3KRUA

Crystal structure of the thermostable old yellow enzyme from thermoanaerobacter pseudethanolicus e39
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
335
structure length
335
Chain Sequence
SILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalysis with thermostable enzymes: structure and properties of a thermophilic 'ene'-reductase related to old yellow enzyme.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus atcc 33223
molecule tags Oxidoreductase
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
total genus 128
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kruA00
4DO5A 2R8WA 4DELA 3VI2A 2FPVA 1V5XA 3G1HA 2Y7GA 3B4UA 4DO6A 4IMFA 5AHLA 4JGDA 4K37A 4EF8A 4A2SA 3TSDA 3TKFA 3M41A 1FQ0A 4MJMA 1H1YA 1LRNA 1YTEA 4OGZA 1P5BA 3KVKA 4O52A 3SSJA 1TTQA 2TMDA 3DI1A 4CNNA 3N34A 1FWSA 2RKXA 2YR1A 1YDVA 4X3ZA 4ZL1A 3ABOA 5H2ZA 4HNTA 2A7NA 1XKYA 2DZPA 2D73A 3NQMA 4XBKA 3EKZA 2QJHA 1N55A 1FDJA 5BMWA 1SZEA 5LNUA 5FEPA 1O94A 3ZWSA 1LYXA 2FJKA 2OT0A 3PB0A 1YXDA 3NQVA 3DENA 1LOSA 2Y63A 3G18A 3P61A 4BI7A 2DZSA 3NQ2A 1OX4B 4LUJA 2Y7EA 3GDLA 4FIRA 1W1ZA 2DP3A 1ZAHA 3W1AA 1XBZA 3ZWTA 3W1UA 2NWRA 3LGEA 3W1MA 4XWUA 1TQXA 2Q3RA 1TPDA 3TMQA 3TNOA 3PWAA 1FCQA 1R2RA 4NZFA 1H7RA 2OT1A 2Y7DA 4IXHA 1TPB1 3LTSA 4IGHA 2EF9A 2C15A 5EPDA 2B7OA 3E12A 3JR2A 1KTCA 2W6RA 4RXGA 1EEPA 1A5CA 1SZGA 1VYPX 3NR0A 1I2OA 2CFFA 4IX2A 3NDOA 3TC6A 3A5VA 1XXXA 2W0UA 4WY0A 2ZZ2A 5EKYA 4ORMA 5BMXA 3ABSA 5E0KA 1B3OA 4JDBA 4NXKA 1F6KA 4ICNA 5SWUA 3UWQA 3TFCA 2V9DA 4QM1A 1L6WA 3I65A 4LS0A 3L5AA 4O50A 1EUNA 1WXJA 3S5YA 3TCEA 3I6RA 2FB3A 1SO6A 2R94A 5D30A 1LOQA 1VLIA 3W74A 2DZWA 2CZFA 2QKFA 4MY1A 4X22A 1M5WA 2OMAA 1CI1A 4ZVJA 2A85A 5F2LA 1L9WA 3BV4A 3HF3A 3JRKA 4TO8A 5TIMA 4M6QA 4R53A 5CG7A 3NQ6A 3A9IA 4R34A 4TMCA 1K3UA 1G7VA 2GQ8A 3FOKA 1UCWA 1ICSA 3SIZA 1W54A 1F7BA 1OHLA 5D03A 4OV4A 1KBJA 4IMEA 5F4XA 3QQ1A 1XUUA 5C5YA 3MMTA 3W2NA 1EIXA 2RFGA 3HIJA 3BLIA 1RVGA 3KRSA 3L21A 1LOLA 3L0NA 1X8FA 4LUIA 5K3VA 1OX5A 5AN7A 2B0MA 3LM7A 1FWNA 4CQ9A 2YW3A 4AHOA 2JGYA 4JTFA 3W2MA 1TMHA 4LS1A 1LORA 2Y7FA 3EX2A 1SR9A 3FA5A 3LXCA 1K8YA 2XN1A 2Y61A 3WJYA 1AW2A 1H63A 1K8XA 1WAUA 3DI0A 3S1WA 3UWYA 4B5NA 3T78A 3G0UA 1YTKA 3W1PA 1O60A 3EX6A 3W7IA 2ZZ3A 2JGQA 2QCCA 3W7HA 1JRBA 3LRKA 5G2IA 1JVNA 1TYGA 1FDZA 3NO5A 2NV2A 3DKLA 1LDCA 2ABBA 4NNBA 5D37A 3ELFA 3MUXA 4FIQA 4O1CA 1KTBA 1KM3A 4RZ4A 3PR2A 1W5NA 1MXSA 5C55A 1TTIA 4FNTA 4IXXA 3MP4A 3PSVA 4ZMGA 4Q4KA 4JTEA 3LCFA 3DGRA 1ZNNA 1KFKA 3LTYA 4IPJA 5AHIA 3PVFA 1K7EA 1DL3A 1H61A 2GVGA 2PE4A 2VFEA 2LLEA 4R7JA 3W7CA 3GVGA 4DEFA 1WA3A 1NF7A 4JY9A 4BFAA 1WBJA 2PCQA 3QW4B 2VFDA 5K4ZA 2W79A 4HSOA 1KLYA 1TRIA 4O0ZA 4BF9A 3NEVA 3O6YX 4OE7A 3HBLA 3LCIA 5D33A 3CEUA 5IBXC 4DBEA 1FY6A 1AW5A 3WFAA 3M9YA 4YCPA 1C9DA 3C8FA 4AWTA 2WKJA 1WDWA 3PG9A 4MZYA 1NVMA 3TQ0A 4OBTA 4O4WA 2ZZ7A 3LTPA 1L2UA 3GDKA 1G4PA 4OWGA 4JIQA 4N9BA 1JUKA 3G3DA 4EVZA 1JJKA 4I7UA 1SUXA 4O13A 4UUIA 5K4XA 1F6PA 2QCDA 3F4NA 1WBHA 3EWUA 2BTMA 2AAMA 4ZQMA 2I14A 4GE8A 2ZRUA 4A22A 4AEOA 4HPXA 3NL6A 1WV2A 2YCEA 1NFBA 1K8ZA 2VKZG 4S2BA 4LS2A 4QQ3A 1TB3A 1KM0A 2VOMA 4KFOA 4BWLC 1H7PA 3UPBA 3LHZA 5DCBA 2FPTA 3TXZA 4AAJA 3IGUA 3EWZA 4NNAA 1PS9A 2B7NA 4O0KA 1U83A 3CTLA 1MEWA 5CZJA 4JXCA 1G4SA 2XN2A 4NVTA 3PB2A 3P84A 4CNOA 4IMGA 1VGAA 1OF6A 3IVUA 1FWTA 4FX6M 3YPIA 1GT8A 1YDOA 1AG1O 1TO3A 2VEKA 4K8EA 3RLUA 1ALDA 5DN1A 2H8ZA 5I3HA 1UUOA 4Z1BA 3GR7A 1DJNA 1GVOA 3F1QA 3E96A 2H8XA 3PBWA 3U2OA 1FX6A 4UTTC 3QYQA 3CEPA 1V7YA 4UMCA 1Y0EA 3PG8A 3PS7A 5DY2A 1ZJIA 1SZFA 3LHTA 5ABTA 3O05A 4K6AA 1EUAA 3NQAA 3W72A 2ZRXA 5G1TA 4BK9A 5BNKA 3FS2A 3LHWA 3KRUA 2B4GA 3QMTA 3L65A 3L66A 3ATZA 2VC6A 4YXGA 5J5DA 5F2MA 4O54A 2ZRYA 3NG3A 3FEMA 5A8GA 3TMLA 3USBA 4I7VA 2BZNA 3LHUA 2JKAA 5HWNA 3W7PA 5GVJA 3G8RA 1HFBA 5KMYA 3TIMA 3G22A 2E6YA 5DBTA 5D38A 2JK2A 2GJNA 5CSRA 4PL1A 4XTDA 4CNPA 4ORIA 5D32A 2B7QA 3BW3A 4RV8A 3C2FA 3FJ6A 1TV7A 3RU6A 5EYWA 1B57A 1KM4A 4AF0A 5D02A 3QC3A 4LV9A 3AO0A 4DBDA 2J9XA 2V2HA 3S42A 1I2PA 3QW3A 2C18A 3NL2A 3ABQA 3SW6A 3L2IA 1GEQA 1TV5A 2QJGA 2QUUA 2CLHA 4HIBA 4MLJA 5AYXA 3HGRA 1XC4A 3PM6A 2C16A 4FNPA 1PHQA 4PH6A 1XL9A 1SSGA 2A1YA 3HB9A 2QCGA 3BG5A 3KX6A 1TSIA 1LLWA 3BGGA 4AHPA 3A5FA 1VHNA 3W1XA 2ZTJA 4Y90A 2ZCGA 3CHVA 3Q94A 3CM4A 4UTJA 5L9FA 3D0CA 5I3FA 4CCDA 1LBLA 2ZA1A 4UXDA 4DF2A 1QO2A 4LVDA 3WJSA 1DOSA 1XCFA 4NUWA 3KRZA 1OX6A 2YYUA 3QEZA 1QO5A 4UMBA 4O12A 4UTTA 3MW7A 