3KRJA

Cfms tyrosine kinase in complex with 4-cyano-1h-imidazole-2-carboxylic acid (2-cyclohex-1-enyl-4-piperidin-4-yl-phenyl)-amide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
318
structure length
304
Chain Sequence
PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKRPPGQLSSRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Macrophage colony-stimulating factor 1 receptor, Basic fibro
publication title Optimization of a Potent Class of Arylamide Colony-Stimulating Factor-1 Receptor Inhibitors Leading to Anti-inflammatory Clinical Candidate 4-Cyano-N-[2-(1-cyclohexen-1-yl)-4-[1-[(dimethylamino)acetyl]-4-piperidinyl]phenyl]-1H-imidazole-2-carboxamide (JNJ-28312141).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 304
sequence length 318
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3krjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3krjA01
2ITNA 3K5UA 4MNEA 4CFNA 3PRFA 5DI1A 3DAJA 4HVDA 2EXMA 4GH2A 3RINA 1WBOA 4MXAA 4D2VA 1NXKA 2A4LA 2JD5A 5BNJA 4YPDA 4U81A 3JXWA 3LXPA 2Y6MA 4G5JA 4MXOA 4EK3A 4AN3A 5HLNA 3P79A 4Y8DA 3R1QA 3ACKA 2HOGA 3KVXA 2BAKA 3OBGA 1KSWA 4G2FA 3R1NA 4RGJA 5EDQA 3CIKA 4EL9A 5CAOA 5HG5A 1ZMVA 1PMUA 4I3ZA 5HBJA 3SKCA 2O64A 2UW5A 1T46A 5KKRC 2QHMA 3H0ZA 5LMKC 2X1NA 4FVQA 1SZMA 5HO7A 4ANBA 4LMNA 5HKMA 5M56A 3N51A 2GDOA 3R8LA 4O7YA 4AQCA 3ZO4A 4FSYA 2VO6A 2WHBA 3R1YA 3QZFA 4W9XA 3DDPA 2I0YA 3A8WA 3OCSA 3NIEA 2OF4A 3VUGA 2W1FA 4FGRA 3AT3A 2A0CX 5JRSA 3VW8A 4O86A 3MYGA 4X0MA 3VS4A 1BMKA 3V6SA 3H4JA 4QQ5A 3KF4A 3QAME 3F5UA 4EOQA 4IBMA 4DG3E 2C6LA 1YRPA 2IZRA 4FSUA 5F1ZA 4FNZA 3HGKA 1XWSA 5BYYA 4F08A 2CPKE 1NVQA 5AWMA 4QMQA 1OKYA 2GSFA 3CC6A 1O6KA 3TM0A 1QMZA 2XNGA 1H4LA 1OBGA 5EQPA 2VU3A 2J0KA 2YIRA 3FZTA 2P2IA 4U40A 2CGUA 4H1MA 5KMKA 4CFVA 3UOLA 4F63A 2QO9A 2JKMA 2FH9A 4CZTA 1ZY4A 2ZV8A 3A7GA 4MQ2A 5LMBA 4HZRA 2OJGA 3SG8A 2KULA 3KN5A 1NW1A 3F7WA 3A4PA 3NVMB 5CZHA 5FGKA 3MH3A 4NM7A 2ZMCA 3VS0A 3HLLA 3A60A 3LLTA 5DT4A 1KE5A 4XBRA 2RFSA 2EB2A 2RFDA 2HXLA 3WZJA 3SAYA 3HKOA 2G2IA 2JITA 3JVRA 4RIWB 4FSMA 3L9NA 3ZRMA 5HU3A 2ACXA 5JH6A 1TQIA 3EH9A 4FYNA 2PVMA 3RAKA 4CFWA 4F6WA 1K2PA 4R3PA 1JWHA 4IX3A 2GPHA 5FTQA 4AA4A 5LMKA 3FPMA 4L68A 2UZWE 3AC1A 5LARA 3QTSA 5GIOE 1UKIA 5FP5A 3IOPA 5IKWA 1YWNA 2QNJA 4IH8A 2PMOX 2X8DA 2X4ZA 2Z7QA 3D83A 3V5WA 2XF0A 3SRVA 4BDCA 3R9DA 5HQ0A 5IEXA 3BE9A 4YHTA 4FG7A 2JC6A 4RG0A 4DEIA 4Q2AA 3TNPC 3VAPA 5M09A 2C69A 2Y6OA 4P5QA 3RK7A 4EK8A 3QWJA 4OTIA 4L00A 4TWNA 4DH3A 4UBAA 4E1ZA 4RLKA 4FIFA 4XV2A 2JKQA 2ITUA 3UPXA 4WD5A 4FUYA 5CSHA 3W8LA 1SNXA 1AQ1A 3MVHA 4KRCA 3LLAA 4IM0A 4X3FB 3V5PA 5JQ8A 2EXEA 4MAOA 3PE2A 5H9BA 3B2WA 3KRJA 4WUNA 3ZXTA 4TKSA 1NVSA 2VTTA 3JVSA 4IX4A 4J99A 1OITA 5DFPA 2WOTA 1LP4A 1BLXA 3ZFYA 3E93A 4OTQA 1Y8YA 5CU4A 5IQIA 5KNJA 1RW8A 4RJ4A 3FZ1A 3NX8A 5T6KA 3VUDA 1YKRA 3FBVA 4K18A 1BKXA 3P7BA 1CTPE 4U42A 3Q60A 5FM3A 4ZOGA 2BKZA 5KO1A 4U0IA 4WBOA 4YO6A 3KCFA 3ULIA 2CNVA 3CJGA 3N9XA 4RVKA 4EHVA 3QUDA 3ZFMA 3EQHA 1R0PA 3V04A 2X9EA 1J1BA 2HXQA 2R3KA 3PE1A 5E8TA 1ZARA 5IISA 1RJBA 2X9FA 3LXKA 3PRIA 4GRBA 2ITZA 3DS6A 4GFMA 3TWJA 3NCGA 3TNHA 2P2HA 2CCHA 4HPUE 2XNMA 3ORZA 2FSLX 5CEIA 1REKA 4L7SA 3REPA 1OIUA 2CHLA 4W4XA 3RZBA 2PVFA 4ANNA 3I7BA 4OAUC 1Y6BA 4CSVA 5DRDA 3GFEA 1ND4A 4ZS0A 4F1OA 4LL5A 3V8SA 4X3JA 1H27A 3UE4A 5D10A 3ZMMA 3UQFA 5TF9A 4Z7GA 2VTSA 4FV8A 3A4OX 3MH0A 2PZPA 5AP0A 2WKMA 5FD2A 3TZ9A 3R6XA 4NZWB 4ANSA 3E63A 1BX6A 4BDJA 3TXOA 3TUCA 2X0GA 3GQLA 4EK5A 4ALVA 5EHLA 3LMIA 1ZOGA 3O23A 3DZOA 2HZIA 4ALUA 3G0FA 1UA2A 4W8DA 3ZZEA 5C8NA 5C9CA 2YN8A 5IA3A 4EOKA 5IA0A 4J95A 5CTPA 2O2UA 3QWKA 5GHVA 4E6CA 3OZ6A 1UU8A 5CANA 3IW5A 2CJMA 1Y57A 3UQGA 4XMOA 3VIDA 1Z57A 5B7VA 3BU6A 4K11A 4EH2A 4BIEA 2PZRA 3GCPA 3PIZA 4YJQA 4AOTA 2JAMA 4EOMA 3AD6A 4LRKA 3HZTA 3UVQA 2BFYA 4DG0E 2X6EA 3DAEA 2BRNA 1ZRZA 3FWQA 5DIAA 4BZNA 4AOIA 3FLSA 1G3NA 4G31A 4FSNA 4DBXA 4MWIA 3W8QA 4B7TA 2IW8A 5KMLA 4O96A 1LPUA 4A9YA 5JFSA 5AEPA 2XEYA 3G33A 5M55A 2PVRA 4YHJA 3U4UA 4YJSA 3R2YA 5AUXA 4DGMA 4RX7A 3QHWA 2Z7RA 2FA2A 2XYUA 2FSTX 2PMLX 2XUUA 4RVMA 5EG3A 4DITA 4C0TA 4IC7A 4L3LA 4ACMA 1CM8A 3PJCA 3OBJA 1H0VA 4X2JA 3UP2A 3PVUA 4DG2E 2IVTA 2RIOA 5AAEA 2UZEA 5BVOA 3EOCA 4RC2A 2VD5A 4F0GA 3IPHA 4B4LA 3CGFA 5ANGA 1OL5A 3WE8A 4UYNA 2UVZA 4M14A 2UW4A 4AF3A 5HO8A 2ITVA 1H1RA 2XRWA 5TOZA 4ACCA 5J1VA 2O8YA 3MTLA 2BIYA 4I5CA 3R9RA 4HOKA 4DE4A 4C3FA 5HNBA 1HCKA 2VO7A 2W05A 2YCQA 4IJPA 4KB8A 1VJYA 4I4EA 3OWLA 3OHTA 3EHAA 4G17A 1SVHA 3CPBA 4RFMA 4O1PA 3E7OA 4MNFA 3HMIA 4C61A 4TZRA 5HVYA 4F9WA 5CF6A 4ZJJA 2BPMA 4QMNA 2PVLA 4BCOA 4XG3A 4CFUA 4R7HA 3NPCA 2F2UA 4FKUA 4EHEA 4ZSGA 2QOQA 3VW6A 2Z60A 3QD2B 3PP0A 2SRCA 3FI8A 4P90A 1VEBA 1OKZA 3HMPA 4LOOA 3BEGA 4XCUA 3RBWA 4HGLA 4BTFA 3G6HA 5CNOA 3UC4A 3E87A 2P33A 3W2CA 5BUIA 5IQDA 3TNIA 4A07A 2QQ7A 2YCFA 1Q62A 1AGWA 4RJ8A 3BWFA 2W99B 3C5IA 4L42A 4BFMA 3F3ZA 3PJ1A 4GIHA 1XH9A 3NIZA 3OOMA 3DDQA 4N70A 2J5EA 3I0OA 2YDKA 3GENA 1DS5A 1XH5A 2GNHA 2UZNA 3EKNA 4RJ5A 1MQBA 3BEAA 4J98A 1Q3WA 3BGQA 4XOZA 2QOIA 5BVEA 4F0FA 4YJOA 4NL0A 1CKIA 3ANRA 4QP4A 1WBSA 2WZJA 3DGKA 3RPOA 3EFJA 4K0YA 3TIZA 2DWBA 4IFGA 4QMXA 4WKQA 