3KRUA

Crystal structure of the thermostable old yellow enzyme from thermoanaerobacter pseudethanolicus e39
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
335
structure length
335
Chain Sequence
SILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
publication title Biocatalysis with thermostable enzymes: structure and properties of a thermophilic 'ene'-reductase related to old yellow enzyme.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus atcc 33223
molecule tags Oxidoreductase
total genus 128
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kruA00
2Z0IA 2OZ0A 4WXYA 3L65A 5E0KA 2Z6JA 1AW1A 2JKAA 3QW3A 2DORA 1Z44A 4FNTA 2FTPA 1I2RA 4QISA 2ALDA 3Q2DA 3M47A 5DCDA 2QUUA 4X9SA 3OHIA 1VLWA 3DFOA 1QFEA 5HINA 1W5PA 3IIZA 3FKKA 4LOCA 3UPWA 2FDSA 1OFEA 3SGUA 3A5VA 3GIYA 4CLMA 3HG5A 1GZGA 3CT7A 4MY9A 4HIBA 3BV4A 3LHYA 2C14A 2NWSA 2HS6A 5GVJA 3P5YA 3IIPA 5CPLA 2Z1BA 5AC7A 4WOZA 4FO4A 2A4AA 3NQ8A 1SW0A 2NUXA 3NYZA 4KFOA 4UMAA 1W3TA 1YTEA 2YYUA 2P10A 1ME9A 3W7KA 4O4VA 1J4EA 1KFCA 1DOSA 3P82A 4RLIA 3TH6A 3W85A 3V1PA 2TPSA 3OVQA 4BI7A 2I14A 2RFGA 3HGSA 3EXRA 1XI3A 1KA9F 2J9ZA 3LCWA 3ABOA 3EXSA 4JY8A 2DZUA 4AWUA 3QYQA 4O4WA 4JTJA 4W9TA 3KRZA 1Q6LA 3P60A 1ZALA 3VE9A 4JEQA 3PS7A 3UXAA 1HO4A 4UIOA 1TPH1 4A3UA 4GRSA 4PA8A 4NVTA 1A53A 2E77A 1BKSA 5KZDA 2NXGA 3NA8A 5G2HA 3OA3A 2Y61A 3TDFA 1TRDA 1WXJA 1XDLA 3MBFA 5CZ0A 5KITA 3KVJA 1N7KA 5G2IA 4CCDA 3C6CA 2QCGA 2A0NA 3WK1A 2GUUA 3W7EA 4MY8A 5EBUA 4ZQPA 5FF2A 2Y85A 3CM4A 3W2JA 1W3NA 5LHFA 1VYPX 3RNDA 5FF4A 3PAJA 1XCFA 2VFHA 5HR6A 3N9RA 5FEZA 3BLEA 1HFBA 3FYPA 3HGJA 3QMRA 2YPIA 3NAVA 1H7OA 5IBXA 1OFRA 1X6UA 3C56A 1SZGA 3P81A 5FF0A 4NX5A 5SWUA 4OHQA 4GBUA 1P0KA 2CZDA 3E96A 4JIPA 4LC8A 3NZ1A 2EAWA 3R5EA 2V0TA 5AOUA 3NM3A 1VRDA 1HG3A 3GX9A 1Q6QA 4MIMA 2CLEA 4BR1A 1TPB1 4LNYA 3NO5A 3HOJA 3EX1A 1IXQA 4JTFA 4R7JA 1RQBA 4ZZ9A 1G67A 3TCEA 2YW3A 3HG4A 1YADA 2V5BA 1TQXA 1OHLA 3B8DA 4TMBA 1VQTA 1H60A 1R46A 1T96A 3GK0A 4YCPA 4O1CA 4Y96A 3STGA 3WFAA 3GXPA 1L6SA 1JQXA 3MP4A 4GC4A 4UFLA 1F5ZA 1SFJA 4JTKA 1A50A 1SQ7A 2G97A 3R8RA 4NZFA 3PBWA 3LHUA 4K8EA 1QWGA 2FJKA 1GYNA 1OFBA 3W2LA 1WX0A 2DJXA 4JTEA 1V7YA 4JDBA 4O1AA 5D37A 1TRIA 3CC1A 5BMXA 3W76A 5FEWA 3PF3A 2VFDA 1SO3A 1FCUA 4NUWA 3FKRA 3C2EA 4LW7A 1OABA 3LBMA 4PH6A 1NEYA 4QJ1A 4FNRA 3CTLA 1L6YA 4N4PA 3LCXA 4JX4A 4LWWA 4Z1AA 4K7VA 1F2JA 4RV8A 3OVPA 1EIXA 3VFLA 4MJZA 2CLMA 4RJEA 4NJIA 4UMBA 2VOMA 3GKAA 3DFTA 4LRSA 3IV3A 3OG3A 3THAA 1ZFJA 1AK5A 4H4IA 3PM6A 3BW4A 3UNDA 2E6AA 3LRLA 1Y0EA 2Q3OA 3TA6A 1GOXA 1BWLA 3BG5A 4N6FA 3PG9A 5C55A 3LHZA 3GNDA 2YX0A 5E93A 1JCLA 4IX2A 2Y6ZA 5DBUA 2DZWA 1W1ZA 2QCDB 1YYAA 3DFQA 2BXVA 5D2WA 1TPDA 3G24A 1UUMA 1OF8A 4WY0F 4JTSA 3W73A 4LU0A 2J9XA 1OX4A 3O8AA 3EWBX 2QR6A 1M7PA 1GVQA 2E5BA 3TX9A 4AVFA 5I3IA 4QAIA 4ALDA 5G4EA 3PR2A 1FUYA 5C6MA 4UTLA 1GVOA 3KAOA 4DF1A 3WJSA 3S5NA 1EP2A 1F73A 1S5VA 3TU9A 2RH9A 4FX7A 4R33A 2Q8ZA 4I7UA 3BG3A 4RZ5A 4E2DA 1LRNA 1RPXA 3GAKA 2WPBA 1D9EA 2BLEA 2QKFA 5CG7A 3G3MA 3N2MA 4K39A 3TK7A 2QCNA 4LVGA 3PWAA 2ABAA 2WNQA 3BVJA 3BPWA 4M5PA 3THQA 1XM3A 5C2XA 2VFGA 4CNNA 1ML1A 3LI1A 5HJLA 4HNUA 1T0OA 4O54A 3IRDA 1OYCA 3QMTA 4JTIA 1EP1A 3LXCA 4IMEA 2WSRA 4MZYA 4K37A 1ZAIA 4MFDA 4GWEA 3LLDA 4HT3A 2DZXA 4JTGA 3N3MA 1NAL1 5D2VA 1I8JA 3L9CA 3H53A 3S1UA 4FNUA 3L5AA 1S5TA 3TAKA 5J5DA 4OGZA 3W1QA 4IPJA 4DEFA 1JJKA 2JK2A 2W0UA 2TMDA 4MPQA 3NQ7A 4X3ZA 3O07A 2CLIA 2PRMA 4M6QA 5LZLA 4HNTA 3S6DA 1FWRA 3ATYA 4HHPA 4AHOA 3O6DA 3DFPA 3NZRA 1EUNA 3O63A 1B57A 3LBCA 1K8XA 3EX2A 2QEZA 2WNNA 2J27A 5K7JA 4I7VA 1JUBA 3S5OA 1KM3A 1OFDA 2CLHA 3EEGA 4O11A 2I9EA 4PFMA 4JYDA 4OT7A 3JS3A 1S3HA 2VC6A 5TBOA 1KTCA 4RZ6A 2XFWA 3ABRA 1TPWA 3GZ3A 4O15A 2NXIA 3NG3A 3B0PA 3W1RA 1KTNA 4P2VA 4JYFA 2Y89A 3HBLA 1GG0A 2FPTA 3M5YA 1R2RA 2C1HA 3P61A 4JDYA 4OV9A 4MJMA 4D2JA 4ZVJA 3W70A 3QC3A 1EWEA 1G7VA 2ABBA 4WX2A 1FWTA 3DZ1A 4O10A 3W74A 1LYXA 3W72A 3MP3A 1M6JA 2I1OA 4MVAA 3FYOA 4HN4A 4LRTA 3SSJA 4FNPA 4UTWC 4PC8A 4GE8A 5CPOA 5D2TA 3PBUA 3TXVA 3S9YA 3RMJA 1UBSA 2JKPA 4FHAA 5FEPA 3FIGA 4LVFA 5CPNA 3IVUA 3GDTA 2ZZ4A 1TV7A 1TPEA 3PUEA 5K9XA 4DF0A 1ICSA 1G4SA 5DXXA 4GXMA 1KTBA 3W1PA 2OMAA 1SZEA 4O57A 3G1DA 4K6AA 1DHPA 3Q94A 4K8HA 1PHQA 1KBIA 4MY1A 3EWXA 1ADOA 2NLIA 4FX8A 3LI0A 4JX5A 4YLWA 1QOQA 1JR1A 2ZZ6A 5AFDA 3EWZA 3NQ2A 5EMUA 3LRKA 4Y90A 2ZZ2A 1F74A 2FLIA 3W22A 3ZR4A 4ORIA 5D38A 5CZJA 4ZMGA 2E6YA 4JTUA 3P5ZA 2QDGA 4UUIA 5D05A 3ABSA 3USBA 2DZSA 4J9JA 3CIWA 3CU2A 1MEHA 4QNEA 4O14A 2BWGA 2ZBTA 3DFNA 2WQPA 5AB3A 2AQWA 3SJ3A 4N6EA 4TO8A 3PSVA 3NQAA 1WYIA 4WZHA 3LCGA 4UFHA 4TR9A 5L9FA 4A2SA 1H50A 3P74A 5HWMA 3VI2A 3UPBA 3DHDA 2VKZG 4P61A 5DELA 4NQ1A 2YSWA 3ZWSA 5CKSA 3G0UA 1FXPA 4BFAA 4BF9A 1VCVA 1MSSA 1G4EA 5U4NA 1EWDA 2WO5A 5TQLA 2A5HA 2VFIA 4HPJA 4NXKA 5FI8A 1FCBA 1TJRA 4M6PA 3NPUA 4GNJA 5HR7A 5HWNA 3DFSA 3IGXA 2G5WA 2CW6A 3MHGA 4JNMA 1KBJA 4ZQOA 3I7SA 4S1FA 1KFKA 1GVRA 2J24A 1C9DA 1OX4B 3QPYA 3O16A 4ZQCA 3W1LA 4JY9A 2CLLA 3LCLA 2B4GA 3T78A 3GR7A 3B03A 4RXGA 4B5NA 2ISVA 1HO1A 2GJLA 4MUZA 1IXOA 5KINA 1ALDA 3NL6A 4O8RA 1EEPA 4C1KA 2C16A 5K9CA 1LM1A 