3LRLA 2H90A 1HTIA 2E6FA 1GTHA 5F2IA 3WJWA 1YYAA 3SGZA 4GUFA 3RMJA 2X1TA 3CB8A 4EF9A 3G1SA 5LZLA 4FF7A 5K2ZA 2PURA 3HQ1A 1M7OA 1GG1A 4MZ1A 3U6WA 3JS3A 1PIIA 1EWDA 2P1FA 4FHAA 1JULA 1W8SA 3TFXA 4XKYB 4X9SA 3NQFA 4XKYA 1DORA 4E38A 1H7XA 3P80A 4UFJA 3OVPA 3PBUA 2ISSA 2WQPA 2ZBTA 2CU0A 4LWWA 5F1UA 3DFSA 3BVJA 1U5JA 3W2KA 3BK0A 4U4MA 1XI3A 4UFHA 5U4NA 1W3IA 1TPUA 1VCGA 1A5SA 4FX8A 4ONVA 2J9ZA 2EGZA 3DBPA 3DAQA 4MIMA 3BLFA 1LZOA 3QPZA 4X2RA 3FIGA 3NAVA 3W87A 3ABRA 4M5PA 3TU9A 3W22A 3NQDA 1DQWA 2JKPA 4ADTA 1OX4A 1IF2A 5LNRA 3M16A 3GXTA 4UR8A 2ATMA 3SGUA 4PFMA 3GDMA 3TH6A 5CPMA 2Z0IA 2CLIA 2A6NA 5J5RA 1VZWA 2QAFA 3L68A 3HG3A 1A5BA 2H6RA 4FNQA 4JX6A 5C54A 3C0JA 3UWWA 1JQVA 2E77A 1FBAA 4Z1AA 1K7FA 3ANYA 1PHWA 3H53A 1OABA 3A24A 5FEZA 3W7RA 2P10A 3QJAA 4O15A 2G97A 3VE9A 3C2VA 2WSRA 1KV8A 4BR1A 3HJZA 2Z1BA 1T96A 3UXDA 3UPWA 3MP5A 3SR7A 1VLWA 1IXNA 1WOBA 1KBIA 2GPTA 3PBVA 5DCDA 1QPQA 3SECA 3A21A 2E6DA 4QNWA 4UR7A 1ICPA 1XDMA 3LBCA 4KFNA 3LXAA 3IGXA 1AL7A 4ZZ9A 3DKJA 5HUOA 4GC4A 2QCMA 1TPVA 1W31A 3KFTA 3U8GA 4WXYA 1Z42A 3W7DA 3B0VC 4GFSA 4WZHA 3G1VA 4NQ1A 1SZNA 4EIVA 4RK8A 3HG4A 4JS3A 1Q6RA 1JUBA 4MZ8A 1Z44A 1D9EA 1FCUA 2Z6JA 3NGJA 1GQNA 3BGJA 5A5WA 3G0XA 1NSJA 4LC6A 1H7WA 1AK5A 2J24A 5CGQA 5D05A 3PSWA 4A29A 4JEQA 4RKAA 4JYEA 5G4EA 4RLIA 1J4EA 2CWNA 2Q3OA 1JCNA 1J5TA 3IIVA 1KM5A 2QCNA 3VFLA 3TJLA 2ZZ1A 3BLEA 3T4CA 3QPYA 1EPXA 1YXYA 1O5KA 4YMZA 3GAYA 5LHEA 2V5BA 3EXSA 4DPQA 4L4LA 1G67A 3DFOA 4GUIA 1KTNA 1Q3NA 1KFEA 4BWLA 4YCOA 2CLFA 4RZ5A 5H91A 5L6UA 1EP1A 2R14A 3W7JA 1B4EA 3EWYA 4YL2A 3LLDA 1H50A 1LM1A 4FNRA 2WV8A 5CZSA 5HJLA 4XUGA 2EHHA 2I1OA 5AC8A 3LCWA 4XTIA 1Z48A 5CZTA 4NJIA 1VYSX 2Y6ZA 3L9CA 3S5OA 2AQWA 5CKSA 3QMSA 5EBUA 1YTDA 3EX3A 1VCFA 5C6MA 2KZHA 2RDTA 5E1QA 5FEWA 4MY9A 2V82A 4JTJA 1LRTA 3E0IA 1VR6A 3HG2A 2GQAA 3UD6A 4Q33A 3SFKA 4W9TA 1W3NA 5AHEA 1G4TA 2EPHA 4JYDA 5EMUA 5FF7A 1OK4A 1QNVA 1VYRA 1M6JA 4IWWA 4FB7A 4AHQA 3S6DA 1BWLA 3TW6A 3FJLA 1Q6LA 1SSDA 2NXGA 3KVMA 3LV5A 3M5VA 4M19A 4O14A 4GWEA 1XUZA 3WK0A 3KAOA 3W75A 4QAIA 3G1YA 4CCCA 4A2RA 4FNSA 4RJEA 2QUTA 3HO8A 1SFLA 3W7KA 5HR6A 3NOEA 1I4NA 2NLIA 2WO5A 4M6PA 4TR9A 4POCA 1YDNA 3S1XA 3V1PA 3F4WA 1TPH1 4Z1CA 3KVJA 1GVRA 1ADOA 1RQHA 2NXIA 5D2XA 3MO7A 3M7WA 4C1LA 3N73A 1LLZA 3UY7A 3C4UA 5CPNA 4DPPA 2DU2A 5F4SA 1QOQA 4K39A 2DJLA 4CQ8A 3FKRA 3UWVA 3LBMA 5T26A 5KITA 2BWGA 3G3MA 1NEYA 1W56A 3QF0A 5D2WA 3P82A 1H51A 1D3GA 1JCMP 3DFPA 3N2XA 4O28A 4A21A 3HPSA 3W7QA 3W86A 4HT3A 1SW7A 5LKYA 1RV8A 2F84A 4LVFA 3OA3A 4MPQA 1YXCA 3OVQA 4K8HA 3NPWA 3VCRA 2RDWA 3BG9A 3C2RA 1YADA 4O1BA 3NL5A 3MHUA 4MVAA 5IBXA 3GYEA 3IRDA 1JCXA 4JNMA 1ME8A 1JQXA 1XFBA 2WNNA 4AB4A 3PULA 4UC5A 1EB3A 5D2YA 4UFIA 3SZ8A 3EXRA 3PUEA 3IIXA 5F2GA 4HNNA 3NZ1A 2NX3A 1VHCA 4QNEA 1CW2A 5AHFA 3GB6A 4UFMA 2H3BA 3RK8A 2R91A 5HUPA 2ZDRA 4DF0A 5DXXA 3GNDA 4RXFA 1A50A 4U28A 3S1UA 1ICQA 3B8DA 3TV8A 1I8JA 1P0NA 3Q58A 1QAPA 2CLKA 3C56A 4MJZA 5FESA 3O1NA 4LC8A 3MWAA 3T40A 4JTHA 3G1AA 5IM51 1J2WA 3W7GA 2V2DA 3BG3A 1GJPA 3RLVA 2J9YA 1S3HA 1VRDA 1ML1A 2Q8LA 3LLFA 3PUDA 1OG0A 1TV8A 3WK1A 3CU2A 4ZQOA 1N8FA 2NUYA 1MSSA 4O8RA 2Q8ZA 4G1KA 3O16A 1YPIA 4O57A 4UNLA 4JTSA 4WOZA 4BI5A 1DKWA 1NF0A 3NPUA 5FF0A 4LVBA 2VELA 5FI8A 3K30A 2BX7A 3TUUA 3GZ3A 4UTHA 4XBSA 5AHMA 4KFPA 4WUIA 1QMLA 5G2HA 5LSMA 5I3JA 1DJQA 1QOPA 3LDVA 4O18A 3TROA 3PAJA 3GXPA 3HGJA 2GJLA 3NQ8A 4ADSA 1SFJA 1HL2A 3EWXA 1X1OA 2QEZA 2FDSA 1P1XA 1OF8A 3TSBA 1H1ZA 3M0ZA 1S5VA 2F7FA 3RNDA 1OK6A 4MOZA 5KTLA 2A5HA 1E51A 1BWKA 3IIOA 2CZEA 3E02A 3DFQA 3STFA 3TR2A 3Q2DA 1OYBA 3GXNA 1KM1A 2RHGA 4Z08A 4GRSA 3E9AA 2Z2UA 2QAPA 3P5YA 3O07A 4PCFA 3W3OA 2VFHA 1TJRA 3M5YA 4JTUA 1DVJA 3N14A 3CWOX 3N9SA 2RDUA 4O53A 3NXFA 3GKFA 1PVNA 3W88A 3KHJA 1VCVA 1KFLA 2PRMA 2YDAA 3TAOA 3UXAA 3NQGA 3IV3A 4TIMA 4DF1A 2TPSA 2DZUA 1H5YA 4HNUA 4O17A 2QR6A 1QPOA 5DLCA 3TAKA 3CWNA 3LHVA 3WJXA 3ATYA 1DQXA 5CPLA 1XM3A 4MYAA 3QH2A 1THFD 1YLVA 2X1RA 3C2EA 1TPEA 3S5NA 5AFDA 3TXVA 4K7YA 1S5WA 4QITA 1OFRA 2J6XA 2H3DA 3PF3A 1Q45A 1QFEA 3P7YA 4LU0A 3B0UX 2V2CA 3PC0A 5HINA 3IVTA 3LB0A 5CPOA 4AWSA 2EKCA 3NPXA 4WJEA 5FF3A 1G4EA 5KZDA 2VEMA 3FFSA 2CW6A 3HGSA 2ZQ0A 4UFKA 1VS1A 1JUEA 2GVLA 1EX5A 2OJPA 1XDLA 1UBSA 1Q6OA 2Y85A 3MI3A 3OBKA 1A53A 3W70A 4IPIA 4JX4A 3W07A 4S2CA 1W3TA 3SI9A 5I3IA 2WOQA 4KWVA 2G5WA 2QDGA 5EL1A 1GTEA 4UTKA 2X2GA 3S8HA 4PC8A 1H62A 4FEZA 1WQ5A 5AHNA 5TBOA 3W1NA 1F76A 1I2QA 3I7SA 1R30A 2JKEA 2FFCA 