3TKHA 4YZCA 3PSDA 3R01A 4EOIA 2HW6A 4MBJA 4A4LA 5J1WA 3L8XA 4KNBA 2ITPA 3H30A 1OPKA 1UWHA 2XYNA 3NSZA 3VWAA 4S2ZA 5KCVA 2V5QA 3U6JA 5JQ5A 4ITIA 4M12A 4DINA 2QO2A 4FIJA 3RK5A 2BALA 4UMRA 4FEQA 2UW6A 2XS0A 4EH7A 3DB8A 3FZSA 4IDVA 2WIPA 2ZM4A 4BDFA 3ETAA 1TVOA 1FOTA 2JIIA 3FMEA 2FUMA 3IQ7A 3MI9A 4I21A 4B8LA 4CQGA 4A9UA 5LVOA 4NJ3A 4JNWA 2A2AA 2R9SA 3GVUA 2YAAA 4QMMA 4CFMA 2ZM3A 4IAKA 5CQWA 3RPYA 4CMOA 4ACHA 1PHKA 2VWBA 4LFIA 2V22A 1KOAA 4KABA 2OK1A 5M4IA 1JQHA 4BWKA 2O5KA 4Q5HA 3UVRA 4ZZNA 4BBEA 5KMJA 4R8QA 4PTEA 2WU7A 2JIUA 1IR3A 1K3AA 3FQHA 3G0EA 3PY1A 4G3CA 5G1XA 1SVEA 3KXHA 5E1EA 5LQFA 4M69A 1MP8A 3TNWA 4EOPA 1Q5KA 5F9EA 1QCFA 2B9HA 4PPAA 2WMBA 2UW0A 5J8IA 2UZTA 2X6DA 3CSVA 4R78A 5IQGA 4AZWA 3LHJA 4HVSA 3KVWA 5EK7A 3R8ZA 3SD0A 2VTJA 5AUUA 5ANEA 4BC6A 3ITZA 4RJ7A 4QMLA 1A48A 4AOJA 5AP4A 2GNGA 5C01A 4PDYA 3EL8A 4KRDA 3BELA 3KRXA 4D2WA 3Q52A 3TV7A 2NP8A 2F49A 3C4FA 4JRVA 2IVVA 4RIYA 1YHWA 5CSPA 3EB0A 5H2UA 2J51A 5EDPA 4U5JA 4D4VA 5C26A 4DFXE 4BDGA 4QMYA 4ZK5A 1GNGA 4FL1A 2EUFB 4GKIA 2XJ1A 3QL8A 3ZS5A 4UB7A 4RX9A 3HDNA 2PTKA 4RLLA 2B9JA 4QD6A 4UMTA 3ZLSA 1WZYA 1JKSA 2F57A 3NMUF 3KMMA 1QPJA 1RDQE 3Q4TA 5E7RA 4UZHA 5ANOA 3C4ZA 2PVYA 5AV4A 3FEGA 4JXFA 4U79A 4JG8A 4ZSLA 5AIKA 4APCA 3FJQE 3GC8A 3Q4UA 4OUCA 4RVLA 5AV0A 5HE2A 5E1SA 5L6WL 3HV3A 5D41A 2I40A 4U43A 2WMAA 1WFCA 4KIKB 3KCKA 2PMNX 1KE7A 5CF5A 2HW7A 2E9UA 5EI6A 3NW6A 3QYZA 4GU9A 4Q9ZA 4OT6A 4JAJA 2R3FA 3VULA 4EQCA 4ZTQA 1ZYDA 3ZBXA 4AUAA 3MFUA 2OJ9A 4FODA 4BTKA 4CG8A 2EXCX 3QD3A 3NUSA 4FIIA 4WSYA 4XP2A 2B52A 2YIWA 5ANKA 4PDOA 3EYGA 2Q0NA 3Q2JA 3FL4A 4DFZE 5LVNA 3P08A 3VBYA 4FV2A 4JDKA 4KD1A 4L45A 2VX1A 4FT5A 3P78A 2G1TA 3A99A 4O6LA 3LJ0A 5K9IA 5CY3A 3BU3A 4O7WA 4B99A 4KSQA 4FV3A 4IVDA 2C6DA 4XG9A 1M2RA 1P2AA 4RMZA 3DFAA 4F65A 3GGFA 2X7FA 5AR8A 1JPAA 4K8AA 3OCBA 4GYIA 4ASZA 4F9AA 4MYGA 4O82A 2UVYA 1H26A 1E1XA 1FPUA 2I6LA 3NYOA 4FKWA 3R8UA 4CYJA 3UNKA 3LFNA 2NO3A 1QPCA 1ZMWA 4EYJA 5JRQA 4E3CA 3D4QA 1JSVA 4FTRA 5EH0A 1YW2A 5F94A 1JVPP 2QLUA 4UX9A 3O51A 3JS2A 4E26A 2W1CA 3BX5A 3UZPA 3VQUA 5C8KA 1FMKA 4DLJA 4FTQA 4CTBA 5FQDC 1F0QA 4NUSA 1PRYA 4GKHA 4C7TA 3NVKI 4BY9E 5CNNA 2CGVA 3V3VA 3BLHA 4JIKA 1ZY5A 3R7VA 2NNWB 2R3PA 2JKKA 3NNWA 3NS9A 4Q9SA 3RHXA 2VWUA 4FKJA 4ZTMA 3KGAA 2VTLA 3M42A 1YI4A 3MVMA 4L3PA 2BFXA 4H58A 4XUFA 4YJRA 3WILA 5I9WA 4I23A 5HIEA 2GMXA 2YCRA 4QMSA 3GU7A 5FRIA 4XG8A 2IJMA 2YM3A 2ITYA 3LQ5A 5CU2A 1J7UA 4PX6A 3I5ZA 1JKLA 3VRYA 2QO7A 4NH1A 4X2FA 3UGCA 3WOWA 4C57A 3KK9A 4PPBA 5HNIX 3OTUA 2GFCA 4NWMA 3FLYA 1PYXA 4DEBA 3V8TA 2PE0A 4FX3A 5L8KA 1PF8A 2YLFA 5HG9A 1UVRA 4H3QA 3U9NA 1U46A 3T3VA 4NIFB 3UZRA 4F99A 1H1SA 2QKWB 4M97A 3GC0A 2C30A 4FC0A 3F5GA 4K2RA 3VBTA 4EH8A 1OM1A 1FGKA 3A7FA 3LJ1A 5J5TA 2XK4A 4X6QC 4RC3A 5JK3A 4IAZA 3PA3A 1P4OA 2HYYA 3M11A 4ITHA 4UALA 4ZXTA 4DEGA 2DYLA 4ZLZA 2OW3A 4C33A 5K4JA 2BAJA 3ZHPC 5K5NA 3PA4A 4PDSA 4OBOA 4L43A 3RK9A 3V5LA 3ROCA 1ZZLA 2RF9A 4FG8A 4O0YA 1ZYCA 3DKOA 1BL7A 3QKKA 4IM2A 4MD8E 3WZEA 3EQBA 4L67A 2JDVA 2QOBA 4BHNA 4BGQA 1NVRA 4DEEA 3MN3A 3LZBA 3ORPA 4O2ZA 3UBDA 4XV1A 2RKUA 2UZDA 3R2BA 5EYMA 2NPQA 1NY3A 2ESMA 2UVXA 4IB3A 3F88A 5BYLA 1FVRA 3R00A 3T9TA 4W9WA 4RT7A 2P55A 5GZAA 1ZAOA 3IW6A 4O21A 3G90X 5K0XA 1BI7A 4O0RA 4XG6A 4F7JA 2HELA 2WOUA 2BCJA 4NK9A 4B6LA 4YZNA 4AGUA 4R5SA 2C3IB 2GHLA 1FVTA 4JX7A 2XK8A 4WBBB 2JAVA 1WVWA 5CVGA 2WAJA 3DKFA 2XKEA 3DBQA 2HY81 1H00A 4BCKA 4E5WA 5LXMA 1A06A 1ZOEA 4DEAA 4I6BA 3KY2A 3PLSA 2BKKA 5DGZA 3DBDA 3ZCLA 3JPVA 3UIXA 4D1SA 2YCSA 3RVGA 2RGPA 4CRLA 2G2HA 2WQBA 3II5A 4HGSA 1QL6A 3VHEA 4F09A 4E6DA 3N4UA 3FMLA 4WG4A 4M68A 4PPCA 4YHFA 1Y91A 3PPKA 2ITWA 5AX3A 2V7OA 4UEUA 2J7TA 4FT7A 4L44A 4CCBA 3F2RA 4CLJA 4E20A 3NUUA 3EZVA 4TYJA 3RAWA 4I6HA 3MPTA 3LM0A 3F7ZA 4CZUA 3EN5A 4H1JA 3R0TA 4RIWA 4F0IA 2J2IB 4IHPA 3UZTA 4XG7A 3UVPA 4YBKA 4O38A 4BN1A 2KTYA 3VS3A 4EQMA 4YJPA 2BAQA 3I79A 1LEWA 3M2WA 3P0MA 5CSXA 1APME 4OR5A 4DCEA 5AR5A 3D7ZA 2HY0A 3KC3A 5IQFA 4IJ9A 4FTLA 5M06A 5CZIA 1W84A 2WELA 2XNEA 4BI0A 1ZXEA 3R1SA 3SVVA 3RCJA 3CTHA 2WIHA 3OY1A 1NT2A 1JAMA 1Z5MA 3BGZA 2VX3A 4U45A 2WTDA 2BZKB 4HZSA 2JGZA 3FSFA 1KWPA 3FXWA 2GFSA 3I4BA 3GCQA 3DOGA 2W4OA 3DK7A 5CENA 3ZC5A 3DCVA 4LRJA 1M52A 3DLZA 3DV3A 3QBNA 4MWHA 5HCYA 4TL0A 3QZHA 3AOXA 4GIIA 3DBEA 3N4VA 2FGIA 2R3RA 2ZB1A 4X3FA 5HLPA 4F9CA 4YURA 2ZDUA 4IIRA 3AT2A 4M3QA 3UC3A 3SG9A 4ERWA 4RJ3A 1ERKA 2I0VA 2OJFE 4C2VA 4FA2A 3N4TA 4HCUA 4FKVA 5IH4A 5HHWA 3G9LX 4AFEA 4GJ3A 3EQDA 4HGEA 5IUGA 5KUPA 5CAPA 3ZXZA 4Y72A 3FZOA 3VRZA 1JKTA 1TKIA 2GS2A 3O8TA 3VS5A 4CKJA 4IXPA 5EI8A 2YACA 3QC4A 4QMVA 5AAFA 3KK8A 4FBXA 3MV5A 4LUEA 4EWQA 4OGRA 3S2PA 1GZ8A 4JR7A 5I9XA 2QD9A 3B8RA 5AM7A 4EK4A 5DE2A 2BIKB 5IEVA 2W1GA 3QQKA 4FVRA 4IWDA 3PTGA 3VS1A 4NW6A 4XBUA 2BRGA 4ZSAA 3AGMA 3SXFA 2XEZA 3ALOA 4D1ZA 4EUUA 3QKMA 5HG8A 2VZ6A 4RZVA 3MW1A 2H9VA 1ZMUA 2X2LA 4NEUA 3DXQA 3OG7A 4JDHA 4QYHA 5AP6A 4ENXA 5JZNA 2WTKB 4O7VA 4O7LA 2WO6A 3HP5A 3KULA 4UWBA 5BVWA 4Z7HA 3TJCA 4H05A 3G51A 4F6UA 2A1AB 5I9UA 2JKOA 3F3TA 3FLWA 2R7BA 3TCPA 5JZJA 5BUJA 1PXMA 1YI3A 1IG1A 3SC1A 2BZHB 4RX5A 4FE2A 1U54A 4AU8A 1ZYLA 5DRBA 3VUIA 2IZSA 3W18A 4UN0C 4XOYA 3BBWA 3UG1A 