2XN1A 1YTDA 3MW7A 3MI3A 4UFIA 3OEXA 1ICPA 5AYYA 1K7FA 3W83A 4FNSA 1TIMA 1WBHA 1D3GA 3NXFA 4UTIA 3FJLA 4O0ZA 1X1ZA 5FEXA 3E0IA 3S5YA 1UB3A 4JTLA 3P7YA 1XL9A 2GVJA 2TRSA 2J6XA 2AAMA 1SR9A 4GUHA 4UR7A 3TR2A 3TIMA 1MZHA 1D3HA 2DZVA 3A22A 3ELFA 1LROA 4IXHA 1QAPA 4CQ9A 2C0AA 3RK8A 3NL5A 3MO7A 1KFEA 1M7OA 4U28A 4BWLC 3FEMA 3K30A 5F2IA 3W1TA 1F76A 1Z42A 3W2MA 3SIZA 3B4UA 5AHFA 3S8HA 4DPPA 2NX3A 1LBFA 3UZ5A 4XQ6A 3LB0A 4L4LA 1O5XA 1RR2A 1WQ5A 1RQEA 1TPUA 4UR8A 4UFKA 3QPZA 2HSAA 1VJIA 2X1UA 3DU0A 3G8RA 3O6CA 4AXKA 3ZS4A 3E49A 3C2OA 1SW7A 2H3DA 4UNLA 3N14A 3QMSA 2QCCA 3W2NA 2QJHA 1I2PA 4OQVA 5AC8A 3LHWA 3CEPA 4WJEA 3BW3A 2FB2A 3I65A 2ZA2A 1FDZA 3KOFA 3W07A 3TMLA 1SPQA 5AHIA 1OFPA 5LSMA 4YCOA 3T4CA 1LRTA 5H2ZA 2CZEA 1QNVA 3Q58A 1JQVA 3LCFA 3U8GA 2ZA1A 1SU5A 4BI6A 3DAQA 4O1DA 4QNWA 1QOPA 3B0VC 3EWUA 3V75A 2ZTJA 3HMJG 4QM1A 2EHHA 2Y62A 3MJYA 4NJHA 1Z41A 3NPWA 1SSGA 3TFCA 3W1MA 4ONVA 1W5QA 2NV2A 4I9AA 1EX5A 1H1ZA 3CWNA 3W71A 5DLCA 3HG3A 1KFLA 2EPHA 3EX6A 4AWTA 4JS3A 1JCMP 1GQNA 3SI9A 2GVGA 1OFOA 2TSYA 5H91A 1TTPA 2NUYA 4O0KA 3N9SA 4NX0A 3HF3A 3G18A 3M41A 2A7PA 1RD5A 2X1TA 2YFNA 4TX9A 4XBSA 4RX0A 5BOOA 1XUUA 1QPRA 2UV8G 2DU2A 4FXRA 2WSQA 1OYBA 3QFEA 2QCMA 1GTHA 1F6PA 2C19A 4N02A 4Z1CA 3NQMA 1CX9A 3NGJA 3TSBA 4UTUA 1T8XA 4FF7A 4UTWA 2RHGA 3TQ0A 4MZ1A 4GJ1A 3NPXA 2G95A 3W7DA 5KMYA 2V2CA 2YFOA 1FBAA 3SECA 4K36A 2YZRA 3O1NA 3O6YX 1TMHA 2X2GA 3G0XA 4JR5A 5G5IA 3U2OA 2JKEA 1KW1A 2O7QA 3UWYA 2V9DA 5AHLA 4ZQRA 4R53A 2Y63A 4XZ9A 2YGYA 4UMCA 1B3OA 1LDCA 1QCWA 4DBDA 3W1NA 3LERA 1HTIA 3L0GA 3LRMA 1XXXA 3GDKA 2R14A 2OT1A 3TFXA 3UWWA 1N8FA 1DVJA 1KV5A 5D02A 3O05A 3B04A 4JIQA 1ZJIA 3TJLA 3UWUA 1TSIA 1G4TA 3S1XA 1WBJA 3MBDA 5BMWA 4X22A 1QPNA 1ZY9A 1KM5A 4ADUA 5EPDA 4O16A 3NEVA 3M16A 1ME7A 1GYLA 3Q37A 1H61A 2QDHA 1CW2A 1BTMA 5HUPA 5EA9A 3VE7A 3B05A 4ML9A 4I7WA 1MO0A 4N9DA 3H55A 3HPZA 2E5CA 5IM51 5U7SA 5CZSA 3W7JA 3A5FA 4LV4A 1S5WA 4S2CA 3S1VA 1SZNA 3OIXA 1IF2A 4GUIA 2VENA 2A1YA 2V30A 3FS2A 4NJJA 3UQNA 4GUFA 4RKAA 4POCA 4NNCA 5F2MA 1XDMA 3W1UA 1SSDA 3P8JA 2CFFA 3KVLA 4AEOA 4FIQA 3UWVA 3W7IA 1XBVA 1TO3A 2VFFA 4RR4A 3F4WA 1R47A 4M6VA 4OE7A 4WQ6A 5G1TA 1U83A 4NZJA 1O94A 4O53A 3TMQA 4N9EA 5A8GA 1TB3A 2AGKA 3C3NA 2ZQ0A 3W23A 2RDWA 3NL2A 1T99A 1QPQA 3KHJA 3TROA 1RQHA 1FXQA 5LNUA 2GPTA 2G96A 4AB4A 3W1XA 1C29A 2E6FA 2FPYA 3DI1A 2E1DA 3HGRA 2J88A 3L2IA 2Y7GA 4AAJA 3SW6A 4AF0B 1KLZA 3MUXA 4MYAA 4CCEA 4LVBA 3GXTA 1P4CA 5TIMA 6TIMA 2F7FA 4XBKA 5K9DA 1VCGA 4Y6GA 1JULA 2V2HA 4LS2A 3A24A 4IWWA 1G69A 5LNRA 1UASA 4O50A 3QQ1A 2Z2UA 2A6NA 4MKNA 4O12A 3L66A 4JICA 4IX0A 4HSOA 4PODA 2YW4A 3WK2A 3G1FA 5HMSA 2P1FA 1VYSX 1VCFA 1OVDA 3GDMA 4N9CA 4QSHA 1MEIA 1ZAHA 4IMGA 1VR6A 1JUEA 2RKXA 1DBTA 1KM2A 3DBPA 3W86A 3C2FA 1G6CA 4A29A 3RLVA 3PB2A 2HS8A 3MMTA 5F4XA 4LUJA 3S5ZA 3TXZA 1A5CA 2ZDRA 2C3ZA 5KSWA 1G4PA 3G1VA 5FESA 4PCFA 4TMCA 1LOLA 3OVRA 5EKYA 1YXCA 4UFJA 3TC7A 1FQ0A 2FFCA 3G0SA 4IGHA 5LNVA 1I45A 3LLFA 4X2RA 4FB7A 1YPIA 3GKFA 5DXYA 3W84A 5AN7A 1JCXA 3R12A 1W5MA 3I68A 4KFPA 1MEWA 4CQAA 4PEKA 3ZFHA 3M6YA 3FA5A 3N73A 2ZRUA 8TIMA 4QIUA 4WD0A 5FF3A 1HUVA 2GJNA 2Y7EA 3DI0A 3EKZA 4O28A 4MLRA 1XC4A 1DKWA 4CNPA 3FLUA 5K4ZA 2E6DA 4HNVA 4KWWA 1SW3A 5KZEA 1YDOA 3CWOX 3QM3A 2BZNA 2ATSA 3H54A 1P0NA 3L5LA 4ORMA 4IJBA 5I3KA 4GFSA 4UCGA 1OK6A 1SO6A 1BEUA 1I2QA 1L2UA 1XBZA 3R2GA 3G3DA 1EA0A 3BLIA 4O52A 1VS1A 1FWNA 4ADSA 3T40A 1YXDA 2DP3A 4KWVA 4ZQNA 5HUOA 2B7OA 3W2KA 4EWND 2QCEA 3C0JA 3L21A 3B06A 3LV6A 1F6KA 1EP3A 3W9ZA 3PG8A 4DO4A 1JCYA 3EWYA 1R30A 1CI1A 3T44A 3G1AA 3KX6A 5E1QA 1XUZA 2DZPA 3GDLA 1AW5A 4JYEA 5D30A 3TV8A 5HULA 4WUIA 5LKYA 1J5TA 1B9BA 2ZRZA 4IXXA 2ZRXA 4EOUA 5AHEA 4A21A 3P84A 4HPXA 4WXZA 1KM0A 3P8IA 4E0CA 3UXDA 5KZMA 2F84A 3N2XA 3STCA 2CWNA 3W88A 1GG1A 1TREA 2ZRYA 3GLCA 2PRLA 3M0ZA 2ZRWA 4U4MA 5DY3A 2QAPA 3UZJA 2FIQA 3CEUA 1QR7A 3NQFA 3TW6A 1O95A 1QPOA 2Y88A 5DY2A 3W7RA 2YR1A 4JN6A 1GTEA 4WOQA 1OX6A 1OF6A 4Y9AA 5DN1A 2W6RA 1OX5A 3I7QA 2ZCGA 1LCOA 1Q6OA 2OCZA 3HIJA 3TNOA 1L9WA 2CLFA 1VZWA 3MHFA 1WOBA 3KFTA 1TQJA 3TSDA 4UC5A 1VH7A 4MFEA 3N34A 5D04C 4UTJA 3LGEA 1XBYA 2YDAA 3S42A 4LV9A 1O4UA 4QQ3A 4DO5A 2A7RA 3G1YA 4BI5A 1XBXA 3QSRA 4JTHA 1LOSA 2IQTA 5K4XA 4ZL1A 3LXBA 1X8FA 3KVKA 2NZLA 3EX4A 1TV8A 2YYTA 2CU0A 2V82A 4NT0A 2WOQA 4TU1A 1IIHA 2E68A 4NJKA 4CNOA 2X30A 5LNSA 2DZTA 1IXPA 2DJLA 2Y70A 1H7NA 4TIMA 4NNAA 4UTTC 4LY8A 4OU1A 1ICQA 4NJGA 1XKYA 2GOUA 4IMFA 3S1WA 4LVDA 2LLEA 1THFD 1F7BA 2GVLA 2WKJA 1FCQA 1VLIA 3R89A 2QCLA 2EKCA 2RDTA 3HPSA 2Q8LA 1PCKA 1DL3A 3GYEA 1LLWA 1OG0A 3LV5A 2ZZ1A 1TPFA 1FDYA 1ZHAA 1YTKA 2YXGA 4UTMA 4LC6A 3IEBA 3KXQA 4O18A 4O13A 1PE1A 2BX7A 3NQDA 1RZMA 4KKXA 1K8ZA 4XTDA 3W7GA 3W7HA 3BGGA 4UNKA 5F4WA 4AF0A 1PHWA 1TTJA 3DH7A 3UD6A 2B7PA 2C13A 3LTPA 3HO8A 5AYZA 1TV5A 1FWSA 3NR0A 1SZFA 2QAFA 3NDOA 3PC0A 1W0MA 4ICNA 1IGSA 1YXYA 3JRKA 1YLVA 1UCWA 5CZTA 5F2LA 3UWZA 2O7SA 3NQEA 1FCVA 1P5BA 5D09A 5HNRA 5I3FA 1ZAJA 4ADTA 2C6QA 3NQVA 4PL1A 5MHBA 1SO5A 1C8VA 2BTMA 2R91A 3HGOA 3STEA 1NVMA 2CLOA 4XUGA 1NF7A 3WJXA 1VYRA 3OBKA 4Z1DA 5AHMA 1TTIA 1F05A 2CZFA 1VHNA 3W7QA 3M43A 4Y8FA 1WDWA 