3KRMA

Imp1 kh34
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor 2 mRNA-binding protein 1
publication title ZBP1 recognition of beta-actin zipcode induces RNA looping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.210 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3krmA00
3N89A 3KRMA
chains in the Genus database with same CATH superfamily
3N89A 1B9KA 3KRMA 2QREA 1PCJX 1LWYA 2HL9A 2V9JA 1PCMX 2FKFA 2H4LX 1YQMA 3OH6A 1C4GA 1R4XA 2Y8LA 4EAJA 3T4NA 2IV9A 2H5AX 2MZ8A 3H1ZA 1YQKA 1VKLA 3DPTA 3IH7A 1N3AA 2HKPA 1LWVA 1UT7A 1TBPA 3EIKA 2I5WA 3OSEA 2HZMA 4PY5A 1NH2A 1M5Q1 1E42A 1NGMA 3CWAA 1WQAA 3OSMA 2NOBA 4B0AA 2Z8UA 1W80A 3NA5A 1MP9A 1UT4A 1KYUA 1AISA 2D0BA 1VOKA 1Q9UA 1QTSA 1QN8A 1EBMA 4WXAA 2V8QA 1PZDA 2V92A 1NVPA 1TBAB 3OCIA 1QNCA 2JOIA 2NLVA 5IYDP 4BJUA 2QRDA 4DULA 3F10A 4CFFA 1KYFA 2NVMA 2OOYA 5EPCA 1N3CA 2LAEA 1P5GX 2NOIA 4ROEB 3ULXA 1QNEA 3EAYA 1HU0A 1JFIC 3CVTA 5KL0A 2QRCA 4I8OA 1C9BB 2DKAA 1XSZA 3ENOC 1RM1A 1QN9A 1QN7A 3F0ZA 2XHIA 1YTFA 3SNSA 2FGTA 1JDYA 5AN4A 4EJZA 2PWWA 3ASMA 1PVSA 5IYCP 3CWUA 3DPUA 3TDHA 3ENCA 1D3UA 2HL8A 4WZSD 2ZFDB 2QR1A 1MPGA 3KTUA 3RPJA 4EALA 1VTLE 1KY6A 2OOXA 4QG5A 1M3HA 1PCZA 2QLVA 3OH9A 2Z0FA 2NOHA 4EAIA 2NOFA 2EHBD 2JHNA 4IL8A 4MRQA 1FN7A 3CWSA 5HSHA 3PMGA 4HJHA 2HZSA 1QN4A 4C7PA 3I0WA 1KYDA 1P5DX 1KY7A 4TPSA 1EUVA 1QN5A 1KFIA 2NOEA 2DKCA 2FUVA 2O3OA 1CDWA 3OSTA 3PDKA 1YTBA 1VTOA 1N39A 1QN6A 1J3MA 3D7QA 3HS8A 1QTPA 4D7QA 3OC3C 5BMNA 3OGDA 2Y8QA 2D0AA 2MJ7A 5F9CA 3I0XA 2DKDA 2F7LA 3C04A 5IYBP 3RSMA 2YH5A 1M3QA 1TUOA 2JHJA 1WJWA 3I3WA 2FKMX 2VJ0A 4ROCB 1DIZA 2D0CA 3OLPA 2R5XA 1T6AA 2YA3A 4Q11A 5JMVD 1YQRA 1QNBA 1C47A 1TGHA 1KO9A 1UL7A 2G30A 1K2YX 5JN5A 1VOLB 3VN5A 1YQLA 3CW7A 2JPIA 2NOLA 1QNAA 3CWTA 4WX8A 1KFQA 1K35A 3HS9A 3CVSA 3D4VA 1LWWA 2NOZA 1QN3A 1V5SA 1LXTA 3UW2A 4EAKA 4D7RA 4EJYA 3BKQX 3TE5A 4EAGA 2NWVA 4RODB 5BMPA 2IV8A
chains in the Genus database with same CATH topology
