 3FNGA 4EEZA 5IM4F 3DV0B 3GRVA 1C9YA 3C4JA 4X1IB 3PXXA 4F1WA 4DL9A 5IRCD 3FGPA 1QP0A 5ES3A 1GNLA 1QSGA 4FWBA 1RQGA 1Y3HA 2QLMA 1JHUA 4IFEA 2MSEB 3DMGA 4LJAA 4Q3BA 1W19A 5LP6C 1AHPA 4AJ1A 1R88A 3TB4A 1P9RA 1GSHA 1NX6A 2FSPA 3QV1A 2HREA 3L7OA 3X0DA 1YQQA 1L5HA 4W6QA 2XB2A 3WIBA 3S1LA 5LQMA 3ES9A 4HVTA 4RKWA 1CRZA 4AWXA 1EM8A 1XAJA 1P7PA 1GGHA 4MP6A 3U17A 2BE7A 2VZ9A 2NUBA 2DT5A 2KHZA 1F14A 3C4QA 4J4BA 3QVOA 3ZCXA 3QVGA 2UUBB 2V6IA 4D02A 3DDUA 1BDBA 4GXTA 4HRAA 4TZTA 1GZ7A 3OPYI 121PA 5HF9A 1KJNA 2CKDA 4D3SA 3OKPA 1X7DA 3I01A 2O8BA 5GVRA 2ODNA 3LC1O 1V25A 2F62A 2HPVA 3MHPA 3MWJA 3OIUA 4PZPA 5LQUA 5AVUA 2ZJOA 2B4RO 3LI2A 4K9QA 3URMA 4Q16A 4ZO9A 3HUFA 2AI3A 4QBFA 1NBIA 1VB3A 3RRZA 4PHHA 4IQ0A 4IKEA 3T7RA 3EZXA 4QTXA 3EMVA 1E94E 2GWRA 4GQBA 4P86A 4JI3B 4IH4A 4QTYA 1R27A 2CDNA 1QCZA 1M1NA 2PT9A 1ZIPA 4RABA 2YC4C 4FMCB 3W1EA 4D9MA 2ZIWB 1YZQA 3RS8A 1X6VA 3PR1A 3Q88A 5JDCA 1TW3A 1EXDA 3I52A 2E18A 4MDHA 1NIJA 3BKXA 1TE2A 5A3SA 4GSYA 4PQRA 2MYPA 1FFBA 3KOZA 3WL5A 3TRFA 4CF6A 3IGFA 4WACA 5DHPA 3M3DA 4EY4A 4JN6B 1PNOA 2JFXA 3A4NA 5IDYA 1OV6A 2O8DB 1QONA 5FORA 4HJRA 1K88A 1QKIA 2OK8A 3TZKA 2RHRA 2F6RA 3JPYA 3EVCA 3FB4A 1I36A 1JI0A 4OGGA 1DBPA 3JVDA 4NENA 4QHTA 1OYYA 4DOMA 5IP5A 4RVHA 2HF7A 5JANA 3QITA 3EOBI 2PKCA 1Y3DE 2NNWB 2WUEA 2VCEA 4KPUA 3SJAA 3G68A 1ADCA 3BB4A 3LW8A 3U16A 2QTNA 2YN2A 1G19A 4EL0A 5T64A 4ZCTA 3EX7C 1IMOA 1OZHA 4PQFA 1L5GB 1ISHA 2REQA 4RPGA 2R5WA 2A86A 2PSJA 2JKZA 2FHSA 1R64A 5AHXA 4DR2B 3MOSA 4ZYXA 1CVIA 4ZU6X 3E6AA 2QTVB 4FFNA 3VU3A 2R0QC 4I4IA 1L5OA 2XECA 2NQ8A 3ZNOA 5KTPA 4JUFA 1PL7A 3CWZA 3LF1A 3OKCA 4ETIA 4PFKA 5IYZB 5JAOA 7MHTA 1IH8A 3T5DA 4GRDA 2PUCA 5EIXA 4S04A 2HBZA 3C3BA 3FW1A 4OU4A 4JS0A 4R5MA 5EKXA 1ZQ1A 1W85A 5F64A 3JV7A 4MPTA 2BP7A 5ECGC 4GRIA 1QYVA 5TPZA 3IP6A 3LLSA 1C8KA 4AMUA 2FGKA 3ETJA 3P4XA 3RYTC 2WICA 4A2CA 1XA3A 4ZTZB 4PSDA 3VC7A 1MRZA 5BN3A 3AVQA 3F4LA 3ORHA 2FI1A 3B1JA 2GM5A 4ZZ3A 4R6XA 5KVVA 2CJFA 2RK3A 1W73A 3WK5A 3SMVA 3RKSA 3ED5A 5JDCC 3RSSA 3C1AA 3A26A 4UREA 4Q00A 4HNAA 3RASA 1JWLA 3O8QA 4HX9A 2PXHA 4IH1A 1YSCA 4GNRA 4M8SA 1LY1A 3C1OA 2Z04A 3G1WA 1GPLA 3OEWA 2B30A 1VMKA 3PC8C 1N1DA 3F5DA 4ZT3A 3OQ1A 3NR2A 2IOFK 2YWHA 2FMUA 1NFRA 4MUNA 4P8RA 5I7OA 3BOSA 3RAEC 1G2PA 2P8JA 4KAAA 1KRWA 5EZYB 4E15A 1NNUA 2XOXA 3IPYA 3BWMA 3PQ8A 3WIOA 1NNI1 5B4TA 2P1DA 4KLAA 2EGUA 1X1RA 1OVGA 3WLPA 1CJUC 4KHPB 3AH8A 2MOKA 4IJKA 2D0PB 4K3UA 4PM4A 1DKRA 1FXWA 4CMEA 5LYJB 1O54A 2R48A 1BG6A 1F12A 2ZIEA 4MRVA 3TSOA 4Y7CA 1K3FA 4U7FA 2O3QA 3QVKA 4BFVA 4ZHQF 1L7NA 5FWAA 3GIWA 4RMNA 3N8DA 3WLOA 2FJPA 4U8GA 1N3IA 5EOVA 5CA1F 1WY5A 5EIWA 3IMEA 4ZRNA 1XFDA 4FWIB 3PGMA 2HWYA 1ZC4A 4AP6A 4DW8A 2C83A 2W48A 4HADA 1NULA 5DKFA 2DF8A 3PPXA 2X8BA 1EX6A 5BN5A 5ULLA 2PNFA 1QH1B 4AS1A 3CT6A 3VO2A 4OXQA 4Y3UA 4GKKB 2VF2A 5DZSA 4P0TA 4O2RA 1IZ0A 5F5XA 1XDSA 3R7BA 1FE8A 1YK0A 