3TKFA 3M1ZA 1W8SA 1LOQA 3G1XA 4RK8A 1DORA 1W5NA 3LHTA 5CGQA 3BO9A 1KFBA 1KLYA 5CPMA 3MWAA 3NQ6A 3DKJA 3TQKA 4GUJA 5DCEA 1H51A 2JBMA 3O06A 4DF2A 3B0UX 2NX1A 3F03K 2GQ9A 4EIVA 3HJZA 4DXVA 5AHNA 5I3HA 2OX1A 3IVSA 1NF0A 4CCCA 3LM7A 3UYCA 1JRCA 3FOKA 3QH2A 4OV4A 5CSSA 1H63A 3PY2A 4FNQA 2E09A 2C15A 3BK0A 4UFMA 2VEKA 4G1KA 5LGXA 1R2TA 3MI6A 2FPVA 3W7LA 4QITA 4RXFA 2YCEA 1RVGA 3PB0A 3ABQA 1WAUA 1Q3NA 1W37A 2NXHA 3L5MA 4N4QA 3QZEA 1GJPA 1TJPA 1PCWA 3M9YA 4DQWA 2V2DA 1PV8A 2H3BA 4FIRA 3GXNA 1B4EA 3IIOA 2KZHA 4HKPA 1PL9A 3MP5A 4UTKA 1H62A 1LZOA 1I4NA 3RFAA 3GVGA 1QDSA 3JR2A 1XFBA 3PULA 2ZA3A 4AHPA 3WK3A 3HQ1A 5AC6A 2PE4A 4AWSA 1SFLA 1BWKA 1P1XA 1R2SA 4YWIA 2ZTKA 3PUOA 5C54A 2OT0A 3M5VA 3I6RA 3AJXA 3QSTA 5HWJA 3W7NA 5AYXA 2W79A 3IIXA 5F1VA 1HL2A 3A9IA 1TCDA 3P62A 4E2BA 1V5XA 1K7XA 2WNZA 1Q45A 3GAYA 3C2VA 3P67A 4M19A 4JD4A 3M7WA 3LHVA 1OJXA 4OWGA 1IXNA 2A6LA 1W56A 3CLMA 3KRUA 1KM6A 3TE9A 2V5LA 4YL2A 3LOTA 5F1UA 2X1RA 3LCIA 4OBTA 5DCBA 2NWRA 4XKYA 4A2RA 3BGJA 2ATMA 2RDUA 2ZYFA 3AO0A 1OFQA 1A5AA 2WJZA 1EPXA 3DGRA 3E9AA 2BSLA 4O17A 3TQVA 1DV7A 4WY0A 1W5OA 2Y7DA 4C1LA 2CLKA 4JTTA 3QRHA 1ZNNA 2FQIA 4KFNA 1NFBA 3NM1A 3I7RA 3LX9A 3MYOA 4JX6A 1G7UA 1RV8A 4H6KA 1FX6A 1WV2A 5D32A 2VEMA 1DJNA 1Q6RA 3C61A 4DBEA 2QCHA 3WJYA 3EWWA 2H90A 1H5YA 2QCFA 3P80A 5CSRA 1H7RA 5KTLA 1IIGA 3NQGA 5BNKA 1ZENA 2VELA 4MOZA 4IMCA 4R34A 1AW2A 4K7YA 3SZ8A 1TTQA 1VGAA 4LVAA 2QUTA 4HSNA 1A5SA 3SR7A 3IIVA 2HMCA 4NNBA 1KM1A 1QMLA 1GPWA 4DO6A 2EGZA 5K2ZA 1KV8A 3LTYA 3QEZA 1K3UA 5I3JA 3W7PA 4EF9A 3EXTA 4LTSA 1H7XA 3YPIA 3KVMA 2JGYA 3TUUA 3GR8A 1AG1O 2V8ZA 1LBMA 3M44A 1A5BA 4LT9A 3PBYA 3W3OA 4GUGA 3VNDA 2ZRVA 3U6WA 1W54A 1EUAA 3QF0A 4UXDA 3E12A 3VCRA 4A22A 2CZ5A 5D33A 3G1HA 4Z0JA 4UTTA 1GT8A 5J5RA 1NSJA 3HB9A 1GWJA 2QJIA 5EYWA 4IPIA 3W87A 1EB3A 2PCQA 2E5DA 3PBVA 1K8YA 4AH7A 2QF7A 4FXSA 3GB6A 5FF7A 3F1QA 3MHUA 1N55A 3C52A 1ME8A 5A5WA 3NPVA 3ZWTA 3NQCA 4Q33A 3C8FA 1AL7A 2VFEA 3S0CA 1I2NA 1TPVA 1LORA 3QQ0A 3LCHA 4MLJA 3D0CA 2D73A 3RF9A 1GVFA 1DQWA 2A85A 5D2XA 2C18A 3O15A 1AL8A 1OYAA 1PVNA 2ISWA 1O5KA 3C4UA 3DXIA 3F4NA 3A21A 4IMDA 4FEZA 3RLUA 5EY5A 4AHQA 3STFA 1ONRA 3T7VA 3WK0A 1QO2A 1JCJA 3N19B 3C2RA 2WSYA 3LTSA 1H7PA 3EB2A 1L6WA 2Y7FA 1FWWA 4ZQMA 4BWLA 3L0KA 3PVFA 5ABTA 1WA3A 1LRQA 3TW7A 3HPXA 2GQ8A 3MI2A 3A23A 3TAOA 4NU7A 3TSMA 5IBXC 3W1AA 1JCNA 4Z08A 2B7QA 1E51A 1M5WA 1TPC1 1FY6A 2A2IA 5F2GA 4JGDA 4RZ4A 1I2OA 3QW4B 1SO4A 5DBTA 1YPFA 4HNNA 5BW6A 1K03A 1B4KA 3W6YA 1LP6A 3HG2A 5F4SA 2ZZ5A 1H1YA 4XTIA 3CQ0A 3ANYA 5LGZA 1GVSA 1OFAA 4K38A 3LDVA 1LBLA 3G8EA 4Q4KA 2P0OA 2R8WA 4LS0A 4UTHA 1W31A 4IQLA 1LTDA 3E02A 3NNTA 1OK4A 3VKJA 3KRSA 4IOTA 5D03A 3CHVA 3PSWA 2X16A 3BARA 1ZCOA 3L68A 3IGUA 3R13A 4LUIA 2NV1A 4YMZA 2JGQA 3W7OA 2B7NA 3RU6A 1K7EA 2H8ZA 3BLFA 4E38A 1PS9A 3GNNA 1AMKA 3FJ6A 5D2YA 5K3VA 2GQAA 5L6UA 4Z0SA 4L4MA 4S2BA 2WV8A 1H7WA 1LLZA 3GDRA 3PUDA 4DELA 4PL2A 3M5XA 4H3DA 3G22A 1JVNA 1YDNA 4JXCA 1WOAA 1QO5A 2H6RA 5I3GA 1KM4A 5C5YA 2Z6IA 2TYSA 2B0MA 4O1BA 4RCXA 3L0NA 1Z48A 2ZZ3A 5G2WA 4Z1BA 4BK9A 2EF9A 2HTMA 3SFKA 1FDJA 3WJWA 7TIMA 3W7MA 4FX6M 3WJZA 2NUWA 1K02A 1X1OA 3BG9A 5G4WA 1PIIA 3FFSA 3SGZA 3EX3A 3BW2A 4XKYB 3TJXA 1JUKA 4M7SA 1U5JA 2Q3RA 3DENA 4DPQA 4YXGA 1MXSA 5EL1A 1VPXA 2NX9A 2V81A 2R94A 3NVTA 2PURA 2ISSA 2A21A 1DQXA 1UUOA 1KFJA 3W75A 3L67A 2J9YA 2H8XA 4LS1A 3W2UA 4M7TA 4WY0B 5HQEA 4PTNA 2QJGA 3DHFA 1TYGA 2VEPA 4MYXA 4N9BA 5BRBA 3CIXA 2ZZ7A 3NOEA 3IVTA 1YDVA 2VXNA 3CB8A 3UY7A 1O60A 5LNWA 6ALDA 3NL3A 2FB3A 2PC4A 3G1SA 4MZ8A 1X7FA 3QJAA 3IGSA 4Q32A 4AMAA 3UY8A 4O19A 4XWUA 4NXSA 2A7NA 4EF8A 2VEIA 1DJQA 1W3IA 5LHEA 1JRBA 1UJPA 3T55A 3LXAA 3EKLA 1SUXA 4IUOA 5T26A 3SY5A 2PRHA 3TC6A 1J2WA 3ATZA 3W7CA 2XN2A 1GEQA 2QCDA 2XN0A 3DKLA 4CQ8A 3INPA 1VHCA 3M5ZA 1VC4A 3CPRA 3UWQA 4N2YA 2ZFAA 4EVZA 2OJPA 2QUVA 3MYPA 5G1YA 2X1SA
chains in the Genus database with same CATH superfamily
2Z0IA 2ZVRA 4WXYA 2Z6JA 3EAUA 3QW3A 1XYFA 2O9PA 2DORA 4FNTA 2FTPA 1AMYA 1I2RA 4NZCA 4EANA 1VB9A 5DCDA 2QUUA 4X9SA 2RDXA 1QFEA 2C8NA 1W5PA 3FKKA 1EC7A 3BOLA 2UY5A 2FDSA 4GZIA 4WSJA 2G8ZA 1OFEA 4CLMA 3HG5A 3CT7A 1V77A 1WKYA 2C14A 2INZA 3M6DA 1J0KA 5CPLA 5AC7A 4WOZA 1V02E 2YCKX 4KFOA 1W3TA 3T0CA 2YYUA 4D6JA 3OYZA 1WP6A 3RJXA 1PX8A 4O4VA 1OINA 1UPMB 3LNPA 4LPCA 1DOSA 3P82A 1Z32X 5H8PA 1QOXA 3V1PA 1XPGA 2BS9A 1BVNP 3BL3A 1ONXA 1U5HA 1KA9F 5CJMA 3LCWA 1UWAA 5LXEA 1YX1A 4JY8A 4AWUA 5A2AA 4Q6JA 4AD0A 3VE9A 3PS7A 2VQTA 2G50A 2XSXA 4A3UA 3EPMA 3FX4A 3URQA 1T41A 1R3VA 4AYGA 5CBIA 2NXGA 5G2HA 3VILA 3OA3A 3H26A 4H8NA 4O1FA 4PUKA 3T2QA 3GC2A 1N7KA 4CCDA 5MKGA 3C6CA 2A0NA 2H9AA 1GZ1A 3NZPA 1AVAA 2INFA 1E71M 5IFPA 4H8HA 3VIMA 1KRAC 2QQ6A 3WZ0E 3PUGA 1P0DA 3RNDA 1VP5A 3B8VA 2PB1A 4B3LA 1RALA 4HMNA 3BLEA 3HQOA 1NWRA 4RDWA 3HGJA 5HQLA 4MNLA 2YPIA 3GIQA 4XK2A 3GTIA 2AOSA 1AA1B 4KCWA 1X6UA 2V3EA 2BMBA 1HT6A 1SZGA 1UBPC 4ZA0A 1KCKA 3VKDA 2DUXA 1A80A 3NZ1A 2NVCA 2DUAA 3APGA 4PMUA 1HF6A 1HG3A 3IJ8A 1JEZA 4MIMA 4BR1A 1ZJBA 3H4GA 4DHGA 5AYIA 3KW3A 4KW2A 1Z7AA 3MCOA 5B7ZA 4WJ8A 3KRBA 2HE5A 2YW3A 2QXWA 3HG4A 2V5BA 2VX7A 3MWCA 1U33A 3CL7A 4TMBA 