3KRUA

Crystal structure of the thermostable old yellow enzyme from thermoanaerobacter pseudethanolicus e39
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
335
structure length
335
Chain Sequence
SILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalysis with thermostable enzymes: structure and properties of a thermophilic 'ene'-reductase related to old yellow enzyme.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus atcc 33223
molecule tags Oxidoreductase
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
total genus 128
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kruA00
3LB0A 3NVTA 3W2JA 3QRHA 3DAQA 3G3DA 1WA3A 4UCGA 4DBDA 1TV7A 1W56A 4IQLA 3FJ6A 4IUOA 1Q6RA 3UPWA 1K02A 3QW3A 4S2BA 3T78A 4I9AA 3N2XA 4IPJA 4JX5A 4YL2A 1UJPA 1VCGA 5CSSA 2E09A 5DN1A 4HPJA 3LCGA 3NQ7A 1FCVA 1ME7A 5FF0A 1W37A 2CLMA 4P2VA 3UY8A 4PODA 3SGUA 1JQXA 5HUPA 2JGQA 2FPTA 3SFKA 1H7RA 1OF6A 3G0XA 3GIYA 5D2VA 2VC6A 1LLWA 2VEKA 2QAFA 3BV4A 3TQVA 1G6CA 3WJZA 3P67A 3G1AA 4LU0A 1VCVA 3C6CA 3LHUA 4O8RA 1XUUA 3EEGA 1VQTA 3S1XA 4UTIA 3VCRA 2DZSA 1JRBA 3DZ1A 2VFHA 4FHAA 4ZQCA 3HG5A 1U5JA 4DPPA 2J27A 5HINA 1YTDA 4BF9A 3FKRA 3FLUA 3EWYA 4UFMA 4NJKA 1B4KA 1KTCA 4M5PA 1RR2A 3CEUA 3BVJA 3WJWA 3WK3A 5FF7A 4IJBA 4UIOA 1EPXA 4JTSA 3OVRA 4E2DA 3BW4A 4B5NA 1KLYA 4FX7A 4NZFA 1LBLA 4IGHA 4PEKA 2Y88A 4KFNA 4MY1A 2ZRYA 4UNKA 4X2RA 4Z1BA 2DZWA 3EWWA 3IIZA 3DFQA 4CQ8A 3UWYA 3RF9A 2Y7DA 1G69A 1DL3A 4O1BA 1T8XA 1VR6A 3E12A 1KW1A 4NT0A 2C16A 4O57A 4POCA 3EXTA 1DVJA 4JTLA 3V75A 1LYXA 2Y7FA 3LHWA 3GX9A 5E1QA 3NQDA 3B03A 1XKYA 3W7LA 3W73A 3TUUA 5CGQA 4TR9A 1VLIA 4HT3A 4HNTA 1FX6A 2A1YA 4IPIA 2ZRUA 3UD6A 1RVGA 3OEXA 5E0KA 3E9AA 3BG9A 3GKFA 3W75A 1WXJA 1AMKA 1J2WA 3GAKA 4PL2A 4O4VA 1DKWA 2ZFAA 2V82A 3NQAA 2QJIA 5D37A 1TV5A 4G1KA 3KRUA 3GXNA 3R5EA 1RQEA 1OFBA 4TMCA 1XUZA 1JCNA 3L5AA 3THQA 3NEVA 3O1NA 4K38A 5CPMA 3D0CA 4PC8A 1EUNA 3LHYA 4WOZA 1TQJA 4NNBA 3KVLA 2ABBA 4C1LA 4N4PA 5J5RA 3U2OA 5E93A 3DHDA 3BO9A 3JS3A 1IIHA 4EVZA 3HO8A 1KFEA 1OHLA 1P0NA 2E77A 1EX5A 2GQ9A 1Y0EA 2YPIA 3TAKA 5FEXA 5D05A 3I7SA 1H63A 4AWUA 4A29A 1CW2A 5LNRA 2NX3A 3L2IA 4IMGA 1XI3A 5F2MA 4FIRA 3USBA 5AFDA 1KFKA 4JN6A 2BZNA 2JK2A 4XKYB 1EUAA 3PM6A 1DORA 4MZYA 2CWNA 5GVJA 5LZLA 4UFLA 4E0CA 3SGZA 2BX7A 1ME8A 3HQ1A 5D2TA 4Z0SA 4JTJA 3C8FA 1TTIA 1KM2A 3JR2A 5FF3A 3GVGA 3N19B 1HL2A 2C6QA 4JDBA 5TQLA 3TSMA 1ICPA 5K4XA 3PSWA 1CI1A 5CZJA 3TFCA 2CLFA 2PRLA 2YDAA 2X1UA 2ZZ7A 4N6EA 2VFEA 1Q6QA 5G5IA 3NG3A 2UV8G 3LRMA 2E68A 4HSNA 5F2IA 4JTHA 4Q33A 1LM1A 4OE7A 3OVPA 2YZRA 1W54A 4MOZA 1Z44A 4PTNA 3W85A 1I2OA 3PBWA 3IGUA 3STGA 5EBUA 1RV8A 1LROA 5F4SA 1FCBA 3NQVA 3ZR4A 5SWUA 2YX0A 4O19A 3CPRA 3SECA 3C52A 2VFFA 4A21A 5TBOA 2C1HA 3DFPA 1G4PA 3KAOA 5K4ZA 3PULA 3LCWA 3MI6A 4FIQA 2Z0IA 3NO5A 3TQKA 4O1DA 5DCBA 4HIBA 4RK8A 1WOBA 1GG0A 3H55A 4QSHA 4O1CA 1M6JA 2CLLA 1W5MA 2X1SA 1JQVA 4S1FA 3C2FA 1GZGA 3W7PA 3HPZA 4Y9AA 1QPRA 1GVSA 4EF9A 1I8JA 3R13A 5U7SA 1ZNNA 1SSDA 2H3BA 4LS1A 4RZ4A 1A5AA 3LDVA 4QITA 2B7PA 4JY9A 3GKAA 3SSJA 3W88A 2BLEA 5D09A 1QDSA 1K3UA 3UXAA 3R8RA 1SQ7A 4AF0B 4MUZA 1OF8A 3CIXA 4UTLA 3CQ0A 3TW7A 2VEIA 5IBXA 1SSGA 4BWLA 1KM6A 2ZA1A 3W7MA 1ICSA 4MVAA 1OFRA 1IXQA 3N2MA 2WSRA 1X6UA 3GDMA 2B7NA 4GNJA 1B9BA 1KFCA 4CQAA 5C5YA 4DO6A 3PBVA 1VPXA 2R91A 4O17A 2YFOA 3VI2A 3W7CA 1L9WA 4LNYA 4QNWA 3QZEA 3O07A 4NJHA 4NQ1A 2NWSA 3NM3A 1SO4A 1H1YA 1LOLA 2V81A 4MKNA 3A24A 4LOCA 2A6LA 3TJLA 4GE8A 2A7RA 1YPIA 1H7WA 3W2KA 4LVAA 3W72A 1GVRA 4WJEA 2H3DA 3W2UA 3C2VA 3NQCA 4TMBA 2O7SA 3DENA 1VS1A 3YPIA 3LLFA 1EEPA 2VFGA 3INPA 4AWSA 3MI2A 1KTNA 4N02A 2DZVA 1MEIA 3LI1A 4GUHA 4BR1A 6ALDA 3GAYA 4JY8A 1TQXA 1B3OA 3OA3A 3L67A 2J88A 3C2EA 1QNVA 2JKEA 3L5MA 3P82A 3BG5A 3UZJA 1HFBA 4BFAA 4XUGA 4R7JA 3CLMA 3BW3A 3PVFA 1XCFA 1RQBA 3RNDA 2WNZA 3EWZA 2A7PA 4UTJA 3W7KA 2E6YA 4JNMA 3TJXA 1OX4A 2W6RA 3F03K 4Z1DA 3LCHA 1GJPA 1H60A 5EA9A 4AHPA 4O1AA 2PRMA 3EX2A 1S5TA 2QKFA 3KX6A 4FXSA 1OVDA 4LUJA 1H7OA 4RLIA 3LXAA 2YR1A 3TK7A 3PB2A 2WSQA 1GYNA 2EHHA 2NXHA 3I68A 2FTPA 1GTEA 3L9CA 1GVFA 1WDWA 2DORA 4GJ1A 4U4MA 1W8SA 1YLVA 1WV2A 3A22A 4HHPA 4YLWA 3ZS4A 2RKXA 1OX4B 4O14A 4AVFA 4JDYA 5D03A 4XQ6A 1PHWA 1HO1A 3LBMA 1W31A 1LZOA 3LHVA 1W5PA 4FXRA 2TSYA 4O16A 2CZDA 1KFBA 3P84A 1OYBA 3FS2A 3HF3A 4LV9A 4MJZA 1J5TA 3E0IA 3OG3A 3LI0A 4LVGA 1F6KA 2V2CA 4Q4KA 3BARA 5T26A 2DZPA 1TPC1 4O10A 1FWSA 3P8IA 4DBEA 1E51A 1GPWA 2ZZ5A 3EB2A 4UFKA 3HGOA 3M47A 1JRCA 5G2WA 3DFTA 2LLEA 4Z08A 3NAVA 1H61A 4HNVA 5LSMA 3KRSA 2EGZA 1BWLA 3IIOA 3LCFA 2GQ8A 4Z0JA 4QISA 5K9DA 1DJQA 2ZZ2A 1FY6A 4S2CA 2BWGA 3JRKA 2QCEA 4JYEA 1W3TA 2FQIA 2Y63A 3PSVA 2PCQA 1X7FA 2HMCA 4MIMA 4WXYA 1FBAA 1HO4A 3TSBA 3STEA 3O63A 2ZCGA 4ZZ9A 1XBVA 4AHQA 4OBTA 3ABRA 4RKAA 3NR0A 1WAUA 4BI7A 3FKKA 2NZLA 2BSLA 4X22A 4DPQA 2E6DA 5D2XA 4AF0A 2FLIA 1QPQA 1THFD 4FF7A 1P4CA 4FNSA 4UR8A 4KWVA 5DCEA 3TIMA 1OFEA 4Y8FA 2B7QA 4JD4A 4JTKA 3U6WA 3N3MA 4OU1A 1WBHA 4MLJA 2QCCA 1ALDA 5K9XA 2W0UA 3Q2DA 3MO7A 3IIVA 1SO5A 1YYAA 3MP4A 4ORMA 4A2RA 1TPEA 3PF3A 4QM1A 1R30A 4JX4A 3TMQA 1TJRA 4NJGA 1VGAA 3GR8A 3L5LA 4JTEA 4E38A 2TPSA 2VKZG 