4IMCA 1RPXA 3TC7A 1RD5A 2C1HA 4RR4A 4LNYA 4WX2A 3W73A 4AMAA 2GUUA 3FYPA 4AXKA 3A23A 4JX5A 1H60A 3THQA 5LHFA 4RCXA 4JIPA 1ME9A 3TK7A 3CLMA 4LTSA 1I2RA 4NJHA 2YXGA 4DXVA 3P67A 2NUWA 4ZQNA 2BSLA 1HUVA 3NQCA 4JTIA 3S9YA 1UASA 3DXIA 1G7UA 1S5TA 2YFOA 1R2SA 3W84A 5DBUA 3M43A 4UTLA 5AC6A 4ZQPA 3LERA 4E0CA 1NAL1 4Z0JA 2ZRWA 5HWJA 3W7MA 8TIMA 2X30A 1TPC1 5LGXA 1O5XA 5F1VA 1IIGA 1FUYA 3W7NA 1JR1A 5AOUA 1F73A 4JTTA 1LP6A 3CT7A 3M47A 3RF9A 3UZJA 4MLRA 2G96A 4MFDA 4WQ6A 1LTDA 1ZAIA 2HS6A 3LCLA 3R13A 4S1FA 3NPVA 4HPJA 3OVRA 4JD4A 3R5EA 1TTJA 2CZDA 1UUMA 2A2IA 3I7RA 5I3KA 4CQAA 3B0PA 2JBMA 3IVSA 3C3NA 5K9XA 2ZFAA 2X16A 2VFGA 3CQ0A 4LVAA 1QDSA 2CLMA 2QDHA 3TSMA 5HULA 2QCLA 4JN6A 5K9DA 4DO4A 1LBFA 4JICA 2CZ5A 5EY5A 1X1ZA 4QIUA 1G69A 3A22A 3GAKA 2NZLA 5HWMA 4N9CA 4PA8A 1IXOA 3LI0A 3MYOA 3LRMA 4MKNA 4ALDA 1K7XA 4ZQCA 2Y88A 1TJPA 4XZ9A 1H7NA 2TSYA 5FF2A 1IXQA 3MP3A 1RQBA 3M5XA 1BEUA 4GUGA 1ZALA 3W9ZA 1BKSA 3QMRA 1AL8A 3G1FA 3O06A 1QCWA 3EWBX 1GG0A 4LVGA 1TPWA 1BTMA 2V0TA 3EX1A 1R2TA 1ZFJA 1TTPA 1SW0A 3UWZA 4HN4A 2PRLA 1GOXA 4JDYA 1B4KA 3UY8A 1IXPA 3MI2A 4GUJA 3R8RA 3QFEA 2A0NA 1M7PA 3M1ZA 3T7VA 1N7KA 2BLEA 5G5IA 3W85A 1L6YA 2WNQA 3C2OA 2A21A 3LX9A 3UNDA 5DY3A 2E09A 5DXYA 3LV6A 3W83A 1PCWA 1ZCOA 3P60A 4LY8A 3NL3A 1B9BA 3L5LA 1XBVA 3WK3A 1OVDA 1FXPA 1OYCA 2DORA 4J9JA 4N9EA 4Y8FA 2C14A 3HMJG 1W5MA 2V8ZA 3BW4A 1HG3A 4UTMA 5G2WA 1QPRA 1WOAA 3O15A 1OFBA 4LRSA 4ML9A 2OX1A 5KZMA 2HS8A 4UTWA 1OFDA 5D2TA 3HOJA 4GNJA 2WPBA 2AGKA 1KLZA 2FB2A 4GUHA 4C1KA 3B04A 4LT9A 3IIZA 4WY0B 2WSQA 4N9DA 3WJZA 3G0SA 1VC4A 1OFOA 4BI6A 3STCA 3G1DA 4JYFA 2O7SA 3W76A 3P8JA 2WSYA 4NZJA 2CLLA 2GVJA 2YGYA 1W5PA 3W71A 3QZEA 1KFCA 3N3MA 3NM1A 2FTPA 5C2XA 3DU0A 1FDYA 2XFWA 2ZZ5A 2YFNA 3NM3A 2DZTA 3TQKA 3QM3A 3P8IA 4N4PA 2GOUA 3GR8A 5E93A 1OFPA 3MHFA 3T44A 2ALDA 1I45A 1OFQA 5LNWA 1OFEA 1LBMA 4JR5A 3AJXA 4UTWC 1FXQA 1ZY9A 3W23A 3EEGA 4N02A 4RX0A 1KM2A 3THAA 3UWUA 2YPIA 2J88A 3MBDA 4ADUA 3TQVA 2O7QA 5F4WA 1TIMA 2DJXA 2HTMA 2ZRZA 4Y6GA 5HMSA 1WX0A 3NQEA 3I68A 1RQEA 1EP2A 2VFIA 4IOTA 4EWND 4N4QA 3C6CA 1W0MA 2C6QA 1UB3A 3TX9A 1GVQA 1KA9F 3W1LA 1DBTA 3SY5A 4CCEA 5FEXA 2OCZA 4RZ6A 1F5ZA 3L0GA 5K7JA 1Z41A 3GDRA 2QCDB 2VFFA 3OG3A 2G95A 4H3DA 5LNSA 3EXTA 3Q37A 3G1XA 4AWUA 4FXRA 4UFLA 1TRDA 1VQTA 4FO4A 1AW1A 4O4VA 1PE1A 4JTKA 1HO4A 1MZHA 1OFAA 3NNTA 1O4UA 5KSWA 3VE7A 4QISA 1FCBA 3N2MA 2QUVA 1VJIA 4AF0B 4WD0A 2ZA2A 2A4AA 2EAWA 2Y70A 2E5DA 1MO0A 3EX4A 4E2DA 1G6CA 3LCHA 3W1TA 2OZ0A 4MUZA 1CX9A 1I2NA 3C52A 6TIMA 3CC1A 1K02A 4O1AA 2FQIA 3GDTA 3HPXA 3RFAA 3TW7A 4HKPA 5BRBA 4GJ1A 3QSTA 3GK0A 4HNVA 3MBFA 3PY2A 2E68A 3LOTA 1R47A 2ZYFA 2ZZ6A 2YZRA 5HNRA 3GX9A 4N6FA 3NVTA 3KXQA 4AH7A 3LI1A 4OV9A 3MI6A 4OT7A 3P81A 6ALDA 2VEPA 4NU7A 1F74A 3W2UA 3NA8A 4NJGA 1W5OA 4LRTA 4HHPA 3EKLA 1T8XA 2J27A 3TDFA 4O11A 1TQJA 3S5ZA 3GKAA 4K36A 3R89A 3QRHA 1KV5A 1LRQA 3M5ZA 1VPXA 3B06A 1O95A 4KWWA 2WJZA 2E1DA 4GBUA 5AYZA 1TPFA 3FLUA 2V30A 2ATSA 1KFBA 2XN0A 4DQWA 3LCGA 4I9AA 1X6UA 3QSRA 4N2YA 1XBXA 4O10A 5LGZA 4MY8A 1OJXA 2YYTA 1LROA 1SW3A 4NNCA 3OEXA 3UYCA 4M6VA 5LNVA 3IIPA 1SPQA 2ZZ4A 1C8VA 5AC7A 3GNNA 3IGSA 2V81A 2ISWA 3IEBA 1GYNA 3TA6A 3STEA 1WYIA 2C13A 2C3ZA 2NUXA 1A5AA 1HO1A 3WK2A 3V75A 4P2VA 3LCXA 4GXMA 4UIOA 4JTLA 1SO5A 3F03K 3LXBA 3M44A 2TRSA 1GYLA 5K9CA 2A7RA 1KFJA 4NX0A 3UQNA 3B03A 4FXSA 1OYAA 2I9EA 2Y62A 4MFEA 1P4CA 2TYSA 4PEKA 1JCJA 1LCOA 3DFTA 5TQLA 2E5BA 3H55A 2ABAA 3MJYA 3HPZA 1KM6A 3BO9A 3W1RA 2C19A 2Z6IA 4Y96A 4P61A 3DH7A 3LHYA 2QCHA 1JRCA 3GIYA 3INPA 3TE9A 4UTUA 4A3UA 4TU1A 3P5ZA 4M7SA 1YPFA 4E2BA 2X1SA 2C0AA 1IGSA 4LV4A 2ZA3A 2QJIA 2V5LA 4KKXA 1JCYA 1H7OA 2YX0A 2RH9A 3BARA 5CSSA 4UCGA 4D2JA 3S0CA 3E49A 2FPYA 5G1YA 4IUOA 2X1UA 2VEIA 4NJKA 4NT0A 1P0KA 1GWJA 3PUOA 2QCEA 4PODA 4FNUA 3MYPA 3O6CA 3W7LA 1DV7A 5BW6A 2A7PA 2ZRVA 3B05A 2YW4A 1T0OA 2QCFA 3NQ7A 4UTIA 1SO3A 4Z0SA 4O1DA 1GPWA 1ZENA 5KZEA 3DHDA 3DFNA 3C61A 3M6YA 4R33A 5AB3A 2GQ9A 3R2GA 1ZAJA 3L0KA 1SO4A 3CPRA 1AMKA 3P74A 3R12A 5DCEA 5AYYA 3MHGA 5D04C 4JTGA 2PRHA 3KVLA 3EWWA 3VKJA 1K03A 2ISVA 1TREA 1L6SA 3FKKA 5CZ0A 4PL2A 2PC4A 7TIMA 3GLCA 3OHIA 5BOOA 3BPWA 1PL9A 3DZ1A 1MEHA 2DZXA 3N19B 4QSHA 1W37A 1QWGA 2VXNA 4L4MA 3W7EA 1UJPA 4N6EA 4UMAA 1SU5A 1ZHAA 1KW1A 3TJXA 3UZ5A 2A6LA 3G24A 4TMBA 4OU1A 4NJJA 1FWWA 5G4WA 3O6DA 4I7WA 1GVSA 4WY0F 2HSAA 4IMDA 2Y89A 1ONRA 3PBYA 4WOQA 1TCDA 3ZFHA 1FWRA 5U7SA 1VH7A 4O19A 1R46A 1EA0A 4FX7A 3DHFA 2VENA 2YSWA 