4F40A 1H60A 2DUZA 3GK0A 1TWWA 4YCPA 4Y96A 1UWQA 3BAYA 2EPNA 1F61A 2X7VA 1R38A 1Q4NX 4GC4A 1F5ZA 1R5YA 4I9TA 2D3LA 3OYXA 2G97A 1XW8A 3PZOA 4S3EA 5AC5A 4NZFA 3PBWA 4K8EA 4HK6A 1UH3A 3W2LA 4MKVA 4JTEA 1XDJA 3V5FA 3H23A 3T0BA 4HZ7A 4DUXA 5D37A 1B0IA 4XAYA 4XKMA 4PCNA 4F0MA 3CZGA 1PZ1A 2BY2A 4Q8WA 1GGOA 3BZJA 2VFDA 3T8QA 3B8WA 4J28A 4PH6A 1KD0A 1NEYA 2WZHA 4QJ1A 3G2GA 4FNRA 3FA3A 3VIOA 4K7VA 2WSKA 2FZ8A 3VDBA 2CLMA 4NJIA 2XH2A 2VOMA 5CC6A 2DSKA 3OG3A 4QE1A 1ZFJA 3TTSA 3UNDA 1NOUA 3HU7A 2Q3OA 3LZ3A 1LL6A 1GOXA 3GHUA 3DBNA 4XVDA 2TODA 3M0XA 3ZLHA 1P6BA 2VOTA 5E93A 3CPGA 4S3DA 3FJ4A 2Y6ZA 2DZWA 1XLDA 1YYAA 1OY0A 2FGLA 1OF8A 1OIMA 4DNMA 3C0LA 3W73A 3O8AA 1M7PA 5I3IA 3CAKA 1EOKA 2ZIDA 4GVHA 1XR2A 1IZCA 2XSBA 3IJ6A 1FWJC 1GVOA 3JZUA 4QHRA 3KAOA 4DF1A 3S9ZA 2YL9A 4LY4A 2RH9A 1VBUA 1VFLA 4E2DA 1PTGA 3RG6A 1LRNA 3MUIA 2WPBA 2QKFA 5CG7A 4FMVA 3W53A 1RJPA 4K39A 3SEPA 1GW9A 1OCNA 3EMQA 3BVJA 5LXXA 4M5PA 3N13A 3FAXA 2QNEA 3LI1A 1Q7ZA 2PWUA 4HNUA 1WZKA 3IRDA 2NVAA 4IMEA 2DSUA 4BQ5A 4K37A 1S2UA 3LLDA 1P7TA 1NAL1 1QWKA 3L9CA 1G5AA 1V0NA 3L5AA 3TAKA 4H6RA 4AZGA 1ZB5A 1V08A 1JJKA 3WD4A 2TMDA 3IRSA 4S39A 3MUZ1 4X3ZA 3RCYA 3HQNA 1FWRA 3WQ5A 3BAWA 4NL1A 3O63A 5LIUX 1VEOA 4LNCA 3R1ZA 3LBCA 4DAFA 3EX2A 2QEZA 5M2FX 1JUBA 1UZ1A 1KM3A 1ZBWA 2CLHA 1K8CA 6REQB 4PFMA 4LB4A 1ZBKA 4OT7A 4PUJA 1CGXA 4CD4A 5TBOA 2YBVA 3RJYA 2UY3A 3RITA 2PDJA 2NXIA 1E0WA 2GK1B 5BYWA 3B0PA 4XD5A 4JYFA 1SJDA 3ITCA 1ISZA 2V6AA 3P61A 4JDYA 3VDCA 4D2JA 2BOFX 3QC3A 1G7VA 3GYCA 4PMXA 3UA4A 2ABBA 4GINA 3ITOA 2QMKA 4AD2A 3WIJA 3FDGA 2JEQA 3W74A 3F4DA 2MUCA 3MP3A 1M6JA 4S38A 3I6TA 2PMQA 3XINA 4QX4A 3E38A 3H2OA 2OZ3A 4GE8A 2YZ5A 3S9YA 3RMJA 1UKTA 4FHAA 2J7CA 4ZSTA 2ZZ4A 4GLEA 1EQPA 1TV7A 5FL1A 1CZ1A 3D3FA 1S2TA 4GXMA 3G1DA 1DHPA 4Z2JA 2W3ZA 3Q94A 2YA2A 2O9OA 3NOYA 1KBIA 3GWQA 4DWSC 4WHBA 1ADOA 1V0KA 4AIBA 4FX8A 3H7UA 4JX5A 2DW7A 1WE5A 1QOQA 3KL0A 2VJXA 2ZXAA 4ECLA 5AFDA 7PTDA 3PBMA 2GDUA 3RLGA 1CECA 2EEXA 1PKMA 4C6OA 5B80A 2ACSA 3W01A 2ZZ2A 1TR1A 2XM1A 4ORIA 2PDNA 5CZJA 4ZMGA 2E6YA 3ZT6A 4JTUA 3USBA 4AW7A 3ABSA 1NM9A 2GVYA 3UA3A 3QY6A 5FSEC 3S3GA 1W1A1 2DGAA 2VR2A 3SJ3A 4D72A 4N6EA 4Q4SA 3UEQA 3A4JA 3GFYA 4DY1A 3NQAA 2EQDA 4WZHA 1C92A 4ZODA 5JH1A 5TNVA 3W82A 5L9FA 4A2SA 3P74A 5HWMA 4AZCB 2VT0A 3ZWSA 1BHGA 2QPUA 3EOUA 4R9OA 3UFYA 3SY1A 5CKSA 1FXPA 1W9XA 1XPYA 1O66A 3FSUA 1G4EA 3AXXA 2E7FA 4HTBA 5D8WA 1YE4A 1TJRA 3AFBA 2YCLA 3F5LA 4M6PA 1XICA 1RA5A 5EB8A 3SO7A 5HWNA 3A3HA 1EJRC 2CW6A 1A5LC 1E1EA 4L4PA 4QG9A 2DT3A 4HVXA 3NDZA 3LMZA 1NELA 3ZZ1A 4GVFA 3O16A 1Q66A 3GR7A 3DG3A 3B03A 4WJXA 2Z2AA 4E8DA 2V5CA 3OO2A 4MUZA 2KAUC 1JCTA 4JL1A 5KINA 5ABEA 4O8RA 4WDTA 3E5PA 2ZUWA 3ITGA 2C16A 5K9CA 3MW7A 4UFIA 4GZJA 3SRDA 3OEXA 5AYYA 4C6KA 1IE7C 2PU0A 5FAJA 1TIMA 4J35A 4UTIA 2JIEA 4F2TA 5FEXA 3S5YA 2PDUA 3PWIA 3WL0A 3VINA 3P7YA 1TVLA 2YLLA 4GUHA 2HJPA 4UR7A 1QI0A 1US3A 3TIMA 4ZXOA 1MZHA 3RN6A 1LROA 1J79A 1VIZA 4CQ9A 1A0DA 1M7OA 3AIVA 4PMOA 4EXAA 3FEMA 5F2IA 4B5XA 1HVQA 1TFVA 5HPOA 2OB3A 4H9ZA 3B4UA 3S8HA 1IWPA 3VM5A 8XIAA 3E2RA 1JFHA 1O5XA 2VTFA 1RQEA 4UR8A 4HCHA 4UFKA 1VJIA 3AZTA 4JFTA 3FEQA 1YEYA 2H3DA 3GH4A 3W2NA 1I2PA 4JQ3A 2OEJA 4AIOA 5AC8A 4AD5A 2YKKA 5BXPA 1TUFA 4OIFA 4IP4A 1MW3A 3BAJA 2AGTA 3R0KA 4U3AA 3W07A 1KRBC 4Q8OA 1SPQA 1F8IA 1OFPA 3RCNA 2J8TA 2OGYA 2CZEA 1QNVA 3H2AA 3LCFA 1REQA 2HXTA 2VWSA 1SU5A 4PTDA 4O1DA 4DYEA 4EPDC 1RSCA 2PP0A 3EWUA 3V75A 5C0QA 1FTXA 3ZJ8A 3HMJG 3QLDA 4LYKA 5EFDA 5HK4A 3V7PA 1EYWA 2EHHA 1SSGA 3WNLA 3UJFA 3W1MA 1W5QA 1EX5A 5I07A 5DLCA 1TJ1A 1KGXA 3S4TA 2EPHA 3K4DA 4U5IA 3RR1A 2GVGA 2Z28A 4MNKA 2TSYA 2XVLA 1S1PA 3GC5A 5H91A 3ONCA 2NUYA 4F0RA 3LYEA 1IEWA 4NX0A 3HF3A 3G18A 5RUBA 4ZOBA 5I09A 2GSEA 3SCUA 2A7PA 1RD5A 1QT1A 1QPRA 2UV8G 1UH2A 4EX4A 5I77A 1WZMA 1F6PA 1H41A 1SZRA 4UTWA 2RHGA 1MW2A 4GJ1A 3W7DA 5KMYA 1KCZA 4GQBA 4IQDA 2YZRA 4E2OA 1XIBA 4DUVA 4GMEA 4LEFA 4O8AA 1TWSA 4XIMA 3TYDA 4JR5A 3E74A 5G5IA 1KW1A 4M29A 3BV7A 3PPCA 2WK2A 1MRAA 2GL5A 4XZ9A 2YGYA 8XIMA 4UMCA 1PXGA 1LDCA 3GDKA 4ZSUA 4HJWA 5T9CE 3O05A 3B04A 5TD4A 3AIRA 2PWDA 2O4QA 5CGTA 2I56A 3WDHA 1GKQA 3DCPA 1T5AA 1S1RA 1WDQA 3NURA 3NEVA 3FDKA 3H24A 1GYLA 5BXRA 1KRCC 3VGHA 1BTMA 4A3QA 5HUPA 1S38A 1XYLA 3B8SA 1OB0A 4N9DA 3H55A 1XP3A 2BHZA 3S1VA 1SZNA 5I00A 1IF2A 5ECVA 4HYWA 2G3MA 4Y9PA 4HYVA 1TMLA 5F2MA 1XDMA 4ZXLA 3W1UA 1SSDA 2CFFA 3KVLA 4C60A 3WBEA 5ECUA 3TR9A 3OLGA 1FP8A 3AHXA 4OE7A 2IW0A 4O53A 1E4NA 1XYMA 3IAPA 3BSMA 5A8GA 1EPVA 1XCXA 3F4VA 4LAKA 4CN4A 4L9ZA 1UWUA 2RDWA 1T99A 1S5MA 1RQHA 4BHYA 2E40A 2I5IA 1OZQA 4A35A 2G96A 5EMKA 3TONA 2P50A 1OGSA 3GHSA 1TZ9A 3SW6A 3WLQA 4HP5A 1KLZA 1OCQA 4MYAA 4CCEA 4LVBA 5DT5A 3BTNA 5AKQA 2F7FA 2CHNA 5K9DA 4Y6GA 2A3BA 4S3AA 4O50A 4K1GA 3IWPA 3V0SA 4LF2A 3LK6A 4IGMA 1FFQA 4PEEA 3BMVA 3OGRA 1OG6A 1MEIA 1EOMA 1HKKA 4IMGA 5REQB 1JUEA 1KM2A 4AUBA 1I75A 3REQA 3RLVA 4ZO7A 3TXZA 5KSWA 4PCFA 1LOLA 3OVRA 4L65A 1X97A 4A6GA 4X63A 2FFCA 1EZWA 2PUZA 4REQB 5LNVA 3LLFA 3VAVA 1LT8A 4FB7A 3O6AA 3F7JA 4RE4A 4H6QA 5M03A 3LUTA 3ZFHA 2ZRUA 4RPQA 5A3HA 2FZMA 4K68A 2QW5A 3WLNA 3ARRA 4R7WA 3BWWA 1DKWA 3MVIA 