3IGSA 3LRLA 4AB4A 3TKFA 3G24A 4IXHA 3GXTA 1Z48A 4CNNA 3HGSA 1H50A 2QCGA 3DU0A 3NNTA 2Y7GA 1C29A 5HMSA 3TNOA 4FX8A 1KTBA 4LUIA 4JYFA 5AHLA 4QIUA 5CZSA 5KZDA 5ABTA 5D02A 2QUVA 4DF1A 1OG0A 2EAWA 1DV7A 3NL3A 4UR7A 2C0AA 1TRDA 4GRSA 4UMAA 4GWEA 1EWDA 4XZ9A 1S5VA 1D3GA 1FCUA 2QJGA 3MYOA 1K03A 3G0SA 1AG1O 3UWVA 3TH6A 2OJPA 6TIMA 3I65A 1EP2A 3TR2A 1H7XA 3M41A 2JKPA 5DY2A 4Z1CA 4MYAA 3NQGA 4DO4A 1YPFA 4PL1A 4UFJA 2ZBTA 3G18A 3S5ZA 2CLEA 3BLEA 3F4NA 1KM4A 4KKXA 4MFEA 1F6PA 1I2NA 3DBPA 1PCWA 1VC4A 1G4TA 2NWRA 3S5NA 5L9FA 4LC8A 2WOQA 2FPVA 3NZ1A 2C3ZA 2HS6A 1YXYA 4UTKA 3KVMA 4CLMA 4FNUA 3DXIA 2Q3OA 5AYZA 1VLWA 3LV5A 1JCLA 1TPWA 3MYPA 3NQMA 3M0ZA 4WQ6A 2YW4A 1X1ZA 1YDOA 1F73A 3HPXA 3P60A 4ML9A 3KHJA 4X3ZA 3W22A 5AB3A 3O06A 4HKPA 2AAMA 5LGZA 3EX4A 1L6SA 3U8GA 1SFJA 3DI0A 5AC8A 2QCLA 2OX1A 1DQWA 2ZDRA 4EIVA 2NX1A 2CZEA 3PY2A 3RLUA 2YGYA 3W83A 1LCOA 3P8JA 2E6AA 5LNWA 2OZ0A 1H7NA 3EXRA 4XWUA 3M9YA 2Q8ZA 3SI9A 4DO5A 5AYYA 2ZA3A 1KBIA 1QOQA 3PUDA 3C61A 1TSIA 4PH6A 1W3NA 4WX2A 3L68A 3N9RA 3SJ3A 3G1VA 1FWRA 1H7PA 4D2JA 4NVTA 3DFOA 3GXPA 2C13A 3W1TA 3BW2A 3PAJA 2I9EA 3V1PA 3WJYA 4QAIA 2QF7A 3KVKA 3QM3A 3UWWA 4EF8A 4UMCA 3LRKA 4N9DA 1ZAIA 2WNQA 3S8HA 2EF9A 1OABA 3QMRA 4JTFA 5D2YA 5CKSA 3QF0A 1F74A 4O11A 3W7GA 3G1HA 3ZWTA 4L4MA 1GT8A 3FIGA 2R8WA 3R89A 4LW7A 2WNNA 4AWTA 3LTSA 4YCOA 1N8FA 5AHEA 2VFIA 4FB7A 2QEZA 1G4SA 4C1KA 4O18A 5K3VA 2IQTA 1LRQA 3LHTA 2PE4A 1ADOA 1GOXA 4NNAA 1FDJA 4NXKA 3RK8A 4LV4A 4ZL1A 4O53A 1TPH1 3RLVA 3HBLA 5KSWA 5CZTA 4GC4A 1YTEA 2G96A 1IIGA 1TJPA 3UZ5A 1HG3A 4M7SA 5HWJA 3T55A 3IGXA 5BRBA 3S1UA 4ADSA 3T40A 2A21A 4MZ8A 2GUUA 4I7VA 2QR6A 3QPZA 1YADA 1GYLA 3NOEA 1ZJIA 2WSYA 2QCHA 4ZQRA 5CG7A 2V2DA 2OT1A 2YYUA 4BI6A 5IM51 1R47A 3HPSA 4OHQA 4FNPA 3W7NA 2QUUA 5AHMA 1TPVA 3W7RA 2A7NA 1QWGA 1G67A 5I3GA 3MW7A 3NQ2A 3LXBA 3ATZA 4CCCA 3AJXA 3P61A 1SFLA 4DQWA 1WOAA 3NPUA 1MEHA 3TC6A 4MYXA 2C19A 5BMWA 1W0MA 5F1VA 3O16A 2NUXA 3TCEA 4FEZA 4JGDA 3W7HA 4ALDA 1R2TA 2ZZ1A 2EKCA 3S1WA 3HG3A 4XBKA 4A2SA 1WQ5A 4A3UA 1JCJA 4JICA 5DXXA 1EWEA 2XN0A 4GUIA 4Z1AA 3CWOX 2B4GA 4R53A 5F2LA 3E96A 5KZEA 5H91A 2X30A 3GYEA 4GBUA 3CU2A 3LV6A 4RXGA 3DHFA 4LVBA 1SW3A 4ZQNA 3C2RA 4M6VA 1JUBA 2J24A 1OYAA 3W1PA 4FO4A 3W9ZA 3M5YA 1ZENA 1XBYA 3PR2A 1PE1A 5AHIA 2WO5A 3CWNA 1I2QA 4MPQA 1IF2A 4CNPA 3KFTA 4CQ9A 3M5ZA 4H4IA 1F05A 2PURA 3R12A 2J9YA 4XTDA 1LDCA 3HGJA 3H54A 2VELA 3HMJG 1Q45A 1SU5A 3R2GA 3C0JA 4NNCA 4NZJA 2RFGA 3O15A 1OFOA 4I7UA 4TIMA 1ZAJA 2E5BA 3DI1A 3P81A 2F7FA 3VKJA 4JTUA 5I3FA 1U83A 5CPOA 1QO2A 1UUOA 2ZRVA 1YTKA 1FXQA 3TE9A 1IGSA 2YSWA 3M1ZA 5TIMA 2CLIA 3W1MA 2J9ZA 2ABAA 4RCXA 3EWUA 2Z2UA 4M6PA 2QCFA 1FXPA 5CSRA 2FPYA 3NQ8A 3K30A 3M43A 3QQ0A 3P7YA 3GR7A 1R2RA 1TREA 5LKYA 4O0ZA 1QMLA 2JGYA 1LP6A 2R14A 4H6KA 1XDMA 4JEQA 4PCFA 3BK0A 4N4QA 2X1RA 2NXGA 2H8XA 3VE7A 3EX3A 1F5ZA 7TIMA 4IMEA 2V5BA 5HUOA 3B0UX 3NPWA 4KFPA 4UFHA 5LGXA 4ICNA 4JS3A 3BLFA 2JKAA 3G8RA 2DJXA 4U28A 2P10A 2Y70A 1OX5A 1TYGA 4LT9A 1P5BA 3RMJA 4MZ1A 5I3HA 4ZQMA 3ABSA 3FOKA 1J4EA 1M7PA 2ZQ0A 4A22A 1H5YA 4XBSA 3MMTA 3EXSA 2G97A 1GG1A 3CEPA 4BK9A 5I3JA 1LOSA 3GNNA 2CZ5A 4RJEA 2ZZ3A 1F7BA 4O13A 2ZRZA 2WQPA 3S42A 2NLIA 2QCNA 1RD5A 1RQHA 5D2WA 5G2IA 3IRDA 4AXKA 4N9EA 3W76A 3M16A 4LVDA 2TYSA 2RDWA 3HG4A 3GB6A 1JCMP 5LHEA 3W1QA 2A2IA 4K7VA 3EKLA 4HPXA 3NL2A 4CCDA 4WXZA 5HQEA 4ZQPA 2ZRWA 2DP3A 1HTIA 3PC0A 5F2GA 4GXMA 1C9DA 3ABQA 1H51A 1WBJA 1PIIA 4RX0A 5FF4A 4GFSA 2X16A 5HR6A 3UWQA 1I2PA 4OGZA 5K9CA 1KLZA 3CIWA 4CCEA 1I2RA 1LBMA 1TIMA 4BWLC 1W5OA 3W2LA 2Y89A 5FF2A 2ZRXA 2ALDA 3M5VA 3TAOA 3TA6A 4M6QA 2QJHA 1NAL1 2GJLA 1XBXA 2Y7EA 2YXGA 3G3MA 3IEBA 4FNTA 3HG2A 5LNSA 3L65A 4LRSA 3QFEA 4NX5A 5CPNA 4RZ5A 1EB3A 1ZALA 3B8DA 4LWWA 3THAA 1UB3A 2QAPA 4IMDA 4GUGA 2O7QA 2J6XA 3GLCA 3W7OA 2YCEA 5FEPA 3UXDA 1M5WA 1DOSA 1GEQA 4W9TA 5AHNA 1O95A 5DBUA 1ME9A 3LM7A 2CU0A 4AH7A 3NQEA 4N2YA 5HNRA 3NXFA 4ONVA 1LORA 4QJ1A 3TFXA 2WV8A 3HGRA 1AL8A 2OMAA 2ISWA 3IVTA 3MBFA 4IX0A 5LNUA 5KTLA 2D73A 1R46A 2EPHA 5BOOA 4UTHA 5KITA 4M19A 3MP3A 3T44A 4LTSA 1AW5A 2A85A 2X1TA 3G1DA 4JIPA 4ZVJA 1G7VA 3HB9A 2Q3RA 1EP1A 3N34A 3C56A 1JULA 3QMSA 2QCMA 5A5WA 1OK6A 2Z1BA 1SUXA 3A9IA 4YCPA 1RPXA 2VOMA 1K7EA 1EIXA 3HOJA 1X8FA 4R33A 1A50A 1LRTA 1Q6LA 1VYSX 3HJZA 4JR5A 1WYIA 3MUXA 1SZEA 4DEFA 1JCYA 3W74A 1Q6OA 3NQ6A 2B0MA 3KXQA 3M5XA 1JUEA 3W2NA 2YYTA 1A5CA 5D30A 5LHFA 3UYCA 1IXPA 4ADUA 3P5ZA 1UUMA 3VFLA 1LLZA 5DCDA 4OV4A 2NX9A 1Q3NA 1W3IA 3QSTA 4ZMGA 3FJLA 3W1NA 3TW6A 1DHPA 2V9DA 3FFSA 2RH9A 1HUVA 1NFBA 4NJJA 3W23A 3W7JA 4MLRA 1L6YA 4FX6M 3M6YA 3LHZA 3S5OA 5G4EA 4X9SA 3TXVA 1GVQA 1JUKA 4TU1A 5FEZA 1TMHA 3O05A 1SO6A 1TV8A 4XKYA 1VZWA 3PS7A 2G95A 3GDKA 1OFAA 3NGJA 3O8AA 5A8GA 5DLCA 1NVMA 1XXXA 5EMUA 4UTMA 1TPUA 1XDLA 2GVLA 3OHIA 4HNNA 1G4EA 2H8ZA 3C4UA 1JJKA 2A4AA 4O0KA 1PCKA 1BTMA 2C15A 3LX9A 5HJLA 2HTMA 1F76A 2Z6JA 4Q32A 3QC3A 4OT7A 3NYZA 4WZHA 4RV8A 4N6FA 1KM5A 1UCWA 3GNDA 2RHGA 3G1YA 1PHQA 1TRIA 5HR7A 5F4XA 1S5WA 3W7EA 1TCDA 3LTYA 1A5SA 4N9CA 1ML1A 3UPBA 4O50A 4PFMA 4UXDA 3MWAA 2H6RA 2G5WA 2YFNA 3LBCA 1JCXA 2DJLA 3WK1A 5FEWA 2QCDA 2V5LA 1R2SA 4K8EA 3QJAA 