4BJHB 2ZREA 1II8A 1CR4A 2CE2X 1BWRA 3PC6A 4PLTA 3I12A 1KIFA 4RHUA 4RELA 4C0SA 2WRZA 3NAZA 1V11A 4Q6WA 1T8RA 1KNQA 4DANA 1S8NA 3RDPA 5ITWA 4QQFA 3E81A 2PSHA 3IO3A 3PJGA 2PV0A 4GKAA 4IDCA 4JBLA 1T9AA 4DA9A 1EVEA 1KS9A 2RCNA 1D5WA 2Y1OA 7ABPA 5BNTA 3LTNC 1KGDA 2QX9A 2PJRA 1QE5A 3LOQA 3U60B 2H6EA 3U7RA 3I5YA 3W1WA 2YZNA 2P5TB 4BVFA 4EHNA 3EPJA 1H6AA 1LNQA 2ZYTX 2W2XA 3N5KA 1I0IA 3OCXA 1T25A 5I6DA 2VNAA 2YBDA 3TXAA 4KR2A 3MWKA 5JQGB 4L95C 4IIUA 3BIFA 3KRTA 3QMMA 4CETA 3SICE 1BA3A 3D5EA 4PZDA 2PL5A 5BP7A 5D1HA 1ESNA 1TUGA 4R2LA 2QUZA 2I2BA 4KO3S 1C30B 2OM6A 3I92A 5FP0A 1N8SA 1DAIA 4FNAA 3LXXA 2IEZA 1DMRA 2PZFA 4B4VA 1A27A 4BZWA 4C0XA 1UBKS 3TE7A 4Y7DA 1CY4A 3UC9A 3I6MA 3ZY3A 1VIAA 3BGOS 4N3CA 1KR5A 3ZCUA 2HQSA 1S3FA 1Y1PA 3DZGA 1OX6A 2DZDA 3A7DA 4B3DA 4AQ7A 3GFOA 4F9FA 1DQYA 2PUWA 3I58A 4I36A 2Z2JA 1G60A 3MJDA 4IX9A 2IXAA 3CRQA 4XIIA 2O9JA 3RUHA 2XLBA 2YWDA 4N7MA 4DRXA 1Q0SA 1JT9A 1NBMA 2FQWA 4ZC8A 1XT6A 3ENNA 1TB4A 3P9KA 4Z3DA 3RTCA 2CXHA 4DYVA 2E5LB 2ILTA 2EFDB 2ZI7A 2I33A 3D0QA 3EBOA 2WSSD 4CLDA 1RXYA 5F73A 3PV0A 1BXRA 4F1JA 1SC4A 5KJEA 1X7WA 4QTTB 5FLYA 2V5VA 2FUEA 3EPPA 4L6IA 5CBPA 3QWIA 2VG8A 1FFEA 1B93A 1W9HA 4LZOA 1QIHA 2D6FA 5KQLA 3T8YA 2IYRA 1A8HA 1X7ZA 3HCEA 1QOQB 4QGGA 4RHXA 1I9GA 4TMFA 1A76A 4HH1A 1YHYA 1Q14A 1G2IA 1Q20A 4MR8A 3CB4A 2C5BA 4H0NA 4O1IA 3I0ZA 3K9FC 4MARA 2AMYA 4R51A 2EWMA 2HZBA 2P2YA 3FUXA 1V71A 2FFHA 3DJYA 3PA8A 4HGYA 2JLBA 1V16B 4JYBA 2DQSA 1SCBA 4IXMA 4DIDA 3OIGA 1FYFA 4M46A 2NZXA 3C98A 3X1MA 2CLOB 1JX6A 1U1IA 1H0RA 4JH0A 2R8BA 3E82A 4UHCA 5IWAB 1U2TA 2HCJB 1TYEB 3L02A 4FGLA 5JYDA 3PL5A 1J1IA 4LZAA 3HSYA 3C5WP 5CFOA 4B80A 3ZOKA 2Y6UA 3A1UA 3EDRA 3G8BA 1QRSA 3V8VA 2HHHB 5JJ5A 3LVBA 5CHYA 1BAPA 4P34A 4MW9A 1BYIA 5EHIA 5DCWA 4DSNA 2JFWA 2QN9A 2E9SA 2BDTA 3A31A 2C00A 3J7AC 4QREA 1TEVA 2JJ1D 2RHBA 5F33A 3UHAA 1U8AA 1W30A 3QOYA 1Z36A 1ACJA 1G4HA 3B9BA 3SN6A 4C1BA 4EFKA 2GH1A 2ZIUB 3KKLA 4NDNE 4WVFA 1TM1E 1P2FA 1ATZA 3PCRB 3WK8A 1HFWA 1RHKA 2WTNA 3R3VA 4BQRA 3KOMA 5EGSA 1QH8A 5C7YA 3P0RA 5PNTA 4H18A 2GEDA 4ZO8A 4ZWNA 1CUGA 1EJBA 4Q3KA 4YJFA 1G8GA 2PXAA 1ZHHA 4Q3LA 3W3AD 1M6HA 4AD8A 3EC7A 3WHIA 2CV0A 1W59A 1E58A 2PFSA 4FN4A 4TL6A 3KR2A 4YRGA 3V5NA 5FPKA 1IHXA 1RAGA 1Y7TA 3ZKWA 2IZZA 1IJFA 4MULA 4KQ2A 1CUZA 1Y33E 2RMKA 1X8LA 5BMVA 2C7VA 2VF7A 5HE9A 4PSCA 3W3ZB 2LV8A 4UQPA 4Z0PA 3WYCA 4FDMA 1ILEA 1VHLA 3MBIA 4R3NA 2ZM6B 3QVLA 3P2YA 1L4HA 2H3EA 2I5PO 3BHJA 4KP7A 9ABPA 1R4NA 4BLUA 1D2AA 1NVBA 2PMBA 1S02A 3L0DA 3E05A 1RXCA 1V0JA 4F71A 1DS6A 2G5GX 3HBJA 4D2IA 3GAFA 5L4NA 3TNJA 1G7TA 2PR7A 2XTJA 2CZGA 3LT0A 4OJMX 3Q85A 1BW9B 4IIJA 4UHEA 3OQ6A 4RZIA 4CM7A 2FUCA 4YRNA 1VGVA 4TTAA 3DLCA 3FGZA 5JU6A 4WOCA 1E4EB 2QNRA 2ZRIA 1YQUA 1Z13A 1MO6A 1WUHS 4GE0A 1ISPA 1ENZA 3FXAA 1PS0A 2WWIA 5ESDA 3SBXA 4BQQA 1QCYA 3GFTA 1J8DA 4MPDA 4ZP1A 5HF6A 2NVBA 3C3PA 2BEUB 2NXWA 3NO4A 