3FLUA 4HNVA 5KZEA 1YDOA 3QM3A 2BZNA 2F2HA 2R9RA 1RP8A 4IJBA 5I3KA 4GFSA 3EWDA 3SRKA 1OK6A 1BEUA 3R2GA 1L2UA 1XBZA 3AIEA 1EA0A 3BLIA 4O52A 3LU2A 1XLMA 4H9VA 1RBAA 4HZ6A 4KWVA 5HUOA 3W2KA 2I17A 4N42A 1EP3A 3AROA 3PG8A 3AYRA 4DO4A 3WX7A 3LNMA 3T44A 1X96A 5TAOA 3G1AA 3KX6A 1XQKA 3GDLA 3QY8A 4H9TA 4WUIA 2PZNA 5AHEA 3P2VA 3KCOA 3P84A 2IPWA 1LF1A 3W38A 3PZQA 3N1AA 5DMMA 4HPXA 4WXZA 4ZTYA 1E4LA 4D71A 3UXDA 1WXZA 2F84A 2CWNA 4S23A 2RJHA 3GLCA 2PRLA 3W37A 3DOPA 3N12A 1DJXA 4F0KA 3CEUA 1QR7A 3NQFA 1QPOA 4KEZA 1GTEA 1WKDA 1AUSL 2EXOA 7REQB 5DN1A 2ZCGA 1Q6OA 3WD0A 3OB8A 3WLHA 3MJMA 1VZWA 3MHFA 2IKIA 1E6RA 2PD9A 4YS1A 1TV4A 4UC5A 1VH7A 2XHYA 4MFEA 5C9RA 5C2GA 4NY2A 2WC3A 4DIAA 4DBSA 2PDFA 4BI5A 3RX3A 2PDMA 3QSRA 4JTHA 4EAYA 2IQTA 5K4XA 3WDRA 2XGIA 1VFFA 1X8FA 5JMUA 2CU0A 2WOQA 1IIHA 4MMWA 4ICCX 5LNSA 3CUFA 2XIIA 4TIMA 4NNAA 1Q13A 1HJQA 4OU1A 1ICQA 3LGDA 4XX6A 5JIWA 4CU7A 2VDGA 3NO1A 1F7BA 1FCQA 5E70A 2J78A 5E9XA 4L7ZA 2RDTA 1PCKA 3CZJA 1B54A 2MNRA 3AI0A 3FAWA 3KOXA 3QV9A 1XLHA 4EAMA 3GS6A 2VX4A 2EO7A 1ZHAA 2YXGA 2YXXA 1FOBA 3ARXA 3KXQA 3E2VA 4O13A 3OZYA 1CGYA 1RZMA 4XTDA 3W7HA 3QGVA 1M41A 1Z89A 5JU6A 4GVGA 4IPLA 5A6MA 5F4WA 4W85A 4AF0A 4ATLA 1PHWA 3KOYA 2C13A 1LG1A 1FWSA 4UQDA 3NR0A 4JN8A 2W4XA 3GO2A 4M6UA 1NY1A 2WKGA 4ICNA 1D8WA 4LYPA 3PTMA 3N4FA 1TE6A 3GSMA 2OWXA 3N6HA 3NQEA 5HNRA 1YDYA 3BQ6A 3M0YA 2ZADA 4PL1A 3KZPA 2PWVA 2BTMA 2R91A 3STEA 2CLOA 2DVTA 3OODA 4RL3A 1L8PA 1ZGDA 3C86A 3TKFA 3M1ZA 1LOQA 3MVTA 2WC7A 1W5NA 3PHAA 2AQVA 1KLYA 1E1CB 3TZNA 1CB7B 3NQ6A 4D8ZA 3BANA 5I3DA 3DKJA 4D6HA 1K9EA 3GIPA 1K4HA 4KEVA 3B0UX 1GQJA 2GQ9A 3EYPA 4DXVA 5IRPA 1A3HA 4AZBA 1N82A 3IVSA 5T91A 2RGMA 2QULA 2CWXA 3FOKA 3QH2A 4DM2A 1IR1A 1H63A 3H12A 3PY2A 2C15A 1V6UA 4AZ7A 5ABFB 4G1KA 1YMYA 3I4EA 4AX7A 3W7LA 4FXJA 1C7SA 2XZ7A 4E6MA 3ABQA 3PWGA 1WAUA 3UR2A 3E0LA 1GJPA 2OO6A 5HOSA 3M9YA 5GNZA 2H3BA 1SGJA 4PTXA 3GXNA 1B4EA 2XIJA 2YLAA 1LZOA 2ZX7A 1WZAA 1Q2SA 3GVGA 3BURA 3TJ4A 2E9BA 4PUEA 3WK3A 1XYAA 5AC6A 2PE4A 4FS9A 2XH0A 4AWSA 2Z29A 4FK9A 4GBDA 3PUOA 3R4IA 4YTSA 3QSTA 5HWJA 3W7NA 1RLDA 5GPRA 2PF0A 3E2SA 1F3EA 3A64A 3IIXA 2PWHA 1HL2A 4M51A 4XSLA 3P62A 2IQ0A 1K7XA 1CGTA 3QZ6A 3UCDA 5CAHA 3TTQA 3P67A 4F0HA 3LHVA 2ZX9A 1OJXA 5CSYA 1W9DM 4OWGA 1W56A 4FSAA 4Q4RA 2V5LA 4DWSA 4YL2A 5CC7A 2X1RA 4UQCA 2ONEA 3G77A 4IF2A 4A2RA 3AO0A 4JEJA 1A5AA 4JQAA 4GI6A 4NP7A 4O17A 1DV7A 4WY0A 1SJBA 1EC8A 2Y7DA 4C1LA 4AVNA 3THUA 4JTTA 1BSIA 3WDQA 1V3JA 1MFUA 1N8IA 5F7UA 3UGVA 3I7RA 5EMJA 1X39A 1UMYA 1WV2A 5D32A 2VEMA 1IZJA 1DJNA 4DBEA 4J7RA 4MDPA 4M56A 4MWAC 1H5YA 3QN3A 5CSRA 3V1HA 5KTLA 3NQGA 3QYSA 1ZENA 5D9NA 4R34A 2BDQA 4K7YA 2QUTA 4JFWA 5PTDA 4JIHA 4C6DA 2ZVIA 2V63A 1US2A 4H41A 4EF9A 5LA0A 2G3IA 3UG8A 1UR0A 1XINA 2FDMA 2V8ZA 4LT9A 3OBEA 3R6IA 1XIMA 2PTYA 3TVAA 3AS0A 4UXDA 4Q8QA 3APYA 4KEMA 4A22A 1B3YA 4Z0JA 1GT8A 2WAGA 2CERA 1GWJA 2DIKA 2QJIA 4M82A 5EYWA 3ICJA 1EB3A 3MMUA 4QAWA 4UBPC 3PBVA 1K8YA 1QW7A 2QF7A 3U2CA 5KETA 4FXSA 3GB6A 5FF7A 2HBVA 1N55A 3C52A 3ZWTA 3C8FA 1Y7VA 3S0CA 1U1HA 3KE0A 1I2NA 3ITTA 3QQ0A 4JZ5A 3D0CA 2CYGA 3KWSA 2D73A 2A85A 2C18A 1B5TA 3O15A 4F2BA 4DJDD 3MDUA 3C4UA 3F4NA 1ADSA 4IMDA 5FJUA 4UZUA 1WUEA 4F66A 4AHQA 2C1GA 1ONRA 3T7VA 3S2CA 4HOXA 4A8RA 4EP8C 1QNSA 3CTTA 2WSYA 1F9CA 3C3UA 4MGGA 3L23A 3HMCA 1FWWA 4ZQMA 1P43A 4X9YA 1J0JA 2ACUA 4NRSA 4PUDA 4QDMA 3OHMB 2NQZA 3AS2A 4M3PA 4BQ2A 1LRQA 3TW7A 3HPXA 4C7GA 1EBHA 3TAOA 1BQCA 4NU7A 3TSMA 4IICA 4Z08A 5A6AA 1M5WA 3HA1A 3UJRA 3GFZA 1Y5XA 2H9AB 2J7DA 5F2GA 1I2OA 3QW4B 2W63A 3SRFA 4HNNA 3FHAA 4GI4A 5F4SA 1H1YA 3ANYA 3AHVA 1DJYA 1OFAA 3LDVA 1UA3A 3VX1A 1DP0A 1LBLA 4I8YA 4Z2IA 3N15A 2R8WA 4IOTA 4IM4A 3GE7A 3CHVA 3LS9A 1KWGA 1GHRA 3PSWA 4S3GA 4GZEA 1GEHA 4YMZA 2XDFA 3W02A 2PDHA 2VCAA 4W4QA 1XYBA 3W7OA 3DYPA 3N04A 3BLFA 4IMAA 4E38A 2J7EA 4ZBCA 4HNLA 2WV8A 3PUDA 3KBWA 3V18A 1PAMA 4GO8A 4PB3A 4IZGA 2TYSA 2OLSA 2WZTA 2OGJA 3L0NA 2FHCA 4C1NB 4BK9A 2HTMA 2PDYA 3WQVA 1KR0A 3J7HA 2D2OA 3T9PA 3WJZA 2NUWA 1X1OA 1NP0A 1PIIA 1V6VA 1E9LA 3TJXA 1U5JA 1A5NC 4QEHA 4YXGA 4W7UA 2V81A 3NVTA 4DJEC 3T1GA 3AU2A 3WH7A 1UUOA 1P0BA 3W75A 3FSTA 1G9HA 4LS1A 3HPFA 4C6IA 3M64A 5HQEA 2PDBA 3DHFA 2VEPA 4MYXA 1LG2A 4N9BA 4DZAA 4YIWA 3QY7A 4HA4A 3I4KA 3WQ8A 3OA5A 4C5ZA 5LNWA 6ALDA 4AZ6A 3G1SA 3CYJA 4R85A 1NWUA 2AL2B 4BZYA 3NSMA 1FHUA 4Q8MA 1M03A 4XWUA 3L4VA 2P53A 4NXSA 4JTCA 4B90A 4EF8A 4A8IA 1DJQA 1W3IA 3LLXA 5LHEA 6TAAA 2Z7GA 3EKLA 5T26A 3TC6A 3W7CA 1GEQA 2XN0A 3DKLA 3M5ZA 1VC4A 2XFYA 3CPRA 4EVZA 5A2BA 1PKYA 1J5SA 3MYPA 4C65A 1AW1A 1KXTA 2Z1WA 2JKAA 3PJXA 1Z44A 1HP5A 2BGQA 2QPXA 2ALDA 4NHVA 3MSDA 4MB5A 4MUPA 2YBUA 5HINA 4LOCA 3NZGA 4QLLA 2XPKA 3ZOAA 3A5VA 1HKJA 2ISFA 2Y8KA 1UR4A 2XINA 3BV4A 1V3IA 3IIPA 2Z1BA 3RUBL 2V3GA 2ODOA 2D2HA 3ES7A 1YHTA 3MKCA 3M0MA 2WZMA 4C7FA 3H2EA 1XLIA 1HJUA 3SUTA 3WQWA 4NRRA 4ES4A 4IJCA 4US6A 1MDLA 1HKVA 3ERPA 3GFXA 4IIGA 2PC8A 1DWAM 2RFGA 3CK5A 3WD2A 4KGJA 3EDJA 4OBSA 5C9XA 1UR2A 4YNGA 4XZHA 5EMLA 3S6OA 4WEVX 1BXBA 4JTJA 3K5XA 5C2CA 5HBFA 1Q6LA 4BA0A 3P60A 1RJRA 4JEQA 2OX4A 3H22A 4UR9A 3UXAA 1TPH1 1HJVA 1IGWA 1GQLA 4NVTA 1BKSA 3ITLA 