5D7AA 4MEDA 3DKGA 3UMXA 1OIQA 2PY3A 4PMTA 4BB4A 3OT3A 1Q4LA 3FPQA 2YZAA 4DYMA 1LR4A 2UZVA 4FZ6A 3W2SA 2NRUA 2JFMA 3FLNC 3JYAA 4GVAA 4ZJVA 2LAVA 2HK5A 4GCJA 4MX9A 2C5OA 2V55A 3GU6A 3GCUA 4EONA 4IEBA 4RJ6A 3RNYA 3QXOA 3U54A 1KE9A 5A3XA 3DB6A 3QQGA 2V62A 3C13A 3FY0A 5CEPA 5E4HA 3CP9A 4JS8A 3K3JA 4FV7A 4DA5A 3MIYA 3BLRA 4IAFA 3F3VA 4BI2A 4E5BA 5HE0A 2BDFA 4PF4A 3QQFA 5FLFA 5DEYA 1W98A 4I0TA 1PXIA 5KE0A 3E62A 4BIDA 4UXQA 4G16A 5HORA 3DNEA 1W83A 3R7YA 4MXYA 3TKIA 3IKAA 3GI3A 3WF6A 2IW6A 4YSJA 2OBJA 3L8SA 5J9ZA 2Z7LA 1I44A 4FZFB 5HVKA 3W33A 3D15A 5HBHA 3KREA 3CEKA 2CNQA 4H3BA 3WYYA 4J53A 5ETCA 2XB7A 3ULZA 5CT7A 4QMZA 4CT1A 5FTGA 2WQMA 3CGOA 4HNFA 4G3GA 5C8MA 2W17A 4RSSA 5L6PA 3I6WA 5FEEA 5CAUA 3HAMA 4XRJA 1PMVA 5A4CA 4FIGA 4Y46A 2WXVA 3EJ1A 3CTQA 4EKKA 1YVJA 4HYSA 4JI9A 2PYWA 5M4UA 4WNPA 5JGDA 4C36A 3ZU7A 1H25A 3DU8A 4L9IA 4XP3A 1IRKA 2C5NA 3FKLA 4C3RA 2VWIA 4KUJA 3MB7A 1U4DA 3AGLA 4J8NA 3LCDA 4B8MA 2ERKA 4ZY5A 3T9IA 3U6HA 2CDZA 4XHKB 4MNEB 1HCLA 4LM5A 5IH6A 4LMUA 5M51A 4I6QA 3SLSA 5CU0A 1Y6AA 1WAKA 2JBOA 1PMEA 3GP0A 3OROA 4JLCA 2W4KA 4HYHA 5DR6A 3ZDUA 4QTDA 3P86A 4R1YA 2PVHA 5BMMA 3SV0A 3NW5A 3UIMA 1V0BA 2C6KA 1SVGA 4PY1A 3DPKA 4QQCA 2XCHA 2H96A 3MJ2A 2F4JA 3C1XA 4F1TA 2B53A 3POOA 4ENYA 4E4MA 4YJTA 5IPJA 4R6VA 3QTRA 4JRNA 1Q61A 4G6LA 4DH1A 4C62A 1BYGA 3D5UA 1WVYA 3GUBA 4TT7A 2BDWA 4F70A 3H10A 3LFCA 5L2IA 4S34A 3UJGA 2F7XE 3PVGA 4V0GB 3EIDA 3TNQB 4FKIA 5AMNA 3F2NA 3Q3BA 3KMUA 4FEVA 5AUYA 2VV9A 4WRSA 2UZLA 4KKEA 3M1SA 3V6RA 5KMIA 3KRWA 3BGPA 2C1AA 3UIUA 4EWHA 2YIXA 2BHHA 4CCUA 1YDRE 3KB7A 4LG4A 5HD4A 2X7OA 1YWVA 4MHAA 3CY2A 5HI2A 4IWQA 5CF8A 3IGGA 2XZSA 2X8IA 3V8WA 4GVJA 4WRGA 4C3PA 4RWIA 4QP3A 4MF0A 3ZZWA 5C4KA 4KKHA 4PUZA 3MESA 1PXNA 3AMAA 3TDWA 5LOHA 4WOVA 3BYVA 4AZTA 3NDMA 4R7BA 3BI6A 3L9PA 4XV3A 1R78A 4FKLA 4CMUA 2VNWA 4FSWA 5B2MA 5EHYA 1H08A 2YHVA 4ID7A 1W0XC 3HEGA 5IUIA 5DPVA 1QPEA 2QODA 3KXNA 3K3IA 4IB0A 4DEDA 3KMWA 2VTPA 5AP5A 3RWQA 5J7HA 3QC9A 4USFA 5DT3A 3OEZA 3MY5A 1G5SA 4YZ9A 2ZV2A 4PQNA 2YM7A 4PWNA 4U97A 4DAWA 1MRUA 2B1PA 1UWJA 4KIOA 5KX8A 4QP9A 4KBCA 4EK6A 4I20A 5FXQA 4AW2A 1RE8A 3W2RA 3P23A 4FOCA 4BDDA 4N6YA 2QCSA 5IQEA 3DJ7A 3DFCB 4O0UA 4RQVA 3AG9A 4RA5A 5KKRB 4G3EA 4QP8A 4XLIA 3WZKA 4K33A 3R04A 4O91A 4HNIA 3MA3A 1SMHA 3H9FA 3I5NA 1UNLA 4ANQA 2QURA 3JY9A 2FVDA 2VTIA 4YTFA 3KKVA 4TNBA 3R9NA 1LEZA 3SRVB 3C50A 3P4KA 2ETMA 2PE1A 3LOKA 1GAGA 4JQ7A 3E3BX 3L1SA 4K77A 4TTHB 4RWJA 4N0SA 4G9CA 4GL9A 5AV3A 4DGNA 3O17A 4QP7A 3I0QA 3JUHA 3O7LD 3ODZX 1OMWA 2X8EA 3F82A 3QCQA 3D2IA 2OXDA 3O50A 3ZSIA 4WT6A 4KBAA 4D55A 2YJSA 2CLXA 2P4IA 4AFJA 3EN6A 1JKKA 1UU7A 1ZWSA 4EUTA 4N57A 3O71A 4MBLA 2VX0A 4KS7A 3Q53A 5CI6A 5BVKA 3ALNA 4ONAA 2C5VA 3FMKA 3HV7A 3BHTA 4IQ6A 3HYHA 4A9TA 2XKFA 3VN9A 1VZOA 1XBCA 2B54A 3R71A 2WNTA 5ANDA 3ZONA 4BCQA 3EQRA 4QNAA 2OJIA 2RFEA 4KKGA 2BROA 3D94A 4RRVA 4OTRA 4R7IA 4E8AA 4F7SA 1URCA 3C51A 3KEXA 4IZ7A 3AMYA 4TWOA 5DMZA 2OWBA 5D12A 3UG2A 4JR3A 3HP2A 2JDSA 3CTJA 2Q0BA 2R3LA 3CCNA 2CSNA 3ZSGA 4BI1A 3MB6A 4B9DA 3G9NA 2IVSA 4FTNA 4IVCA 4F6SA 5J9YA 5HEZA 3U6IA 1GIJA 4EOSA 1JSUA 2PE2A 4KIKA 3WZDA 4ZTHA 2G9XA 2YWPA 3FQSA 3PXFA 2J6MA 2V0DA 4FNXA 4MD7E 5H8GA 4D2RA 1YOJA 4Y5HA 5E8WA 4U44A 5T3QA 4LUDA 2W1EA 1SNUA 1OUKA 5AIRA 1Q97A 3LXNA 4BL1A 4EKLA 1CKPA 3PPZA 2W1ZA 3EN4A 4I5HA 2IVUA 3P7CA 5L8JA 2YZLA 4QPMA 4BDEA 2PVJA 1Q41A 3UOKA 2XP2A 4DT9A 1E9HA 1REJA 5FUTA 4BDKA 4FKGA 3FHIA 4RFYA 3KQ7A 5CEMA 4FTOA 2W9FB 4IMYA 3P5KA 4XV9A 2GS7A 3MY1A 4V05A 3AT4A 5GZ8A 2WPAA 2W7XA 3KXMA 5H3QA 2YEXA 2R3OA 3OT8A 3NWWA 3PJ2A 5FXRA 5JFWA 4BKYA 4QTBA 3DT1A 3QRIA 4KA3A 4X6RA 3CXWA 3LAUA 5L2SA 4FZDB 3CR0A 5AV1A 3R21A 4DLIA 2FSOX 3BIZA 3PJ3A 1MRYA 1WBVA 3ZFXA 4EOOA 4O7TA 3AC3A 3FE3A 3MTFA 4N4SA 4GU6A 2H6DA 5JT2A 2GHGA 3ENHA 4ANOA 2IG7A 3OC1A 5HU9A 4CYIA 2RL5A 5L8LA 3HECA 2JFLA 3R28A 5GJGA 1F3MC 5DT0A 3QRKA 4O7NA 5ACKA 4I1ZA 5KBRA 2HAKA 3SGCA 4MH7A 3R83A 1BUHA 4FKRA 2X4FA 3DTCA 4YUQA 4GFGA 4FSTA 3BPRA 4C4FA 5EQYA 5A4EA 4H3PA 2BVAA 3VF9A 4AA0A 1XBBA 5BPYA 5D7VA 3S3IA 4GV1A 4FT3A 3TTIA 1Q8UA 1WMKA 2OKRA 4XEYA 3NNUA 5AP3A 3W2QA 2OXXA 4DH5A 1J7LA 2CNUA 3UO6A 3UTOA 4I94A 4YJVA 2J4ZA 5FM2A 3TUBA 1G8SA 2PUNA 3RGFA 4C8BA 4JOAA 2WMQA 3HDMA 3BU5A 3RI1A 4EH4A 4JBQA 4XRLA 4QYGA 3IW7A 3Q5ZA 4QP1A 4HVGA 4AACA 4RA4A 2FSMX 3QZIA 1H1QA 5L3AA 4JBVA 3IDCA 5HCXA 2QOKA 4A9RA 4JDIA 5CF4A 2W9ZB 2WMVA 3RNIA 5HICA 3WIKA 5HESA 4E73A 2R3NA 4JVGA 5GJFA 2C4GA 2WMUA 4RWKA 3QKLA 4DGLC 4W4VA 4PMSA 5FEQA 2Y4IB 5I9ZA 4LGGA 4BTJA 4FYOA 2J5FA 3D5WA 4FV4A 4I0RA 4Y85A 4CTCA 1XQZA 3ZM9A 4NIFA 2OLCA 2YM5A 3VBVA 2XK6A 2HZ0A 2UW9A 4M15A 1PYEA 2CGWA 1PJKA 3V5TA 1YXXA 3QALE 2PUIA 2Z02A 2X2KA 4ANMA 4O0SA 3WI6A 4LGHA 4DTKA 5L2QA 3UP7A 4Z16A 4BRXA 2B4SB 2GCDA 4NT4A 4LOPA 1Q99A 5IG1A 1YXVA 4FK3A 3ROYA 1GZOA 4KSPA 4BR3A 5J9LA 2HIWA 5HO6A 5ITAA 4UMUA 1UU3A 2GNJA 3S4QA 5EOLA 2W1DA 3ZUTA 4BICA 2H8HA 1H28A 3D0EA 2B55A 3GBZA 3H0YA 5TE0A 4O7ZA 5AP1A 3D5VA 2WTWA 3KFAA 1JLUE 2GQRA 2YERA 4ZY4A 2BR1A 3L9MA 2VWWA 4YMJA 2Q83A 1F5QA 2UUEA 2W96B 4O0XA 5H8BA 5DBXA 4YTIA 3WF5A 4TW9A 2OFVA 1FVVA 4FSRA 3MIAA 3ORLA 4IANA 3UNJA 3TUDA 4AT5A 4DEHA 3A61A 5ANJA 4ZLYA 