4O28A 3B4UA 1VCFA 3HIJA 1MXSA 1OYCA 1YXDA 4UUIA 1L2UA 3QW4B 3FEMA 5EKYA 3OBKA 1C8VA 4NU7A 2NV2A 4K6AA 4UNLA 1KM1A 3A5VA 3ZFHA 4LVFA 1B57A 3NPXA 4TO8A 5F1UA 1QCWA 4DF0A 3G22A 4AMAA 5AOUA 3UY7A 3NL5A 2C14A 2NUWA 2WJZA 4YXGA 5G1YA 1V7YA 4OV9A 4AHOA 1SR9A 2TMDA 5G1TA 3N14A 3ZWSA 1M7OA 4QQ3A 3ATYA 3WJXA 1O5KA 3NDOA 2WPBA 2I14A 4AAJA 1NF7A 2VEPA 1IXOA 5HWMA 1WX0A 3SY5A 3IIPA 3CC1A 3PBYA 3W07A 1TB3A 3M44A 4NXSA 2AGKA 2VEMA 4FNRA 1FUYA 1ZAHA 5C6MA 4ZQOA 3QMTA 3DFSA 5D33A 3RU6A 2V0TA 4DELA 1G7UA 1GQNA 3GDRA 1K7XA 1NEYA 4UFIA 3LCXA 3AO0A 2JBMA 2GVJA 3QQ1A 2E5CA 1PV8A 3EX6A 3G1XA 3W84A 3W71A 1MEWA 3W1LA 2VENA 3M7WA 4K37A 4UTUA 1YXCA 5C55A 4IMFA 1VYRA 4IWWA 4YWIA 2GQAA 1PS9A 5H2ZA 2ATSA 4LY8A 1OX6A 1KM0A 1SZGA 2QDHA 1VYPX 1GWJA 1T0OA 4EWND 2ZA2A 5DXYA 3TMLA 1LRNA 1DJNA 1OFDA 2F84A 2FJKA 3DKJA 1H1ZA 3CB8A 3TX9A 2GJNA 3B0VC 3W70A 3I7QA 2C18A 5L6UA 1MO0A 3P62A 2KZHA 1N55A 3QYQA 2HSAA 2Y85A 1FWWA 1FWNA 1LOQA 1OFQA 5DELA 3L0NA 1K8XA 1OK4A 3P5YA 3PWAA 5CZ0A 3UWUA 2W79A 1D3HA 1UBSA 2FFCA 3W7IA 2VFDA 4NX0A 3PG9A 4E2BA 4FNQA 3FYPA 1TPDA 3OIXA 3WK2A 3ANYA 2ZZ6A 3LCIA 4JIQA 3O6DA 1TTPA 3G0UA 3B0PA 3L66A 1FCQA 3GZ3A 4N9BA 2R94A 3KRZA 1QPNA 2DU2A 1QAPA 4IMCA 4RR4A 4R34A 3NQFA 1OFPA 1XBZA 1W1ZA 2V8ZA 3P80A 1EP3A 3LGEA 3W1RA 4I7WA 4K7YA 4WOQA 4EOUA 1LBFA 3CM4A 1P1XA 1FQ0A 5FI8A 1TTQA 2B7OA 1B4EA 2Y61A 2VXNA 1AK5A 1QR7A 2QCDB 3CTLA 3NPVA 3WJSA 3FYOA 3A21A 4MY9A 2H90A 5I3KA 2ISVA 4HNUA 3TQ0A 4KFOA 2PC4A 3NZRA 1I4NA 4JTTA 3IV3A 1MSSA 3BPWA 4JYDA 5AN7A 4K36A 5HWNA 2GOUA 3GDTA 1XM3A 4JTIA 3KVJA 1FWTA 3LCLA 3PBUA 1AL7A 2V2HA 1BKSA 3W7QA 1TPFA 3UWZA 2OCZA 3Q58A 2FB2A 2E5DA 4J9JA 2I1OA 3LERA 3MHFA 4LS0A 3PUOA 2XFWA 3QSRA 5KZMA 3S6DA 1XL9A 3QPYA 4IX2A 3SZ8A 1KV5A 1DBTA 4MJMA 3WFAA 5BMXA 3STFA 4O4WA 3TV8A 4UMBA 4XTIA 3RFAA 4WY0A 3I6RA 5U4NA 1W5NA 3QEZA 1ZFJA 2OT0A 3VE9A 5EY5A 3S5YA 1Z42A 3A23A 3L21A 5D04C 1S3HA 2ATMA 5KINA 2ZTJA 2CFFA 3F1QA 2Y62A 3Q94A 1QO5A 3MI3A 3IVSA 3LLDA 1QPOA 1VRDA 2XN1A 5EL1A 3T7VA 3FA5A 3CT7A 1D9EA 2E1DA 1QFEA 4P61A 5DBTA 4UTWA 3W1UA 1AW2A 4L4LA 1YDNA 1VHCA 4UC5A 3B05A 2CZFA 3G1SA 1A5BA 1DQXA 1JVNA 3E02A 2P1FA 5CPLA 3W1XA 2AQWA 4RXFA 3TC7A 3EWBX 2A5HA 1O4UA 1ONRA 2Y6ZA 3LTPA 3S9YA 1MZHA 4JXCA 5MHBA 3N73A 3G8EA 1P0KA 5G4WA 3T4CA 2CLOA 3GDLA 2NXIA 2GPTA 4IXXA 3EKZA 5EPDA 1ZHAA 5LNVA 3SR7A 3W3OA 3TDFA 1PVNA 3F4WA 5AC6A 3CHVA 4JX6A 4UTTA 1K8YA 1T96A 1VHNA 3PB0A 1PL9A 4OWGA 3EWXA 5G2HA 1BEUA 3PUEA 3TXZA 2TRSA 3MJYA 4ADTA 1FDZA 3UNDA 1W5QA 3IIXA 1FDYA 1K8ZA 1AW1A 2NUYA 3MHGA 4HN4A 3W6YA 3IVUA 4WY0F 3NM1A 1ZCOA 4OQVA 3B04A 3STCA 3W87A 4DF2A 2GVGA 3C2OA 1L6WA 1KBJA 2YW3A 2ZZ4A 1CX9A 1ICQA 3W7DA 5IBXC 3PG8A 2ISSA 3S1VA 1NF0A 3SIZA 2FB3A 5EYWA 4Y96A 3DKLA 5K7JA 1VH7A 1YDVA 2QUTA 1I45A 1ZY9A 1KV8A 1O94A 4PA8A 1TO3A 4O12A 4UTTC 1K7FA 4UTWC 3DGRA 3L0KA 3O6YX 1SW0A 4Y90A 2FIQA 3TSDA 2BTMA 4M7TA 2CW6A 2E6FA 3GK0A 4WD0A 1KFJA 5D38A 2DZTA 1T99A 3TU9A 3I7RA 4O52A 3MHUA 1XFBA 3H53A 4AEOA 3BGGA 3ABOA 2DZXA 2PRHA 1RZMA 3KOFA 5BW6A 1KA9F 2A0NA 1KFLA 1X1OA 2DZUA 4K39A 2J9XA 4LC6A 1TPB1 3W86A 4HSOA 3LOTA 5DY3A 3QH2A 2NV1A 1JR1A 3VNDA 3S0CA 5C54A 4Y6GA 5K2ZA 4IOTA 1UASA 3ELFA 2RDUA 4RZ6A 2CLKA 4QNEA 1IXNA 3MBDA 2V30A 1O5XA 2FDSA 1TTJA 5D32A 1GTHA 4O15A 1OJXA 4YMZA 5FESA 1SZFA 2X2GA 3WK0A 1SO3A 1F2JA 1V5XA 3UQNA 4NJIA 4O54A 5J5DA 3NA8A 4JTGA 1EA0A 4GUJA 3A5FA 2ZYFA 1BWKA 5AYXA 3MP5A 5HULA 4NUWA 1H62A 3L0GA 4H3DA 4WY0B 3DH7A 3TROA 3BG3A 1Z41A 3SW6A 4BI5A 1N7KA 1XC4A 2HS8A 2CLHA 3O6CA 5BNKA 3B06A 3N9SA 5KMYA 1VJIA 4DXVA 2QDGA 3EX1A 3W1AA 5F4WA 4ORIA 4WUIA 3OVQA 4LRTA 5AHFA 1NSJA 1SPQA 4MFDA 2Z6IA 4K8HA 4LS2A 2A6NA 8TIMA 3LXCA 1LTDA 4KWWA 5AC7A 2XN2A 1SW7A 1QOPA 3E49A 1O60A 1KM3A 2Q8LA 3C3NA 3G1FA 3W2MA 2WKJA 3Q37A 1SZNA 2P0OA 4MY8A 3P74A 2BXVA 1GVOA 4CNOA 3NL6A 3DFNA 1A53A 5C2XA 2ZTKA 4GUFA 4TX9A 3BGJA 3BLIA 5I3IA 2RDTA
chains in the Genus database with same CATH superfamily
2I9UA 3NVTA 5ECUA 3CPUA 1P0DA 3W2JA 1W56A 3FJ6A 4HPGA 4GCXA 1G01A 2BOEX 1EJTC 3LG3A 3T78A 4YU1A 1E1EA 4YL2A 1UJPA 1VCGA 4C6EA 1KRCC 4J5NA 4LBSA 1WKEA 4RDYA 4S3DA 2DSKA 4C6MA 2FPTA 2NSOA 1Z7AA 2GSHA 1OF6A 3BAJA 3GIYA 5D2VA 1TZZA 4J1OA 4XIAA 4HJWA 3F5JA 5FKYA 3BV4A 3L4YA 2XWEA 3N17A 1KRMA 4LU0A 3ME3A 5JBFA 1VCVA 2IQ0A 3EEGA 3JZUA 3S1XA 3WDIA 4UTIA 3DZ1A 4FHAA 1E3XA 1GORA 3SSZA 1R38A 1P6BA 1SFTA 3WQWA 4UFMA 3DYMA 3IGHX 1RR2A 3GTXA 4RZBA 5A6BD 3WJWA 3WK3A 1JDDA 4CD5A 4NY2A 1AVAA 4QG6A 1KLYA 3VIJA 4NZFA 2BASA 4IGHA 3WMCA 4US6A 4KFNA 4QBXA 3EWWA 3IIZA 4CQ8A 1LG2A 2VGGA 6ENLA 1PAMA 1U1UA 2XFYA 4C6CA 3GR4A 3UA4A 3WBAA 1DL3A 3E12A 2C16A 4JTLA 1GVYA 1RA5A 3CL7A 3QOKA 4J3TA 2MNRA 3AFBA 4J35A 1J11A 3B03A 4HHLA 1XKYA 3W73A 1KWGA 1LUCA 4HT3A 4LAMA 1J0HA 3BQ6A 3N2CA 3H4GA 3LLXA 1FKWA 1RVGA 2Z2AA 5HMEA 4LAUA 3B97A 2X0HA 4IL0A 1J2WA 2BP1A 3FA3A 3GAKA 2OZ8A 4XAPA 4B91A 3RN6A 3ZO9A 2VX6A 1DKWA 4HA0A 4GI9A 1VKFA 3CUIA 2QJIA 5D37A 1IWBA 3KRUA 2YCLB 4K2SA 1OFBA 4D6HA 2A3HA 4TMCA 1XUZA 5I02A 5HAOA 1KGXA 3THQA 5D9NA 3D0CA 4KW2A 2BVDA 2DW6A 4J28A 4WOZA 4C1LA 4WSKA 2D20A 5LIKX 4H6RA 3NSNA 1UR8A 2Z1XA 5B7YA 3B8TA 3JS3A 1VFSA 