4YVXA 1AJ2A 4WDWA 1PKLA 1TRDA 3MBFA 5CZ0A 1OC6A 5D4YA 5KITA 2ZXQA 1M3UA 4LUSB 2DW6A 2QCGA 1B90A 2EG7A 4BCEA 5E09A 3KBJA 2GUUA 1K9DA 2PTZA 2VRKA 5FF2A 3GVQA 5CH9A 3GBDA 2VC7A 3PAJA 1W1YA 5M1TA 5JVLA 2BOEX 5HR6A 3N9RA 4OUIA 5FEZA 1K9FA 3A9BA 4QTGA 2YB4A 2GK1A 1HFBA 3FYPA 3QMRA 1H7OA 1FH7A 4D8LA 2HCVA 2WVTA 4GI9A 1JF5A 5C71A 4NX5A 4GBUA 1QUMA 2VVNA 1CLXA 2DT2A 1P0KA 2CZDA 4GQQA 3GVVA 5AOUA 1UZ4A 3R0UA 2XTKA 1Q6QA 2BOGX 2CLEA 2IXUA 3SCTA 4PN2A 3EX1A 4JTFA 3T6CA 3DG6A 3RXZA 4PTWA 2XISA 1YADA 4P8VA 1TQXA 2J7HA 1OHLA 3WD3A 4ZB2A 2ON3A 4W5ZA 4O1CA 4NZ1A 1XH1A 4TTUA 4B5VA 3GXPA 1Z3NA 3N11A 4DJFC 1JNEA 1L6SA 3BCFA 1UC4A 3B9NA 3PFMA 4NASA 1W3JA 2WW5A 2NQLA 1ZLPA 1LUCB 3AHZA 5LIYX 3LHUA 5EMYA 1QWGA 2FJKA 1GYNA 1J0ZA 1WX0A 1KNWA 2ZOXA 3M07A 3MQTA 3VUPA 1TRIA 5BMXA 3RGTA 5FEWA 3POCA 5GQBA 2VM8A 2CBJA 4DZ5A 3I6EA 1B1YA 3R25A 4JHZA 1XLBA 1XLEA 1BPLB 8A3HA 4LW7A 1XLCA 4IFOA 3VK5A 3CTLA 3Q4DA 4N4PA 5A6JA 3VZZA 4Z1AA 3ALFA 4S3BA 4ZB0A 2WWCA 3UYIA 3R8HA 4AZCA 3RX4A 4HTYA 3DFTA 4S3KA 4LRSA 3IV3A 5IDIA 4Y9NA 3WLLA 1F4AA 6XIAA 2IPJA 2W62A 1X6LA 1R86A 3BW4A 4LANA 2PGRA 3LRLA 1J96A 3AICA 3MCMA 3PG9A 3LHZA 2YX0A 2G3FA 4W8BA 1L6GA 1HVXA 1W1ZA 2QCDB 3SBFA 3DFQA 3CS2A 2BXVA 2Y4SA 1ZZMA 1TPDA 3G24A 4JTSA 2QJNA 2J9XA 4HZMA 3VDHA 4DWSD 4JTDA 4QAIA 1ZBCA 2PDXA 1WDSA 4PMVA 5JUVA 1FUYA 5C6MA 4UTLA 3VU2A 3S5NA 3TU9A 1UPPA 1E1FA 3UR5A 4I7UA 3DG7A 3VD9A 4MWAE 1KFWA 1TV3A 4DYKA 5CPTA 4U10A 1R9XA 4EXBA 2XG9A 1U1JA 6PTDA 4LVGA 5MF5A 2ABAA 2WNQA 5BU9A 3RCMA 3THQA 4GQRA 4RDYA 2VFGA 4CNNA 5HJLA 4O54A 2IS7A 1W32A 1OYCA 3CO4A 1D8CA 2E9MA 2OO0A 4S3CA 4MZYA 1ZAIA 3SCOA 3VOGA 3SQSA 1DEDA 1UP2A 3OGSA 4HQVA 2ACQA 4HT3A 5HNUA 2DZXA 3G6LA 1IEXA 1NFGA 3TQPA 1V6WA 1FH8A 1PDYA 4HMEA 4FNUA 2VEFA 4MM1A 4H2CA 4P8UA 2ALRA 2JFEX 4OGZA 1WKEA 2EPOA 3ABXA 2YCIX 5DX7A 1V3LA 4DEFA 1UD3A 2W0UA 3UJEA 1EDQA 5CJ5A 3O07A 4QE4A 3WH8A 4CNUA 5LZLA 3S6DA 4HHPA 4C6EA 3RPMA 4WSHA 1XFCA 5FJTA 2NT1A 4ZTXA 3NZRA 1EUNA 1GW1A 1ZCCA 3A4WA 2WNNA 2HVNA 3N9KA 4I7VA 3S5OA 4XD3A 4YTTA 2NT0A 4O11A 3QKZA 1S3HA 1CXFA 4CNTA 2DQWA 2XFWA 3OGVA 3VGBA 1GOOA 3VIJA 1REQB 2WHLA 3TTYA 1GJUA 4P2VA 2J75A 3WDIA 2R1MA 1R3YA 3CT2A 3SURA 4RE3A 4MJMA 4ZVJA 3W70A 1EWEA 3TN6A 4J3ZA 4WX2A 3VX0A 1FWTA 2EJ1A 4QS6A 3W72A 3S47A 4MVAA 3WUGA 4HN4A 1PTDA 4FNPA 1F3TA 2QJJA 2W9MA 1PWLA 4RNJA 3TXVA 2JKPA 3QTGA 1W9PA 1UIOA 3VGGA 4LVFA 1L0PA 3IVUA 3GDTA 3MCNA 1WUFA 3PUEA 3KUMA 4E3VA 5K9XA 3OIHA 1JGIA 1ICSA 1KTBA 3W1PA 1KCLA 4GNKB 4K6AA 2B31A 2Y5EA 2ZWYA 2XU2A 1HJSA 1R9ZA 1NDVA 3EDFA 4IISA 1JIBA 2QV4A 4YLWA 3EWZA 1IV8A 2W91A 4Q6XA 3A4XA 1S39A 5ABGA 3W22A 3ZR4A 1VFMA 4UUIA 2REQB 3CIWA 3CU2A 1MEHA 4U2YA 5A6KA 1U22A 1E9ZB 4QROA 3E1F1 5AB3A 5BRQA 3AOFA 1WYIA 3EOSA 3TYZA 2NQ5A 4TR9A 4I5RA 1H50A 3GTHA 1ZP3A 4JTQA 3DHDA 2VKZG 5DELA 2Z1XA 4HOZA 4NQ1A 4BFAA 1HZYA 4BF9A 4QXIA 3QQWA 1EWDA 1SM9A 3SUUA 2VFIA 5FI8A 2F61A 3SB0A 4GA8A 4C6NA 3EDKA 7ODCA 3DFSA 3W24A 3A47A 1PTAA 3TYBA 1X1NA 1KBJA 4S1FA 1GVRA 2J24A 1EBGA 1WXYA 4M0XA 1C9DA 3ABZA 4ZQCA 5BWAA 4B5TA 4EE9A 2B4GA 3T78A 1EHAA 3DC8A 1L6FA 1YNYA 4GCXA 2ANUA 2ISVA 3ME3A 3PNZA 2GJLA 7TAAA 4WR3A 1S2VA 3H4XA 1MFVA 4JBRA 2XN1A 1JPMA 4PTVA 5HJXA 3JW7A 2PPGA 2A79A 3W83A 1ZQ5A 5AVNA 4FNSA 2DVUA 2DH2A 4O0ZA 1OT2A 2NSOA 2GVJA 2AAMA 3BH4A 3PPGA 3UETA 1KBLA 5FIPA 5CAKA 3TR2A 1UJQA 3TW9A 1M7JA 2DPEA 1RVKA 1C8XA 3RK8A 1VBJA 4JFUA 1EKOA 1K6WA 2WSPA 3CMJA 1F76A 1JPDX 3SIZA 2PGEA 1KCXA 4RNHA 4DPPA 2NX3A 1HN1A 4DLFA 3LB0A 3GBEA 3WNKA 3UG5A 3CUXA 4L4LA 4NSBA 4IH3A 5REQA 1TPUA 3XISA 2JE8A 4WKAA 3AQUA 3DU0A 5E6YA 3AMGA 3G8RA 3O6CA 3E49A 3C2OA 1FWGC 1SW7A 4W86A 4OQVA 3LHWA 3REQB 4LBRA 3I65A 2FB2A 4REQA 1FDZA 3CZKA 3TMLA 5A6SA 2ZUSA 1GVIA 4JKLA 2VDIA 5AHIA 3AIBA 5GJPA 2NQ9A 5LSMA 3H8AA 3Q58A 4ERIA 3AXMA 3GVWA 4PFHA 2ZA1A 1IEIA 4Z2LA 1BVWA 3DAQA 5A6TC 1QOPA 3AXHA 3V0UA 2ZTJA 1AJ0A 2HXUA 1SFSA 5I79A 2OOGA 4QM1A 1C93A 1W2VA 3OPSA 3NPWA 1RBOB 3TFCA 2QVNA 2PODA 1BYDA 4I9AA 1I9CB 7XIMA 4IGSA 3AIWA 3W71A 3A6OA 3WF1A 2X8RA 2VX6A 1GQNA 1V79A 3P0XA 4GIAA 2PDQA 1QBBA 1R6WA 1O68A 5E0CA 1TTPA 3E5BA 3PZVA 2PTXA 4DI9A 1KGWA 2XIBA 3NFUA 2O0TA 3WLOA 4O0KA 4OFCA 2O56A 5HMDA 1W8GA 3M41A 4JPGA 3RO8A 3U2ZA 3A3WA 1SJAA 5BOOA 1XUUA 5LIWX 4AWEA 3D3AA 1BYAA 2WSQA 3FN9A 4N02A 1R8LA 1CX9A 2FFIA 3WBAA 3HV8A 4U2ZA 1R7AA 3U5UA 5FL0A 4BEUA 4GYFA 2VVSA 4W87A 2V2CA 3SCRA 3O9NA 2OU4A 2UY2A 3M4HA 1TMHA 3WLTA 2X2GA 5I78A 3G0XA 1Q5MA 2Q6ZA 2CBUA 2JKEA 4LBUA 3UXKA 4IFKB 5EFFA 3WLMA 2V9DA 3EMCA 1TZ7A 3CZEA 2FH6A 4I90A 4ZQRA 1OGGA 3T0DA 1B3OA 3MC5A 4DBDA 4V1XA 3W1NA 1HTIA 7REQA 2OT1A 3TFXA 3CUJA 3OZMA 4WLCA 3KS5A 4GZ7A 5D02A 4JIQA 3TJLA 2WJFA 3NWRA 2O55A 1M01A 4MNJA 1K70A 1W1B1 4PULA 2A3AA 1ZY9A 1KM5A 4ADUA 5DFAA 3VNYA 2PS2A 4PTMA 4TQTA 1ME7A 3L2LA 3Q37A 1L8NA 3SAZA 1CW2A 3WQOA 4MF4A 4V33A 5EA9A 3VE7A 2GGJA 1MO0A 1HJWA 4KERA 3HPZA 4Z1YA 1ZS2A 3A5FA 4LV4A 1TA3B 3ECQA 1RK5A 3OIXA 3A13A 2A1YA 3CL8A 3UQNA 4GUFA 3LD5A 4NNCA 4AEOA 4J27A 1XBVA 4RR4A 4G7EB 5G1TA 1U83A 1E70M 3G5EA 3CNYA 4P7QA 3HV9A 4D6GA 1POJA 1TB3A 3CMFA 4MG4A 3VYLA 4XZMX 3VOIA 4C6BA 3KHJA 3MKVA 3BCJA 5LNUA 3GG7A 