2ORYA 2R8PA 4ZOBA 3B20A 5FBRB 2UXBB 5SICE 1SU7A 1SWVA 3HYSA 1QMPA 3NTOA 1JG3A 1U99A 2Y4NA 3IAXA 3ZC3A 5F3WB 1HLGA 3LC0A 5EXPA 3QWFA 1KFJB 2EFGA 5F76A 2IL1A 2PZLA 4O2AA 3EZ7A 4ESEA 1ZX1A 5BW8A 2P6RA 3AUAA 1FC0A 4UEKA 3L0OA 1H0KA 4WUTA 3HNOA 4R16A 3WGYA 3RLIA 2GN4A 4G1FA 4CKEA 5I8WA 3OQOA 3IODA 4NU5A 2D1RA 3OP4A 3PC4A 3QEKA 4E1BA 2MSLA 1WNTA 3HA2A 4WNCA 4H77A 2F67A 2AJBA 2AF3C 4ARAA 1OVMA 4DMRA 1N8TA 1XZKA 1SKYE 4TT3D 1MPXA 3ZD7A 1G20B 1UDBA 2CK3D 3WYBA 5CRIA 4QRIA 1CZKA 4B3BA 2JI6A 1TTTA 4GPEA 2FFJA 1P77A 3H0EA 1F4VA 4FCWA 3REGA 3MOGA 4PSVA 1U0JA 1VYTA 4QC2A 1RPAA 4XYMA 5AYVA 1NJ1A 4QDJA 4E2YA 1KEEA 1XLUA 4J0HA 4S1VA 2IEBA 3R7NA 1VG0B 2IUEA 1PQ4A 3CPJB 2V7VA 3KXLA 4WXMA 3EW9A 4HAIA 5AKYA 2WLTA 4MGHA 1QHXA 1I32A 2ENWA 3T15A 3EHDA 1U3DA 4G8BA 3A6KA 4D82A 1MW8X 4OVKA 4MV0A 2RARA 3LPCA 3C5VA 1SCAA 4BPRA 2DPHA 3UVEA 2G6TA 5DHRA 2IX9A 1POWA 3KC2A 5G4LA 5CFRA 2R00A 1RFLA 1WMFA 3U39A 2FQXA 2R00C 3UB4A 3JTEA 4PZYA 3WXBA 1FVOA 3WHPA 2OZPA 4BAUA 3CTPA 4HAWA 2YIDA 4ZAFA 2QU8A 5K3FA 2BKAA 3QKTA 4JKIA 5AOBA 3V4LA 5JXWA 2FR8C 4AJHA 1JIKA 2J9FA 4IDAA 5GIOE 4G81A 4KN8A 1SHKA 5LQDA 3WWZA 4HGPA 3IAS6 1SQFA 3R7WB 3U3OA 1TDJA 4EG5A 1XX6A 3AESA 5DOVA 3KEGA 4MAFA 1E2HA 5IX8A 3KJGA 1FEZA 1VL8A 4CI0B 4ML3A 1C7QA 1IONA 1T3GA 2P2SA 3FNEA 4EW6A 4AY6A 3FWZA 3NCTA 5K0FA 4CG2A 1JEEA 4U0KA 4YROA 1LX6A 3Q10A 5AD1A 2V55B 1WX1A 2ZJAA 3ZNQA 2J6CA 1EP2B 1UR5A 4EG4A 5MF6A 1G3QA 1WW2A 2JGDA 4LWQA 4AIIA 2O0LA 2CB0A 2WJHA 2ZRJA 4B83A 2D3TA 1LTQA 1UPUA 2EARA 4UOEA 1TL7C 5DU2A 4PR3A 1TJ5A 4B82A 3UF0A 3AVVA 1QCCA 5EPEA 1U1EA 3TR6A 2A30A 2O2EA 1IEWA 2W71A 3LBFA 3QEOA 4BNUA 3H19A 1A2BA 3ZX5A 3MGCA 4KWCA 4B6OA 1N3YA 1QNLA 5AIAA 3RC1A 3WMGA 1S2LA 1MJHA 4D9KA 1TQ2A 2ZIZA 2JLSA 4HDNA 1MP0A 5BORA 1EUCB 1HG0A 4HG2A 4D4HA 1YR9A 4JL5A 1Q7TA 1Y1KE 2DBRA 4Q7EA 1TC2A 5LXTF 1R0ZA 3EF1A 1DX4A 3U9TA 1BH6A 1N2GA 3MCTA 2VYNA 3TQIA 3PUWA 2FZ5A 4D9HA 1NTOA 1FNNA 2G7MC 3VSEA 4BGEA 3V6MA 1D6NA 3E5HA 4OBXA 3WDKA 3RF6A 1SC6A 1IHDA 5I7AA 1EFHA 3JQ7B 5BSEA 3IOYA 2C9DA 5EY5B 2X0FA 3WYNA 4JI5B 2H8GA 1C3OA 5L40A 4QQKA 2IGBA 4JSYA 5DRTA 3UM9A 2O2SA 3H1FA 4HX5A 2FLVA 1EQAA 3JQBA 3UZUA 1G6Q1 2ASEA 3FZGA 2HXSA 3PQ5A 1NYRA 2IS6A 1G5IA 1H6DA 2Z9BA 3ANXA 3E2PA 4ID9A 1SWWA 1XQ9A 2C5GA 2WHRA 3ODGA 2IYEA 1IJBA 2ID8A 2H4XA 3WRYA 3PT5A 3B7PA 3QUQA 1CY6A 5LQNA 3ZHTA 4UZFA 4XB6B 2DGDA 5ARDA 3VH4A 1O87A 4MVJI 4Q66C 1KKLA 1C1YA 4PCLA 1BROA 3E27A 3OTWA 4J9UE 3DNFA 1C3LA 1Y37A 2IHYA 3BAZA 2IIPA 3COJA 2PSDA 1F6WA 2XB8A 1U3FA 3RBZA 4CMEC 5E2IA 1R0XA 1NLMA 2OV8A 1ZA1A 3OM9A 5KQMA 2W2KA 2HJWA 2GYWA 2IYYA 4K6CA 5H1YA 1YRWA 3C3DA 1LU9A 3GNTA 3IILA 4UOQA 4XVUA 1K6EA 1UBNA 3EXEA 5FUMA 4YCNA 2FPWA 1S2IA 4P53A 4QM6A 4D0NA 3QH4A 3GVCA 2W4QA 2PZKA 3JVVA 2WIJA 5GZ1A 2CVHA 3O38A 2L42A 4X7MA 1U28C 3O31A 4ZVPA 5IJ0B 1X92A 2AOWA 3W8DA 1JNYA 1Z7WA 3HHEA 3HKEB 3R8CA 2LUOA 2HXGA 