5DG5A 3IGOA 5HZNA 4HYUA 3D7TB 4J7BA 4MXCA 3GU5A 1R39A 1Z9XA 2RFNA 2PWLA 3CJFA 3HA6A 4FV5A 4BBFA 2OZAB 4PL3A 4C34A 4EBVA 1YXTA 1OI9A 3IG7A 2XM8A 5CEKA 3DA6A 4CKRA 5M44A 4OTDA 4QYFA 5F4NA 2JDTA 2YDIA 3BHVA 4USDA 3ZYAA 1OGUA 1PXPA 5J5SA 4YC6A 3TEIA 5E91A 3CQUA 2OH4A 3OWKA 4FNYA 3FY2A 3QD0A 4MD9E 1OVEA 2PZIA 4GMYA 3FMMA 5CU3A 3B2TA 2XNPA 4CQEA 4PP7A 4QO9A 4I41A 3LM5A 5E8YA 5KHWA 2UW7A 2W0JA 3O2MA 4ZEGA 4DH7A 4R1VA 5CSWA 4RVTA 1XH7A 5GNKA 2BRHA 2PMIA 4R3RA 4AA5A 4DTAA 5HTIA 3E3PA 4JDJA 4CG9A 2VTOA 4IAYA 5FEDA 2QOLA 3FAAA 3O0GA 4FTCA 4LV8A 3ATTA 4MQ1A 3QA0A 1XBAA 4IC8A 3BV3A 3IO7A 3Q9ZA 4MF1A 3KN6A 4KIPA 2IW9A 3TI1A 4PMPA 5DH3A 3F5XA 3GOPA 2B0QA 2QR8A 3EMGA 4M84A 2R7IA 4QTCA 2C6TA 3D2KA 4G5PA 4TYHB 3QYWA 3F69A 3H9OA 5HE1A 2R0UA 5ETFA 1URWA 2QG7A 4BCMA 1KV2A 4DFLA 3QUPA 3KL8A 1WBPA 4M69B 4WG3A 3W16A 3ZDIA 5FTOA 3OXZA 2UV2A 4RIXB 3JR1A 3A7JA 4EBWA 3I1AA 4R5YA 2PVNA 5H8EA 3BRBA 5BUEA 4LQMA 5ICPA 4WHZA 5DA3A 3PY3A 4AW5A 2YLEA 3OXIA 3VQHA 3C0HA 3LCKA 3KRLA 4EOLA 3LFAA 3DAKA 4FEWA 2Y8OA 3Q4ZA 4PMMA 1XJDA 4XS2A 3R7UA 4BDIA 5K5XA 1IASA 4K6ZA 4M0YA 2VTNA 2VWZA 2O65A 2WMTA 3COKA 5EM6A 3Q9WA 4NFNA 4J97A 2B9FA 2UZOA 4Z55A 3L8VA 4WA9A 1XH4A 5CI7A 2CGXA 4IE9A 4A7CA 2I0HA 4CV8A 4FEXA 3FMHA 1MQ4A 5CVHA 3QTXA 4ASXA 4ANLA 4I22A 3F2AA 3E7VA 3RAIA 5K3YA 4KIQA 5AA8A 2X7GA 3QCSA 2BMCA 4UV0A 1XHAA 3DQXA 2XM9A 2OG8A 4EHGA 3UMWA 3Q96A 3LIJA 4HJOA 2C0OA 1UNGA 4USEA 2PL0A 3PXZA 3EFLA 2AC3A 3ORIA 2DS1A 2JDOA 2REIA 5L4QA 5IDNA 2PU8A 3GC7A 1M2PA 4L52A 4YGAA 1Q8TA 4D5KA 3DKCA 4IWOA 2WMRA 2XIZA 2AC5A 2XNBA 1ZZ2A 2YISA 3NUYA 1FQ1B 4TPTA 3ZLXA 2X81A 3D5XA 4CXAA 3U51A 2R3JA 4WNOA 4D9UA 5M57A 3SA0A 3TKUA 4AP7A 4ZSJA 1T45A 3GCVA 5A4TA 3UO5A 3DZQA 2WB8A 2YIQA 3EQGA 3MVJA 3ZC6A 4FKTA 2WMWA 4J8MA 5AUWA 4BCJA 5DHJA 4M0ZA 4PV0A 4DH8A 3BE2A 3MBLA 5HLWA 4BGHA 1W8CA 1KUTA 4H36A 4FTMA 4EC8A 3MDYA 3RHKA 4CKIA 5I9VA 5JKGA 4L7FA 3RM7A 3TTJA 5CASA 2R64A 1IA9A 4U80A 4FKSA 4UWCA 3NUNA 4JG6A 3AQVA 3KXXA 3Q04A 3QU0A 3VF8A 4X3FC 4BYIA 2Z2WA 4WUAA 2E9PA 2XK7A 3I81A 3ORKA 3MFSA 3WARA 3WYXA 4YJUA 3NAYA 4AN2A 1JBPE 4GK2A 4F9YA 2WTVA 3A2CA 2V7AA 3IDPA 3RALA 1JOWB 3PSCA 2PZ5A 4XLVA 3BHYA 1UV5A 1KE8A 4WIHA 3SW4A 3THBA 3W1FA 2QU5A 3NEWA 4D5HA 3ET7A 5AA9A 3VUHA 5DYJA 3GT8A 1M14A 2XKDA 4TYGA 4EH9A 5C4LA 3TZ8A 3QX2A 4QRCA 4IB5A 3ZLWA 5M07A 4IX5A 2ERZE 3MGYA 5CEOA 3KU2A 1V1KA 2VO3A 3GQIA 2VTQA 3SOCA 3ZLYA 3QLFA 4YTHA 5D9HA 1OBDA 3U55A 3ORXA 5LVMA 5EYKA 3TACA 3TT0A 3NUAA 3VUTA 4EORA 3KXZA 4RPVA 4FG9A 3BV2A 3OUKA 2QVSE 3PIYA 5AM6A 3OUNB 2FO0A 3RCDA 4RBLA 3FZRA 1R3CA 4Y83A 2OGVA 3TJDA 5BX0A 4OAVB 3VHKA 2W5HA 1ZYSA 4W4WA 4ZJIA 1MRVA 4OW8A 3ID6C 3E8EA 3FSKA 4FT9A 3COHA 4AE6A 4NTTA 3LPBA 1S9IA 2B7AA 3OWPA 4JL9A 3V01A 4YZDA 3AC8A 4C35A 4Z3VA 3QFVA 5M53A 4ZZOA 2CKOA 2QC6A 5B0XA 4M8TA 3PVWA 1Y8GA 2ITTA 3C4EA 4WNKA 3TV4A 4S32A 1TQMA 3G2FA 4LOQA 2YM6A 4FV9A 3WF8A 4AGCA 4C38A 3RPVA 5A4LA 4FOBA 4RFZA 3PVBA 3HL7A 2XJ2A 1H07A 3A7IA 3VS6A 2W4JA 1AD5A 1PKGA 2QI8A 2XIYA 2OXYA 4GYGA 3TN8A 5IZFA 4YP8A 3EZRA 3F9NA 4A9SA 4O2PA 4MTAA 3W55A 4YTCA 2C6MA 3FMNA 4LRMA 4ZLOA 3C4CA 3EQCA 4IVBA 3IW4A 5AP2A 1B6CB 3ZTXA 4FKPA 5IQHA 1Q3DA 1H8FA 1YXSA 1IAJA 4YC3A 2WFYA 3G5DA 4IW0A 3ZSHA 2X2MA 3SX9A 3ZEPA 4P7EA 3Q4CA 4WG5A 2WU6A 5E8SA 3PFQA 4NM3A 4EC9A 2PUPA 3EQFA 4GJ2A 4X7QA 4DFYA 2ETKA 5IA4A 2CKQA 2UZBA 5CLPA 4QMUA 3FLQA 3QGWA 2XRUA 4YO4A 4E4LA 4FKQA 3KF7A 4AZSA 4BIBA 4J1RA 4A4XA 3LCOA 3FQEA 2C6EA 3NAXA 5A9UA 4BBMA 1B39A 2XIKA 3QCYA 2YAKA 3CD8A 1FGIA 4FF8A 4J96A 4NW5A 5CVFA 4D58A 5J87A 2JDRA 4QTAA 1OZ1A 3Q6WA 4X2KA 2GNLA 1GIHA 1P5EA 5CS6A 2XA4A 4ZP5A 4V0GA 5AR7A 4QT1A 1SYKA 1H0WA 1OIRA 4RC4A 5FDXA 5HD7A 4YZMA 1OL7A 2GU8A 4FKOA 2VTAA 5IQAA 3PXRA 4CNHA 3QX4A 3DK3A 3FMDA 4O1OA 1GJOA 4AS0A 3FL5A 5EKNA 1J7IA 4MXZA 5HNGA 2QLQA 2RSVA 2GS6A 3R8MA 4F7NA 4DT8A 3G6GA 2YWVA 3NCZA 2O0UA 2WTCA 3LJ2A 4U8ZA 4PRJA 3RMFA 1HOWA 1O6YA 3HA8A 3BQCA 2I7QA 3PYYA 5TKDA 3CD3A 4K1BA 3CS9A 3NYNA 1XH6A 4JJRA 3GB2A 4ERKA 4PTGA 4U3ZA 3R8PA 2R3HA 2WMSA 4FUXA 4E4NA 5J79A 2ZDTA 3GC9A 4FL2A 4V04A 5TO8A 3C4XA 4FZ7A 1ZYJA 2VTRA 3VVHA 4AAAA 4FV1A 4F9BA 5C1QB 4IVAA 4EYMA 4QOXA 4BDHA 4EH3A 2AUHA 5DLSA 4CRSA 3GXLA 2CMWA 3OCTA 2E2BA 3GU8A 4L6QA 4M13A 3RM6A 3UNZA 1CSNA 1YWRA 4CGAA 3QXPA 1R0EA 4ZSEA 3F6XA 3S0OA 1OL2A 3LMGA 4TXCA 5FP6A 4BKZA 5CT0A 4CD0A 3R7EA 2OJJA 4LL0A 3UODA 1A9UA 2YFXA 3G15A 2C3JA 4OTFA 5EM5A 2WMXA 5EW3A 3QLGA 4G34A 3K2LA 4HPTE 4RIOA 5DNRA 3MPMA 3O8UA 4AXAA 1DI8A 3BYUA 4U3YA 4QPSA 4QQJA 4HVIA 4ZMFA 3GOKA 4IAAA 4PTCA 4TWCA 2J0IA 4CFXA 4CVAA 2EB3A 3CLYA 3BQRA 4YNOA 1CKJA 4C37A 3DXNA 5I4NA 1V0OA 3PLAE 2XIXA 3UOJA 5IQCA 4L46A 4QPAA 4TWPA 4QMWA 1ATPE 5E8VA 3ATSA 3JY0A 1YQJA 2W1IA 3PG1A 4O27B 4XP0A 2VAGA 3R63A 1FBNA 3EFWA 3IS5A 3NYVA 4EOJA 3FUPA 5CSVA 3GNIB 4F7LA 3L9LA 5I0BA 5CALA 1OL1A 3QTUA 5LVLA 2HWOA 4BHZA 3OVVA 4L8MA 3AD5A 3COIA 3UYTA 3DK6A 4CT2A 4BF2A 4FTUA 4MKCA 2ITQA 4PNKA 5HGIA 2XBAA 4GG5A 3PXYA 2QKRA 1U5QA 2YDJA 2ZV7A 4XX9A 3ZRKA 4C2WA 4O83A 4S31A 3BYOA 2W1HA 4BCPA 3LFDA 3NUPA 4RZWA 3W2PA 2CN8A 4YLJA 5IUHA 2XK3A 5M4CA 5DN3A 4ACGA 3LMHA 4D2PA 5KMMA 2C0IA 4G9RA 4MK0A 4D0WA 4IX6A 3LE6A 4IACA 2IPXA 3SHEA 