3H2MA 1WKFA 2GPTA 1C29A 3AYTA 5FAGA 4TOQA 2E1DA 4KCUA 3HGRA 2J88A 3L2IA 4PB5A 3FJNA 4AF0B 3NYDA 3KOZA 5TIMA 1P4CA 4HA0A 4XBKA 1VCGA 1ECQA 2GZXA 3QR0A 3A24A 4IWWA 1G69A 2OXNA 4G8TA 3RM4A 2A6NA 4MKNA 3VIIA 2R24A 1XGEA 1CXKA 1O1HA 4IX0A 3MUY1 4JICA 3DESA 2YW4A 4HD5A 5GNXA 3G1FA 3WNNA 2D0GA 1VYSX 1VCFA 2AKMA 3GDMA 4N9CA 3CQIA 3OTRA 1VR6A 3RILA 3C2FA 1BG4A 4MJ2A 4A29A 2PZ0A 1A3WA 3MMTA 5F4XA 4LUJA 3VMNA 4CGTA 2ZDRA 1G4PA 1E1CA 4GQ0A 1DWFM 3VNKA 4BY3A 1YXCA 3TC7A 1FQ0A 1PDZA 3VVGA 1HL8A 4PRWA 4DZHA 2P3ZA 5DXYA 5AN7A 4GX8A 1RP9A 1W5MA 3I68A 1WPCA 3VGFA 1MEWA 1JXJA 3MDWA 3M6YA 4BS0A 1DJWA 2J8FA 4QIUA 4AEFA 1Q6EA 5FF3A 2WVSA 2ZICA 4EKJA 1CYGA 3Q65A 4JCLA 4C6MA 3QOMA 2Y7EA 4E4FA 1RCQA 5ABFA 4J2PA 3N18A 3DYMA 4CNPA 5K4ZA 1GQKA 4KWWA 2PDWA 4IJRA 2ZX6A 3CWOX 3VKAA 1GK8A 4M24A 1E0UA 3BLKA 4I3GA 4ATDA 4RNFA 3K46A 2VHLA 3MUCA 2HVMA 3WMLA 1NDYA 4OJYA 3QXBA 2XVKA 4ROPA 4D8AA 3N3TA 1VS1A 1O5QA 1ESWA 1EJVC 1RD6A 3R79A 4ZQNA 3GU9A 4EWND 3L21A 2JF7A 3LV6A 3UVAA 1K77A 3WO8A 3LENA 1EGVA 4GACA 1XH0A 1JZ6A 3KLKA 2X09A 3KTCA 4JYEA 5D30A 3TV8A 4DXKA 1JZ2A 3ZJ7A 3GXFA 1J5TA 1UH4A 1B9BA 2ZRZA 4EOUA 3NUKA 4A21A 4DJFA 3G1RA 4B4FA 2TAAA 4E0CA 1TVNA 4B3ZA 1Q7QA 3N2XA 3II1A 1GG1A 2ZRYA 2ZRWA 2J66A 2POTA 5D8ZA 3UZJA 4DWSB 2EPMX 3TW6A 2Y88A 3CV1A 1W3HA 2ZX5A 1XSKA 1OX6A 4R88A 2WMGA 3SUSA 3I7QA 3HIJA 3TNOA 5AZ0A 1L9WA 2BXYA 2WZEA 2ZC1A 4HNOA 3KFTA 3CHDA 3TSDA 1Q7MA 4L64A 3N34A 4UTJA 3LEPA 3NVDA 3LGEA 4AD4A 1PYMA 3EKGA 3S42A 4HPHA 1BFNA 4LV9A 1O4UA 3RM9A 3MSGA 4PUUA 2XWEA 2A7RA 3G1YA 3TP4A 1CEOA 1Q85A 1VJSA 1WB0A 1LOSA 2AMGA 2QIWA 2NZLA 4NIRA 3WLSA 1H09A 2V82A 4TU1A 2E68A 4CNOA 2DZTA 2PGWA 1R3TA 4UQBA 3ZJ6A 1UR8A 3CQKA 1O6IA 4UTTC 3VCCA 2I57A 4LY8A 2PFHA 5BOEA 1HP4A 4NJGA 1P48A 4P5UA 3S1WA 1CCWB 4KIRA 1LQ2A 1THFD 1Q4WA 3CHEA 4RV3A 2CXEA 3GVRA 1VLIA 5DMLA 3E0VA 3R11A 2QCLA 2EKCA 3HPSA 2Q8LA 3RIKA 2CHRA 2PLJA 2VDHA 1LLWA 3UCQA 1TPFA 1FDYA 4UTMA 1O7AA 3IEBA 3T8LA 3ZJKA 4O18A 3L2MA 5E6ZA 2D24A 3NQDA 3B8IA 4E4PA 1A5OC 3IJLA 3BGGA 4HK7A 2VI0A 2BVDA 3GH7A 3FXYA 3URNA 1TTJA 3S9IA 3LTPA 1GCYA 5AYZA 1TV5A 1UOZA 1HL9A 3ZSSA 3GNXA 4ML4A 1SZFA 1TX0A 3NSNA 1IGSA 1YXYA 1YLVA 3GDBA 1JDAA 2QDEA 4MWAD 3OOQA 4GYPC 1FCVA 1P1MA 4MAZA 1E6XM 3V5OA 2WANA 2XFRA 1PIFA 1Q8AA 2GUBA 4J3TA 3HGOA 4J3UA 1NVMA 3AZRA 3RYSA 4XUGA 3DUGA 1NF7A 4RE2A 4PB4A 4Z1DA 4HNCA 5AHMA 1WO2A 2CZFA 4Y8FA 5EMMA 2WM0A 4ZFMA 3QBUA 4G9PA 1W8SA 4L5ZA 3CB3A 4XAGA 5CGQA 3FHQA 1KFBA 5A8QA 4AISA 4PMJA 3TQKA 1IT8A 3K1GA 5DCEA 2VURA 1I6NA 5BCAA 5FA5A 2ZUVA 2CBIA 1U5VA 2AL1A 4K1WA 1YW1A 5AHNA 5J04A 3ZXWA 1CXIA 3ARZA 1PPIA 3WQGA 4PSPA 4WGHA 2XVNA 1NF0A 1O1ZA 4CCCA 3N6QA 3UYCA 3KCJA 4NAFB 2D20A 4B15A 3OQEA 4FNQA 2X0YA 2BB0A 5LGXA 4RXFA 9RUBA 2YL5A 4R7OA 1RVGA 3V4BA 3VOJA 1UR1A 1Q6DA 4N4QA 3QZEA 3QGAC 4D6IA 1UD5A 4FLQA 3VNZA 5C9UA 2W67A 4DQWA 1PV8A 1F3XA 1GVYA 4YHEA 4B2DA 2BG5A 4UTKA 1H0GA 6XIMA 3UPMA 2NVDA 3PULA 2ZA3A 1BWKA 1R2SA 1EDGA 2NW0A 3PNUA 4CQDA 5C54A 3M5VA 3AJXA 3VCNA 5AYXA 4XZWA 4HU3A 4G56A 1K1DA 3A9IA 2OYMA 4C1NA 3C2VA 4M19A 3M7WA 4ZOCA 1Y5VA 3OU8A 5IFTA 1IXNA 3CLMA 1ZTVA 3TE9A 2QHAA 4JHMA 1XGZA 3LOTA 5F1UA 4WGXA 5DCBA 3WLRA 3ZT5A 4DO7A 3ARPA 1A4MA 2ATMA 1BRLB 4IT1A 2ZYFA 4QBXA 3L4UA 2F38A 4RNIA 3DGRA 1TE1A 1W5OA 2D69A 2OLHA 1UQZA 1PJ9A 3KS6A 1UR3M 1WNOA 1GZJA 1FX6A 4WSKA 3CPUA 2AL2A 3LGGA 4JN7A 4N0RA 3EWWA 2Q71A 1OC5A 2HE8A 1H7RA 2PDKA 2BV9A 2EPLX 5A8NA 1J0IA 4IMCA 3AMCA 2XZ9A 4GXWA 1XSIA 3SR7A 3N2TA 4EWJA 2EGZA 1M7XA 1K3UA 3H2CA 1C7TA 3EXTA 4LTSA 1H7XA 2DSVA 3DC0A 2JGYA 1GKRA 2J7GA 1V02A 1FKWA 1A5BA 1OM0A 1TUXA 3WLIA 4J2MA 2HWGA 4FF5A 3VNDA 4PRRA 1W54A 3QV7A 3QF0A 4PUMA 2CZ5A 5D33A 1YPXA 1BYBA 1KQYA 4G7FA 1GOKA 1UMLA 3BJFA 3GNRA 1XYCA 2E67A 4IPIA 1NARA 4H6EA 1UWIA 2PCQA 4P8WA 4Q8NA 2FKPA 4NZ5A 3F1QA 3TNBA 3MHUA 4UQEA 5A5WA 3NPVA 4YYCA 4YVPA 1AH0A 4Q8TA 1KWKA 3LCHA 4MLJA 4RPPA 4LUTB 1YBQA 1DQWA 3U4FA 5D2XA 5CCZA 1TJ2A 2IPGA 1AL8A 1OYAA 1PVNA 2ISWA 3K1DA 2Y24A 4W8AA 1O5KA 3A21A 1H2JA 3SY8A 3MKKA 2C71A 3STFA 3WK0A 4AIUA 3VA8A 3N19B 1CXHA 4GVIA 2XIQA 1GVEA 1ZL1A 1FWHC 2CPUA 5HMFA 2E4TA 2WKLA 3F4CA 1MQQA 3R43A 2BFGA 4GX9A 2J47A 4LUSA 1N2VA 3BLOA 1EA9C 2GQ8A 3MI2A 3PP7A 1W1TA 3A23A 2GGGA 3VNJA 3VDAA 3FCPA 1JCNA 3W1AA 2B7QA 4L61A 1E51A 2GVEA 1TPC1 1I0DA 2A2IA 1DWIM 2VGBA 4JGDA 4RZ4A 4A3YA 3W6YA 3ZVHB 1J18A 3OZOA 4XTIA 1OD8A 2OZTA 4QQUA 5M3WA 1CXEA 3WENA 4YTQA 3E02A 4H9MA 2QZRA 2DT0A 4W8LA 2QGHA 3HFTA 2X16A 4GYJA 3L68A 1XRFA 3IGUA 4EACA 4G5DA 3ALGA 3WUFA 2JGQA 2B7NA 1QU4A 3RU6A 1E0XA 3FJ6A 4K2SA 5K3VA 4K8GA 4Z0SA 4Y8EA 1MQRA 2P8BA 3L4XA 3G22A 5C7VA 1FWFC 4PMRA 2DT1A 4PCTA 5C5YA 4IFRA 4O1BA 1LUCA 5G2WA 4Z1BA 1KBBA 1MZRA 1CBGA 7ENLA 2EF9A 3WJWA 1W9BM 1TWZA 3DFYA 1VBGA 3V0TA 1K02A 3BG9A 3SGZA 3EX3A 3BW2A 4QGCA 3WG6A 3DENA 1VPXA 2NX9A 1AZ2A 3SCWA 2PURA 2Z2BA 2A21A 3L67A 3GG1A 3UZZA 3W2UA 4J3XA 3ENLA 5FSDC 3F2DA 1B31A 2QJGA 5A8PA 1SYTA 3QKEA 4RW5A 3E0FA 3O0KA 1CPUA 5BRBA 2PWGA 1R85A 1IYXA 1M53A 3CIXA 5IXEA 1XG4A 3NOEA 1ADDA 1VD6A 2IQDA 1UIPA 4E5TA 4HHHA 2R1LA 3NL3A 2PC4A 4MZ8A 1JZ7A 1QW9A 2Y1HA 4AMAA 3UY8A 4O19A 1SJCA 4BQ3A 3PZIA 