3LHKA 4G3XA 4RCVA 1RQRA 4XTRA 1ORVA 1H1LB 4LGMA 1N34B 1OFTA 2FDRA 4QOHA 2V7QA 1DKQA 4ZT7A 4EQ6B 1ELOA 2DFKB 1P6XA 2NSYA 2Z5VA 2VPIA 2ZBUA 3K4HA 4N7BA 5KINB 4RBNA 2IP1A 1YQTA 1VJ0A 2AJTA 2VHZA 2XITA 4JWKA 2WOJA 2P41A 3FOAA 4GGPA 5C1IA 1IUPA 3A2LA 1MHPA 3G3EA 4F85A 1NA5A 3V7WA 3G0IA 3GELA 4MI3A 1DC3A 2F3QA 2QL5A 4PFQA 4P3PA 4W9NC 3ZWQA 4CLRA 1A04A 3JQAD 4FX5A 3T1NA 5KNCA 3THYA 1WETA 4AZVA 1IBMB 4TYYA 1XF9A 3FVTA 4I55F 1T8WA 2GN2A 4GPTA 2V98A 2GJSA 2JH8A 1KY2A 3NTRA 2ZSIA 4MDEA 1ZUNB 1TKBA 4QARA 1M2OB 4HB2A 2ZB4A 4JLDA 1KZ4A 5EE1A 4EG6A 1OQAA 4N12A 1S8OA 1WHSB 3O2NA 2R1TA 5LBIA 1J2RA 1IZZA 4NG4A 2P91A 5CDUA 2BMAA 1ESDA 5C8XA 2RGBA 3UN1A 3TCNA 4TSFD 4F72A 5DYNA 3KQMA 2ZRNA 2Z2YA 5EG5A 3W5DA 4KO1S 4JI7B 1J1UA 3WWOA 3PXDA 5IXJA 4BWFB 3S5JA 2G0NA 4HWOA 4LSMA 3EFOB 1NURA 1APBA 3OWHA 1BEZA 4IDFA 4MIYA 5ILQA 3STVA 4ND5A 5A71A 2CV1A 2EYQA 3LX8A 1A5BB 2JCBA 2ZJ8A 2EIXA 5AVJA 3WBKA 721PA 1M5RA 4KUHA 4ARVA 1NBOA 3E15A 3DVSX 4PW0A 3F78A 1BXZA 3EPHA 3HWWA 1JEQA 2JI9A 3BMCA 1CQXA 4M9ZA 4C4OA 2C7GA 2EDCA 4JL8A 4JVMA 5H16A 5I8ZA 5KAPA 3S2SA 2X8AA 2I6FA 1B3BA 1P1HA 2GKOA 4TLBA 1NSTA 4ZJYA 3T94A 3PK0A 2ZIXA 4G84A 4L5CA 3ND9A 3GAMA 4ICIA 4RV4A 2YW2A 1DTSA 2QD4A 3GJ6A 4U2KA 2XXAA 4AO6A 1ZJ4A 4AJOA 3THWB 3ETHA 4NJMB 4B34A 4LV8B 4BBPA 2BSXA 4ONEA 3PDHA 3TSCA 8ADHA 3GRRA 3QUSA 4ASUA 2A4MA 3T1HB 2H1OA 1XKLA 1X7XB 4M0UA 1RRVA 1U04A 3KR9A 4IVNA 1JH9A 2QTBA 4XWYA 3CZ5A 2CZQA 2WWRA 3CYFA 2XKKA 1ZMRA 4J6FA 2ZTSA 3HDTA 5A62A 1QWOA 4ARSA 1JHYA 3W90A 1MD9A 2BI8A 1Y8QB 3A58B 3K9GA 2ZUFA 2ZJFA 1POXA 2XVYA 4JOBA 2G71A 4Y0AA 3BBLA 2JGKA 4XQ9A 5FADA 5HBGA 3FMFA 3HUUA 2WY2D 4E03A 4KWEA 2YHIB 4HSEA 1J25A 1ZVMA 2ROQA 5ELXA 4NYJR 2EYUA 4IXTA 2XMRA 2ZCJA 1SXJA 1ZM9A 2OSVA 5B1DA 5CLIA 3E58A 2VTBB 1V1RA 2GSWA 2J07A 1GU0A 3BK1A 4LCEA 1FW6A 2A5FA 1CETA 3C3XA 4JX8A 1JYFA 5AJUA 2Q5EA 1JHVA 2A0WA 1ZOSA 4EHJA 4CIAA 5JAPA 5FL7A 1Z4KA 2XGGA 3AOEA 3MVEA 4ZXPA 5IM5A 4EGAA 3MERA 5BQXA 3OQNA 4NR0A 3GEPA 3GMDA 1BHSA 4JR0A 5KYWB 4OLBA 5L51A 1M5TA 2PUVA 1N2CB 2EJWA 2ZI9A 3P2JA 3PFBA 4O1HA 5HKLA 1J6UA 4QASA 2RGRA 3TFOA 2POCA 1SURA 1QGYA 1H69A 2IXFA 5AVWA 3F74A 4O2AF 4GKJB 1PJ4A 1TAQA 4IJQA 3FG9A 3WZ2A 3AM3A 4CM9D 2NUTB 2XCQA 3QF7A 2FCAA 4RVCA 3G7NA 3ZNNA 1AZWA 1OXMA 3P5BA 1IVSA 4IGAA 1MB9A 4MI9A 4G1MB 3EZNA 1D6MA 1U3CA 4G41A 4I50F 1U9IC 2NV6A 2XVXA 4KTVE 4P54A 4R5HA 5IEJA 3IB3A 5ALLA 1Q44A 9LDTA 2YYSA 4BGVA 2YR0A 2WE7A 4YCBA 4FOLA 3R1IA 4QXOA 4TTPA 2NVUA 4H1WA 4LFBB 1JW9B 1R00A 3RSZA 4B43A 1QZXA 3DXYA 5KEIA 1YS1X 3OF2A 2VT2A 2NU8A 1RKUA 4I4NA 1PGPA 4I6EA 2ZITA 2QORA 1PR4A 1JHQA 2WVHA 1WBBA 1L4MA 3DEZA 4BNMA 1N77A 4MUBA 4RNDB 2QPLA 4FLFA 5CA0B 3FCAA 1C4OA 3GRPA 1W75A 5H9VA 2F55A 4Q5IA 4RFSA 3CUEF 2I9KA 4R2IA 3WLMA 1KYQA 4GI3A 3BGDA 2RGYA 4UHJA 2E5FA 5AXAA 4HGRA 4LHEA 3FRIA 1UC5B 1I2MA 3BH6A 4WERA 1KAOA 3Q72A 2PR2A 3TLAA 1RPZA 