3W2LA 4K38A 4YLWA 3CIWA 2NV1A 5FF4A 2NWSA 3W2JA 3ZR4A 3L67A 4OQVA 1IIHA 3NYZA 2CLEA 4IX0A 1QR7A 2CLOA 5I3GA 5HR7A 2DZVA 5EA9A 5DELA 2E6AA 3QQ0A 4AVFA 3STGA 4LOCA 3O8AA 2NX1A 4LW7A 4Y9AA 1GVFA 1GZGA 2NX9A 4QJ1A 3I7QA 1MEIA 2BXVA 3EB2A 3H54A 3KOFA 4EOUA 4O16A 4YWIA 1Q6QA 4Z1DA 3N9RA 3L5MA 3P62A 3BW2A 4H4IA 4H6KA 5HQEA 4CLMA 1FCVA 2P0OA 1QPNA 1ME7A 3ZS4A 2IQTA 3T55A 1DHPA 1X7FA 4MYXA 3CIXA 1XBYA 5D09A 2ZTKA 2NXHA 4K7VA 3HGOA 4WXZA 2QF7A 1JCLA 2E5CA 4XQ6A 1F2JA 2UV8G 1RZMA 4JY8A 1C29A 4ZQRA 4Q32A 3VNDA 3SJ3A 1F05A 4UNKA 3O63A 2FLIA 4OHQA 1PCKA 4TX9A 5KINA 3OIXA 1W5QA 2B7PA 1RR2A 1T99A 4IQLA 5MHBA 1EP3A 1EWEA 3W6YA 3NZRA 5D2VA 2HMCA 3FYOA 1D3HA 3G8EA 4IJBA 4NX5A 4PTNA 3HG5A 4M7TA 1SQ7A 1PV8A 3W7OA 2FIQA 2WNZA 4HSNA 4NXSA 3W1QA 3S1VA
chains in the Genus database with same CATH superfamily
1ELSA 3IRSA 4B4FA 4DELA 2YXOA 1F3XA 3VGBA 1O68A 1NP2A 5AHLA 4C90A 3KL5A 4BZYA 1DJXA 5GJMA 3KRBA 4A2SA 1V02E 4NASA 4IM4A 1JPDX 1F8MA 1Z69A 5FA5A 3N18A 1E6ZA 5CBBA 4F2TA 4A3RA 1VBUA 1A5LC 3ARXA 2DY3A 2ZUSA 1V08A 3BLPX 3DI1A 3LGGA 1UZ4A 4ZL1A 1PX3A 1RA5A 1X7IA 4S3CA 3AXKA 4LAOA 3WMCA 5JH1A 3USZA 2DZPA 5I77A 4DZHA 3CS2A 1FRBA 3BJTA 1VBRA 4DVOA 2QJHA 1FDJA 2ZE3A 1QASA 4GK8A 1SZEA 2GSHA 4CVWA 5FEPA 3GG7A 3GE7A 3IJ7A 1LYXA 3G5EA 4YU1A 2Z4GA 1YXDA 3UT0A 3BURA 4C60A 3DENA 1JI2A 1NOUA 1OCBA 4D1JA 3M0YA 3TJIA 2DP3A 3WLRA 2FMNA 3W1AA 3PZVA 4D8ZA 4XWUA 1FHUA 4HPHA 2WCGA 3VDGA 1P48A 1TJ0A 3LNMA 3TMQA 1TPDA 4J2MA 1POJA 1R2RA 1DP0A 4IXHA 4RE3A 3GNRA 1PXGA 3OYZA 2OB3A 1I0DA 1BVWA 5EPDA 2B7OA 3IGHX 1EEPA 1UD2A 4TX8A 2GK1B 1CCWB 3U7VA 3L4XA 3WLSA 4H04A 3GQYA 4IX2A 3BTNA 5BMXA 1XXXA 4ORMA 3ABSA 5E0KA 4ICNA 3E6EA 5SWUA 3UWQA 4U31A 1C90A 4X9YA 1UMYA 1EL3A 4IG2B 2F6KA 3ABZA 2GK1A 3ITLA 3OB8A 1UG6A 1SO6A 2R94A 3WYZA 5D30A 2DZWA 4MY1A 2ACUA 3CUZA 1R0MA 4X22A 3PZOA 4MWAC 1L9WA 1ZGDA 3HF3A 2FMOA 4R53A 5CG7A 3TTEA 3EGJA 3NQ6A 3AHXA 3MB9A 3A6OA 3N4EA 2QV4A 4PB3A 3ID7A 3CIVA 3N2BA 2D20A 1ICSA 2WHMA 5AVNA 2PDCA 4TVCA 1F7BA 4OV4A 4HP5A 5F4XA 1XUUA 6A3HA 1EKOA 3DG3A 2RFGA 3L21A 3BLIA 3O7UA 4ZE5A 1AJZA 1X8FA 1K4GA 4LUIA 4IHCA 1CTNA 2VCAA 3ITVA 2B0MA 4GZEA 1HKKA 2YW3A 3P0XA 2UY3A 4CQCA 3CZEA 1MYRA 3GHTA 3FA5A 2DVUA 2C79A 1O1HA 4W87A 1KB3A 3S1WA 3RYSA 3G0UA 1XG4A 1O60A 2D0GA 2JGQA 2QCCA 1JRBA 3VDCA 5A6KA 1AUSL 1F9CA 3NO5A 2ZUWA 2NV2A 1YE4A 3DKLA 1BVNP 3H2AA 2ABBA 4Z17A 1TWZA 1JNEA 1XYCA 1SR0A 1I75A 3VKAA 3N15A 3PR2A 4AD3A 2PWVA 1J2BA 4IXXA 3MP4A 1EZ2A 3HPFA 1ZNNA 2W5FA 2PTWA 2J79A 4YTTA 3GM8A 5AHIA 3PVFA 4HMCA 1H61A 2GVGA 1S2TA 4QDMA 3WF3A 1E6PA 3H22A 3LG3A 1WBJA 2PCQA 3QW4B 4CU6A 1WDQA 4GX9A 1KCLA 4EACA 1OEPA 4GINA 3WIJA 2DW6A 3LCIA 4PGLA 5IBXC 4DBEA 3WNKA 1B90A 1AW5A 1EJSC 4AWTA 2V67A 2VD8A 1K1DA 3TQ0A 3I3DA 4OBTA 5BXRA 3VAVA 2RGMA 3WBAA 4IICA 3LPGA 4JIQA 1K4HA 1JUKA 3G3DA 1XPGA 2CETA 1UOZA 3K1GA 1E1EA 4HHLA 4JBRA 3BAKA 2Y5EA 1DEDA 4F2BA 2E25A 5C9RA 1WV2A 3KBJA 2D22A 3KL0A 3VABA 2YL9A 5EMYA 3AUJA 4S2BA 4QQ3A 3WQCA 3SO7A 1TV2A 3IJQA 1VJZA 2NQZA 3NVDA 4ATLA 4PUJA 4KFOA 3N4FA 4DHGA 3ARYA 1CGWA 3EWZA 4PBEA 4GI9A 5XIAA 4XUYA 3WF0A 4NVTA 4CNOA 4IMGA 4QBXA 4BS0A 1R3YA 1FWTA 2F2KA 4FX6M 4B4HA 5BXPA 1RK5A 3LEPA 1RY0A 4D6CA 2H8ZA 2I7GA 1UUOA 4Z1BA 3W26A 4M8UA 1TFVA 3U2OA 3TOPA 1FX6A 4UTTC 3QYQA 3CEPA 4UMCA 3GU1A 3GC5A 5DY2A 1SZFA 3LHTA 2VMFA 2BFGA 4Q4QA 1CGTA 3QYSA 3W4RA 4HNCA 1AD4A 4MHBA 1HJXA 2ZRXA 3ZVIA 1TV3A 2B4GA 3ENLA 2OEKA 3H2OA 4GQRA 3CUXA 2VZOA 2E9BA 2VUYA 3RU8X 5F2MA 4O54A 1XLCA 3NG3A 3V0TA 1V0KA 3FEMA 5A8GA 5HJYA 2F6UA 3TMLA 4I7VA 4QG6A 5HPCA 3LHUA 3RO6A 3W7PA 3G8RA 2R9RA 4J3WA 3G22A 2ZUVA 1KXVA 5DBTA 2ZE0A 2JK2A 2VWSA 3M0MA 1B3YA 4IIEA 5GJNA 1SJCA 4TXEA 3WCZA 4CNPA 3CL6A 4L56A 4H01A 2B7QA 2DGAA 3H2NA 3FJ6A 5DF0A 3NDZA 1KM4A 3BUVA 4W88A 5HANA 4IF2A 5HPOA 2J9XA 1I2PA 2ZC1A 2C18A 3WLHA 3ONCA 2WPGA 3IK4A 2WZHA 3F5LA 4JIHA 1TV5A 1PZ2A 2J78A 3ES8A 4NZ5A 1ONXA 2QUUA 1NOWA 2CLHA 4HA1A 4MLJA 5AYXA 3HGRA 1XC4A 3AMGA 3LU2A 3PM6A 3GU9A 6REQB 3Q67A 4FNPA 2OGYA 4PMYA 1SSGA 2CWXA 4P8UA 3KX6A 1TWSA 3BGGA 4P7RA 4AHPA 1JIBA 3W1XA 2P3EA 2IQ0A 1PEZA 1XYAA 3UGRA 1AZ2A 5I3FA 2V3EA 3GG1A 4UXDA 1M7JA 4LVDA 3WJSA 4NUWA 3QEZA 4O12A 1VBGA 2VC9A 1Q7QA 4A8NA 3F4DA 1BAGA 3NFUA 3QGVA 3URAA 1SJDA 4C6EA 2P50A 7PTDA 4LANA 3S5SA 2X1TA 2Y5SA 1M7OA 3SN4A 1TUXA 1W8SA 3TYUA 5MKGB 2WC4A 1JGMA 1Q66A 1ZRQA 2BVTA 3UG8A 3SFWA 4IIDA 5A3HA 2YCJA 2CU0A 4LWWA 1U5JA 4U4MA 3MMUA 5AKQA 5BOEA 4FX8A 3TLQA 3O6AA 