3HO8A 1EX5A 2Y5SA 1UC5A 1Y0EA 5D05A 4XZWA 1CW2A 5LNRA 3IS4A 3TCSA 1FVPA 2X41A 4FIRA 3USBA 2UY5A 1KFKA 3CH0A 1BRLB 1QI5A 3TW9A 4QE5A 3KHDA 1JG9A 4XKYB 1VEOA 5H8PA 2CWNA 3MKKA 5LZLA 4UFLA 4E0CA 1X6NA 2BX7A 1QI2A 5CSYA 4Z0SA 4KIEA 2P53A 3JR2A 1CYGA 3KP0A 2BV9A 4N42A 1ZQ5A 2OELA 1QXLA 5K4XA 5TQLA 1BTCA 3TFCA 4E4FA 2PRLA 3VGGA 3VDBA 4E6MA 4N6EA 2VFEA 3SRFA 3A4XA 5I7GA 4MAZA 4Q33A 1NOFA 5AY7A 1LM1A 4LF2A 1U33A 1P0EA 3MDWA 3KZPA 1Z6KA 3MV01 1TJ2A 1VFUA 4PTNA 5A6TC 1I2OA 3PBWA 4I6VA 4YVVA 3STGA 6REQA 1LROA 4Y2WA 5F4SA 1FCBA 1R0MA 3BH4A 4O19A 2X0YA 3CPRA 3SECA 2ZIDA 3KE0A 5DMYA 5T8GA 1G4PA 1NWRA 4WDXA 5CLWA 2Z0IA 3NO5A 3SUWA 2PLCA 4P7NA 1BAGA 4RK8A 4ES4A 4CNTA 2CLLA 4PZVA 5EFFA 2X1SA 4ZB2A 5EMLA 3W7PA 4TVDA 4Y9AA 3KL5A 3MT1A 4IH3A 4RDVA 4H8HA 5JQ9A 2O4QA 1ZNNA 5FJJA 3ABXA 4LS1A 5FD0A 1FTXA 3LDVA 1EXPA 3KCLA 3SSJA 2VCCA 3IPWA 1XLLA 4GIRA 5D09A 3OBAA 4L7ZA 1ISVA 4ACYA 3R8RA 4MUZA 3P0XA 2OVLA 4B2DD 3S47A 2PDUA 2VEIA 4B5WA 1V8EA 3OGVA 1CPUA 1ICSA 1IXQA 3N2MA 2B7NA 3T6CA 4U5IA 4O17A 3W7CA 1L9WA 4DM2A 3CZEA 2ZUVA 3GWQA 3QY6A 3N4AA 3O07A 4ZOAA 1FFRA 4KCUA 3IANA 1QK2A 1SO4A 1LOLA 2W67A 2A6LA 4HPHA 1H7WA 1WDPA 4LUSB 4LVAA 1OG6A 3AYVA 4XZMX 4WR3A 1DEDA 2ZE3A 4AZ5A 4DN1A 1JZ3A 4QS5A 1GYMA 1YPXA 4CEUC 3MI2A 1VFMA 3KDOA 1YX1A 3LI1A 6ALDA 4JY8A 4H83A 4W85A 4E2OA 3N3TA 1HFBA 1JPKA 4BFAA 4XUGA 3BW3A 1IWAA 3V5CA 2W6RA 3LENA 4HU4A 4D71A 1GJPA 2HXTA 1IEIA 2KX9A 3CUHA 4O1AA 3U48A 4AHPA 4CN4A 4DJFA 3EX2A 2VDHA 1FWCC 1XYMA 2OTDA 4ZO7A 4UQDA 4FI4A 3PB2A 6PTDA 1NFPA 1XV8A 4BY3A 2NXHA 3I68A 3GTHA 3L9CA 5D4YA 1GVFA 3GTIA 2VWSA 5TD4A 4PUNA 2DSZA 4HHPA 1UMLA 1DIEA 4YLWA 2RKXA 4O14A 3KW3A 4R7OA 3B8IA 2WZMA 1PZ0A 2OO0A 2PZ0A 3MS8A 1HO1A 2G3NA 4WSHA 3LBMA 4KETA 2OGYA 4O16A 2PWUA 4F2TA 3QGKC 4XZLX 4JQ4A 3LI0A 3WLKX 1F9CA 4J3UA 3RILA 2IPWA 3AMLA 2FTYA 1GVEA 5I2UA 1FWSA 2DH2A 3TONA 3OHMB 3AS3A 3P8IA 4DBEA 4P8XA 1GPWA 3M47A 4C1NB 2OOGA 3W28A 3ZT7A 4IL2A 4NZ5A 2LLEA 4Z08A 1XCXA 2J75A 5HNNA 4HNVA 4ML4A 5LSMA 2GGHA 3LCFA 4Z0JA 1EDTA 2WB5A 1FY6A 3JRKA 3H7RA 4NZ1A 1Q6EA 2QCEA 3I4KA 1WB0A 4PULA 3AXHA 2CXEA 1W3TA 3TJ4A 3EKGA 2PC8A 4FLOA 4IFKB 5DF0A 3RX3A 3SCRA 4WXYA 1KNWA 2XU2A 3TSBA 2X09A 3STEA 4OBTA 1MZRA 5LXEA 3NR0A 2NZLA 4X22A 4DPQA 2FLIA 2V3EA 4FNSA 4U31A 3CAQA 3LZ5A 1LG1A 4JD4A 1WBHA 2B81A 4MLJA 4AD4A 4GIEA 2W0UA 3A4AA 3MO7A 1DXFA 3A6OA 3WUFA 1TPEA 4ZBCA 4QM1A 3H24A 4JX4A 1UR1A 1JGMA 1K4HA 3Q4DA 1TJRA 4GK8A 4V27A 1R3YA 4KPLA 3L5LA 2TPSA 3F2DA 3T42A 4V1XA 1Z48A 3HGSA 4HOZA 1EJUC 4OKDA 1UYQA 3GG1A 2IPJA 3CT2A 5KZDA 4CD4A 5ABTA 2QUVA 1OG0A 2DFAA 2BNJA 5BZAA 4DNMA 1PBGA 4C6DA 4MM1A 3MSGA 1C8QA 5HPCA 1S5VA 3G0SA 1AG1O 6TIMA 3ZT5A 3V4BA 3PWIA 4IJRA 3QGAC 5DY2A 1V08A 1LF1A 3ARQA 1YPFA 2O56A 2OEMA 2ZBTA 3G18A 3BLEA 2BOFX 1KM4A 1F6PA 1I2NA 3ALFA 1W17A 1AD1A 1DP0A 4DJEA 5JVLA 3FDGA 3WSUA 1G4TA 3JW7A 1XIIA 4FLRA 4LC8A 2C3ZA 1KKRA 3KRBA 4UTKA 2DSWA 4FNUA 3WH8A 1TWWA 1EHNA 2NSXA 3O0FA 1VLWA 1MQRA 2GSJA 3M0ZA 3AWOA 1F73A 2J8TA 4KBXA 3W02A 2BGSA 3DBNA 3P60A 2X05A 3W22A 4G7FA 5E70A 4HBKA 3PBMA 4DZAA 2Z1VA 2DSUA 3L7RA 1L6SA 1SFJA 2NQHA 3QZAA 4D1JA 4F0RA 1LCOA 2E6AA 1QK0A 1OC5A 3GQYA 3SI9A 4DO5A 5AYYA 2ZA3A 1QVBA 1YNQA 3N9RA 3ZVHB 3SJ3A 1FWRA 1MNSA 3GG0A 3T8QA 3URBA 3W1TA 2D22A 3WQ8A 1XH1A 2I9EA 4OTKA 3RYSA 4MDPA 3LRKA 2Q02A 3WH6A 2VOTA 4N9DA 3QY7A 3M6DA 3TLQA 3DOPA 1F74A 3ZWTA 1UD5A 2WANA 1B30A 1E6QM 4LW7A 2WNNA 4AWTA 1S3TC 1W9PA 4DUVA 3BAIA 1SMAA 3BTNA 5K3VA 4L1GA 4H9UA 3BSMA 5FJOA 3LHTA 2PE4A 4GNVA 5E6ZA 3FN9A 1FDJA 3RK8A 1DWFM 2XG9A 3PZ9A 4LV4A 3AIUA 2OEKA 5KSWA 3ARXA 3UCQA 3AJ7A 1YTEA 1BYCA 3S1GA 1ITUA 2VYOA 4LANA 1HG3A 4M7SA 1QNQA 3AHVA 3E3HA 3S1UA 4L9ZA 2HPIA 4I7VA 5BWAA 4ZQRA 2YYUA 1T8QA 4HHMA 1UZ4A 4AVOA 4FNPA 2QUUA 5AHMA 1HL9A 2YLLA 4EACA 3TYUA 4AZGA 5E09A 3PAOA 4BJHA 1SFLA 4JFVA 1MEHA 3FHAA 5BMWA 2NW0A 2C19A 4IFOA 3ZJ7A 4PE8A 2GFTA 5BRQA 2PLJA 3TCEA 4IIFA 1R2TA 3GHSA 3HG3A 1IYXA 4A2SA 1V3MA 3CLWA 5DXXA 3PFMA 3CWOX 2B4GA 5F2LA 2ADAA 1O7AA 2R1MA 4I8DA 4JKMA 3N4EA 3L4ZA 3LV6A 2EG7A 2J24A 2WMJA 4YVXA 3BICA 1UA7A 1A5MC 3CHCA 4O8AA 1A5KC 2DZBA 4ACZB 3KBWA 4CQCA 1JEZA 4FPSA 2XTKA 4CNPA 4H4IA 4DYEA 1F05A 2FFIA 3NFUA 1V7AA 3N04A 3HGJA 1E71M 4MKSA 3N6QA 1SU5A 3VKDA 1ZLPA 5BXRA 3OQEA 3C0JA 4I90A 2E5BA 3MCOA 3GRIA 1JD9A 5I3FA 3QQWA 3FX4A 3ZSSA 2ZRVA 1IGSA 4U2YA 2J7EA 5TIMA 2J9ZA 4RCXA 2D23A 2WZTA 3TN5A 1YKWA 4YS1A 4CU7A 4M6PA 2VQUA 2QCFA 5CSRA 1O66A 3M43A 1TREA 5LKYA 5DFAA 1Y8BA 1LJYA 1HQTA 2IXUA 3E5PA 3V5FA 3BK0A 5JU6A 2AL2B 2AKZA 4LUTB 3I10A 1XLJA 1MYRA 1QHOA 3CAVA 2QQ6A 1GJUA 3SN4A 4U28A 1CCWB 1UIPA 4IP4A 4MZ1A 5I3HA 5A8NA 3FOKA 2CBJA 3WLMA 4JAWA 1H5YA 3SDOA 1E3ZA 1IZCA 2C79A 7CGTA 3REQB 5I3JA 1UR4A 2WCGA 3GNNA 1SJDA 3UA3A 2FKPA 1F7BA 4O13A 3AALA 3S42A 5FL0A 4KIRA 4B5VA 2GUBA 1QNRA 3ARVA 2AMXA 2GGJA 2X7VA 3QBUA 5FSEC 3M16A 4LQ1A 1VEPA 2RDWA 1JCMP 3MMUA 2A2IA 4K7VA 3PHAA 2X2YA 4HPXA 4MJ4A 4UB9A 2DVTA 3NL2A 1OWQA 4PB3A 1K77A 3KS5A 1DIOA 4PCTA 4ZO9A 1BXNA 2ZRWA 3QHOA 1GOMA 1L2QA 5F2GA 2OWXA 3WQVA 1WBJA 4RX0A 5FF4A 4YNGA 1V0LA 4JFSA 2PDQA 4XZHA 5A1AA 2Y24A 2WW5A 3H8AA 1FWAC 4XAYA 1KLZA 2GQ3A 1Q5MA 