4MW4A 1XYVA 3E9DA 1MR3F 2IUYA 2NU7B 3OT5A 3DEKA 3Q9NA 4LOLA 1YI1A 2YN0A 3I83A 4W7SA 4BZZA 4ZICA 3FCOA 2X0RA 1U4NA 3DTYA 4NJEB 5BMOA 3IQIX 3QPUA 1GDHA 2ZJ2A 4LXXA 2REBA 4QOSA 4WY8A 2WNHA 3OQIB 3WHKA 4V1CA 3AEQA 4PG6A 3JW8A 4Q05A 4RK0A 4MLZA 3CH6A 1T36B 2JIRA 3L49A 4H7JA 5ITZB 2AEJA 3T5AA 4ZYVA 1G20A 1TQ8A 2B25A 4OLHA 5CLLA 3DMTC 3GMTA 4MJXA 4R1MA 1CUJA 1E1NA 3MWEA 4DLLA 4DMUB 5FKJA 1FUEA 4BRUA 1YGPA 2EATA 3VNAA 1LBSA 3P2MA 2PZAA 2WSIA 4V1CB 2YHIA 1TCAA 2O7RA 1RWPA 3CPEA 4H1VA 4J0KA 4CMKA 3K2QA 2XCSB 3CFYA 1I51A 3A6FA 1NI4A 1GPUA 3ELDA 3FRJA 3K6RA 8MHTA 2B5OA 3EDOA 3FVWA 1WOMA 3AFHA 2CXXA 4UMVA 1JMYA 2PBFA 4A1OA 1JDUA 2QAJA 5C4MA 3M1IA 4HSGA 4TMWA 2ATVA 3ZWNA 5HWSA 5JD6A 2ONCA 1X7XA 2ID4A 4EA8A 1GTMA 2UXCB 3QLTA 2QRUA 4QUBA 5H3CA 5FFNA 1H22A 2BRUC 4BVJA 3W6OA 2R8YA 4CDGA 2XCIA 1IDN1 1GGKA 1J0AA 2A78A 1EM6A 4P5DA 1K5GA 1TU3A 1ZGZA 1NVXQ 4XVRA 1CUSA 1E6KA 2XUJA 1V9CA 1LFAA 1R18A 3RSGA 5F98A 2C88A 1JQAA 2WT8A 3BHNA 4OEHA 5JBQA 2BFDA 1CULC 2OCBA 4M8LA 4ND7A 3X2EA 3G6WA 4Q4HA 1GKIA 5IABA 5IJZA 2PGJA 4EYQA 1WL8A 5EIEA 1G8KA 1T3HA 1V4BA 4E5PA 2GO7A 2QTAA 3N6XA 2M6SA 3EDMA 3LKVA 2ZAOA 4OK6A 1N5MA 4HTFB 1A1VA 4YXWA 1GM5A 5IMBA 1AB6A 1XTKA 2DJ5A 2QROA 3REFA 4EABA 1F6DA 1GYRA 5EJ4A 3DULA 2HQBA 5IAEA 4PPGA 3HADA 4WJKB 2HRBA 3KAJA 3T3DA 2EKDA 1LBTA 2W6IA 3GGGA 4GIBA 2FPGB 5BN5B 1AA9A 4OSOA 2OBFA 2DUWA 4FHDA 2AJDA 3LX5A 5A7HA 3OP1A 1M2KA 3GZJA 4PAWA 1Q1ZA 5KJFA 1D0VA 3ICPA 2AV6A 1M0WA 1T2EA 1JFTA 2QV0A 1CF4A 3LK6A 4YALA 5K09A 3DL2A 3DE7X 2CJYA 4ZVSA 2GWHA 3DD5A 3TAHA 3H7AA 2FPUA 2BELA 4OQ4A 4Y18A 2C29D 1Z28A 1QIMA 2XB4A 5JJBA 5HRCA 4KQWA 1O6ZA 3TQTA 4P84A 4CDRA 3KQPA 2B4QA 2OQVA 2AFIA 1CZNA 1VE1A 4K40A 4B8WA 4A7PA 3UJBA 1Y98A 3SYLA 4FMPA 4XM0A 4V0RA 4FS8A 1PJBA 2HLDD 1ZNZA 5EJ8A 3VR2D 2QBYB 5LNK1 3NHZA 2H63A 4B1FA 2WUWE 3JWHA 5HOQA 3JYHA 4V2UA 1TKAA 5AKXA 4BKQA 2HYDA 1JE1A 2LKCA 3QY0A 4HWGA 3KWFA 2IV3A 4MWBA 4H35A 3CLHA 3EZ9A 3BXXA 2CHQA 3ORRA 3I5MA 3ZE7A 4Y1FA 4BY9E 1DTWB 3IDSA 2X2OA 3MJEA 4W1PA 4U3JB 4BIMA 3T9DA 1TFUA 3ZCRA 2OHVA 5F7JA 3T34A 2BVNA 2VUSA 1JV2B 4MK4A 1KJ8A 2NUPB 3BSFA 3ZPXA 2X58A 5FOWA 1E1LA 3R3JA 1YJCA 3EWAA 3GDOA 4AZTA 4DHWA 1NW5A 5FIUA 3QBTA 2Z2XA 2ZBPA 5EJ9A 3BJZA 1DO2A 1GPDG 3HXQA 1EDBA 2Q5HA 2BFOA 3WDSA 3FPAA 5AQEA 2J87A 2DETA 1MX9A 3SKYA 2QRPA 5DHTA 1NZDA 1DZ3A 3JQEA 4WMLA 5ARCA 2V4MA 3HCCA 3T7AA 1X3LA 3OFVA 4RL6A 2NPFA 2PT6A 1GPNA 2R6HA 2DSTA 1XR3A 3P9IA 4GNKA 5HX7A 3W5BA 5L6LB 3QYFA 1E6LA 1W94A 2DHCA 1A5ZA 3H2IA 1OKKA 5IUJC 3E7DA 3VOSA 1EK6A 1XU4A 1Z5GA 3EGIA 3F1KA 4U0JA 4CM4A 4JKOA 5CURA 4JCCA 5CDGA 5D51S 3PTZA 2Q8NA 3BHIA 4IKPA 1T2AA 4HMPA 2W2TA 1I4EB 4DMHA 3QTBA 4LBWA 4DM4A 3KT0A 3PL1A 1RJWA 5G3YA 1AH2A 1QKJA 3KD2A 1FFXB 4Y9SA 3ABZA 3FDZA 4D80A 3C1UA 4EPXA 4AM8A 1I3NA 1YB2A 1GL3A 3A32A 1RHQA 5D3MA 1CJVC 1DBIA 1M1NB 1VHTA 1C8LA 5L3QB 5C51B 2B3DA 1GL6A 2QN8A 