1R8LA 3LGDA 1OC6A 2J9ZA 1RHCA 4MIMA 3BLFA 4HMDA 4PUWA 5GQBA 4M5PA 3W22A 3NQDA 1DQWA 1OX4A 4GQBA 3OZMA 4Y8EA 2BGQA 6XIMA 4JCLA 2V5DA 3V16A 5J5RA 3EYPA 1KCZA 1UJQA 2D2HA 3C0JA 1JQVA 1XLMA 2FTYA 2INFA 1PHWA 2NW0A 1QW7A 1V0MA 2WJFA 4Q6XA 3VE9A 2J75A 1B5TA 1U5VA 1HKMA 3WEOA 1T96A 2P88A 4Y9PA 3UPWA 4DO7A 5DT7A 4IZGA 3WLNA 2Y4SA 3O3RA 2FHFA 5DCDA 3WQOA 3FVDA 3SECA 1HVXA 3A21A 3GNPA 3S2LA 2OODA 2OOGA 3WDRA 1RH9A 3FGCA 4HA0A 7ENLA 4KFNA 4B90A 4GC4A 4UZSA 3SCNA 4KWUA 3KFTA 4WXYA 3CH0A 1BG9A 4GFSA 3QOKA 1YW1A 3G1VA 3CZGA 4NQ1A 4DAFA 3PP7A 4JS3A 1JUBA 3NDYA 3OGRA 3VMNA 1GQNA 1JG9A 2XH2A 3G0XA 4ZOEA 3SN1A 4S3BA 3PSWA 4JEQA 4JYEA 1TJ2A 2X0HA 1KM5A 2W92A 4I8YA 1M04A 3VFLA 1E9YB 3PWIA 4ZO9A 3QPEA 3SAZA 1EPXA 1O5KA 5E0FA 3MSDA 4YMZA 3GAYA 5LHEA 3S2CA 5DMLA 3TZFA 4LALA 1G67A 2ANUA 4GUIA 5E9XA 1KFEA 4BWLA 4YCOA 4RZ5A 5H91A 5L6UA 3VX1A 1ENUA 1EP1A 3KBWA 2YL6A 3A3HA 2YB4A 2WMFA 5CZSA 5HJLA 3PBGA 3I3EA 1YNQA 3LCWA 1Z48A 2VCBA 3SADA 4FXFA 4G6CA 4W85A 1LF1A 2HE8A 4LUTA 3QQWA 4F9JA 5EFFA 3WQWA 2PLJA 1LRTA 3E0IA 1O12A 2CBUA 3B8TA 3EBVA 2GQAA 4MNKA 3SFKA 4W9TA 4NKCA 1W3NA 5BU9A 5AHEA 4JYDA 2V5CA 5FF7A 1LL4A 1QNVA 2OXNA 1VYRA 4QJ5B 4IWWA 1X6LA 2X1IA 3TW6A 3KVMA 4M19A 4O14A 1XUZA 3WK0A 5IHSA 3DGBA 4CCCA 4A2RA 5JIWA 3HO8A 2OGJA 3IUDA 3F4WA 3KE0A 1TPH1 4Z1CA 1RQHA 2NXIA 5D2XA 3MO7A 3M7WA 4ZO6A 4YTRA 4C1LA 8CGTA 5CPNA 3OVGA 3I6TA 4YVPA 4CQ8A 1NEYA 5D2WA 4MWAB 3P82A 1D3GA 4O28A 2E1WA 4A21A 1SW7A 4AD1A 1TA3B 1YXCA 4K8HA 3VCRA 4M56A 1H2JA 3VDBA 1CXIA 1JYXA 3B40A 4GKLA 1CB2A 2XU2A 1XFBA 4UC5A 4UFIA 3TVAA 3V36A 1VFSA 4ATWA 1W9BM 2PDNA 1CLXA 1CW2A 1US0A 5AHFA 1ITUA 2H3BA 3RK8A 1ADSA 4HOZA 1J10A 4DF0A 4PULA 2WVTA 4U28A 2F2HA 3OBAA 3AZRA 3AJ7A 3EOUA 1QAPA 2CLKA 2C7FA 3T40A 3A47A 1YPXA 4C6FA 3GTIA 1GKQA 3RLVA 1H3GA 5IHRA 1E5NA 3LLFA 3PUDA 4G7EB 2F9RA 2ZKMX 3BZJA 3CU2A 1N8FA 1RP8A 4BQ3A 4O57A 4C6DA 4BI5A 2JALA 1WNOA 4F40A 1VFUA 2HVNA 2OTDA 1LL6A 3TUUA 3VDAA 4XBSA 1VFTA 2O92A 2UY4A 1UWSA 4AW7A 3LDVA 1Q63A 4ADSA 5LYRA 1S5MA 3CH9A 3C3UA 2FDSA 2O0TA 1R3SA 3VD9A 1L8NA 1OF8A 3M0ZA 4RE0A 1UA7A 1FWCC 4DZIA 1REQB 5E0CA 3U2CA 4F3HA 2X2YA 1GQJA 1HJQA 2QUMA 3LBOA 1U1HA 2CZEA 1RLDA 3Q2DA 1YHTA 2Q09A 1UKQA 4YN5A 2VZVA 1UR8A 3A3WA 4GRSA 3RJXA 3KDNA 3P5YA 1QTWA 2VFHA 3HV8A 2ZC8A 3N14A 2VEGA 3GC2A 2GJPA 2Y8VA 2X09A 5A6LA 3W88A 1KFLA 4ZFMA 2Z1KA 3UXAA 4TIMA 1EH9A 2OZ3A 2TPSA 4OIFA 1UH2A 2ISFA 2ICSA 3D6NA 5DLCA 3TAKA 3CWNA 1IGWA 1DQXA 4GOAA 3CJPA 2DH2A 1IZKA 4GYFA 3C2EA 1TPEA 5AFDA 2QHAA 2FZBA 5EMLA 4QITA 3AS3A 5J04A 1EJWC 2J6VA 2ZDSA 2E28A 2OFJA 4K2SA 4KRUA 4HVXA 4R3UA 4GG9A 2V2CA 5A94A 5HINA 1FWDC 3TLLA 4AWSA 5A6BA 3WBWA 1B1YA 3NPXA 3NOYA 1G4EA 5KEZA 4F0SA 4OZOA 2ZQ0A 4JL2A 3AZSA 4XZIA 1JZ4A 4RE2A 3BAIA 4ZB5A 2E9MA 2OJPA 1EBGA 2I16A 2QPUA 2BOGX 4IPIA 3SBFA 4KWVA 5EL1A 1GTEA 4OBSA 2X2GA 1UROA 4S3EA 4INFA 3W1NA 1EJRC 1M41A 3WLQA 2JKEA 2FFCA 4GPNA 4IMCA 2GWNA 1Q7MA 4BHYA 1ZBVA 2PSNA 4RR4A 1UIOA 4C91A 4LNYA 4WX2A 1FH8A 3FYPA 3MSRA 4AXKA 1PYMA 1H60A 3THQA 3UVIA 4OOUA 4LTSA 3VZYA 3RDKA 4C1NA 5FJTA 2C8NA 3N2CA 4AZCA 4AZGA 3WD0A 4U3AA 3S9YA 4Z1YA 1W1PA 3AIWA 3HQPA 3IACA 4FR6A 3SY1A 1NAL1 3WFZA 2ZRWA 4HYVA 4XAYA 3VM5A 1TPC1 2CITA 2R6OA 1O5XA 5F1VA 1QPKA 1FUYA 1KR1A 4IJCA 4CUCA 3CT7A 3M47A 2VR4A 4H7CA 3ZJKA 1ZAIA 4S23A 2WZTA 4HK5A 1W9VA 3NPVA 4QHRA 3PWGA 1TV4A 4ICCX 4Z42C 1UUMA 2A79A 4J3UA 5G1MA 5I3KA 4CQAA 4KETA 4U5KA 5LA0A 2QVNA 5K9XA 1UZDA 2ZFAA 2E8ZA 2VFGA 2QDHA 3TSMA 1WDDA 2B81A 3DX5A 3TA9A 1EQPA 4AU0A 4IFKB 5K9DA 4JN6A 1V6YA 3LQLA 4DO4A 3ES7A 1NQ6A 1UWTA 1W2PA 3A22A 3GAKA 3CXOA 1XLEA 4W4QA 3RCMA 4PA8A 1IXOA 3AYVA 3GHUA 4ZSUA 3VU2A 1TJPA 1MUCA 3EA3A 2TSYA 2X7VA 5FF2A 1A3HA 1RQBA 5FKYA 3M5XA 1BEUA 1ZALA 4GUGA 3W9ZA 5ABFB 3QMRA 2JEPA 1QI5A 3KOZA 4XO7A 3AIBA 3O06A 2VHLA 1GG0A 3EX1A 3NCOA 1N2VA 1R2TA 4F0LA 1ZFJA 1TTPA 3EOSA 4HN4A 4XISA 1R6WA 1GOXA 4JDYA 2WVVB 3ARZA 4IFRA 1KCXA 3EB3A 3VIGA 4LQ1A 4GQQA 2A0NA 4H6QA 1QATA 2ZXAA 3K4DA 3VPLA 3KS6A 4CD4A 1WKDA 3UNDA 1G9HA 4LBUA 1Z8AA 2ZX7A 4L5ZA 4YHEA 1X38A 4DJDA 5GNZA 1XBVA 3E2RA 3A4WA 2DORA 2BXYA 3A4AA 3FVMA 1HG3A 2JF6A 3DFHA 5G2WA 1GKRA 1WOAA 1FHLA 3T05A 3AROA 5KZMA 4UTWA 3HOJA 4R7WA 1KLZA 4C1KA 4U2YA 3WJZA 3G0SA 1AQHA 1XKJA 1GQIA 3QV6A 1MFVA 1OFOA 3STCA 3CZJA 4JL1A 4HOXA 3P8JA 4NZJA 2YGYA 1QI3A 2GVJA 1W6TA 1BHGA 1W5PA 4K8GA 1KFCA 3UF9A 2ZWYA 1XRSA 1PDYA 2ZZ5A 9CGTA 1ZBCA 1UKSA 2BY1A 3PJTA 1NDYA 1F07A 3TQKA 4C6JA 3S1GA 4DUVA 1O66A 