3W32A 2W06A 5JFVA 3VNTA 2QU6A 3P1AA 3PIXA 4A06A 3FI3A 4OBPA 4FTJA 1U5RA 2R2PA 1PY5A 2WEIA 2ETRA 3HUBA 3I60A 3DLSA 3MFTA 5FBOA 5AX9A 4UXLA 3T3UA 4KS8A 4PP9A 2Y7JA 4X2GA 3GCSA 4F4PA 4IAIA 3BYMA 5EM7A 3MWUA 3TL8A 3ZO3A 1XKKA 2ITOA 5CU6A 4HYIA 3F3WA 3VBQA 5L2TA 2Y4PA 3S1HA 5EW9A 3NRMA 1V0PA 4DFUA 2F9GA 4HCVA 3A8XA 4EHZA 4FK6A 5CYIA 2C5YA 2R3QA 3QA8A 4AW0A 3HMMA 3A62A 1L3RE 2VTHA 4FR4A 3R7GA 1YDTE 3OS3A 3TDVA 3KULB 4FIEA 4NM0A 4EH5A 3V5JA 2WEVA 3POZA 1STCE 1OIYA 1OUYA 3OWJA 4UMQA 3ERKA 3FYKX 4J71A 3HX4A 5B2KA 5AADA 4EJ7A 4AZVA 4U7ZA 1OKVA 4GFOA 2H34A 2RG6A 3U8WA 3HRCA 5A46A 3AC2A 3RPSA 3WF9A 2C0TA 4U9AA 2Y4IC 1U54B 5EDRA 2QONA 4GUEA 3I6UA 3PG3A 4JIAA 2J50A 3OD6X 2VWVA 5IF1A 3FKOA 4HCTA 5GJDA 4AGDA 4RQKA 5IA1A 3UPZA 1G8AA 3OY3A 3R9OA 3ZO2A 2QG5A 4CZYB 4IZYA 5CEQA 4FTTA 3EFKA 5HIBA 4OBQA 2C3KA 5C03A 3K5VA 4O7RA 5L2WA 2EVAA 3IDBA 3QHRA 3QUEA 5DOSA 3RPRA 3HV4A 4XG2A 4PNIA 3MH2A 3Q32A 5AUTA 3NNVA 4JAIA 3OCGA 2Z7SA 3QQLA 4M67A 3NYXA 5CX9A 3E64A 2ZYBA 4QYYA 4KAOA 5FDPA 3EQPA 4MXXA 1H1PA 2I0EA 4YNEA 4JBOA 3R30A 4AT4A 2O63A 2ZVAA 3EL7A 2BILB 4G3FA 4IM3A 2HCKA 4LI5A 5HE3A 3LFBA 5BMSA 5JGAA 3DXPA 5A6NA 2FYSA 4JQEA 3W10A 1PXJA 3TZ7A 1S9JA 1O9UA 4DTBA 5DWRA 3EN9A 3LQ8A 4NSTA 3ZUUA 1J3HA 3QF9A 4FICA 3EKKA 2PK9A 4BCFA 3C4WA 1BL6A 2OU7A 1GIIA 2XCKA 4F64A 5JMSA 4O81A 5CQUA 4ZS4A 3TZMA 4QYEA 2W5AA 3R9HA 4F1MA 2J0JA 2WTIA 1WBTA 4FNWA 3D14A 5LWMA 5ACBC 4FZAB 4TYEA 4Y73A 4YLKA 4DC2A 3MJ1A 5E8XA 5HVJA 4ZAUA 1XO2B 2EU9A 2XKCA 4K9YA 3CKWA 5HCZA 3MA6A 3PXQA 5KMNA 3IOKA 2YJRA 4YLLA 4DGOA 3OMVA 5HTCA 1UKHA 5AP7A 1QPDA 2HZNA 2XNNA 5HBEA 3U4WA 5EYCA 5FG8A 3VJOA 3IW8A 4Y5QA 3LFFA 3EYHA 2OIQA 5BYZA 3ZH8A 2VNYA 1RQQA 4TNDA 1Q8ZA 4D4RA 3FC2A 3TG1A 4EQUA 4FT0A 4H39A 4FMQA 1XH8A 4RWLA 3F3UA 4BCIA 2ITXA 4G3DA 4C4IA 2HZ4A 4PL4A 4NYEA 3UIBA 3PP1A 1OPJA 3FV8A 5E8ZA 3HV6A 3FI2A 2O3PA 2XH5A 4EI4A 4GG7A 2C3LA 2BTRA 5BVDA 5L6OA 4DFBA 1X8BA 3SXRA 1PXOA 3ORTA 3SW7A 2A27A 3AMBA 4L3JA 4D2TA 2VTMA 3H9RA 4IWPA 5AR4A 3NW7A 4S33A 5FBNC 4ACDA 3VUMA 4I6FA 2JIVA 2C6IA 2VGPA 4KBKA 2BTSA 2A19B 2F7ZE 5EOBA 1M2QA 2GQGA 3FLZA 4KINA 3Q6UA 4MCVA 2BRMA 3DJ6A 3F61A 4OLIA 4XG4A 3RZFA 4EZ5A 4J52A 4BCGA 5BVFA 3D7TA 1GZNA 3FC1X 2XMYA 3UQCA 3CQWA 4QMOA 3CQEA 4AW1A 2BDJA 3BYSA 4FTIA 2OZAA 4AN9A 1YOLA 3HRFA 2OI4X 2J0LA 4JBPA 3RKBA 1CMKE 3KXGA 4E4XA 3LCSA 5D1JA 4RX8A 4GW8A 2GTNA 1WCCA 3QTWA 5LJJA 3FHRA 4FIHA 3QCXA 3BZ3A 2RG5A 2C5XA 4I4FA 5FWKK 3ZUVA 4S30A 4D2SA 2JBPA 1OL6A 2F2CB 3BHUA 5KZ0A 3SXSA 2FB8A 3C9WA 4YPSA 3C7QA 3DQWA 3LXLA 3PA5A 1PW2A 5AR3A 2HWPA 1YOMA 1M17A 2R0IA 3OW3A 4X2NA 4U41A 5I9YA 1H1WA 2BUJA 2PZYA 3NR9A 4ZMEA 4GSBA 3UDBA 5DR2A 4AZEA 4M66A 5CWZA 1CDKA 1XR1A 3K54A 2W5BA 3PWYA 2DQ7X 4PL5A 3ANQA 5GINE 4BYJA 4DHFA 4O6EA 3COMA 5KZIA 1OPLA 3O96A 5E8UA 4BGGA 3ZOSA 3B8QA 3HRBA 2OFUA 1VR2A 4LGDA 2XK9A 3C5UA 4TYHA 3NUXA 3ZBFA 4GS6A 2E9NA 4GUBA 4ZY6A 5DVRA 1W82A 2PHKA 3KRRA 3HVCA 4RIXA 3QGYA 2C6OA 4I0SA 4UZDA 1UNHA 5JEBA 2VN9A 4QQTA 3DBCA 4DBNA 4AG8A 1PXKA 2WQOA 1J91A 3AC4A 3LFEA 4AGWA 2WQNA 4R3CA 2ZM1A 3C0IA 1NA7A 3D9VA 2CKEA 4AT3A 4D4YA 1DAYA 2UW3A 4FV6A 4ALWA 4BDBA 3PSBA 2CN5A 2R4BA 3P7AA 3WBLA 2G2FA 2YM4A 4W8EA 3VJNA 4BTMA 4I93A 3DY7A 5EW8A 3WE4A 1YHSA 5HX6A 5AJQA 5LVPA 5EKOA 2R5TA 2OF2A 3QQJA 4O0TA 4CEGA 4FSZA 2BRBA 2AYPA 2OIDA 3LW0A 3GU4A 4OTGA 4YR8A 4I24A 3MPAA 5KHXA 2PPQA 4E93A 1GOLA 3WF7A 4B0GA 4DGGA 3EWHA 5AFVA 1O6LA 4P4CA 5A6OA 1UU9A 5I3RA 2R3GA 4TN6A 5JFXA 4CLIA 1VYWA 5A4QA 2QOFA 4YU2A 4APPA 4EEVA 3V5QA 4OTPA 4D28A 3HMOA 4FTKA 5BQ0A 2WD1A 3QRUA 5IH5A 3R22A 4XNEA 4WSQA 2GNFA 2YABA 2XIRA 5HTBA 1U59A 5LCJA 5AUZA 2VWXA 2ZAZA 5TR6A 2IO6A 3E8CA 3MH1A 5EYDA 2B9IA 4II5A 5IMXA 3HMNA 4EJNA 3T8OA 1IA8A 1P4FA 5M08A 3RWPA 4HW7A 5CXZA 4QMTA 3UOHA 4NM5A 4OTWA 5K0KA 3FXXA 4GK4A 4ZIMA 2J0MB 4NKAA 4NU1A 4CV9A 4A4OA 1Q8YA 1H24A 4FTAA 4N6ZA 3ZM4A 3I7CA 3VBXA 3U87A 3CKXA 2JLDA 3BBTB 4BCNA 4C4GA 3PZHA 3UYSA 3RP9A 2CLQA 4BVUA 4BZOA 5AAGA 3EN7A 5LWNA 5ANIA 5KMOA 4QP2A 5AV2A 4R77A 1B38A 3NZ0A 4PDPA 4ASEA 1YDSE 2LGCA 2F7EE 3AC5A 3CPCA 3Q9YA 4HVHA 3V51A 5HIDA 4EH6A 3ZEWA 1YHVA 3VO3A 2CCIA 5CXHA 3ZRLA 4YBJA 2XBJA 5ETAA 4BWXA 1DM2A 1ZOHA 4M7IA 1OKWA 5EM8A 3TIYA 3EQIA 3CBLA 5B2LA 3OF0A 2QHNA 3BWJA 4ORKA 3R7OA 5FXSA 2C1BA 3E8NA 5EI2A 2NRYA 4NTSA 1WVXA 2ONLC 4IFCA 3DBFA 2E9OA 3BLQA 2OZOA 2UZUE 4JX3A 1M7QA 2XJ0A 3C0GA 1Q8WA 1OECA 2IZTA 3O8PA 5E90A 5TT7A 4C4HA 3PDTA 2YA9A 2QOOA 4FL3A 4FVPA 2ZJWA 4UYAA 2GTMA 1KV1A 4XH6A 4ZTSA 4D0XA 3ORNA 5EHOA 1R1WA 4MBIA 1BI8A 3OTVA 5IA5A 4IZ5A 4E5AX 4DF3A 3OW4A 1I09A 1PMNA 3LVPA 3HV5A 3GEQA 2WQEA 4Z9LA 5GZ9A 4CFFA 4DFNA 4DN5A 3CY3A 3LFQA 2X39A 3ODYX 4AWIA 2CKPA 2IWIA 4FI1A 4AZFA 4ZTLA 1DAWA 2WTKC 4W4YA 2PUUA 3VBWA 1IAHA 4HGTA 2BHEA 2OO8X 5IQBA 3PZEA 3MFRA 5HG7A 4O7SA 4GT3A 2HENA 4NKSA 3HNGA 3QTZA 1VYZA 3PPJA 3P9JA 4Q5EA 4QMPA 3W2OA 4L53A 5AUVA 5IEYA 2I1MA 1PKDA 3BCEA 1H01A 5ETIA 3DTWA 3MVLA 2PULA 4BDAA 4UMPA 2JEDA 5I3OA 3VC4A 5CAQA 5DR9A 2VGOA 3NLBA 4ARKA 3QD4A 3TV6A 4GEOA 3SOAA 1JNKA 3E88A 4NCTC 4D9TA 4RIYB 4E7WA 2ZMDA 3R02A 4FGBA 5AR2A 3FKNA 4IDTA 2J9MA 2YM8A 5DEWA 3ACJA 4EZ3A 4O0VA 5JN2A 4BCHA 5E92A 2WGJA 4AX8A 4G6OA 2ONLA 3Q2MA 