5A3RA 1W7AA 3LIIA 1H3EA 3TBFA 3I2HA 3KBBA 1PG5A 2GM9A 1Q1GA 3DNMA 2HK6A 1H8HD 1Q77A 1V3UA 1H2ZA 1SO8A 2I4IA 5FBZA 3T9BA 4F4IA 4G0VA 4LRYA 3ADKA 2VNKA 3EE6A 1KWGA 1XTRA 2X0KA 4XFDA 5G0UA 3E7WA 3FPGA 3ENWA 4RJ2A 1SQ0A 5FL3A 4J7XA 1N5RA 5EUQB 3S3TA 4BYGA 3K70B 2BOVA 1THZA 1L5WA 1RHUA 1PZFA 3DT8A 5B53A 3MTEA 3D7RA 5FTKA 4UDYX 4OLAA 3TTWA 2WM2A 2FN7A 4LZWA 4CMIA 2PIAA 3HNRA 3K1AB 2VJPA 1CWUA 4QFBA 2DBZA 3ENKA 4BX3A 3E1SA 3PI7A 3L0SA 2EU8A 1KZ9A 3DE2X 3JRWA 2B36A 5IAKA 2Z8YA 4ZT6A 2GD6A 3PFGA 1MZPA 1E9BA 4GR5A 1EGMB 3OM1A 1QK3A 1QG4A 2UZ1A 2REQB 5KYWA 3OZBA 4P6VF 2RGUA 5ETJA 1AV7A 3EGXA 3FZYA 4II3A 5AXDA 4C1NA 5K6RA 5I7EA 3EISA 4DN6A 5JWOA 1TEZA 2J45A 1A2OA 3EXIA 2PBLA 3NWJA 2A57A 2F64A 1P4RA 4NHOA 4U3JA 3SR3A 3HV2A 1GQ2A 4O4HA 2M6LA 8ATCA 4LY0A 2ZE6A 4MRAA 3RVNA 5EQTA 4UDNA 1JKFA 1RZVA 2BM9A 2H1IA 2WTEA 3FLAA 4TTTS 4U7WA 4BMOB 1MG0A 1ZH6A 5EJMA 2ZR7A 3TLEA 1OBHA 1P2BA 3VU9A 2OZLB 4XX0A 3Q3CA 3CSUA 2VSXA 3E8SA 2VHYA 1TO2E 4N0PA 1IG0A 2N42A 3DOEA 3C1TA 1EESA 2FDXA 3HBNA 1ZCFA 2A7XA 2O14A 1WDMA 4IL5A 3T6KA 4INJA 1Z8DA 2YW9A 3LDAA 3KLPX 2J8ZA 4R6WA 4RVOA 5BOSA 5ADHA 1ZK0A 4ZT2A 1D5CA 3M6LA 4PLGA 3KUDA 2CXSA 2WHPB 1Q83A 1QZTA 3NTLA 1E7QA 5DV9A 4IMIB 2HT6A 3EXHC 5J1SB 4TM7A 1M10A 2R87A 1KEVA 3RADC 3RVBA 4Y2QA 2C94A 3JSXA 5TNXA 4IM7A 3U80A 1CEEA 3MUEA 4DXDA 2YINC 3ZS8A 2NZ8A 4TN5A 4DUGD 2AG6A 1KETA 2WYUA 2GILA 2R1ZA 2W0MA 4I50A 5JEDA 5KSOA 2ZJ7A 2VQ6A 4DIFA 1VSTA 3DT6A 5DVZA 3OCUA 5REQA 3VV2A 4JT4A 4WA8A 1RS0A 2MDTA 3D3QA 1YDHA 3OE1A 1JPNA 1W85B 1RAHA 4N4AA 1G6OA 4YXFA 5C0OE 1NSFA 2J3DA 1FVFA 3OZIA 3SZRA 3UW3A 1RKXA 2YUTA 3R4VA 4DC9A 3FHOA 2EW2A 1UP6A 5F5LA 3IULA 3LV8A 3AZPA 3F8SA 4GGMX 4QHSA 4B85A 4A1FA 2OV2A 5I3ZA 2J3EA 1NXQA 4G0NA 4LJKA 3C5CA 5DP1A 3V4OA 3FCXA 1YR3A 2AXEA 2P9JA 3CTMA 4Q4AA 4TQAA 2AZTA 1HTBA 4W9NA 2Y93A 1ZGHA 4FBMA 3T9CA 3TM4A 2Y0PA 4NV1A 3H75A 4MKIA 1RLMA 4D8YA 1FB5A 3G0CA 2IOQA 4KR7A 4RWEA 4YRPA 4B7XA 1P1BA 3SX4A 4BNDA 3QPVA 3H4IA 1OYOA 1NW6A 1PE0A 2PEZA 2GS9A 1Y6RA 5DNVA 3HVUA 4U63A 2C04A 3AHIA 3INTA 1Y1SA 2GJ4A 4LZJA 1XD8A 3OX2A 1KYIA 1Z06A 4QATA 4JLAA 5K0GA 1HE4A 2B1GA 5BVGB 4G0YA 3W34A 1IDOA 4C6TA 2QRNA 3WJ1A 4G56A 3K4PA 4R9NA 1YZYA 1QO0D 4H7KA 4NU6A 1WMAA 3RK0A 2XYRA 2IPAB 4O6VA 3KM0A 5C3MA 4K6HA 3LCRA 2PHZA 3QOXA 4LBZA 2WNSA 1UP4A 1MCZA 5EIAA 3HDQA 4JJZA 4EYOA 3UJ7A 4ZZ0A 2QN7A 3LLCA 4NZ9A 5C8YF 2RAVA 3TZBA 1IPEA 2E21A 5E6UB 1WCIA 5BSVA 1UBGA 2HNBA 4NU0A 3ZW9A 3TEJA 1UC9A 3WQBA 4UUMA 4RMGA 3KYJB 3WYEA 3C14C 1WCV1 1YFKA 1TK9A 3NIBA 2Y2UA 4MQEB 2AN1A 5DHUA 1HUQA 2GN8A 3NIDB 1PHRA 4GECA 5AO9A 821PA 3NUGA 2Q29A 3I3SR 5EIBC 4K6GA 1ZH2A 2FPRA 4W8OA 3EEOA 7YASA 5B7NA 2C4TA 4JOSA 2V6JA 1YS6A 4GWKA 3Q15C 4WFKA 1UOQA 4OTZA 1YTLA 3W8RA 1NXPA 4WZBE 3MINA 4LOHA 5ESXA 5EESA 3CNBA 2FMFA 1TM4E 1LUAA 2JL1A 3HLYA 3KEQA 3QKIA 1ZH0A 2PVCA 3BJEA 2HFJA 3C2QA 3TVTA 4O4JB 1U6JA 