2C91A 3GR8A 1OFPA 1XX1A 2ALDA 3QBUA 3V5OA 2XIIA 1OFEA 5LNWA 5JUVA 1UR1A 3ARTA 1NTHA 5BXSA 3LM3A 4DLFA 4FLQA 3M07A 4RX0A 1KM2A 4X61A 4QE4A 3UWUA 4UZUA 5C9XA 3MBDA 3B9AA 1XH1A 5F4WA 2DJXA 4S3JA 1EP2A 4JIRA 4GHRA 4EWND 2ZICA 2DPEA 1W0MA 2C6QA 1UB3A 3TX9A 5CG0A 4FALA 2VD9A 2G37A 3W1LA 1A5UA 1T8QA 5K7JA 4WJXA 4D72A 4DYJA 4S3AA 4C1NB 2OZ8A 5LNSA 3G1XA 4FXRA 2OYMA 5LIUX 4NSBA 3MUY1 1XYFA 2Z27A 2PDJA 2WLZA 1DYSA 1B3VA 1SMDA 3H21A 2QV5A 4JTKA 2IS7A 2MANA 4N42A 4RNFA 5C9UA 2HPMA 3EPOA 1XD0A 3CHEA 4QISA 3TTYA 1LQ2A 3OHMB 1YNPA 3N2MA 2FYMA 1VP5A 4WD0A 2ZA2A 4GY1A 2A4AA 3EDEA 4WDTA 2Y70A 1TJ1A 1ITXA 1E1FA 4H41A 3LCHA 2G8ZA 3R10A 4GIRA 2VP8A 4FF5A 4XSMA 6TIMA 1UC5A 3GSMA 3U48A 3E3HA 4AYGA 1K02A 4O1AA 9XIAA 1QXLA 3MDWA 3HPXA 4HKPA 5LIWX 4CNSA 5BU6A 3QV9A 4QP0A 4HNVA 4JKLA 2F8QA 1IWPA 2ZYFA 2ZZ6A 1QI0A 2YZRA 5HNRA 5CSUA 1NWTA 2PWFA 5HXMA 2VVNA 3AYTA 3MI6A 1EBHA 3BV7A 3P81A 4HZ7A 3CYJA 3N04A 4Q8PA 3TW9A 3NA8A 3WO8A 3EKLA 5HNTA 1KV5A 3B06A 4KWWA 4ZTXA 2WJZA 4GBUA 5I24A 1QNOA 4QLKA 4AEEA 1S3TC 1KFBA 1GONA 3EOLA 4DQWA 2INZA 1X6UA 3R4IA 2WMHA 1SW3A 3OEXA 1EHAA 4ZENA 4E6MA 4D6GA 1RSCA 1EJXC 3ARPA 3ARQA 3UYCA 3IIPA 4RW5A 1C8VA 3H7VA 1PAMA 4MAVA 2ISWA 3O2LA 3TA6A 3STEA 3WD2A 2C13A 4IJRA 2NUXA 1Q4WA 1EYWA 1HO1A 2YOCA 3LCXA 4JTLA 3F03K 1GYLA 2I5QA 2A7RA 4NX0A 3F5JA 3GR4A 1EF2A 1OYAA 2Y62A 2R82A 4MFEA 4UQBA 3N2TA 1V79A 2E5BA 4GVIA 3MJYA 3ZJ6A 4GXWA 1KM6A 2XIBA 3VKBA 2C19A 2Z6IA 4AYSA 3DH7A 3LHYA 4XIAA 3INPA 3VNJA 4A3UA 2PTYA 3MV11 3CASA 3GRIA 3LYEA 4TU1A 1HT6A 4ERIA 3A4JA 4M7SA 4E2BA 1VB9A 2ZA3A 4Q4PA 1J0KA 3WQ5A 1U22A 3EMCA 2OO6A 2YX0A 1K9DA 3P3BA 2IKHA 3E49A 5G1YA 2EPKX 4P7NA 5A95A 2Q8XA 4HOWA 1QI2A 4ZOAA 2G3IA 1P0KA 3U7BA 2F6XA 4PODA 1ZJBA 3L4VA 4FNUA 1CT5A 1PKLA 4JNYA 1JFHA 2YW4A 3NQ7A 2XSBA 3TWAA 2XUCA 2YZ5A 1Z9AA 4H7ZA 4UTIA 2JE8A 4O1DA 3OODA 4TTUA 4NP7A 4DYKA 5KZEA 3UCDA 1VEOA 3DHDA 4LCSA 4JZ5A 4A05A 4MNLA 1UD8A 3G6MA 5AB3A 4OUIA 1YDYA 3LPFA 3L0KA 1OINA 3R12A 5DCEA 3MHGA 2PRHA 2J7GA 3VKJA 4DWDA 2Z29A 4KPLA 3FKKA 3IJ8A 4W86A 1UKOA 1RCXB 4QJ3B 1JDAA 2PA6A 3GLCA 3BPWA 1J9YA 1WZKA 2DZXA 4U10A 3WMBA 2JQXA 1K9TA 2VXNA 4DI8A 3R79A 3IS4A 5A6BD 1HKIA 4UMAA 1ZHAA 1E0VA 1KW1A 2WB5A 3CUIA 5TD4A 4NJJA 3O6DA 4R9XA 1P7TB 1XIFA 1GVIA 4WOQA 5CPSA 3K1DA 2RGLA 4KWOA 2YSWA 3W2LA 4YLWA 2J77A 2GUBA 4PUMA 1XPYA 3ZR4A 3L67A 4OQVA 1IIHA 3T1GA 4M1RA 5FJUA 4R9OA 5I3GA 4GYPC 3HZ3A 5DELA 3FJ4A 1G1YA 1ZS2A 4LOCA 1GVFA 2PF0A 1KBKA 2VRKA 1GZGA 2W63A 3SGGA 1VKFA 3H54A 1PSCA 3VMOA 4DB7A 4Z1DA 2CHNA 3L2LA 2P0OA 5C2CA 1JI1A 4D71A 3AZTA 2IQTA 1UQZA 3P14A 5CQ1A 2ZTKA 3DYOA 4F0MA 3SURA 3U5YA 1CPUA 3WL0A 4GYJA 3QV7A 1E4NA 1XR2A 1C29A 4ZQRA 2Q6ZA 2NVDA 1F3WA 2IPFA 2P8CA 4UNKA 1PCKA 1NELA 4AIEA 1RY8A 1FP9A 4IQLA 1FWBC 1AQMA 1EYEA 1XLIA 2HMCA 3MC5A 4NX5A 1QK0A 1UD4A 5D9PA 1LQAA 3EOOA 4Z2IA 1SQ7A 2X42A 3UEQA 2FIQA 2VDHA 4NZCA 2YL8A 4AX6A 4PMQA 3S1VA 2R8WA 3DFYA 3QHMA 5D9MA 1ZPTA 2R1LA 1V5XA 3G1HA 1PKNA 4JGDA 2ACRA 4D6FA 1DE5A 1LG1A 4I9MA 2VOTA 4XZLX 3M41A 1LRNA 2WSKA 3VIHA 3EDJA 1P5BA 2Q02A 4EK7A 3ZLHA 2TMDA 2NQHA 3ABOA 1LT8A 1NIUA 4HNTA 4W5ZA 3W25A 2A7NA 4IPPA 3UNTA 2D73A 3NQMA 1GZJA 1LWIA 5LNUA 1MDRA 3ZWSA 3GG0A 2ONEA 3WFLA 3R0DA 3NTYA 1W17A 2FJKA 2OT0A 1D7KA 2BMBA 3WBEA 3G18A 3H4XA 3F4CA 2DZSA 3VGGA 3K46A 3ZT6A 3ZWTA 3W1UA 2NWRA 3W1MA 4GD0A 3ITCA 2Z7GA 2Q3RA 1L6FA 4S38A 1TPB1 4IGHA 1LL7A 2V3DA 3SUSA 5GPRA 3JR2A 3NUKA 1A5CA 3GHSA 1EX1A 1VYPX 2XH4A 3UZWA 1I2OA 1Q5MA 1MW1A 3NDOA 4WY0A 2ZZ2A 1B3OA 4JDBA 1DWHM 4NXKA 1CIUA 4IP4A 3RXZA 2BY2A 2HROA 4IL2A 4EWJA 3QN3A 4LS0A 4HHMA 3L5AA 1REQA 1HL9A 3PPCA 1UYQA 3BSGA 1LOQA 1VLIA 3W74A 1UUQA 2P5NA 2QKFA 3IUHA 4B5UA 1M5WA 2OMAA 3SCOA 5F2LA 1VIZA 4TO8A 3RRXA 5TIMA 2GDQA 2X05A 5IRPA 1KXTA 4GX8A 3E2SA 2QZRA 1Q65A 3WQFA 1OD8A 9RUBA 3R8GA 1KGWA 4CCZA 5E6ZA 3VKCA 5C5YA 4PBFA 3MMTA 3OGVA 1EIXA 3HIJA 2Z00A 5K3VA 2YA2A 1OX5A 2ZVRA 3LM7A 2D3NA 1FWNA 3UU0A 5C70A 3ZJ7A 3PANA 3FV9A 1TMHA 3VC6A 4FOJA 4YHGA 3M0VA 3WJYA 3WLPA 2Y61A 2GSEA 5BXTA 1WAUA 2YB1A 3DI0A 3UWYA 3GO2A 1YTKA 1Q8AA 4S3GA 3EX6A 1WKFA 2VURA 3DYMA 4LUSB 1E9IA 3W7HA 3E0WA 4WDWA 3GW0A 1H11A 2XISA 2WMJA 1LDCA 2HVOA 1T7LA 3MUXA 1KTBA 1R3TA 1KM3A 2CPUA 4GYKA 2W66A 1VFFA 3VD7A 5HNUA 4PCNA 1BYDA 4PCSA 4AC1X 1DL3A 3VNMA 1NF7A 5HNNA 1D8WA 3B9NA 3ZIZA 4A3YA 1YMYA 1V3MA 3CUGA 1ZUAX 1AH0A 4FP1A 4Y9NA 1KBLA 3MSGA 4FMVA 5C7HA 3NEVA 3O6YX 3HBLA 3U4FA 1J79A 5D33A 3CEUA 1RJQA 2QJMA 2WZMA 3VCCA 3M9YA 