1FINA 3A7HA 2DUVA 3KA0A 3PY0A 4GT5A 3QRJA 4BKJA 1KE6A 3VS2A 5A54A 2IN6A 2GQSA 2VRXA 3VS7A 5A14A 1J1CA 5IDPA 5JSMA 5EFQA 2XVDA 3E5AA 4TYIA 5LMAA 3GFWA 3OEFX 4D4SA 3OFMA 1KOBA 2C68A 2OICA 3DNDA 4LV5A 5IU2A 4TRLA 3DJ5A 1E1VA 4FEUA 3ORMA 3FYJX 4BWPA 4YJNA 1ZLTA 4ZTNA 3NNXA 5KBQA 5BVNA 4IZAA 3LQ3A 4CMTA 4O84A 3F66A 1TQPA 4XYFA 1MUOA 2Z8CA 4O22A 2EWAA 3AXWA 5CAVA 5IA2A 4C4JA 2VUWA 1DI9A 2P0CA 4G6NA 2OH0E 4AE9A 2YIYA 3QTQA 3S00A 3Q5IA 4FV0A 4BZDA 4JT3A 1WBNA 1OB3A 3IK3A 3MY0A 5J7BA 3SDJA 4ZZMA 1GY3A 4MVFA 1M7NA 4I5PA 3LKMA 3FDNA 3FMJA 2PSQA 1EH4A 2ZB0A 4I92A 4JG7A 5F95A 4JQ8A 4C58A 3AD4A 4GK3A 3E92A 4EZ7A 4C59A 5IMEA 3NGAA 2R3MA 3QZGA 3O7LB 4XJ0A 4DCAA 5E9EA 2UW8A 3HUCA 4G1WA 2QR7A 4IB1A 3R7IA 4I5MA 1W7HA 2R3IA 1WBWA 3WZUA 4O0WA 4NCTA 4U6RA 3E8DA 4UWYA 3UO4A 5EQEA 2VWYA 3ENMA 4V01A 3QQUA 5M4FA 2GHMA 2XNOA 3HAVA 1PXLA 4KWPA 2E9VA 4X21A 3LCTA 2ZOQA 4GT4A 1GZKA 2IZUA 3QTIA 1FMOE 2Y9QA 3OXTA 4ASDA 4Y95A 4E6QA 3R8VA 3OOGA 4IADA 5T68A 5D11A 5K4IA 3ZO1A 4WNMA 4TY1A 3R73A 4P2KA 3RAHA 4L01A 2BZIB 2J90A 3IECA 3BKBA 2QOCA 3CE3A 3F5PA 5F20A 4OT5A 2GNIA 4YSMA 1YI6A 3IONA 2C47A 3FI4A 4NFMA 1SM2A 2G01A 3FZPA 4WO5A 2P3GX 1P14A 2OIBA 3BHHA 3ELJA 3QQHA 3H3CA 3RTPA 4D1XA 1K9AA 2BZJA 3U9CA 5I5ZA 5JGBA 1YXUA 4QTEA 3Q9XA 4ZTRA 5GIPE 3PUPA 1JSTA 3QRTA 2YITA 2OSCA 2ZV9A 3OP5A 4P5ZA 4QP6A 4E6AA 3FXZA 4UY9A 1L8TA 3LFSA 1IEPA 3PJ8A 4C4EA 4LYNA 2G15A 4FSQA 1LUFA 2QOHA 3WIGA 5J95A 3RJCA 4NJDA 3S95A 4YZBA 3VUKA 2Y0AA 3MS9A 3L8PA 3PWDA 3PXKA 5LCKA 5G6VA 4C02A 4QNYA 5HX8A 2PVKA 5C27A 1Q24A 2VO0A 4YC8A 5HOAA 2WTJA 3SQQA 4OTHA 3MSSA 4ITJA
chains in the Genus database with same CATH superfamily
2ITNA 3K5UA 4MNEA 4CFNA 3PRFA 5DI1A 3DAJA 4HVDA 2EXMA 4GH2A 3RINA 1WBOA 4MXAA 4D2VA 1NXKA 2A4LA 2JD5A 5BNJA 4YPDA 4U81A 3JXWA 3LXPA 2Y6MA 4G5JA 4MXOA 4EK3A 4AN3A 5HLNA 3P79A 4Y8DA 3R1QA 3ACKA 2HOGA 3KVXA 2BAKA 3OBGA 1KSWA 4G2FA 3R1NA 4O4FA 4RGJA 3CIKA 5EDQA 4EL9A 5CAOA 5HG5A 1ZMVA 1PMUA 4I3ZA 5HBJA 3SKCA 4QEBA 2O64A 2UW5A 1T46A 5KKRC 2QHMA 3H0ZA 5LMKC 2X1NA 4FVQA 1SZMA 5HO7A 4ANBA 3KIOC 4LMNA 5HKMA 5M56A 3N51A 2GDOA 3R8LA 4O7YA 3W0SA 4AQCA 3ZO4A 4FSYA 2VO6A 2WHBA 3R1YA 3QZFA 4W9XA 3DDPA 2I0YA 3A8WA 3OCSA 3NIEA 2OF4A 3VUGA 2W1FA 4FGRA 3AT3A 2A0CX 5JRSA 3VW8A 4O86A 3MYGA 4X0MA 3VS4A 1BMKA 3V6SA 3H4JA 4QQ5A 3KF4A 3QAME 3F5UA 4EOQA 4IBMA 4DG3E 2C6LA 1YRPA 2IZRA 4FSUA 5F1ZA 4FNZA 3HGKA 1XWSA 5BYYA 4F08A 2CPKE 1NVQA 5AWMA 4QMQA 1OKYA 2GSFA 3CC6A 1O6KA 3TM0A 1QMZA 2XNGA 1H4LA 1OBGA 5EQPA 2VU3A 2J0KA 2YIRA 3FZTA 2P2IA 4U40A 2CGUA 4H1MA 5KMKA 4CFVA 3UOLA 4F63A 2QO9A 2JKMA 3VONA 3TMOA 2FH9A 4CZTA 1ZY4A 2ZV8A 3A7GA 4MQ2A 5LMBA 4HZRA 2OJGA 3SG8A 2KULA 3KN5A 1NW1A 3F7WA 3A4PA 3NVMB 5CZHA 5FGKA 3MH3A 4NM7A 2ZMCA 3VS0A 3HLLA 3A60A 3LLTA 5DT4A 1KE5A 4XBRA 2RFSA 2EB2A 2RFDA 2HXLA 3WZJA 3SAYA 3HKOA 2G2IA 2JITA 3JVRA 4RIWB 4FSMA 3L9NA 3ZRMA 5HU3A 2ACXA 5JH6A 1TQIA 3EH9A 4FYNA 2PVMA 3RAKA 4CFWA 4F6WA 1K2PA 4R3PA 1JWHA 4IX3A 2GPHA 5FTQA 4AA4A 5LMKA 3FPMA 4L68A 2UZWE 3AC1A 5LARA 3QTSA 5GIOE 1UKIA 5FP5A 3IOPA 5IKWA 1YWNA 2QNJA 4IH8A 2PMOX 2X8DA 2X4ZA 2Z7QA 3D83A 3V5WA 2XF0A 3SRVA 4BDCA 3R9DA 5HQ0A 5IEXA 3BE9A 4YHTA 4FG7A 2JC6A 4RG0A 4DEIA 4Q2AA 3TNPC 3VAPA 5M09A 2C69A 2Y6OA 4P5QA 3RK7A 4EK8A 3QWJA 4OTIA 4L00A 4TWNA 4DH3A 4UBAA 4E1ZA 4RLKA 4FIFA 4XV2A 2JKQA 2ITUA 3UPXA 4WD5A 4FUYA 5CSHA 3W8LA 1SNXA 1AQ1A 3MVHA 4KRCA 3LLAA 4IM0A 4X3FB 3V5PA 5JQ8A 2EXEA 4MAOA 3PE2A 5H9BA 3B2WA 3KRJA 4WUNA 3ZXTA 4TKSA 1NVSA 2VTTA 3JVSA 4IX4A 4J99A 1OITA 5DFPA 2WOTA 1LP4A 1BLXA 3ZFYA 3E93A 4OTQA 1Y8YA 5CU4A 5IQIA 5KNJA 1RW8A 4RJ4A 3FZ1A 3NX8A 5T6KA 3VUDA 1YKRA 3FBVA 4K18A 1BKXA 3P7BA 2IF8A 1CTPE 4U42A 3Q60A 5FM3A 4ZOGA 2BKZA 5KO1A 4U0IA 4WBOA 4YO6A 3KCFA 3ULIA 2CNVA 3CJGA 3N9XA 4RVKA 4EHVA 3QUDA 3ZFMA 3EQHA 1R0PA 3V04A 2X9EA 1J1BA 2HXQA 2R3KA 3PE1A 5E8TA 1ZARA 5IISA 1RJBA 2X9FA 3LXKA 3PRIA 4GRBA 2ITZA 3DS6A 4GFMA 3TWJA 3NCGA 3TNHA 2P2HA 2CCHA 4HPUE 2XNMA 3ORZA 2FSLX 5CEIA 1REKA 4L7SA 3REPA 1OIUA 2CHLA 4W4XA 3RZBA 2PVFA 4ANNA 3I7BA 4OAUC 1Y6BA 4CSVA 5DRDA 3GFEA 2XALA 1ND4A 4ZS0A 4F1OA 4LL5A 3V8SA 4X3JA 1H27A 3UE4A 5D10A 3ZMMA 3UQFA 5TF9A 4Z7GA 2VTSA 4FV8A 3A4OX 3MH0A 2PZPA 5AP0A 2WKMA 5FD2A 3TZ9A 3R6XA 4NZWB 4ANSA 3E63A 1BX6A 4BDJA 3TXOA 3TUCA 2X0GA 3GQLA 4EK5A 4ALVA 5EHLA 3LMIA 1ZOGA 3O23A 3DZOA 2HZIA 4ALUA 3G0FA 1UA2A 4W8DA 3ZZEA 5C8NA 5C9CA 2YN8A 5IA3A 4EOKA 5IA0A 4J95A 5CTPA 2O2UA 3QWKA 5GHVA 4E6CA 3OZ6A 1UU8A 5CANA 3IW5A 2CJMA 1Y57A 3UQGA 4XMOA 3VIDA 1Z57A 5B7VA 3BU6A 4K11A 4EH2A 4BIEA 2PZRA 3GCPA 3PIZA 4YJQA 4AOTA 2JAMA 4EOMA 3AD6A 4LRKA 3HZTA 3UVQA 2BFYA 4DG0E 2X6EA 3DAEA 2BRNA 1ZRZA 3FWQA 5DIAA 4BZNA 4AOIA 3FLSA 1G3NA 4G31A 4FSNA 4DBXA 1TZDA 4MWIA 3W8QA 4B7TA 2IW8A 5KMLA 4O96A 1LPUA 4A9YA 5JFSA 5AEPA 2XEYA 3G33A 5M55A 2PVRA 4YHJA 3U4UA 4YJSA 3R2YA 5AUXA 4DGMA 4RX7A 3QHWA 2Z7RA 2FA2A 2XYUA 2FSTX 2PMLX 2XUUA 4RVMA 5EG3A 4DITA 4C0TA 4IC7A 4L3LA 4DHIB 4ACMA 1CM8A 3PJCA 3OBJA 1H0VA 4X2JA 3UP2A 3PVUA 4DG2E 2IVTA 2RIOA 5AAEA 2UZEA 5BVOA 3EOCA 4RC2A 2VD5A 4F0GA 3IPHA 4B4LA 3CGFA 5ANGA 1OL5A 3WE8A 4UYNA 2UVZA 4M14A 2UW4A 4AF3A 5HO8A 2ITVA 1H1RA 2XRWA 5TOZA 4ACCA 5J1VA 