3N89A 1B9KA 3KRMA 1LWYA 1YQMA 1R4XA 2IV9A 2MZ8A 3H1ZA 1YQKA 3DPTA 3IH7A 1N3AA 1LWVA 1UT7A 1TBPA 3EIKA 2I5WA 2HZMA 4PY5A 1NH2A 1E42A 1NGMA 3OSMA 2NOBA 4B0AA 2Z8UA 1W80A 1MP9A 1UT4A 1KYUA 1AISA 2D0BA 1VOKA 1QTSA 1QN8A 1EBMA 1PZDA 1NVPA 1TBAB 3OCIA 1QNCA 2JOIA 5IYDP 4DULA 3F10A 1KYFA 1N3CA 2LAEA 2NOIA 4ROEB 3ULXA 1QNEA 1HU0A 1JFIC 4I8OA 1C9BB 1RM1A 1QN9A 1QN7A 3F0ZA 2XHIA 1YTFA 3SNSA 2FGTA 5AN4A 4EJZA 3ASMA 5IYCP 3DPUA 1D3UA 4WZSD 3KTUA 3RPJA 1VTLE 1KY6A 1M3HA 1PCZA 2NOHA 2NOFA 1FN7A 2HZSA 1QN4A 3I0WA 1KYDA 1KY7A 4TPSA 1QN5A 2NOEA 1CDWA 2O3OA 3OSTA 1YTBA 1VTOA 1N39A 1QN6A 3HS8A 1QTPA 3OC3C 3I0XA 2D0AA 2MJ7A 5IYBP 2YH5A 1M3QA 2VJ0A 4ROCB 2D0CA 4Q11A 1YQRA 1QNBA 1TGHA 1KO9A 2G30A 1VOLB 3VN5A 1YQLA 2NOLA 1QNAA 3HS9A 2NOZA 1LWWA 1QN3A 4EJYA 4RODB 2IV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N89 A;  3KRM A; 
#chains in the Genus database with same CATH topology
 3N89 A;  1B9K A;  3KRM A;  2QRE A;  1PCJ X;  1LWY A;  2HL9 A;  2V9J A;  1PCM X;  2FKF A;  2H4L X;  1YQM A;  3OH6 A;  1C4G A;  1R4X A;  2Y8L A;  4EAJ A;  3T4N A;  2IV9 A;  2H5A X;  2MZ8 A;  3H1Z A;  1YQK A;  1VKL A;  3DPT A;  3IH7 A;  1N3A A;  2HKP A;  1LWV A;  1UT7 A;  1TBP A;  3EIK A;  2I5W A;  3OSE A;  2HZM A;  4PY5 A;  1NH2 A;  1M5Q 1;  1E42 A;  1NGM A;  3CWA A;  1WQA A;  3OSM A;  2NOB A;  4B0A A;  2Z8U A;  1W80 A;  3NA5 A;  1MP9 A;  1UT4 A;  1KYU A;  1AIS A;  2D0B A;  1VOK A;  1Q9U A;  1QTS A;  1QN8 A;  1EBM A;  4WXA A;  2V8Q A;  1PZD A;  2V92 A;  1NVP A;  1TBA B;  3OCI A;  1QNC A;  2JOI A;  2NLV A;  5IYD P;  4BJU A;  2QRD A;  4DUL A;  3F10 A;  4CFF A;  1KYF A;  2NVM A;  2OOY A;  5EPC A;  1N3C A;  2LAE A;  1P5G X;  2NOI A;  4ROE B;  3ULX A;  1QNE A;  3EAY A;  1HU0 A;  1JFI C;  3CVT A;  5KL0 A;  2QRC A;  4I8O A;  1C9B B;  2DKA A;  1XSZ A;  3ENO C;  1RM1 A;  1QN9 A;  1QN7 A;  3F0Z A;  2XHI A;  1YTF A;  3SNS A;  2FGT A;  1JDY A;  5AN4 A;  4EJZ A;  2PWW A;  3ASM A;  1PVS A;  5IYC P;  3CWU A;  3DPU A;  3TDH A;  3ENC A;  1D3U A;  2HL8 A;  4WZS D;  2ZFD B;  2QR1 A;  1MPG A;  3KTU A;  3RPJ A;  4EAL A;  1VTL E;  1KY6 A;  2OOX A;  4QG5 A;  1M3H A;  1PCZ A;  2QLV A;  3OH9 A;  2Z0F A;  2NOH A;  4EAI A;  2NOF A;  2EHB D;  2JHN A;  4IL8 A;  4MRQ A;  1FN7 A;  3CWS A;  5HSH A;  3PMG A;  4HJH A;  2HZS A;  1QN4 A;  4C7P A;  3I0W A;  1KYD A;  1P5D X;  