2ODBA 4GVXA 4I08A 4YMGA 2I22A 5A5DA 2C5SA 3G5MA 3ID6C 5A1TA 2BFMA 1BYUA 2E1RA 2WU4A 4GZMA 2JLUA 1GKLA 3A8TA 4I14A 5GOZA 3UBTA 2FFAA 3DE5X 4HGNA 4BO8A 2OE2A 4QUJA 2IUTA 4ZOLA 4BFTA 2ATCA 1LSUA 1FFSA 1YU6A 4MJLA 3TNLA 1GTG1 4BQSA 3LYUA 2CUNA 2BHSA 2OBXA 4G0OA 2B5VA 3WFZA 1CUXA 2XAUA 1FJHA 4RL4A 3UB2A 3QE3A 1J21A 2B94A 2CYCA 5CLJA 1CE8B 3T7EA 4FKBA 2X8LA 4G0UA 2QLFA 5LLTA 1XKXA 4JJGA 5I45A 3KYDA 1G5RA 3R5SA 4L9WA 2H3HA 1AUPA 3WC4A 4D3FA 3LPNA 5JMTA 4KQ9A 4WVLA 1ULUA 1NQAO 3IEMA 4J4TA 3PYMA 1GR0A 2PL9A 3RS7A 2LCFA 4Q3DA 1J4AA 1EGVB 1ND6A 3P2OA 3VPAA 5IBQA 4GMHA 4UHHA 1SA0B 5HA5A 1KI7A 1AKRA 1GVHA 3FYUC 3PF9A 3QNMA 4YP1A 5KNCH 2Q2WA 5LA6B 4OHWA 4AJNA 1HZJA 4QIHA 1M2HA 1E7SA 3KFVA 4RV9A 5JY1A 1PBNA 2OQIA 2A0UA 3INRA 3VHQA 4R2JA 4C5CA 1TRKA 4MW7A 1AF4A 3OQIA 1CU1A 3PNLA 3ZY6A 2X1LA 3GNLA 4YCMA 4ZJUA 4HLCA 1H93A 1YXMA 4BE9A 1PL8A 4L07A 4FEGA 4C0WA 3EW7A 1Q50A 1OFIA 3UAGA 2ZVDA 2V59A 4KG7A 5KTRA 4AIRA 5KTKA 3VSDA 1ZIDA 1NVTA 1PSWA 4X71A 4ZAGA 3IEPA 2IHNA 3K0CC 2EKLA 4Q7QA 4C22A 2Q4DA 3K0BA 3PEFA 3QPWA 5DTJA 4FLEA 4FR2A 4IIYA 4X95A 4ZKEA 4DS3A 4E12A 2QQEA 3G5UA 1V8OA 3ADDA 4LJYA 2IXEA 2BE9A 3GFPA 2FFRA 3EZLA 2DFPA 3L1IA 4IYRA 4OHMA 3TR0A 1OZGA 1NRWA 5JQWA 3AXTA 1YB5A 1VTKA 3ZX4A 1VL0A 4GOOD 2UVQA 4Q1AA 1O96B 4HAOA 4C0JA 1JG4A 1Y8CA 4PHTA 4ENVA 2XNHA 3GLVA 1F2UB 1H42A 1Q22A 1VGQA 3DQQA 1OHHA 1S2MA 5KWJA 3S8YA 5IN5A 5IAJA 4DCUA 3MK31 3NYQA 1OFUX 1OXUA 2GF9A 3RU9A 3V7FA 5BMVB 4RULA 4X66B 1JJ7A 3DOOA 1WPQA 5LKRA 1P60A 4HLUC 3SE0A 3TSWA 3VQTA 2ID7A 3EQ7A 3IXMA 3EZGA 4LF5B 3GEIA 2H54A 3PICA 1CUBA 5JAMA 4G5GA 1VIMA 4U6QA 2CXUA 3G9TA 4BFZA 1Z6ZA 1PZNA 1GL9B 1IZ7A 2F1OA 1CHNA 1NF2A 4IRUB 1F20A 1X42A 4LXTA 4PYMA 3GEDA 4TL8A 5B1EA 1JFLA 3ZEIA 1EVZA 4CRWB 2FX3A 5LUBA 4MHSA 3LL4A 4R69A 3GFVA 2NOAA 4ZPXA 1YR2A 2NTVA 5B2FA 1MH9A 4OH7A 5C2JB 1I7SB 3ESCA 4F5YA 2DERA 3MINB 1TU4A 1UDRA 2K6GA 2NYRA 2WSMA 2GFIA 3HU3A 1C4XA 4B40A 3ICOA 1OX4B 3SG0A 4XWOA 3U4DA 3TRIA 2VYVD 4FDAA 2R86A 2XCTB 3KPVA 4E2FA 4MCAA 4E7OA 1NT4A 4YQYA 3HJFA 2YKGA 3ZK8A 3RB8A 4QRDA 2DMRA 2HU2A 4UVGA 5HG0A 3BL8A 1ZICA 3N2IA 4O2BB 1RI4A 3QPAA 3O4FA 5TJHA 4LFAB 4AXXA 1GP2A 1C81A 3BGWA 5EIOA 4CHTA 3X1WA 3I2GA 3TYXA 4CW7A 4K8OA 4WXEA 1UZUA 4MEBA 4KYUA 4RK1A 2CWDA 2QTVA 4Q48A 2FWMX 3DXFA 2ZSDA 3D8TA 4Y2RA 4HEQA 1UBOS 1MV5A 1AKEA 2P2ZA 1M2JA 3QEBZ 3ZXYA 2NUPA 3VR6A 3AXSA 1N6KA 3VNQA 4X54A 1AHNA 1ZM2A 1RYNA 3PNPA 4JLUA 5HK9A 3P94A 1X8XA 2WA2A 5CLHA 1FS6A 2MMGA 2C5HA 1B0UA 2C99A 1F0PA 5TMBA 4PGAA 4RORA 1WE2A 3K53A 3REQA 1PFYA 1K92A 1QDUA 2EEPA 1C4WA 6LDHA 1DAHA 2IYSA 2FX5A 2Q62A 3RTBA 2XX3A 3BVPA 4LRUA 3E35A 3EOAI 1HDEA 3ZQKA 2ZOSA 4MMYB 4TT8A 4WW0A 4FONA 2YVLA 4AB1A 1E0SA 1T5IA 2I6TA 3UK6A 2EWVA 3DBRB 1EZ4A 5BT9A 2DFNA 3ST7A 4EP1A 3N05A 2VZEA 5E6RA 3R8XA 3PIRA 1RQ2A 1OJLA 3O1JC 4IWXA 3SZOA 3VI4B 4TTVA 5B6PA 2WWTA 1SY7A 4HDMB 4IF6A 