2O8YA 3MTLA 2BIYA 4I5CA 3R9RA 4HOKA 4DE4A 4C3FA 5HNBA 1HCKA 2VO7A 2W05A 2YCQA 4IJPA 4KB8A 1VJYA 4I4EA 3OWLA 3OHTA 2X0OA 3EHAA 4G17A 1SVHA 3CPBA 3W0NA 4RFMA 4O1PA 3E7OA 4MNFA 3HMIA 4C61A 4TZRA 5HVYA 4F9WA 5CF6A 4ZJJA 2BPMA 4QMNA 2PVLA 4BCOA 4XG3A 4CFUA 4R7HA 3NPCA 2F2UA 4FKUA 4EHEA 4ZSGA 2QOQA 3VW6A 2Z60A 3QD2B 3PP0A 2SRCA 3FI8A 4P90A 1VEBA 1OKZA 3HMPA 4LOOA 3BEGA 4XCUA 3RBWA 4HGLA 4BTFA 3G6HA 5CNOA 3UC4A 3E87A 2P33A 3W2CA 5BUIA 5IQDA 3TNIA 4FJVA 4A07A 2QQ7A 2YCFA 1Q62A 1AGWA 4RJ8A 3BWFA 2W99B 3C5IA 4L42A 4BFMA 3F3ZA 3PJ1A 4GIHA 1XH9A 3NIZA 3OOMA 3DDQA 4N70A 2J5EA 3I0OA 2YDKA 3GENA 1DS5A 1XH5A 2GNHA 2UZNA 3EKNA 4RJ5A 1MQBA 3BEAA 4J98A 1Q3WA 3BGQA 4XOZA 2QOIA 5BVEA 4F0FA 4YJOA 4NL0A 1CKIA 3ANRA 4QP4A 1WBSA 2WZJA 3DGKA 3RPOA 3EFJA 4K0YA 3TIZA 2DWBA 4IFGA 4AXDA 4QMXA 4WKQA 3TKHA 4YZCA 3PSDA 3R01A 4EOIA 2HW6A 4MBJA 4A4LA 5J1WA 3L8XA 4KNBA 2ITPA 3H30A 1OPKA 1UWHA 2XYNA 3NSZA 3VWAA 4S2ZA 5KCVA 2V5QA 4FRFA 3U6JA 5JQ5A 4ITIA 4M12A 4DINA 2QO2A 4FIJA 3RK5A 2BALA 4UMRA 4FEQA 2UW6A 2XS0A 4EH7A 3DB8A 3FZSA 4IDVA 2WIPA 2ZM4A 4BDFA 3ETAA 1TVOA 1FOTA 2JIIA 3FMEA 2FUMA 3IQ7A 3MI9A 4I21A 4B8LA 4CQGA 4A9UA 5LVOA 4NJ3A 4JNWA 2A2AA 2R9SA 3GVUA 2YAAA 4QMMA 4CFMA 2ZM3A 4IAKA 5CQWA 3RPYA 4CMOA 4ACHA 1PHKA 2VWBA 4LFIA 2V22A 1KOAA 4KABA 2OK1A 5M4IA 1JQHA 4BWKA 2O5KA 4Q5HA 3UVRA 4ZZNA 4BBEA 5KMJA 4R8QA 4PTEA 2WU7A 2JIUA 1IR3A 1K3AA 3FQHA 3G0EA 3PY1A 4G3CA 5G1XA 1SVEA 3KXHA 5E1EA 5LQFA 4M69A 1MP8A 3TNWA 4EOPA 1Q5KA 5F9EA 1QCFA 2B9HA 4PPAA 2WMBA 2UW0A 5J8IA 2UZTA 2X6DA 3CSVA 4R78A 5IQGA 4AZWA 3LHJA 4HVSA 3KVWA 5EK7A 3R8ZA 3SD0A 2VTJA 5AUUA 5ANEA 4BC6A 3ITZA 4RJ7A 4QMLA 1A48A 4AOJA 5AP4A 2GNGA 5C01A 4PDYA 3EL8A 4KRDA 3BELA 3KRXA 4D2WA 3Q52A 3TV7A 2NP8A 2F49A 3C4FA 4JRVA 2IVVA 4RIYA 3W0OA 1YHWA 5CSPA 3EB0A 5H2UA 2J51A 5EDPA 4U5JA 4D4VA 5C26A 4DFXE 4BDGA 4QMYA 4ZK5A 1GNGA 4FL1A 2EUFB 4GKIA 2XJ1A 3QL8A 3ZS5A 4UB7A 4RX9A 3HDNA 2PTKA 4RLLA 2B9JA 4QD6A 4UMTA 3ZLSA 1WZYA 1JKSA 2F57A 3NMUF 3KMMA 1QPJA 1RDQE 3Q4TA 5E7RA 4UZHA 5ANOA 3C4ZA 2PVYA 5AV4A 3FEGA 4JXFA 4U79A 4JG8A 4ZSLA 5AIKA 4APCA 3FJQE 3GC8A 3Q4UA 4OUCA 4RVLA 5AV0A 5HE2A 5E1SA 5L6WL 3HV3A 5D41A 2I40A 4U43A 2WMAA 1WFCA 4KIKB 3KCKA 2PMNX 1KE7A 5CF5A 2HW7A 2E9UA 5EI6A 3NW6A 3QYZA 4GU9A 4Q9ZA 4OT6A 4JAJA 2R3FA 3VULA 4EQCA 4ZTQA 1ZYDA 3ZBXA 4AUAA 3MFUA 2OJ9A 4FODA 4BTKA 4CG8A 2EXCX 3QD3A 3NUSA 4FIIA 4WSYA 4XP2A 2B52A 2YIWA 5ANKA 4PDOA 3EYGA 2Q0NA 3Q2JA 3FL4A 4I6LA 4DFZE 5LVNA 3P08A 3VBYA 4FV2A 4JDKA 4KD1A 4L45A 2VX1A 4FT5A 3P78A 2G1TA 3A99A 4O6LA 3LJ0A 5K9IA 5CY3A 3BU3A 4O7WA 4B99A 4KSQA 4FV3A 4IVDA 2C6DA 4XG9A 1M2RA 1P2AA 4RMZA 3DFAA 4F65A 3GGFA 2X7FA 5AR8A 1JPAA 4K8AA 4QDVA 3OCBA 4GYIA 4ASZA 4F9AA 4MYGA 4O82A 2UVYA 1H26A 1E1XA 1FPUA 2I6LA 3NYOA 4FKWA 3R8UA 4CYJA 3UNKA 3LFNA 2NO3A 1QPCA 1ZMWA 4EYJA 5JRQA 4E3CA 3D4QA 1JSVA 4FTRA 5EH0A 1YW2A 5F94A 1JVPP 2QLUA 4UX9A 3O51A 3JS2A 4E26A 2W1CA 3BX5A 3UZPA 3VQUA 5C8KA 1FMKA 4DLJA 4FTQA 4CTBA 5FQDC 1F0QA 4NUSA 1PRYA 4GKHA 4C7TA 3NVKI 4BY9E 5CNNA 2CGVA 3V3VA 3BLHA 4JIKA 1ZY5A 3R7VA 2NNWB 2R3PA 2JKKA 3NNWA 3NS9A 4Q9SA 3RHXA 2VWUA 4FKJA 4ZTMA 3KGAA 2VTLA 3M42A 1YI4A 3MVMA 4L3PA 3O5AA 2BFXA 4H58A 4XUFA 4YJRA 3WILA 5I9WA 4I23A 5HIEA 2GMXA 2YCRA 4QMSA 3GU7A 5FRIA 4XG8A 2IJMA 2YM3A 2ITYA 3LQ5A 5CU2A 1J7UA 4PX6A 3I5ZA 1JKLA 3VRYA 2QO7A 4NH1A 4X2FA 3UGCA 3WOWA 4C57A 3KK9A 4PPBA 5HNIX 3OTUA 2GFCA 4NWMA 3FLYA 1PYXA 4DEBA 3V8TA 2PE0A 4FX3A 4AQKA 5L8KA 1PF8A 2YLFA 5HG9A 1UVRA 4H3QA 3U9NA 1U46A 3T3VA 4NIFB 3UZRA 4F99A 1H1SA 2QKWB 4M97A 3GC0A 2C30A 4FC0A 3F5GA 4K2RA 3VBTA 4EH8A 1OM1A 1FGKA 3A7FA 3LJ1A 5J5TA 2XK4A 4X6QC 4RC3A 5JK3A 4IAZA 3PA3A 1P4OA 2HYYA 3M11A 4ITHA 4UALA 4ZXTA 4DEGA 2DYLA 4ZLZA 2OW3A 4C33A 5K4JA 2BAJA 3ZHPC 5K5NA 3PA4A 4PDSA 4OBOA 4L43A 3RK9A 3V5LA 3ROCA 1ZZLA 2RF9A 4FG8A 4O0YA 1ZYCA 3DKOA 1BL7A 3QKKA 4IM2A 4MD8E 3WZEA 3EQBA 4L67A 2JDVA 2QOBA 4BHNA 4BGQA 1NVRA 4DEEA 3MN3A 3LZBA 3ORPA 4O2ZA 3UBDA 4XV1A 2RKUA 2UZDA 3R2BA 5EYMA 2NPQA 1NY3A 2ESMA 2UVXA 4IB3A 3F88A 5BYLA 1FVRA 3R00A 3T9TA 4W9WA 4RT7A 2P55A 5GZAA 1ZAOA 3IW6A 4O21A 3G90X 5K0XA 1BI7A 4O0RA 4XG6A 4F7JA 2HELA 2WOUA 2BCJA 4NK9A 4B6LA 4YZNA 4AGUA 4R5SA 2C3IB 2GHLA 1FVTA 4JX7A 2XK8A 4WBBB 2JAVA 1WVWA 5CVGA 2WAJA 3DKFA 2XKEA 3DBQA 2HY81 1H00A 4BCKA 4E5WA 5LXMA 1A06A 1ZOEA 4DEAA 4I6BA 3KY2A 3PLSA 2BKKA 5DGZA 3DBDA 3ZCLA 3JPVA 3UIXA 4D1SA 2YCSA 3RVGA 2RGPA 4CRLA 2G2HA 2WQBA 3II5A 4HGSA 1QL6A 3VHEA 4F09A 4E6DA 3N4UA 3FMLA 4WG4A 4M68A 4PPCA 4YHFA 1Y91A 3PPKA 2ITWA 5AX3A 2V7OA 4UEUA 2X0QA 2J7TA 4FT7A 4L44A 4CCBA 3F2RA 4CLJA 4E20A 3NUUA 3EZVA 4TYJA 3RAWA 4I6HA 3MPTA 3LM0A 3F7ZA 4CZUA 3EN5A 2XAOA 4H1JA 3R0TA 4RIWA 4F0IA 2J2IB 4IHPA 3UZTA 4XG7A 3UVPA 4YBKA 4O38A 4BN1A 2KTYA 3VS3A 4EQMA 4YJPA 2BAQA 3I79A 1LEWA 3M2WA 3P0MA 5CSXA 1APME 4OR5A 4DCEA 5AR5A 3D7ZA 2HY0A 3KC3A 5IQFA 4IJ9A 4FTLA 5M06A 5CZIA 1W84A 2WELA 2XNEA 4BI0A 1ZXEA 3R1SA 3SVVA 3RCJA 3CTHA 2WIHA 3OY1A 1NT2A 1JAMA 1Z5MA 3BGZA 2VX3A 4U45A 2WTDA 2BZKB 4HZSA 2JGZA 3FSFA 1KWPA 3FXWA 2GFSA 3I4BA 3GCQA 3DOGA 2W4OA 3DK7A 5CENA 3ZC5A 3DCVA 4LRJA 1M52A 3DLZA 3DV3A 3QBNA 4MWHA 5HCYA 4TL0A 1OGYA 3QZHA 3AOXA 4GIIA 3DBEA 