1KY7 A;  4TPS A;  1EUV A;  1QN5 A;  1KFI A;  2NOE A;  2DKC A;  2FUV A;  2O3O A;  1CDW A;  3OST A;  3PDK A;  1YTB A;  1VTO A;  1N39 A;  1QN6 A;  1J3M A;  3D7Q A;  3HS8 A;  1QTP A;  4D7Q A;  3OC3 C;  5BMN A;  3OGD A;  2Y8Q A;  2D0A A;  2MJ7 A;  5F9C A;  3I0X A;  2DKD A;  2F7L A;  3C04 A;  5IYB P;  3RSM A;  2YH5 A;  1M3Q A;  1TUO A;  2JHJ A;  1WJW A;  3I3W A;  2FKM X;  2VJ0 A;  4ROC B;  1DIZ A;  2D0C A;  3OLP A;  2R5X A;  1T6A A;  2YA3 A;  4Q11 A;  5JMV D;  1YQR A;  1QNB A;  1C47 A;  1TGH A;  1KO9 A;  1UL7 A;  2G30 A;  1K2Y X;  5JN5 A;  1VOL B;  3VN5 A;  1YQL A;  3CW7 A;  2JPI A;  2NOL A;  1QNA A;  3CWT A;  4WX8 A;  1KFQ A;  1K35 A;  3HS9 A;  3CVS A;  3D4V A;  1LWW A;  2NOZ A;  1QN3 A;  1V5S A;  1LXT A;  3UW2 A;  4EAK A;  4D7R A;  4EJY A;  3BKQ X;  3TE5 A;  4EAG A;  2NWV A;  4ROD B;  5BMP A;  2IV8 A; 
#chains in the Genus database with same CATH homology
 3N89 A;  1B9K A;  3KRM A;  1LWY A;  1YQM A;  1R4X A;  2IV9 A;  2MZ8 A;  3H1Z A;  1YQK A;  3DPT A;  3IH7 A;  1N3A A;  1LWV A;  1UT7 A;  1TBP A;  3EIK A;  2I5W A;  2HZM A;  4PY5 A;  1NH2 A;  1E42 A;  1NGM A;  3OSM A;  2NOB A;  4B0A A;  2Z8U A;  1W80 A;  1MP9 A;  1UT4 A;  1KYU A;  1AIS A;  2D0B A;  1VOK A;  1QTS A;  1QN8 A;  1EBM A;  1PZD A;  1NVP A;  1TBA B;  3OCI A;  1QNC A;  2JOI A;  5IYD P;  4DUL A;  3F10 A;  1KYF A;  1N3C A;  2LAE A;  2NOI A;  4ROE B;  3ULX A;  1QNE A;  1HU0 A;  1JFI C;  4I8O A;  1C9B B;  1RM1 A;  1QN9 A;  1QN7 A;  3F0Z A;  2XHI A;  1YTF A;  3SNS A;  2FGT A;  5AN4 A;  4EJZ A;  3ASM A;  5IYC P;  3DPU A;  1D3U A;  4WZS D;  3KTU A;  3RPJ A;  1VTL E;  1KY6 A;  1M3H A;  1PCZ A;  2NOH A;  2NOF A;  1FN7 A;  2HZS A;  1QN4 A;  3I0W A;  1KYD A;  1KY7 A;  4TPS A;  1QN5 A;  2NOE A;  1CDW A;  2O3O A;  3OST A;  1YTB A;  1VTO A;  1N39 A;  1QN6 A;  3HS8 A;  1QTP A;  3OC3 C;  3I0X A;  2D0A A;  2MJ7 A;  5IYB P;  2YH5 A;  1M3Q A;  2VJ0 A;  4ROC B;  2D0C A;  4Q11 A;  1YQR A;  1QNB A;  1TGH A;  1KO9 A;  2G30 A;  1VOL B;  3VN5 A;  1YQL A;  2NOL A;  1QNA A;  3HS9 A;  2NOZ A;  1LWW A;  1QN3 A;  4EJY A;  4ROD B;  2IV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...