3CIWA 1HL8A 3AS2A 1AQFA 2HV5A 5FF2A 3VAVA 1OCQA 1UKQA 4MTVA 3SCOA 2X0SA 3TAOA 5IDZA 3R79A 4TVCA 4KEVA 3S6OA 3HG2A 1RLCL 4LRSA 4TXEA 4NX5A 2WAGA 3ZMRA 4NAFB 1ZALA 1KBLA 3OO2A 3HA1A 2QAPA 2J6XA 5FEPA 1E15A 1XJBA 3CUGA 4PTDA 1GEQA 3AXKA 1J93A 2WMIB 5DMMA 2VO5A 1O95A 8RUCA 3WLIA 3ARYA 3LM7A 2JEPA 1BQCA 3S46A 1VBHA 4ONVA 2P3EA 3TFXA 1EDQA 1UOKA 2OMAA 3V0UA 3GXDA 3TOYA 3E0VA 2WWCA 5KITA 1GOWA 2EPHA 1E56A 1MFVA 3VPLA 3T44A 1RSCA 1AW5A 2A85A 4QS6A 4V33A 1R9ZA 3TYDA 2PP1A 1JULA 5A5WA 2WQDA 2Z1BA 3A9IA 3ENLA 1RPXA 2VOMA 4MMWA 4Z2KA 4DYKA 1YEYA 3CZLA 1A50A 1Q6LA 1VYSX 4B92A 2PDCA 4US5D 4ZFMA 3BLOA 1GHRA 1DJHA 1RK5A 3KXQA 3W2NA 1WKDA 2WJDA 5D30A 1GOQA 1UKTA 5LHFA 2VJXA 3UYCA 4U10A 1GNXA 3KLLA 3VFLA 1LLZA 8XIMA 4OV4A 1O6IA 5C9XA 2NX9A 3EZ4A 5PTDA 4I9TA 4H9XA 3GU9A 4ZMGA 4KS0A 5CJMA 5C9ZA 1HUVA 1H09A 4NJJA 1H1NA 3W7JA 7ENLA 3OGRA 4FX6M 3CMGA 3C86A 4MAVA 3EOUA 1PWLA 2JIWA 1E73M 4FK9A 3PS7A 1Z32X 3GDKA 4HQVA 4ZTYA 5A8GA 5DLCA 4F3HA 4UTMA 3OHIA 2IS7A 4YYFA 1DXEA 5CJ5A 1Q4NX 4O0KA 4DLMA 2PTZA 2HTMA 1E4IA 1F76A 5H8MA 4FF5A 4WZHA 5GNXA 3RR4A 2BHYA 4RV8A 4N6FA 3NDZA 1UCWA 4H00A 3GNDA 2PFHA 4L65A 3T1GA 1UH3A 3LTYA 1M04A 2XZ7A 1XRVA 4N9CA 4O50A 3MWAA 4BF5A 5HOSA 3URQA 3II1A 1EDGA 4KERA 2DJLA 5FEWA 2V5LA 3AQUA 1R2SA 1MXSA 1YXDA 4ICCX 4DBSA 2VR5A 3PJWA 1L2UA 2VCBA 2I56A 4AU0A 4NU7A 3ARSA 4K6AA 4UNLA 3EAUA 3AWNA 1K9EA 3HPAA 3NPXA 4EWJA 4TO8A 1QCWA 2V38A 4L61A 2VX7A 5AOUA 1ZU8A 1K6WA 1XH2A 2XPKA 3KL0A 4HB7A 3OU8A 2NUWA 5E9AA 3UYIA 3CBWA 1SR9A 2TMDA 3ANVA 3ZWSA 1V0MA 4W86A 1O5KA 3PTQA 5BU6A 4AAJA 1HX0A 1NF7A 3SQSA 3UJ2A 4ZO8A 1K9TA 2OWWA 3SY5A 3IIPA 4P8VA 4NXSA 2VEMA 1CXEA 4ZQOA 2RAGA 4E3VA 1G7UA 4UFIA 3AO0A 3QQ1A 1XS2A 3DN5A 2OQHA 4HN8A 3RG6A 3LD5A 2WKGA 3AHXA 4IPNB 2VENA 3M7WA 1A3HA 1BGAA 5A8QA 4Y8EA 4UOZA 2A3CA 3VTRA 3WD0A 3SRDA 3W82A 5C55A 4PCSA 4IMFA 3WNMA 1QBAA 1H0GA 2GQAA 2ONEA 3QHMA 2ATSA 4LY8A 3VOGA 1EOMA 1KM0A 1SZGA 2A3LA 3OYZA 4DWSC 2EG8A 2QULA 3TMLA 3BZJA 3EWDA 1LRNA 2FJKA 3CB8A 3HMCA 4K3ZA 3W70A 1Z69A 1R8LA 1CXHA 4HTBA 2O0TA 3ZQ9A 5I78A 1MXGA 2KZHA 3L4WA 5HMFA 1FWNA 3VCCA 4F0HA 3L0NA 1K8XA 4H7CA 2HXUA 3PWAA 3UWUA 3M0MA 5CXPA 1UBSA 1NH6A 2FFCA 2HNEA 1IGWA 4MNKA 2O9PA 4J4KA 1PKNA 4E2BA 4PTWA 4E8GA 3B0YA 3PPHA 3LCIA 3DX5A 4IISA 3CTTA 3B0PA 3WNOA 2FGLA 2R94A 4BCEA 4AX7A 2DU2A 1QAPA 4IMCA 1OFPA 3RHGA 3P80A 1EP3A 3WD1A 3LGEA 1JGIA 3GVVA 3R43A 4K7YA 3SO7A 4CU6A 5FI8A 1TTQA 4UCFA 2J7BA 2B7OA 1B4EA 3CQJA 2Y61A 4Z17A 3GG8A 1AK5A 3AIEA 3FYOA 3BCFA 3HU7A 3A21A 2XVKA 2H90A 5I3KA 5CJNA 4HNUA 4KFOA 1JL8A 2PDFA 3NZRA 1GOKA 5HDRA 1V77A 3IV3A 4XZIA 3BPWA 4K36A 3D3AA 1XM3A 2DT0A 2VRQA 5JBDA 4EXAA 1FWTA 3PBUA 4DUWA 7PTDA 4M0XA 4PMQA 1XYBA 1XD1A 3S2LA 3UWZA 1ZRQA 4C6LA 4JFWA 2FB2A 2E5DA 2X1IA 5F7UA 3W0KA 3UR5A 9CGTA 2AQVA 2OSWA 3PUOA 3QSRA 2QPUA 3M46A 2OOFA 1KV5A 1DBTA 5A6JA 5BMXA 4YTTA 4YTSA 3I6RA 3VE9A 3A23A 3L21A 5C9WA 1I0DA 2XDFA 2YDQA 3LLDA 2XN1A 1ADDA 3FA5A 3LSBA 3CT7A 4RE2A 3GC4A 1IWPA 1UP2A 3W1UA 1AW2A 1AJ2A 1VHCA 3SJNA 4UC5A 2G3JA 4C5YA 2CZFA 1P6WA 5CPLA 5C7VA 1KR1A 3R10A 4RXFA 4GO8A 2PDIA 3RMEA 3VGBA 3BLPX 4YIWA 4CNSA 1XRTA 4JXCA 3B8SA 3G8EA 5G4WA 4S3CA 1MRAA 4C6IA 2HROA 3SR7A 5HBFA 1JF5A 3W3OA 3TDFA 2OLSA 3UGVA 3K4DA 3F4WA 5A95A 2XVGA 1PTGA 1VHNA 4PMJA 2CEQA 4HJFA 3WLRA 3TXZA 3CHDA 2DIEA 4WCJA 3FA4A 3H4WA 1FDZA 3UNDA 1W5QA 1MVYA 2F9RA 1AW1A 1JDEA 3MHGA 3W6YA 3NM1A 4OQVA 3W87A 5D9OA 2JEQA 4LYPA 5KETA 2BHUA 4MJ2A 2W63A 4XSLA 1ICQA 3W7DA 5IBXC 3W38A 3PG8A 2ISSA 3S1VA 1JZ7A 3SIZA 5EYWA 2HRWA 1UWTA 1ZBVA 4C6PA 1RD6A 2ZKMX 2PDLA 4PA8A 3AS0A 3S3GA 3W6LA 1K7FA 3O6YX 1SW0A 1GCYA 1Y5XA 2W62A 1GGOA 4TQTA 4JTQA 4PRRA 4WD0A 4IMAA 2FVKA 5EMKA 3I7RA 4XKMA 3LYEA 3MHUA 3PJUA 3ABOA 2DZXA 1A0CA 1MUCA 2A0NA 4GZ7A 1X1OA 2J9XA 4M51A 3DHUA 4UQCA 3OODA 2UBPC 5DY3A 1DJWA 2CETA 5IFPA 2NV1A 3WQGA 3WFZA 4EE9A 3S0CA 2HEJA 1KGUA 1V6VA 3H7VA 2RDUA 4GZJA 4E4UA 3MBDA 2V30A 2D24A 1XD0A 3ES8A 3CL6A 1I0BA 1TTJA 1EFZA 5FESA 2TODA 4M24A 4GLEA 3WK0A 4Q7BA 3ZLHA 1EA0A 4U2ZA 4A35A 2ZYFA 2VL4A 2DEPA 2ON3A 3REQA 4NUWA 1T7LA 1H62A 3L0GA 4H3DA 3DH7A 3MUY1 1JDCA 1S1PA 2HS8A 1TR9A 1TUFA 3G77A 1BFNA 3W1AA 1BVWA 5I79A 2A6NA 4W5ZA 4XUYA 4LUTA 4FXJA 5AC7A 1SW7A 3EA2A 3GNPA 2PF8A 3BZGA 4L80A 4EKJA 2VZVA 1O60A 1XR2A 3G1FA 4QLLA 3W2MA 3SUVA 2WKJA 1B54A 4H9YA 2P0OA 1V6TA 1XICA 1JD7A 1LL4A 1O5QA 4L5ZA 3R58A 2UZ9A 1AZ2A 3DFNA 3MQTA 1UKSA 4TX9A 2RDTA 1XSIA 3WELA 1U1HA 1TV7A 1TFVA 4OUIA 1IT0A 4IQLA 4IUOA 4ZOCA 4G56A 3UPWA 5FAJA 4J2PA 3QW3A 4S2BA 3QVQA 4BF7A 4I9AA 3N2XA 3S2NA 4JX5A 4YN5A 5CSSA 2E09A 3UT0A 1QATA 5DN1A 4HPJA 3LCGA 1KRAC 3VD4A 1W32A 1V79A 1KCKA 1XIGA 2AMGA 4P2VA 4PODA 1JQXA 5HUPA 4IFRA 5IDIA 4ACZA 1W9VA 4BA0A 2QAFA 1IZKA 1ZB5A 4H1ZA 3P67A 2HE5A 1VIWA 3WZ0E 4HZ6A 2ANUA 4AZ6A 2ODOA 4C65A 1QNPA 1JRBA 2VFHA 3WMLA 3HG5A 4GYFA 4DPPA 3K8LA 1FHDA 1M41A 3V0TA 2J27A 2E9BA 2FDMA 3OIHA 3EWYA 4NJKA 1WDRA 4J7RA 1DWHM 2QUMA 2IKHA 4GJIA 3RRXA 6CGTA 5FF7A 4IJBA 3N11A 1EPXA 4JTSA 4GVGA 3AOFA 4C6NA 4E2DA 4FX7A 4PEKA 2OWCA 2J78A 4UNKA 2WZHA 4MSSA 4AYGA 4DXXA 4FR1A 1E0UA 3RF9A 4ZB5A 2Y7DA 1G69A 1EHAA 3PZNA 4GC3A 4POCA 1KW1A 