3UVAA 1WDWA 2PS2A 3LPPA 1BF2A 3W29A 2WMIB 2CYGA 4QXIA 3TYZA 1YBQA 2ZZ7A 3GHRA 1XHGA 3F2CA 1MWOA 1G4PA 1Q6EA 3KZSA 4OWGA 2G3NA 3WF1A 3WQ8A 4AQLA 2VRQA 4AY1A 4N9BA 4EVZA 1JJKA 3VIOA 1ITCA 3D47A 4CN6A 2Z1VA 4GCAA 1ISVA 4A6GA 1F6PA 1A4MA 1WBHA 2NQLA 2AAMA 2I14A 4DWSD 4L64A 1UR2A 4A22A 4I5XA 4DNHA 3CHFA 4MDOA 3CZLA 2EEXA 1FKXA 1NFPA 3ITGA 4GLEA 4B91A 2HV5A 3HMCA 1F3EA 1KM0A 4S3FA 4BWLC 1H7PA 3UPBA 1QHPA 2XFYA 2DSWA 2W67A 3QFWA 1FH7A 3FA4A 2B7NA 5CZJA 2OLAA 2XN2A 1PKMA 1OGGA 5JBDA 2CBJA 3AMDA 3WLLA 3U4AA 1AG1O 3GH7A 1BRLB 5EMKA 3VOHA 3GD6A 1PBGA 3AS0A 4LF2A 7XIMA 4PUKA 3F1QA 1R7OA 2L5HA 4AWEA 3BMWA 4GFIA 3PG8A 3SCTA 4O1FA 4GO9A 1TVPA 5ABTA 3O05A 4KEZA 3T0TA 2P53A 4BK9A 4LH8A 3LHWA 4BEQA 3QMTA 2FGLA 3L66A 4IG2A 2DSKA 7TAAA 1MUMA 2JF7A 2NT0A 4N0RA 4V15A 4YXGA 3VX0A 1ZB5A 4X0VA 3FAWA 3USBA 4C6KA 4AX7A 2BZNA 2XZ9A 1RP9A 2O4MA 5HWNA 2WC3A 1HFBA 7ODCA 2XM1A 3TIMA 2E6YA 2VO5A 4Y2WA 3WMLA 2YXXA 1BYAA 2FZ9A 1DXIA 4JHZA 3I3BA 3OLIA 4ORIA 1Y65A 1FKWA 4RV8A 1Q4NX 1S2AA 3PTKA 4EPDC 5EYWA 1CWYA 1V6UA 5M2FX 3KTXA 4AF0A 5D02A 3PK7A 3QC3A 1K8CA 2V2HA 3BH4A 3S42A 4B5TA 3NL2A 1AH3A 3QV8A 3L2IA 3OQ8A 1SFTA 1GEQA 4YYCA 3U57A 3UPMA 4DWSB 1R3VA 4UBPC 5EBAA 2PP0A 4Y9OA 2DQWA 4I90A 1BXBA 3UR2A 2YBTA 1PHQA 2A1YA 1ZQ5A 3H2EA 1TSIA 2ZTJA 3CT2A 4BCEA 2ZCGA 1XSKA 2PI6A 3CM4A 4UTJA 2PDPA 3V35A 1MQPA 4C6LA 4US5A 4JN7A 1GOWA 3T08A 1DOSA 1XCFA 4GZIA 2YYUA 3AIUA 4UMBA 1VEMA 1EOMA 3DIPA 4GA8A 4MWAA 7A3HA 1HTIA 2E6FA 5JMUA 3WX7A 1GTHA 5F2IA 2CHRA 1L8PA 3WJWA 3SGZA 4AZ6A 3G1SA 4FF7A 5K2ZA 2XH0A 3PNUA 4ZOBA 1EWDA 3N13A 4FHAA 3OTRA 4XKYB 4PZVA 4EP8C 4F48A 3NQFA 1PZ1A 1Z7AA 4XKYA 1DORA 4HK7A 2BOEX 1H7XA 3B4YA 3OVPA 4FPSA 2ISSA 5F1UA 3BVJA 3W2KA 3BK0A 1XI3A 3M0IA 3HQNA 1A5SA 3XISA 1UH3A 2EGZA 1G94A 3DBPA 2G3JA 4BY3A 3DAQA 5A8OA 2J7EA 3QPZA 1W1VA 5GNYA 4X2RA 3FIGA 2ZXDA 2DUAA 4LBRA 1WCGA 5FSEC 4HZMA 2JKPA 2ESCA 3GXTA 4UR8A 3SGUA 4GXPA 4W8LA 3GDMA 3T9PA 2QAFA 4FNQA 4JKMA 1SFSA 5C54A 3AU2A 3UWWA 2YCIX 4PUUA 1K7FA 4JTDA 3ANYA 5BWAA 4B9YA 3CV2A 3TYCA 4V1XA 4Q4SA 2G97A 5EMMA 2OVLA 4IP7A 4GH3A 3HJZA 3CAKA 2Z1BA 3T42A 1E6SM 2XTKA 3UXDA 3MP5A 1MMFA 3S47A 3W53A 1BYCA 3VNLA 3N6JA 3LMYA 1XGDA 5T9CE 3V5FA 2A3EA 3R7MA 1E73M 3WQEA 1HNYA 3N12A 1XDMA 3LBCA 2PWEA 3DKJA 5A6TC 3T2PA 5HUOA 2CNCA 2QCMA 1W31A 4XAZA 4O8AA 2OLSA 3IV8A 3B0VC 3D5HA 1OC7A 2Y8UA 5M03A 4LUTB 4Q22A 4RK8A 4P5UA 1C8YA 2PUZA 3VMPA 3BGJA 3UCCA 4B5VA 4GIEA 2PTDA 4PN2A 1AK5A 5CGQA 4AZIA 3ICJA 2AAAA 4HBKA 1G5AA 1HF6A 5A8QA 3CAVA 3MU7A 3RX4A 1GQLA 5CPQA 5I07A 3WUEA 3CWHA 3WH6A 4YVVA 4Q8WA 1B3ZA 1XQKA 2J7CA 1MFUA 4LYQA 3V0SA 1I60A 1A5NC 4FNRA 4FZIA 3FDKA 3R11A 4U33A 2X7WA 4NIRA 3NEHA 1KRMA 1WUFA 3ECQA 3POHA 5AC8A 1CYGA 4XTIA 5CZTA 2INEA 1VYSX 3B8VA 3ZR5A 1P6WA 1QNSA 4KESA 3KWSA 1YTDA 4GGBA 3KM8A 4NF7A 5C6MA 2RDTA 5IXEA 1FWIC 3ORWA 4LYPA 1DIEA 3N1AA 4MY9A 2FVLA 5JBFA 2IMRA 1EDQA 2J74A 3UJFA 4HZ8A 3UD6A 2VZTA 1G4TA 1RUSA 3GNOA 1M6JA 4FB7A 4XK2A 4L9YA 1TR9A 1SSDA 4GWEA 5B80A 1DHKA 3KAOA 3QHNA 2HJPA 2C1IA 3W75A 4QAIA 3CYVA 1SFLA 2BV9A 1AJ0A 2ZX6A 3VOIA 5HR6A 2NLIA 3PZUA 2WO5A 4M6PA 4P7QA 2HRWA 1GCYA 1YDNA 3S1XA 5JIPA 4PUNA 1HJSA 1GVRA 3BLKA 1IEQA 4NYYA 4M1BA 3TQPA 2RJHA 3N73A 2VEFA 1LLZA 3BGAA 3SEPA 3UY7A 3C4UA 4DPPA 2DU2A 1QOQA 3FKRA 3W02A 3LBMA 5KITA 3T2QA 1W56A 3QF0A 1H51A 1JCMP 3N2XA 1Q2SA 1ZBWA 5CC6A 3BJSA 3W7QA 2CBIA 2QLYA 3PZQA 4D6EA 4F4RA 5LKYA 1ODUA 4M6UA 4MPQA 3OA3A 2CLPA 4QS6A 1R38A 2RDWA 3UCQA 5FJRA 4O1BA 1PX4A 4XV0A 1QVBA 5IBXA 3IRDA 3QHOA 1ME8A 2V69A 1JQXA 4AB4A 2GGIA 1O7AA 3AXMA 3PULA 3SZ8A 4PTWA 3IIXA 4XAPA 4WHBA 4EXQA 4UFMA 3GS6A 5HUPA 3HPAA 3DUGA 4RXFA 2VJXA 3POCA 1V3IA 3B8DA 1P0NA 3TYAA 3Q58A 3O1NA 1XDJA 4J7RA 3G1AA 5IM51 4AEFA 4L65A 4ERGA 1A5OC 1S3HA 1TMLA 1OG0A 1TV8A 3PTQA 7REQB 4ZQOA 3FGCB 1BXCA 4O8RA 2Q8ZA 1YPIA 4H9ZA 4JTSA 1UW9A 4MUPA 4KEVA 2VELA 3NWRA 3ITTA 5FI8A 3K30A 2OYLA 3UA4A 5JU6A 1XCXA 2AQVA 4KFPA 4WUIA 2DZAA 4L6DA 1QMLA 3A64A 5G2HA 3ZVHA 5LSMA 3GVQA 2PLMA 4XD5A 1DJQA 2NT1A 1QOPA 2P3ZA 3TROA 3GXPA 3NQ8A 2GDUA 3BZGA 3GFYA 3EWXA 2QEZA 1SYTA 2NVAA 3SRFA 1H1ZA 1NDWA 4PBGA 1OK6A 4XAGA 2EBNA 2A5HA 3W28A 1QHOA 3E02A 1V6TA 3TR2A 1OYBA 4K3ZA 2RHGA 3MUZ1 2O9OA 1L6GA 3B97A 4UCFA 1R3RA 4QEEA 4REQB 3O07A 2HCVA 1TJRA 5E5CA 4JTUA 3UZYA 2EKGA 3KCJA 3NXFA 4JHOA 3RM4A 4FLSA 2ZX8A 3Q65A 4WEVX 2YDAA 3TAOA 4XB3A 4IIFA 4Y9MA 3NQGA 3IV3A 3CO8A 5A6AA 1PZ3A 2DZUA 3GG8A 2E7FA 4HNUA 4O17A 2QR6A 1J0YA 3MMWA 