4CIYA 4RHCA 2XB6A 4JGGA 3GDHA 1NOKA 2EFEB 1TZJA 3HKBB 3JQ6A 4ECAA 1I7LA 5E4TA 1GQFA 2IP2A 4J94A 4B6PA 1MW9X 1GPBA 3CGGA 3KV1A 2XE7A 5D86A 5BSWA 1E9DA 2AXNA 4QPJC 3GN1A 4HRVA 1YI8A 5I9SA 3JASB 5JCJA 4UD2A 2VHTA 4WCFC 2N3ZA 1Z08A 2YWBA 1JLKA 4Q37A 4QULA 3ZTYA 1TJPB 3C41J 1RBZA 2OBYA 4PPNA 4CM5A 2R1VB 3X1YA 3HXLA 1JTFA 3G59A 4TYQA 3SXUA 1YL5A 2I1WA 3FPHA 1R9JA 2VSNA 5HILA 3AEUA 4TKUA 1HQCA 5KYGA 2RAFA 1UJCA 3B6EA 3DHVA 3A9SA 1SCIA 2FEXA 1R16A 3R3ZA 1YS9A 1IU9A 3CLSC 3M89A 4HGOA 3L4SO 3F5QA 1O94C 3HMKA 1DSSG 3NM6B 1RXVA 2GYYA 1XMXA 4MUKA 2BI4A 3GGOA 1SHTX 2QUBA 5DNEA 3TGPA 2R85A 1T6NA 2J46A 3HFJA 4Q39A 3W79A 4ROSA 4US1R 3BTOA 1ZRMA 4X1YA 3W1VA 3C6YA 1ZYUA 3JWJA 3OFKA 5K0TA 3HRKA 5K03A 5FRDA 1ZD8A 3GQBB 3GUCA 4OLJA 3UOGA 5IDXA 2PWYA 1IEXA 5FBQB 1VHQA 4EJSA 3BDVA 2ZWPA 3U7JA 1NVGA 1NC1A 2ZYHA 2GZDA 3N6VA 3NJ4A 5FAXA 2PGLA 2XQIA 4CG1A 1ZINA 2ZAIA 2FG7C 2GK6A 3FWPA 3IQZA 3O3NB 2C9BA 4PLFA 2OQRA 4TLAA 3RGWS 5DXFA 2WB2A 3EC1A 1IJKA 2IQIA 3NVDA 5LPNA 2ZYIA 3K0AA 4ZDWA 1ML3A 2Q7DA 1O89A 3NMUF 3H5VA 1RI2A 3P32A 1U65A 5IG2A 3NYRA 2P30A 4CMAA 3WB0A 3LNCA 1H2AS 3OMXA 1V1JA 5JXHA 4DCSA 1N7HA 3I9V1 1SJ9A 3FDXA 5JSZB 2GRUA 5I47A 3L8MA 2JGDB 2Q50A 1F8UA 5JFTA 5BPHA 3FJOA 1K9VF 2OGUA 3QHQA 3SR0A 1K8XB 3EUEA 1RE1A 4YRCA 5TSDA 4WLEA 1SZDA 3D81A 4H31A 1NVVQ 3BFJA 1W2WB 3L4BA 4LE1A 5FTNA 5LBTA 4HCJA 2V7BA 1UEJA 1VB5A 1N5LA 3I2FA 4J0QA 1MXFA 3ZYCA 4RTRA 4GR4A 3WL4A 1UK7A 5KDLA 2RFLA 3PT9A 1JB1A 4ZQBA 1P17A 3USES 3CLTC 5K5EA 1URPA 2VK8A 3NPAA 2WTMA 3ONNA 2HIAA 3ZHOA 4UASA 5K3OA 1W48A 3OOYA 3W5CA 4L73A 5EKDA 4TMTA 4PLVA 4NEGA 3X1XA 2FSIA 4BATA 4KDCA 1GU1A 4YCSA 2PUBA 4Q1FA 1CZOA 4HEJA 3PPIA 1JEYB 2PMCA 5CJJA 1W49A 2ZI6A 3CUWA 1HBJA 4N54A 1KYYA 2IUFA 2HY7A 5DXJA 3AKEA 1NQUA 3NIGB 3PUIA 1MAVA 4QE3A 2VUTA 1ADJA 1OSNA 3MWYW 4Q4AB 1Z07A 3E3LA 2A5LA 1XEXA 4L74A 4EB0A 4BKRA 5AVRA 2I4OA 5CX4A 1DE0A 2X8WA 2BMFA 2QQ0A 3O3OB 5ER9A 4R8VA 2Y3IA 4FN5A 3AUUA 3H2JA 3PDIA 2O8FB 1X7ZB 1CV2A 5AOAA 3HYTA 1PDWA 1VHJA 3H87A 1BMDA 3LGAA 1S1MA 3U6KA 3MJTA 1M72A 1VDZA 4MQMA 5K3EA 2M6KA 3BRWD 1CERA 1X19A 2Q99A 1GZ5A 3K8QA 1HFEL 3BD9A 4DA0A 1YOVB 1Z4MA 2OLKA 2ZYVX 5CM9C 3MS4A 1M6VB 2IELA 3BRWA 3PFIA 4R1UA 4UM5A 3D7SA 1EFUA 2JZOA 3B51X 4Y6OA 4ZI7F 5E2AA 1B16A 3ZN2A 1UC8A 1ODSA 1EFLA 4S1NA 2XAAA 5IW8A 4IGEA 3SM9A 3JYLA 1V3VA 2G63A 4WQMA 1PNRA 2B1IA 4Z99A 3VYSB 4YNBA 1WP9A 1JU9A 4MJ3A 4F7WA 2DLDA 1EA7A 2X5NA 5DBOA 2WV9A 4OHVA 5AK5A 1CS0A 3QPDA 4JMLA 4AO7A 4BMSA 1W6UA 3PC2A 5A9RA 4P3XA 2DC1A 1W5SA 2O0KA 4DNXA 4XRGA 4KO2S 1MVLA 2OO7A 1Y3FE 2FR0A 3KOYA 4M1QA 3RRMA 1ZRHA 1V7QA 3IOMA 3A06A 2JGRA 1L6RA 3UMVA 1GNQA 4LAFA 5FBHA 3ETGA 2VP0A 1QHEA 2GEFA 4ZHSA 1QQBA 1C9NA 4G09A 3ZDBA 4EMUA 2OCKA 5A0FA 5LD2C 3K8ZA 1W4RA 3TPFA 6Q21A 3CINA 3KS9A 1NBME 2V7PA 3N1UA 4N3GA 1PS8A 5LP6F 3NEPX 3C85A 3WLAA 3LUFA 1OILA 5TQVA 5JHHB 2NZVG 2AOVA 3VHLB