4NT0A 1KWKA 2PF0A 3EXTA 4TV6A 1LYXA 3LHWA 2YB1A 4FMVA 4UBPC 4OIFA 3GX9A 5C7HA 1Y5VA 3UVAA 1W6TA 2R1LA 4QDMA 2DVXA 5CGQA 1VLIA 4P7LA 4Q4MA 1IE7C 2CBVA 4QQUA 2OYLA 4AIOA 2ZRUA 1J96A 2Z26A 1S2VA 2VM8A 3GKFA 1WXJA 5TAOA 1UWAA 2W27A 4RE4A 4BZYA 4PL2A 2I57A 1L6GA 2AAAA 2PDPA 1NELA 1V02E 1C8YA 1AMYA 1TV5A 2J47A 3FHQA 4DUOA 3VCNA 1J9YA 1MMFA 4K38A 1KXHA 3CO8A 4UWMA 1EUNA 1O12A 2XIBA 4HCHA 3ZVHA 1TQJA 3BAXA 3KVLA 4B9YA 2ABBA 3UEQA 1GJWA 1XHGA 3VZYA 1EO7A 3TYAA 3TEVA 2GOKA 3WFLA 1CIUA 1OHLA 2CHOA 1R7OA 3GBEA 2YPIA 1K8CA 3TAKA 2PA6A 4AWUA 1LQ2A 3W00A 1ADSA 4HYVA 3EB3A 3L2IA 1VEMA 4GHRA 3N25A 4Y9NA 5AFDA 3E1F1 4D6EA 4QCFA 3TTQA 4JN6A 1QI3A 3ARWA 3U7VA 3MSRA 1V6XA 3W24A 3WX7A 1DORA 4KMQA 4A8IA 3WIJA 2ASHA 4JTJA 3C8FA 1TTIA 2WHKA 1M01A 5FF3A 2C6QA 4JDBA 3PSWA 4FOKA 1MI3A 3FVMA 5A94A 3UERA 1ECEA 1A3XA 4JTHA 1TIWA 2DW7A 3OVPA 1W54A 1RCQA 4HMNA 1Z44A 2PGWA 1OEPA 3E2QA 3IGUA 5EBUA 1NDZA 3GVRA 4HA1A 3CQHA 3ZR4A 5SWUA 2J13A 1S5MA 3KAOA 5K4ZA 1UD2A 4IGMA 5I07A 4FIQA 3TQKA 5AYBA 3E0LA 4Q8NA 1XG3A 2EXOA 4XVDA 5G4HC 3H55A 1M6JA 4L56A 2I16A 3C2FA 3THDA 2ZX9A 1RA0A 1PZ1A 1YHTA 3WEZA 4WEVX 1GVSA 2PWDA 5U7SA 1KC7A 3R94A 4XISA 4RZ4A 1EO5A 2WMIA 1A5AA 4HU8A 3PZMA 1TWDA 2W61A 3WD3A 3GKAA 2BLEA 1TWIA 1QDSA 4NAFA 1GZ1A 1VBJA 1K3UA 3UXAA 1SQ7A 3N12A 4S3GA 3GTFA 3VOIA 3UZZA 3TW7A 2F61A 1KM6A 3LK6A 2ZA1A 2G37A 5M1TA 4FSAA 4JNZA 4MVAA 1JDFA 4GNJA 4YTQA 5C5YA 3IJQA 3PBVA 4LNYA 1WUEA 2GLKA 4QNWA 3QZEA 4JN7A 3A64A 1HP5A 4PUJA 3NVDA 4H9VA 4HMCA 2V81A 4O0QA 4R7WA 3TJLA 1AH3A 4GO9A 2A7RA 2X7WA 2C71A 3W72A 1AQMA 4EPKA 4WJEA 2J4GA 3W2UA 3C2VA 3IUHA 3JUGA 3ZLGA 1OD0A 5EB8A 2PWFA 2NVCA 2W9MA 1X97A 1VS1A 1R3RA 1BGGA 3WNKA 2HK1A 4BEQA 1MEIA 4GUHA 3KBVA 4K8GA 4KWUA 3OA3A 3L67A 4J2MA 3BG5A 4FS9A 1AQHA 2ALRA 3PVFA 4YTUA 4QJ3B 2GJRA 2WNZA 3FK4A 4RPQA 1PYFA 1EPVA 3W7KA 4JNMA 4Q4RA 1VPYA 4XD3A 3LCHA 1R9YA 1JAEA 2BOGX 1XX1A 8XIAA 1QHZA 1DJIA 3CYVA 1S38A 3KX6A 3CV6A 4FXSA 1IEQA 4PUMA 1VJSA 4B5TA 3W37A 3VNYA 2YR1A 3TK7A 3HJEA 2EHHA 3GFXA 1DWJM 3P6LA 4JPGA 3Q67A 3NXLA 1WV2A 3A13A 1MUMA 2AL2A 4AVFA 5D03A 2HWGA 3EGJA 3P14A 4JIRA 1LZOA 2EPKX 1UC4A 4UQAA 3G6MA 2J66A 1KFBA 1VB9A 2HNHA 3HF3A 4MJZA 3E0IA 1A5OC 4TX6A 2E7FA 3FDKA 4AD3A 1AUSL 2V6AA 2W5FA 4LALA 1TPC1 3WQ4A 5GNZA 2ZZ5A 4LUSA 2QV5A 4C7DA 4FOJA 1VJZA 3POHA 4DB7A 4CU8A 3XINA 3H23A 1H61A 3KBMA 3P93A 4AW7A 2EGZA 1BWLA 5I00A 4WHBA 2ZZ2A 1G5AA 1X98A 2BWGA 3E5BA 2Y63A 1MFUA 2VT0A 2PCQA 2OZ3A 3QZ6A 3WQDA 2ZCGA 1XBVA 4BI7A 1WAUA 1IEXA 4YJ5A 5D2XA 4HGXA 3AYRA 4HA4A 2YA2A 1K6AA 4UR8A 2WHMA 5DCEA 4LYQA 2ZUMA 2B7QA 1XWYA 3N3MA 2YIHA 3HQPA 1EQPA 3F4CA 3PF3A 1R30A 2ZXQA 4O1FA 3SGGA 4WKAA 3FV9A 4P7RA 4E38A 3AUJA 1QT1A 4AB4A 3M4HA 3K8KA 4IXHA 1M65A 1B5TA 1BF6A 2QCGA 3DU0A 3ARUA 1YW1A 2FVLA 4GG9A 3PTKA 2PDGA 1KTBA 1PXGA 4QIUA 1SJAA 1XLGA 3T0CA 4DVOA 4K68A 3CPGA 2EAWA 3ITVA 3NL3A 4X61A 3B9OA 3NCOA 3UJFA 2PGFA 3WLJA 3U9IA 1E9IA 6REQB 2D3NA 4OBRA 4XZ9A 2J62A 3UWVA 3W4RA 4GACA 2OJPA 1EP2A 2QVHA 4UQ9A 2YZ5A 3OBEA 3M41A 4JCLA 2BS9A 3CASA 4Z1CA 3NQGA 1IV8A 3ECQA 5J8LA 2IXVA 3S5ZA 3F4NA 4KKXA 1XLAA 3QYSA 3DBPA 2NWRA 3UP8A 3NZ1A 2HS6A 1YXYA 4CLMA 3BSGA 3LPFA 3ITGA 1V3IA 4W8LA 5A6AA 1QTWA 1BRLA 1ISXA 1TPWA 3WDQA 3PWGA 4FZIA 4E4PA 1X1ZA 4QX4A 1W8GA 4ML9A 3S2CA 4V28A 4X3ZA 1GQIA 5EU9A 2XVPA 4HP5A 1D3CA 1OC6A 1CLVA 2AAMA 4DX3A 3U8GA 3TWAA 5AC8A 1BLIA 2NX1A 2W3ZA 3PY2A 3RLUA 3F5LA 2YGYA 3W83A 2FZMA 3MC5A 1PB0A 3EXRA 1H7NA 3RU8X 1QOQA 3WQCA 1BKHA 1TSIA 4WX2A 3IACA 1IZJA 3ITOA 3M0LA 4D2JA 2CXGA 3DFOA 3GXPA 3BW2A 2ZVIA 3PAJA 1NQ6A 3KVKA 5I6SA 4UMCA 2V3DA 3GU2A 2YCLA 3N6JA 3QMRA 3QN3A 4JTFA 1UR2A 3FYYA 1S2CA 3QF0A 2G3MA 4O11A 1RCOB 3VNMA 1GT8A 1TCMA 3N1AA 2R8WA 1EF3A 4GX8A 3R89A 1N8FA 5AHEA 4Q8QA 4FB7A 2QEZA 2OYKA 4AD2A 2IQTA 4MB5A 4HD5A 3LNMA 4ZE4A 1ADOA 1GOXA 3IAPA 3OLGA 4ZL1A 3HQNA 5FJRA 2V5CA 4PMYA 1LUCB 1TX2A 4KCTA 1V0KA 3E74A 4GC4A 2XUCA 3MVTA 1D2KA 4R3UA 2G96A 4XG1A 4ZEPA 1OM0A 3UZ5A 2PBGA 5HWJA 4ADSA 2WVSA 4QROA 2FZBA 2GUUA 3RCNA 4ICMA 3QPZA 1GYLA 3NOEA 5CG7A 4M6UA 3CAKA 5BXTA 1A3WA 1RBOB 1R47A 1XFCA 2QIWA 2P50A 5CSUA 3GFZA 1UUQA 1JYWA 1H2JA 1TPVA 4DNHA 5C9UA 1G67A 5I3GA 3MW7A 3NQ2A 3LXBA 1HXJA 1CGWA 4GZEA 4WRHA 3LGGA 3WDPP 1XKJA 3TC6A 4MYXA 3B9AA 1M7JA 5H1WA 3A4WA 1M3UA 2OKTA 4JGDA 1UOZA 1E5JA 4J3SA 3DG7A 2QJJA 1K1DA 1WQ5A 2QF8A 2C7FA 1EWEA 4V2XA 3E96A 5KZEA 3S2MA 3GYEA 3MVIA 3CU2A 4RXGA 1DWGM 5LIYX 1U5VA 1SW3A 3WF1A 2PDXA 3C2RA 1JUBA 4FO4A 4IFKA 4UOJA 2OFJA 3W9ZA 2IUZA 2HISA 4PR4A 1CWYA 1XIEA 4LEQA 4CQ9A 2FHBA 1S2TA 4QXIA 9XIMA 4DLFA 5CBJA 1RHCA 5HNTA 3H54A 3HMJG 1Q45A 2OXNA 4C1NA 3R2GA 4NNCA 1GQKA 2RFGA 5CBBA 1XPYA 4TIMA 2INEA 1MW3A 3SCSA 3P81A 3W81A 2F7FA 3C5QA 4JTUA 1U83A 1W1VA 4IQDA 1EC8A 1UUOA 1YTKA 3AZTA 3LPPA 3ZJ8A 2XHYA 1U22A 3M1ZA 4XVEA 4AEEA 3K5XA 2ABAA 4PB5A 4F9JA 2Z2UA 1PEZA 1FOBA 1IEVA 3NQ8A 3K30A 3P7YA 3CV7A 3GR7A 3VD7A 2WK2A 4O0ZA 4Y9PA 2JGYA 1TX0A 3E2VA 1E4LA 2NQ5A 3B8WA 2JALA 2PDYA 2H8XA 2WHJA 1SFSA 1HIZA 7TIMA 1QNOA 3W26A 3VO0A 4KFPA 4UFHA 1IT7A 2DPEA 3LM3A 1P6CA 4M1BA 2YOCA 1GZJA 2DJXA 3GG7A 3QV7A 1TYGA 1P5BA 4RE0A 1LLOA 3RMJA 4ZQMA 3NZQA 3ABSA 