3N4VA 2FGIA 2R3RA 2ZB1A 4X3FA 5HLPA 4F9CA 4YURA 2ZDUA 4IIRA 3AT2A 4M3QA 3UC3A 3SG9A 4ERWA 4RJ3A 1ERKA 2I0VA 2OJFE 4C2VA 4FA2A 3N4TA 4HCUA 4FKVA 5IH4A 5HHWA 3G9LX 4AFEA 4GJ3A 3EQDA 4HGEA 5IUGA 5KUPA 5CAPA 1W2FA 3ZXZA 4Y72A 3FZOA 3VRZA 1JKTA 1TKIA 2GS2A 3O8TA 3VS5A 4CKJA 4IXPA 5EI8A 2YACA 3QC4A 4QMVA 5AAFA 3KK8A 4FBXA 3MV5A 4LUEA 4EWQA 4OGRA 3S2PA 1GZ8A 4JR7A 5I9XA 2QD9A 3B8RA 5AM7A 4EK4A 5DE2A 2BIKB 5IEVA 2W1GA 3QQKA 4FVRA 4IWDA 3PTGA 3VS1A 4NW6A 4XBUA 2BRGA 4ZSAA 3AGMA 3SXFA 2XEZA 3ALOA 4D1ZA 4EUUA 3QKMA 5HG8A 2VZ6A 4RZVA 3MW1A 2H9VA 1ZMUA 2X2LA 4NEUA 3DXQA 3OG7A 4JDHA 4QYHA 5AP6A 4ENXA 5JZNA 2WTKB 4O7VA 4O7LA 2WO6A 3HP5A 3KULA 4UWBA 5BVWA 4Z7HA 3TJCA 4H05A 3G51A 4F6UA 2A1AB 5I9UA 2JKOA 3F3TA 3FLWA 2R7BA 3TCPA 5JZJA 5BUJA 1PXMA 1YI3A 1IG1A 3SC1A 2BZHB 4RX5A 4FE2A 1U54A 4AU8A 1ZYLA 5DRBA 3VUIA 2IZSA 3W18A 4UN0C 4XOYA 2XARA 3BBWA 3UG1A 5D7AA 4MEDA 3DKGA 3UMXA 1OIQA 2PY3A 4PMTA 4BB4A 3OT3A 1Q4LA 3FPQA 2YZAA 4DYMA 1LR4A 2UZVA 4FZ6A 3W2SA 2NRUA 2JFMA 3FLNC 3JYAA 4GVAA 4ZJVA 2LAVA 2HK5A 4GCJA 4MX9A 2C5OA 2V55A 3GU6A 3GCUA 4EONA 4IEBA 4RJ6A 4O4CA 3RNYA 3QXOA 3U54A 1KE9A 5A3XA 3DB6A 3QQGA 2V62A 3C13A 3FY0A 5CEPA 5E4HA 3CP9A 4JS8A 3K3JA 4FV7A 4DA5A 3MIYA 3BLRA 4IAFA 3F3VA 4BI2A 4E5BA 5HE0A 2BDFA 4PF4A 3QQFA 5FLFA 5DEYA 1W98A 4I0TA 1PXIA 5KE0A 3E62A 4BIDA 4UXQA 4G16A 5HORA 3DNEA 1W83A 3R7YA 4MXYA 3TKIA 3IKAA 3GI3A 3WF6A 2IW6A 4YSJA 2OBJA 3L8SA 5J9ZA 2Z7LA 1I44A 4FZFB 5HVKA 3W33A 3D15A 5HBHA 3KREA 3CEKA 2CNQA 4H3BA 3WYYA 4J53A 5ETCA 2XB7A 3ULZA 5CT7A 4QMZA 4CT1A 5FTGA 2WQMA 3CGOA 4HNFA 4G3GA 5C8MA 2W17A 4RSSA 5L6PA 3I6WA 5FEEA 5CAUA 3HAMA 4XRJA 1PMVA 5A4CA 4FIGA 4Y46A 2WXVA 3EJ1A 3CTQA 4EKKA 1YVJA 4HYSA 4JI9A 2PYWA 5M4UA 4WNPA 5JGDA 4C36A 3ZU7A 1H25A 3DU8A 4AAYA 4L9IA 4XP3A 1IRKA 2C5NA 3FKLA 4C3RA 4DHZA 2VWIA 4KUJA 3MB7A 1U4DA 3AGLA 4J8NA 3LCDA 4B8MA 2ERKA 4ZY5A 3T9IA 3U6HA 2CDZA 4XHKB 4MNEB 1HCLA 4LM5A 5IH6A 4LMUA 5M51A 4I6QA 3SLSA 5CU0A 1Y6AA 1WAKA 2JBOA 1PMEA 3GP0A 3OROA 4JLCA 2W4KA 4HYHA 5DR6A 3ZDUA 4QTDA 3P86A 4R1YA 2PVHA 5BMMA 3SV0A 3NW5A 3UIMA 1V0BA 2C6KA 1SVGA 4PY1A 3DPKA 4QQCA 2XCHA 2H96A 3MJ2A 2F4JA 3C1XA 4F1TA 2B53A 3POOA 4ENYA 3UDZA 4E4MA 4YJTA 5IPJA 4R6VA 3QTRA 4JRNA 1Q61A 4G6LA 4DH1A 4C62A 1BYGA 3D5UA 1WVYA 3GUBA 4TT7A 2BDWA 4F70A 3H10A 3LFCA 5L2IA 4S34A 3UJGA 2F7XE 3PVGA 4V0GB 3EIDA 3TNQB 4FKIA 5AMNA 3F2NA 3Q3BA 3KMUA 4FEVA 5AUYA 2VV9A 4WRSA 2UZLA 4KKEA 3M1SA 3V6RA 5KMIA 3KRWA 3BGPA 2C1AA 3UIUA 4EWHA 2YIXA 2BHHA 4CCUA 1YDRE 3KB7A 4LG4A 5HD4A 2X7OA 1YWVA 4MHAA 3CY2A 5HI2A 4IWQA 5CF8A 3IGGA 4BJJB 2XZSA 2X8IA 3V8WA 4GVJA 4WRGA 4C3PA 4RWIA 4QP3A 4MF0A 3ZZWA 5C4KA 4KKHA 4PUZA 3MESA 1PXNA 3AMAA 3TYKA 3TDWA 5LOHA 4WOVA 3BYVA 4AZTA 3NDMA 4R7BA 3BI6A 3L9PA 4XV3A 1R78A 4FKLA 4CMUA 2VNWA 4FSWA 5B2MA 5EHYA 4LV7A 1H08A 2YHVA 4ID7A 1W0XC 3HEGA 5IUIA 5DPVA 3NFGB 1QPEA 2QODA 3KXNA 3K3IA 4IB0A 4DEDA 3KMWA 2VTPA 5AP5A 3RWQA 5J7HA 3QC9A 4USFA 5DT3A 3OEZA 3MY5A 1G5SA 4YZ9A 2X0PA 2ZV2A 4PQNA 2YM7A 4PWNA 4U97A 4DAWA 1MRUA 2B1PA 1UWJA 4KIOA 5KX8A 4QP9A 4KBCA 4EK6A 4I20A 5FXQA 4AW2A 1RE8A 3W2RA 3P23A 4FOCA 4BDDA 4N6YA 2QCSA 5IQEA 3DJ7A 3DFCB 4O0UA 4RQVA 3AG9A 4RA5A 5KKRB 4G3EA 4QP8A 4XLIA 3WZKA 3W0PA 4K33A 3R04A 4O91A 4HNIA 3MA3A 1SMHA 3H9FA 3I5NA 1UNLA 4ANQA 2QURA 3JY9A 2FVDA 2VTIA 4YTFA 3KKVA 4TNBA 3R9NA 1LEZA 3SRVB 3C50A 3P4KA 2ETMA 2PE1A 3LOKA 1GAGA 4JQ7A 3E3BX 3L1SA 4K77A 4TTHB 4RWJA 4N0SA 4G9CA 4GL9A 5AV3A 4DGNA 3O17A 4QP7A 3I0QA 3JUHA 3O7LD 3ODZX 1OMWA 2X8EA 3F82A 3QCQA 3D2IA 2OXDA 3O50A 3ZSIA 4WT6A 4KBAA 4D55A 2YJSA 2CLXA 2P4IA 4AFJA 3EN6A 1JKKA 1UU7A 1ZWSA 4EUTA 4N57A 3O71A 4MBLA 2VX0A 4KS7A 3Q53A 5CI6A 5BVKA 3ALNA 4ONAA 2C5VA 3FMKA 3HV7A 3BHTA 4IQ6A 3HYHA 4A9TA 2XKFA 3VN9A 1VZOA 1XBCA 2B54A 3R71A 2WNTA 5ANDA 3ZONA 4BCQA 3EQRA 4QNAA 2OJIA 2RFEA 4KKGA 2BROA 3D94A 4RRVA 4OTRA 4R7IA 4E8AA 4F7SA 1URCA 3C51A 3KEXA 4IZ7A 3AMYA 4TWOA 5DMZA 2OWBA 5D12A 3UG2A 4JR3A 3HP2A 2JDSA 3CTJA 2Q0BA 2R3LA 3CCNA 2CSNA 3ZSGA 4BI1A 3MB6A 4B9DA 3G9NA 2IVSA 4FTNA 4IVCA 4F6SA 5J9YA 5HEZA 3U6IA 1GIJA 4DDGA 4EOSA 1JSUA 2PE2A 4KIKA 3WZDA 4ZTHA 2G9XA 2YWPA 3FQSA 3PXFA 2J6MA 2V0DA 4FNXA 4MD7E 5H8GA 4D2RA 1YOJA 4Y5HA 5E8WA 4U44A 5T3QA 4LUDA 2W1EA 1SNUA 1OUKA 5AIRA 1Q97A 3LXNA 4BL1A 4EKLA 1CKPA 3PPZA 2W1ZA 3EN4A 4I5HA 2IVUA 3P7CA 5L8JA 2YZLA 4QPMA 4BDEA 2PVJA 1Q41A 3UOKA 3AKJA 2XP2A 4DT9A 1E9HA 1REJA 5FUTA 4BDKA 4FKGA 3FHIA 4RFYA 3KQ7A 5CEMA 4FTOA 2W9FB 4IMYA 3P5KA 4XV9A 2GS7A 3MY1A 4V05A 3AT4A 5GZ8A 2WPAA 2W7XA 3KXMA 5H3QA 2YEXA 2R3OA 2XAMA 3OT8A 3NWWA 3PJ2A 5FXRA 5JFWA 4BKYA 4QTBA 3DT1A 3QRIA 4KA3A 4X6RA 3CXWA 3LAUA 5L2SA 4FZDB 3CR0A 5AV1A 3R21A 4DLIA 2FSOX 3BIZA 3PJ3A 1MRYA 1WBVA 3ZFXA 4EOOA 4O7TA 3AC3A 3FE3A 3MTFA 4N4SA 4GU6A 2H6DA 5JT2A 2GHGA 3ENHA 4ANOA 2IG7A 3OC1A 5HU9A 4CYIA 2RL5A 5L8LA 3HECA 2JFLA 3R28A 5GJGA 1F3MC 5DT0A 3QRKA 4O7NA 5ACKA 4I1ZA 5KBRA 2HAKA 3SGCA 4MH7A 3R83A 1BUHA 4FKRA 2X4FA 3DTCA 4YUQA 4GFGA 4FSTA 3BPRA 4C4FA 5EQYA 5A4EA 4H3PA 2BVAA 3VF9A 4AA0A 1XBBA 5BPYA 5D7VA 3S3IA 4GV1A 4FT3A 3TTIA 1Q8UA 1WMKA 2OKRA 4XEYA 3NNUA 5AP3A 3W2QA 2OXXA 4DH5A 1J7LA 2CNUA 3UO6A 3UTOA 4I94A 4YJVA 2J4ZA 5FM2A 3TUBA