4BF5A 1W17A 3T55A 3LXAA 5HJYA 5DT7A 4IHCA 2QCDA 4DX3A 2D0HA 4CQ8A 5I02A 3ARYA 2BP1A 2ZFAA 4DJFD 5G1YA 5BROA 2OZ0A 4AXNA 3L65A 3AIUA 4PUWA 3QGKC 3VMOA 3QLLA 4LAMA 3KLLA 2ZUTA 3OHIA 1VLWA 2DV0A 1OQFA 1P0EA 2Y8UA 2Q01A 5XIAA 2FH8A 3GH5A 1GZGA 4HIBA 5C8BB 5GVJA 3P5YA 1FFRA 2A4AA 3NQ8A 1X38A 3MB9A 4UMAA 4AFYA 5G4HC 4HA3A 2DZAA 5JBEA 1WCGA 2WLZA 1J4EA 1KFCA 2GWGA 1H0IA 4UOZA 3W85A 3P3BA 4PMYA 4CEUC 3OVQA 4BI7A 3VGEA 1BF6A 4ILSA 1C3FA 1XI3A 3I3BA 2J9ZA 4AY7A 1Q2RA 3QYQA 1AD1A 4LXFA 3AYVA 5C70A 3KRZA 2CEQA 3LY0A 3WMSA 3VO0A 4UIOA 1JI2A 1QI4A 3FGCB 4GRSA 4PA8A 1IQ8A 4G6CA 1A53A 5DRCA 1PKNA 4DB7A 3NA8A 1S5NA 1WXJA 1XDLA 3GHRA 4AZ5A 3KVJA 1M68A 5FACA 3WK1A 2R1PA 3M0HA 5EBUA 1A49A 4WRHA 1Q6CA 3CM4A 4ZE5A 3W2JA 2CBVA 3ZIZA 1XCFA 3B0YA 1VF8A 3BCDA 4FLOA 4DLMA 1ZP4A 5IBXA 1OFRA 1KR1A 3WQDA 5SWUA 2E3ZA 3VKKA 5A6BD 3SADA 2A3EA 3IS4A 1EC9A 4LC8A 2EAWA 3R5EA 2OG9A 2V0TA 1E9IA 1UROA 1VRDA 4FA3A 1FRBA 1RHCA 3ITYA 1R7OA 1TPB1 4HU4A 1JYXA 4GQGA 4GI8A 1RQBA 4ZZ9A 2OR2A 3TWBA 1DJIA 1ITQA 4HSHA 1QATA 2C1IA 3B8DA 1VQTA 1AQFA 1R46A 3CZLA 3GUWA 3EMZA 3R10A 3STGA 4FOJA 2PDIA 3SQMA 4W88A 1MMFA 4AC1X 1DXFA 5E0FA 1SFJA 4JTKA 1A50A 1SQ7A 1R3WA 5XINA 3MANA 3EOOA 3TA9A 3ZR5A 3VKBA 2PDPA 2ZXBA 3LZ5A 2OPJA 1OFBA 4GKTA 3QFWA 1H5VA 5A8MA 1V7YA 4JDBA 1RH9A 3HQPA 1M04A 1CLVA 2I5GA 2ASHA 3AMDA 3W76A 4B5WA 3WLPA 1XRSA 2REQA 3PF3A 4FI4A 4J3WA 1CLKA 3QHNA 1R3RA 1SO3A 4MNMA 1FCUA 1V93A 1US0A 3C2EA 1OABA 3LBMA 1EH9A 2MANA 5CC3A 1L6YA 1RCXB 1XCWA 3CAQA 3LCXA 4JX4A 1F2JA 4RV8A 4B2DD 1EIXA 1B30A 4XD6A 1EZ2A 4UMBA 3GKAA 1B3ZA 3WQCA 3F2BA 3CV6A 4H4IA 3DERA 3PM6A 1WDPA 3NXLA 2E6AA 1Y0EA 3TCSA 2Z4GA 3TA6A 4XZNX 1BWLA 3BG5A 3P14A 4GISA 1W6TA 4IX2A 1S2CA 2FZNA 1WAWA 3KTXA 5DBUA 2XVPA 4DJDA 4OZOA 1UUMA 2HZGA 4MWAB 4A3RA 3APTA 2QR6A 1LQ0A 1GVQA 4JHOA 2E5BA 3TX9A 5FJOA 3U0HA 1HW6A 1V3KA 4AVFA 4B3KA 5G4EA 2QT3A 3OBAA 3WJSA 1EJXC 1EP2A 1S5VA 2Q8ZA 2O92A 3BG3A 1KBKA 3AHTA 4RZ5A 1JF6A 4W93A 1RPXA 3GAKA 5CPSA 4GHRA 4MDOA 3G3MA 3CV2A 3N2MA 2OSWA 4ZOEA 4XSMA 4OVXA 3K8LA 1D3CA 4G1NA 5E9AA 3T0TA 3ZT7A 2WHJA 4BJHA 4GK8A 5C2XA 2RJGA 3DHUA 1UHVA 4JTIA 3LXCA 3SGGA 2WMJA 5A2CA 2UWFA 4MFDA 4GWEA 4ENLA 4E8GA 4IQEA 4GPNA 2XYLA 3N3MA 5D2VA 1MRQA 3H53A 4IG2B 2A3CA 3S1UA 3UZWA 3RRAA 1G1YA 4QSFA 2J4GA 2VZOA 5J5DA 3W1QA 2VR4A 1FH9A 2JK2A 2BGNE 2PRMA 1WZLA 3WFLA 4HNTA 5BXTA 1FKXA 3ATYA 4AHOA 3IJ9A 3O6DA 3DFPA 1LJYA 3PZGA 2JEPA 4Z2HA 1B57A 1ITCA 2CKRA 3M0JA 1Q6GA 3GU2A 3PJTA 3O0FA 5K7JA 2FZ9A 3IUHA 1LWJA 2DZBA 1KC7A 2V69A 3EEGA 3GW0A 3UF9A 3TEVA 1XIFA 4LYQA 4PMNA 5CG0A 2VC6A 4H1ZA 1IT0A 2V5KA 1KTCA 4M8UA 2UZ9A 1GOQA 4O15A 3XIMA 2HEJA 3W1RA 1KTNA 2E8YA 1KXVA 4DM1A 3KOWA 2Y89A 3N2OA 3HBLA 1GG0A 2FPTA 3K8KA 1R2RA 4JCMA 4RE0A 5D9OA 3DFHA 3WBWA 4BQ4A 1V03A 1W1IE 3QV6A 1IEVA 1JDFA 2I1OA 1ITUA 3GG8A 1TX2A 4LRTA 3SSJA 4UTWC 5D2TA 3EPOA 4XZIA 3MMWA 2DFAA 3FIGA 3WNOA 1QK2A 3DYOA 1PIGA 3UVIA 5CPNA 1JYVA 1PSCA 4DF0A 1WDRA 1KO0A 2DVXA 2OMAA 2X0SA 1I60A 4Z17A 3CO8A 4ATWA 1PHQA 3MU7A 4INFA 4MY1A 3AUOA 1M65A 2Q8XA 4P7RA 1JR1A 2ZZ6A 2WM1A 4RW3A 2PF8A 5IDZA 3NQ2A 2GWNA 4IFKA 1XD1A 3LRKA 1MDRA 4H83A 2X41A 5D38A 3UR7A 2OVLA 5D05A 2DZSA 4J9JA 1TKKA 1QBAA 4LJ3A 1UZHA 3DFNA 2WQPA 3GXMA 2AQWA 4LCRA 4B9ZA 3PSVA 4GH1A 3T0AA 1OZMA 4A8NA 3VIFA 4LBSA 1MUMA 2EG8A 3UPBA 1RCOB 4CN1A 3RDKA 4Q8VA 3RM8A 4L1GA 1UD2A 2V68A 3ZQ9A 2C0HA 3WMBA 1DTUA 1VCVA 4US5D 1MSSA 1OEPA 3WQ4A 1LWHA 1FWAC 1UD4A 3E2QA 1HGWA 1DXIA 4DYJA 4H2HA 3NPUA 3NDYA 4GNJA 1TA3A 1BF2A 4JNMA 1QPKA 4ZQOA 3I7SA 1KFKA 4DN1A 4L80A 4GIEA 1EIBA 1NH6A 4H7CA 3MA8A 2PDLA 3ZR6A 4TV5A 1OX4B 4CQCA 3QPYA 4H04A 2CLLA 2YA1A 4X2PA 4QP0A 1JDDA 2Z7KA 5DO8A 3RLHA 4H9XA 4RXGA 4G7EA 3S2NA 4B5NA 1TV2A 1MUCA 2ISDA 1HGYA 1IXOA 1ALDA 3BLLA 1EEPA 2B81A 4OOUA 1JYWA 4C1KA 1DWJM 3FK4A 1LM1A 3L4YA 3MI3A 4HK5A 4LALA 2XIOA 4L56A 2YL6A 1WBHA 1D3GA 3NXFA 3QHOA 1E4MM 1QNRA 4X61A 3E0IA 3O3RA 1UB3A 1DIKA 2PGFA 2R6OA 1OD0A 1XL9A 1UA7A 2J6XA 1QXLA 3KBMA 3NGFA 1D3HA 3ELFA 1DQUA 3EOEA 4IXHA 3MO7A 3UJSA 3W6MA 4HZ8A 3K30A 3PTQA 3O2LA 4PSRA 2X7WA 3URAA 1LBFA 1VJZA 4XQ6A 1RR2A 3U5YA 1WQ5A 3ANUA 2IKJA 4I5UA 2HSAA 2X1UA 4EXQA 2OTDA 3GNPA 4AXKA 3V3WA 3ZS4A 3RAOA 4UNLA 2QCCA 3G6MA 3EB3A 4TVDA 4WJEA 1QASA 4KRZA 3BW3A 4F0LA 4HCDA 4PMQA 3RR4A 4UQAA 3W25A 1J12A 4AG0A 3T4CA 3UERA 4KT2A 3UXLA 1JQVA 3VIPA 5BU6A 2C79A 4BI6A 4QNWA 1UR9A 2OSYA 1F3WA 2EKGA 3MJYA 4NJHA 2D2JA 5AC4A 3H4WA 3DX5A 2NV2A 1H1ZA 1GYMA 3KL3A 3HG3A 2G4FA 4AWTA 1JCMP 3SI9A 4JIIX 3ARTA 4D9PA 4J4KA 1FWCC 2J62A 1V51A 2OKTA 3WDJA 4Q8UA 3L4WA 4AEEA 4F9JA 3N9SA 5CZKA 1LL4A 4WKHA 4IPNB 4MHBA 5CC5A 4W84A 3TLQA 4I5XA 2YFNA 3FXGA 4XBSA 4B16A 4RX0A 2WVVB 2WMIA 4H8VA 2X05A 4TVUA 4OOZA 1XRVA 3TSBA 1EFZA 1VFUA 3TQ0A 4MZ1A 3NPXA 1DIDA 4V15A 2G95A 1VFHA 1NFPA 1FBAA 3SECA 5HATA 1YKWA 1X8CA 3WKZA 4L9XA 3UWYA 2CXGA 1UD6A 2QJMA 2I5QA 4XAFA 2D2GA 1NJJA 2Y63A 4GY1A 4LAUA 1NU5A 3TTEA 3HN3A 3GXIA 1V7AA 3LRMA 1DWGM 2IKHA 2DEPA 1QW8A 1IR2A 4PMZA 1DVJA 1ZJIA 1Q8JA 2OYLA 3UWUA 4D6CA 1G4TA 3I3DA 2X1IA 2RAGA 3KDOA 4FR6A 1QPNA 2FZBA 3K4AA 1VEMA 5EPDA 4O16A 3SIMA 3VNLA 1DJHA 1UWRA 2OQHA 1H61A 1DTNA 4Y