1KR0A 3RGTA 4C90A 4PUUA 2ZQ0A 4A22A 1UQYA 2PDHA 2QPSA 3EXSA 2G97A 1TMLA 1DHKA 1J8VA 1E0VA 2PU0A 4KQNA 1RD5A 2JF6A 5D2WA 3BJFA 4AXKA 3U4AA 1XIHA 2G3IA 4XD4A 4N9EA 5A6KA 5T9BG 3W76A 4LVDA 6A3HA 2QDEA 4I3GA 3ITXA 2F6KA 3BXWA 3DC0A 3EA1A 1FFQA 4CCDA 2E4TA 1E70M 1B3XA 5HQEA 1F3TA 4ZQPA 1GHSA 5EGRA 4W4QA 3HV9A 3MZNA 3TN3A 1C9DA 2J7CA 3VVGA 2PGEA 1H51A 4H2HA 2X8RA 4AMCA 3RCYA 2X16A 3UPMA 2ZXAA 4OGZA 3F5KA 3NYDA 3PZUA 4CCEA 3D6NA 3W53A 1DXIA 1LBMA 5C70A 5CPSA 1OB0A 3DYPA 2ZRXA 3ARPA 5HANA 3M5VA 3WL1A 2HQAA 1ZP3A 4M6QA 1NAL1 1XBXA 2Y7EA 3G3MA 2A3BA 4PBFA 3O2LA 1QNSA 1A0DA 4A8NA 5CPNA 4RZ5A 2AGTA 4QR6A 1JZ8A 1AJ0A 5HPOA 1XG4A 3OP2A 2HVMA 2O7QA 1CGXA 3UXDA 4IGNA 1M5WA 4CKQA 4Q4OA 3CYJA 3UXLA 1M1BA 4ZCWA 4AH7A 2HE8A 4GJJA 1V6YA 1LORA 4QJ1A 1DTUA 3HGRA 1AL8A 3HPFA 4NRSA 9XIAA 2P0IA 5LNUA 3B0XA 4M19A 4HK7A 5A69A 3RAOA 2X1TA 4JIPA 4ZVJA 4HNCA 4HNOA 3HB9A 3C56A 1SUXA 3HOJA 1X8FA 2Y5EA 3SUTA 3SCVA 2A79A 4LSBA 1E72M 1W3HA 1SZEA 1UWRA 1J6PA 4DWDA 3T4WA 1UR9A 4TX8A 2REQA 1BXBA 1TV3A 3UXKA 4G9PA 2G4JA 4ADUA 1UUMA 1G1YA 4AISA 4MWAD 1W3IA 4QSFA 4J40A 2PS2A 4S39A 1NFBA 3TQPA 4C6BA 4D9PA 1HJSA 5XINA 2YA0A 4Q8VA 3TXVA 2GK1A 4CVWA 1GVQA 2PDMA 1DPMA 1TMHA 3O05A 3SN1A 1US0A 3KCOA 4XKYA 4GABA 2G95A 2WVTA 4PBGA 3N29A 1XXXA 1UG6A 1GKRA 2GVLA 1E1FA 2GWNA 4NIRA 1G4EA 3WNNA 1JJKA 1M9HA 2A4AA 2BY1A 1PCKA 1OGBA 1W1YA 4RE3A 4GH3A 4LAOA 5AKQA 3NYZA 1W2PA 4AY7A 4EXBA 5F4XA 3JZEA 5LYRA 3W7EA 1TCDA 3BURA 1J10A 1ML1A 4PFMA 1U30A 4B90A 3M07A 2PAJA 1JPMA 1R3QA 3GZAA 5IHRA 3WK1A 2FZDA 1C7SA 3QJAA 3DERA 1Z3NA 3HIJA 1X7IA 3IWPA 4UUIA 2WMFA 3FEMA 2QPXA 3A3XA 3OBKA 1E0TA 1C8VA 2QLYA 4CD6A 5CCZA 1KM1A 3NQBA 3NTYA 2JFEX 3A5VA 4XAZA 4LVFA 3V0SA 2FH6A 1B57A 1E43A 1TWZA 1AQ0A 4S3AA 3UJSA 2R1KA 4DF0A 4C6FA 1HW6A 4QAWA 4IT1A 4NILA 1K70A 4HZMA 1NARA 3GDBA 4F8XA 5BRPA 1XLDA 3ATYA 4EK7A 3L4VA 3NDOA 3WLSA 2VEPA 2OB3A 1WX0A 3VUPA 3PBYA 3GYCA 3F4DA 4W7VA 4D6GA 3UWEA 3DFSA 2RDXA 3RU6A 3VNLA 2OLAA 1UH2A 1IT8A 1B3ZA 2JBMA 1B9ZA 2E5CA 3EX6A 1JIBA 4B4HA 4F0KA 1WKYA 3KTSA 3W1LA 4PTVA 2C91A 3E2RA 1YXCA 4R9XA 3S83A 2XYLA 1FKXA 4IWWA 1YNPA 3UBPC 5H2ZA 2V5JA 3TNBA 1OX6A 2GGEA 4X2PA 1VYPX 4ZENA 5DXYA 3WQOA 1FA2A 1OFDA 1VP5A 4L9XA 2PTDA 4HNLA 3CV2A 4B3ZA 3I7QA 5L6UA 1JZ4A 4Q3MA 5I03A 3QYQA 4LCRA 1LOQA 1OFQA 1WZKA 7TAAA 1QU4A 1ONWA 3P5YA 5CZ0A 2W79A 2ZDSA 1J0KA 4TV5A 2DT1A 1D3HA 3W7IA 1OSEA 4Q8TA 3B9NA 5CC5A 3BC9A 2Y0FA 3L12A 3N18A 3PG9A 4NX0A 4QJ5B 3FYPA 3O0KA 2I5GA 3GY1A 4JIQA 3LQGA 3O6DA 1TTPA 3G0UA 4AIBA 3H26A 4H01A 1YBQB 3WO8A 3ZJ6A 1AH4A 2EPNA 5BCAA 2CESA 4RL3A 3VYLA 4R34A 3SQMA 1XBZA 2V8ZA 1UWIA 3CJPA 1S2AA 5CBIA 4D6FA 2PU1A 3WNPA 3F2BA 1GVIA 2ESCA 2TAAA 1GW9A 1QR7A 2QCDB 3CTLA 5CG0A 3NPVA 2FZNA 5CPQA 1UPPA 3WJSA 1C91A 4GI8A 4UOQA 3BQ5A 1I4NA 1MSSA 4JYDA 5LIUX 5JIWA 2GOUA 1ZSXA 3KVJA 4HSHA 3VOCA 2D2OA 4XZBA 3DESA 3AC0A 2V2HA 1JPHA 4E5TA 1ZUAX 1TPFA 5C0QA 3Q58A 2YL9A 3QXBA 1KKOA 3ABZA 2XFWA 3S4TA 4ERIA 1YE4A 3S6DA 7XIMA 4HMEA 3COTA 4MJMA 1RY8A 2BXZA 4UMBA 1CGTA 4GIAA 1L0PA 1XC6A 3VU2A 4GPNA 3R1ZA 2OT0A 4P7OA 3WUGA 1Z42A 1WDQA 3B4YA 5D04C 1S3HA 4KWOA 5KINA 2ZTJA 1N8WA 3C3UA 1VRDA 1IEWA 5EL1A 3WMBA 1ENUA 2QJNA 4P61A 4NSBA 3VDHA 4YWSA 1UD6A 1GK8A 1B2YA 2PZNA 2NQ9A 1XIJA 2QZRA 2VC5A 2WC3A 1DQXA 4Z2JA 3C0LA 2ZUTA 1TKKA 2XZ9A 1P43A 3T2PA 1CNVA 2HK0A 3TC7A 2VZUA 3EWBX 5AYIA 4DWSD 2A5HA 1O4UA 3AROA 2DVUA 3S9YA 5REQA 1MZHA 3U57A 4GY0A 5MHBA 1HT6A 5HQLA 3OB8A 3DC8A 3GDLA 2POZA 2NXIA 2BMBA 3BAWA 5EPDA 4L6DA 5CGMA 1LT8A 3DDMA 1K8YA 4RNIA 3CUXA 1KCZA 1X39A 2VGIA 5G2HA 2TRSA 2YDSA 4WIWA 3A3WA 3OZOA 4ADTA 2NUYA 1UR0A 4WY0F 1ZCOA 3B04A 3DEQA 4DF2A 2GVGA 1L6WA 4H04A 2O9RA 2YW3A 2Z7GA 1ZGDA 2XWDA 1TMQA 5A8PA 1NF0A 3PNZA 2FB3A 4PMDA 1WXYA 5K7JA 1T41A 2ZX8A 1OQFA 1O94A 4DO7A 2ZUSA 4UTTC 4UTWC 3PZQA 4GFIA 3ID7A 4A8LA 2VC7A 4LBRA 4DJED 4GQRA 1Q8AA 1FWIC 1KFJA 5D38A 3TU9A 3CMJA 3UG4A 1XFBA 1FH9A 4E8CA 3T0AA 1I1XA 1WZMA 1FHVA 1UP3A 2QT3A 3BUVA 3KOFA 4YPJA 5BW6A 3U0HA 1KA9F 3BLLA 5KZ6A 4RUBA 4HSOA 2YJQA 1JF6A 4Y6GA 5K2ZA 4WSJA 1UASA 3RO8A 3ICJA 4B5XA 4RZ6A 5DQPA 2PD5A 2CLKA 3DG3A 3NEHA 4DIAA 1BG9A 1SVDA 3BLDA 4LCQA 3U3HA 4PTXA 4O15A 3U2ZA 1OJXA 4XV0A 1SZFA 4GGHA 2F6UA 2X2GA 2Y8VA 5E5CA 3GD6A 4NJIA 5DMNA 2PWVA 3NA8A 3NO3A 4JTGA 2ZUNA 3A5FA 5AYXA 3VUSA 3NZGA 3S2JA 4REQA 3BG3A 3VIKA 1QW8A 4BI5A 1N7KA 2R82A 1UROA 2PPGA 3N9SA 5KMYA 3ZLFA 4JHZA 4QLJA 3EX1A 5F4WA 4ORIA 4D8LA 4HTYA 4LS2A 5AVHA 4H9TA 3VK5A 8TIMA 3LXCA 1LTDA 4F0SA 2CKSA 2XN2A 2VI0A 3E49A 2CIPA 1KM3A 2V63A 4ATDA 2L5HA 3ZYZA 1FWJC 3POCA 3VMNA 3P74A 1EYWA 4GH1A 2BXVA 4CNOA 1PPIA 2D0HA 5KEZA 4PBEA 1CBGA 4ERGA 5M5DA 5I3IA 3BLIA 3ANUA 3WLHA 3QY8A 2VUYA 1ISZA 1W9BM 5M17A 2ISDA 3FNDA 4N7QA 3W29A 3MSDA 3QRHA 3G3DA 4CVUA 1WA3A 3GC2A 1WE5A 3JU2A 4LAZA 3WBEA 3MCMA 4Q22A 1E4NA 4IPJA 2EJ1A 5DX7A 3S9IA 3RIKA 2WNWA 4CD8A 3C2YA 4RNFA 3MWCA 5LA0A 1FCVA 1ME7A 1W37A 3QR1A 3VGDA 3UY8A 2GJPA 3TN4A 4F66A 2VRKA 1BVZA 1ZS2A 4Q8PA 3SFKA 2D2HA 1H7RA 4DJFC 3G0XA 2VC6A 2Q8XA 1LLWA 2VEKA 1IR2A 4EPEC 4GKLA 3FSTA 1G6CA 3WJZA 3G1AA 3VD9A 3LHUA 3WQ5A 3AIVA 3SIMA 7REQA 2YCJA 1VQTA 4AC7C 2DZSA 2P5NA 2ZWZA 3UJRA 1UWQA 1A5NC 1XIFA 4XSMA 1P7TA 5HINA 3WLLA 1BHGA 1YTDA 4C7GA 3FKRA 3AMCA 1WDSA 1B4KA 1KTCA 4M5PA 3WLNA 3SRHA 3CEUA 4AXNA 3QOMA 2D69A 2VX5A 1W9XA 2PLMA 1R9XA 3OVRA 1OBAA 2EEXA 3UZXA 3BW4A 4B5NA 2QMJA 2PLKA 4FXFA 3GVQA 3KM8A 4X2RA 2DZWA 1Q6GA 1F4HA 1Q7ZA 4O1BA 1EJSC 1W1TA 1VR6A 4O57A 4Z1YA 2BGQA 1DVJA 3V75A 2Y7FA 3VD5A 1J6OA 4K1WA 3VMOA 3TTYA 1K4GA 3W7LA 3TUUA 3L4TA 3R0UA 3AU6A 1OGSA 1FX6A 1H41A 2A1YA 4CQBA 3UD6A 2O4MA 1RY0A 1JXJA 1DJYA 3PUGA 2JQXA 5E0KA 3E9AA 3BG9A 3W75A 1VBGA 4B5UA 3KOXA 3L4XA 1SYTA 2VEGA 4O4VA 2ZFAA 3QC0A 4JQ1A 3OZYA 1S2WA 3VA8A 4QG9A 4XB3A 1WCGA 2HCVA 5C9RA 1SJCA 3FAXA 4D6CA 3WEOA 1T40A 1E55A 1P1MA 3OGSA 3NEVA 4HPNA 3BAKA 1A47A 2VEFA 3LHYA 1JPIA 5J5RA 5E93A 1FWDC 4U5KA 1ZBKA 1LL7A 2QNEA 2XISA 1IIHA 4R88A 3U4FA 1KFEA 1P0NA 1NDWA 1CLXA 5HK4A 5I0DA 3UFYA 2GQ9A 3GFYA 1FHLA 3BOFA 3I7SA 1H63A 3R25A 4WF7A 1HNYA 2NX3A 1TZ7A 4IMGA 4DXKA 5T9CE 5F2MA 1NWTA 2XSBA 1EUAA 1I60A 3I3BA 3ZZ1A 2G41A 1C7TA 4MZYA 4WJXA 5GVJA 3H2AA 2EQDA 3AHZA 5D2TA 1KM2A 4KRTA 1UWSA 3GVGA 3GIQA 4GQQA 3MJMA 4X0VA 2Z1KA 1ICPA 2ZOXA 2E1WA 1CI1A 5CZJA 2CLFA 2CERA 4I9JA 2O55A 2EJAA 3VKCA 1HJVA 3UG3A 5G5IA 3NG3A 4LUYA 1MRQA 2E68A 3VNKA 4OE7A 1ZJHA 1B1YA 4MOZA 1E6XM 5DRCA 1REQA 2WZEA 4JZ5A 2OGJA 1EX1A 1QUMA 2DQXA 4ZXOA 2YX0A 3IJ9A 1Q4WA 1J0ZA 3CL8A 1XLCA 1AODA 3C52A 4Q7NA 4A21A 4GBDA 1QRQA 2D2JA 3PULA 5BOFA 3LCWA 3SCNA 4B9ZA 3FGCA 4RW3A 4NP7A 1XYFA 4O1DA 1LL6A 4HIBA 4ERAA 1WOBA 1KCXA 3IUIA 1GG0A 3LEPA 4S1FA 4IIDA 3TJIA 3HPZA 4GX9A 1I8JA 4QJ4B 4P5UA 2O92A 1XIDA 1SSDA 2EKGA 2H3BA 4ENLA 4F2UA 3VOFA 2WYSA 2VVNA 1N2VA 1X6LA 4XD5A 1EYEA 4IP5A 3VM5A 3ARTA 4HMDA 1UQZA 3KDNA 7A3HA 4AF0B 4GYPC 2OG9A 1OF8A 3CIXA 3WENA 2WLZA 5M2FX 2PP0A 3CQ0A 4BQ3A 5IBXA 1RP8A 1SSGA 3GTNA 1E4MM 1KFWA 1J0IA 1OFRA 2C1IA 2WSRA 1X6UA 3GDMA 4AD0A 4P7QA 1B9BA 3OLIA 4CQAA 4DO6A 5CPTA 2OODA 2R91A 4C5ZA 3VI2A 1W3JA 3G6LA 4AQLA 4NQ1A 2NWSA 3WQPA 3UU0A 3VGEA 5T91A 1PWMA 1H1YA 4MKNA 1F3XA 1XDJA 3DFHA 3D3FA 3MKCA 4LB4A 5AECA 4S3KA 3EPOA 4GE8A 3F2CA 1YPIA 1NP2A 3W2KA 1G0CA 1AFSA 3NQCA 1UHVA 4TMBA 1M03A 3DENA 1VFLA 4J3VA 4DI9A 1EEPA 2VFGA 3INPA 3OYXA 3PPFA 4AG0A 1KTNA 4N02A 3R8HA 4BR1A 3GAYA 1B3OA 5A6BA 3C2EA 3L5MA 3CK5A 1FH8A 3UZJA 2GGIA 3T08A 4R7JA 3CLMA 1RQBA 3RNDA 1CLKA 3EWZA 1RVKA 3KCJA 4BEUA 2A7PA 3VDCA 4UTJA 2E6YA 4GKTA 4AIUA 3TJXA 3F03K 1KBBA 5HQMA 1POJA 3U5YA 5EA9A 1H60A 3TTOA 1TVLA 1S5TA 3WLTA 1XLMA 3TYZA 1OVDA 4GYPA 4LUJA 4RLIA 2NT0A 1AH0A 3H22A 2FTPA 1GTEA 3LY0A 4IIEA 1GKPA 2DORA 4GJ1A 3QTGA 1W8SA 1K9DA 3GNXA 4L1WA 3A22A 2X40A 3M7SA 3ZS4A 1OX4B 4JDYA 1RJRA 4XQ6A 1PHWA 1DJXA 4AZ7A 3KOWA 4ECLA 4GD0A 1VBUA 1W31A 3H2OA 1MNZA 3IAQA 4PMNA 3VKBA 1NU5A 3P84A 4LAKA 1OYBA 3FS2A 1V51A 2GVEA 1R3VA 4MHBA 4E2VA 4DUXA 3UG8A 4S23A 4Q4KA 3U5UA 3BARA 1J5SA 5FACA 1L8PA 2HBXA 4XZNX 3JVAA 2DZPA 3EMZA 4QG8A 4M81A 1UIOA 4O10A 1GUVA 2Q71A 4HYWA 2BHZA 1OGGA 1E51A 4UFKA 3HGOA 1JNDA 2P88A 4WJ8A 2F6XA 4GY1A 3QPEA 4CD7A 3KRSA 5AZ1A 5K9DA 3SY1A 5XIMA 3BCJA 3M0KA 4JYEA 3GH5A 3WD2A 2GYIA 3PSVA 1ODUA 1X7FA 3W27A 1C3FA 2HMCA 3L4UA 2EBNA 4PGLA 3CZ8A 4AHQA 3ABRA 3H21A 2XH2A 3FKKA 2E6DA 1TVPA 1QPQA 3UZYA 4A3YA 4KWVA 1L6FA 3KL3A 1OFEA 4Y8FA 1W3KA 3U6WA 1KXTA 1PO9A 1US3A 3Q2DA 3T0BA 4XAGA 3IIVA 4ORMA 2ZUWA 3BANA 2GWGA 2BDQA 4NJGA 3T9PA 1VGAA 3LBOA 2V5DA 4NYUA 3UR8A 2W92A 3MY9A 3IGSA 5E0FA 3LRLA 3TKFA 1BF2A 1X38A 1O1HA 4GGBA 4GISA 3GXTA 3WBXA 1XYCA 4CNNA 1H50A 2J8GA 3NNTA 2YCKX 4JTDA 5FJIA 3TNOA 3GXFA 4FX8A 4AC1X 4LUIA 5CZSA 3OTRA 1W1IE 2PDKA 4UR7A 1TRDA 2YA1A 4UMAA 1PZ3A 3VX1A 1EZ2A 1FCUA 2QJGA 3MYOA 1K03A 3G2GA 5FJPA 2UY4A 3PJTA 1FH7A 2R24A 4KRUA 1H7XA 1KXVA 3A4JA 3WUBA 4HOXA 1OCBA 4PTMA 3N2BA 2BY3A 3RM9A 2Z29A 3AXMA 1BYDA 4D1IA 4HVXA 2DY3A 3MUCA 1CGVA 2QS8A 5I3DA 4PL1A 5MKGB 2CLEA 2WVUA 1F07A 1ECQA 4JIIX 3N2TA 3S5NA 3TYCA 2CYGA 5FJTA 2VTFA 4U33A 4BQ4A 3GUGA 3DXIA 1D8CA 1HGWA 5IFTA 2Q3OA 2A3AA 1DWIM 5LXXA 1XIMA 3MU7A 3LV5A 4Q7IA 3NQMA 4WQ6A 2YW4A 4TOQA 1R6WA 3HPXA 4JL1A 1CGYA 2QXWA 3O06A 4HKPA 5DMLA 4F40A 1HJUA 2FTWA 1ESWA 3DI0A 1DQWA 1XPGA 2ZDRA 1R3WA 4EIVA 1WUFA 4M3PA 2J74A 3E38A 3P8JA 1RUSA 1A5LC 3GUWA 2YL6A 4WVXA 3M9YA 1ZBWA 1KBIA 4JFTA 5LA2A 1JPDX 3L68A 4LB3A 3G1VA 4HU0A 3ONCA 1H7PA 3FVDA 3VGFA 5FCZA 2C13A 4E8DA 5HJXA 4E3TA 1CT5A 3V1PA 3WJYA 4QAIA 2QF7A 3UWWA 3QM3A 3BOXA 4OUEA 4EF8A 2BY2A 3AUOA 3MUIA 1TWSA 2WNQA 1ISWA 1J0YA 3XISA 5D2YA 5CKSA 3W7GA 3G1HA 5JXQA 5CZKA 1NY1A 2YB4A 1IHIA 2ACQA 2HPMA 1Y5WA 2WVVA 1LRQA 3GH7A 1TELA 3CB3A 4NNAA 1XH0A 1XRSA 5ABFB 3FJNA 3WN6A 1S5NA 3BGAA 3WNLA 2XVLA 2J6VA 1TPH1 4Q6XA 3HBLA 5CZTA 4YYCA 4UTFA 3MTWA 3NGFA 1IIGA 1TJPA 3T55A 3IGXA 3ITYA 5BRBA 1B90A 1ITXA 4FALA 3T40A 2A21A 3S5SA 1YADA 1ZJIA 1J18A 2WSYA 2V2DA 4Z2GA 4BI6A 1TZ9A 3DYOA 3HPSA 1BWVA 4KEMA 1TJ0A 3W7NA 3WH5A 5BOEA 3DIPA 1EEXA 1AA1B 3W7RA 2A7NA 1QWGA 1MW1A 1PKLA 1NOUA 4CCCA 4DZ5A 1WOAA 3NPUA 3CXOA 2OR2A 4YHGA 5F1VA 4XIMA 2NUXA 3OLDA 4OECA 4GY7A 2WXDM 1TE1A 4DBUA 3W7HA 3IJ6A 4ALDA 1A80A 1MXDA 2CZVA 2ZZ1A 5ENLA 3OZPA 2P8CA 3NOYA 2Z4GA 2XN0A 4GUIA 4Z1AA 4R53A 2D2GA 3F4VA 5H91A 5M03A 2X30A 3GHRA 3KOZA 4IIHA 4J3XA 3N2OA 4ZQNA 3RRAA