5D9NA 1YBQB 5LIXX 3WJXA 5I2UA 3MUAA 3JU2A 1XM3A 3CNYA 3QH2A 3VA8A 4E8DA 3E2QA 1PTAA 4E2VA 4K7YA 2X40A 4YIWA 3KWXA 5HA7A 4G2DA 1BYBA 1J18A 4IGMA 2W91A 3FHQA 5RUBA 4JCMA 1G01A 4OECA 1QFEA 3VIMA 3N17A 3OO2A 3RCYA 2DDXA 2VNCA 3WMSA 1FFRA 1SGJA 4DWSC 1OBAA 5FF3A 3QGKC 3FFSA 4OBRA 4AG0A 1VS1A 2GVLA 2BB0A 1EX5A 5C9WA 3BCJA 4IQEA 1UBSA 4XZHA 2Y85A 5FL0A 1GGOA 3OBKA 2J4GA 2TODA 3W70A 1B9ZA 3OG2A 2WOQA 3EDFA 1QNQA 1WP6A 2CZVA 2G5WA 2QDGA 5AC4A 4PC8A 1H62A 3KOYA 3SRDA 1KGXA 3B8SA 3M0XA 1BTCA 1FWGC 1JZ2A 1I2QA 3I7SA 2OELA 2XH7A 4CEUC 2C1HA 1ZJAA 2VGGA 3HV9A 5JQ9A 1UKPA 2GUUA 3A23A 5LHFA 1M01A 4JIPA 1ME9A 2YLAA 4EE9A 3TK7A 2IKGA 3WY1A 3GXDA 4RL3A 4ZQNA 1UASA 3IUIA 1S2WA 4D6DA 1G7UA 1S5TA 1R2SA 3UR5A 4WDUA 3PUGA 1UR3M 4ZQPA 3LERA 4KEMA 4KCWA 3UR8A 1XLGA 4UWMA 4Z0JA 4CQBA 4WLCA 5HWJA 3AYSA 3W7MA 4LFYA 1QHZA 1JDFA 5LGXA 1BPLB 1C93A 5AOUA 1F73A 2C71A 1E55A 1LP6A 4LYRA 2AMXA 1TZZA 1PZ0A 4WQ6A 1LTDA 2XINA 3LCLA 3R13A 5H1WA 4HPJA 1BQGA 2CZDA 4DLMA 4LBSA 3B0PA 3C3NA 4YYFA 3TN6A 4G9PA 2X16A 3CQ0A 4LVAA 1QDSA 2CLMA 5HULA 5XIMA 2FVMA 4UOQA 1PIFA 2CZ5A 2XIMA 5FJOA 3T2OA 3BLDA 1XLHA 2OYKA 4ATDA 3LI0A 1GVYA 4PMXA 4E2OA 3MY9A 1IXQA 3VKDA 3MP3A 4F0HA 2WZEA 1BKSA 3HURA 2XYLA 1HJWA 4G1NA 4ECLA 4AD2A 4PCPA 1QCWA 2PEVA 1OGBA 5I03A 3MKVA 1SW0A 1GPFA 2PRLA 8XIAA 3VUSA 3GVVA 2QYGA 4B5WA 4LEQA 4H8HA 3R8RA 1JPKA 3JZUA 5ABHA 1VPQA 1PB0A 3T7VA 3T0CA 1JDDA 2GLKA 1L6YA 2WNQA 1FHDA 2A21A 2EPLX 3QXBA 4Q8VA 2WBGA 1KCKA 1PCWA 3P60A 1FFQA 2VYOA 1B9BA 1UZ1A 4I6KA 5ABGA 1OVDA 1FXPA 2WQDA 2HPIA 4J9JA 3UETA 5IFPA 4IGSA 2J13A 2V8ZA 3RR1A 1QPRA 3MMDA 2C1GA 2HNHA 2VUNA 5CAKA 1XIHA 3MKCA 2AGKA 4GH1A 3D3FA 1H09A 2QVHA 4N9DA 5LXEA 3SM0A 4TTGA 3W76A 2VTFA 3I10A 2WSYA 2CLLA 3CZKA 3W71A 2AOSA 3PZIA 5MF5A 4C5ZA 5C2XA 3DU0A 1JF5A 1FDYA 4B15A 2ALRA 2AQOA 1Y5XA 3GXIA 2TAAA 3QM3A 3WQPA 2V63A 2W62A 3RX2A 1XG3A 1MW2A 3UERA 1OFQA 2YCLA 2ADAA 3AJXA 3SQMA 3EEGA 5I06A 1M3UA 3WH9A 1Q6FA 2WW5A 3EA1A 2PTXA 1KC7A 1M68A 3BXWA 1BSIA 2O7QA 5I0DA 2Q71A 2HTMA 2G41A 3NQEA 3OLDA 1RQEA 1A0EA 2VFIA 1E56A 3QVQA 1A47A 1H0IA 1LJYA 5I5RA 4N4QA 3C6CA 1KA9F 3DN5A 3L4ZA 3ZVHB 4DNMA 4GQ0A 2P76A 1NFGA 3T6CA 1Z41A 5CBJA 2EPNA 2QCDB 1PWLA 2IUZA 2G95A 4H3DA 4UFLA 1TRDA 1Y5VA 2WNWA 4FO4A 3DHPA 3F2BA 1PE1A 4ZXOA 5A69A 3NNTA 4IUGA 1O4UA 4AUBA 3FHAA 4R85A 2QUVA 3ARRA 3QZ6A 8A3HA 4WDXA 2E5DA 5FL1A 3EKGA 3DOPA 4E2DA 2QIIA 3W1TA 2OZ0A 4MUZA 2VC7A 3AFBA 4F79A 3GNXA 2PDQA 1TWIA 1IT7A 1XW8A 4Q8QA 1CNVA 3GDTA 3RFAA 3TW7A 4JQ3A 4NZ4A 1GNXA 2ACSA 4GJ1A 3GK0A 3IJDA 1E4LA 1GORA 1UWIA 3PY2A 2E68A 3SQLA 1RJPA 3LOTA 2WHJA 4ERAA 3HTWA 5CLTA 3GU2A 1ESWA 2HBXA 3MTWA 1XYZA 4K1GA 3DBNA 4HPGA 1O1ZA 5M5DA 4CD7A 4K1WA 2OEJA 3B9DA 1B2YA 1B3XA 4IH3A 4NU7A 4NHVA 3W2UA 3FK4A 4O11A 5LA1A 3S5ZA 1ZP3A 3QRHA 4US6A 1TPFA 2YCLB 1F4HA 1PKYA 2ATSA 2QPXA 4HU4A 2XN0A 4JFTA 2HVMA 3LCGA 5CAHA 5LGZA 3AHZA 1UQYA 3BE7A 1F8IA 1LROA 4KCVA 2WMGA 2OSXA 1XLDA 3N11A 4OJYA 5LNVA 2ZZ4A 1EC8A 3GNNA 4MG4A 1Q13A 3VINA 3IEBA 1GYNA 1HP4A 3H2CA 3IJ6A 4RDWA 4PTMA 3WK2A 1WKYA 4P2VA 4GXMA 3ZR6A 4QROA 1N8IA 1SM9A 3LXBA 1FWEC 2TRSA 4PSRA 1RVKA 4EANA 3DDMA 4PEKA 3AS2A 2YA1A 2ABAA 3TYDA 1VFLA 3W1RA 4G8TA 4Y96A 1JRCA 4C7GA 4QFUA 2POTA 1JAKA 5G4HC 1HP5A 3MDUA 2X1SA 3APGA 3TONA 3VNIA 2QJIA 1H7OA 2HNEA 1ITQA 2PPGA 4E8GA 2PWGA 3S0CA 4Q8OA 4TX6A 4PRWA 2FPYA 1IZCA 1KKRA 2WC7A 1GWJA 2VDIA 3PUOA 2QCEA 1AODA 3AXHA 1VEPA 4RPPA 4EXAA 3BQ5A 3MS8A 1DV7A 3W7LA 1K77A 3G1RA 2A7PA 1T0OA 2QCFA 1XIBA 4YTQA 1WZMA 3B8UA 4QGCA 2PODA 3EB4A 1SO3A 3HFTA 4Z0SA 1GPWA 2BY0A 1ZENA 3HQOA 3C61A 2HEJA 3NO1A 2QXWA 2GQ9A 2ACQA 3R2GA 1WPCA 3CPRA 5REQA 5AYYA 1M1BA 2CHOA 4JTGA 3EWWA 5REQB 2ISVA 3UGVA 4W7VA 3SCPA 3RAOA 7TIMA 4WF7A 3AXIA 4DN1A 1X96A 3DZ1A 1OT2A 2XHYA 1KGUA 2PF8A 1QWGA 4L4MA 2OLHA 4O1EA 3OU8A 1SU5A 3TJXA 4NY2A 3UZ5A 1MQQA 3G24A 2X0SA 2FGBA 3A9BA 2XGIA 4HJWA 3EPNA 4B9ZA 4WGXA 4WY0F 6PTDA 4LB3A 4H8VA 1FWRA 1VJSA 1R46A 1XIMA 3RM8A 4K38A 3CIWA 3W2JA 1FWAC 1QR7A 3BWWA 1D3CA 2E6AA 4UB9A 2QULA 2NV9A 2NX1A 4LW7A 4Y9AA 4Q7IA 1V6VA 3CHCA 2NX9A 4QJ1A 4NAFB 2DIJA 4JKKA 4YWIA 1Q6QA 4XD4A 5EFDA 2CXGA 3S46A 3BW2A 1ISZA 1XCWA 3R25A 4CLMA 1ME7A 5JVLA 4UQEA 3T55A 5CEWA 2XDFA 4NILA 1XBYA 3Q45A 4X0NA 3PBMA 3HGOA 1P6BA 4HHHA 4XQ6A 1F2JA 2UV8G 4E3VA 1RZMA 3VOGA 3VNDA 1F05A 2G3FA 3GDBA 2PP1A 3O63A 1J6OA 2BNJA 3OZPA 3OIXA 1T99A 5D8WA 1VRXA 4P8WA 5D2VA 1P1MA 5C8BB 4PTNA 4ACYA 5B7ZA 3TYEA 1PV8A 3W7OA 2WNZA 4HSNA 2GQ3A 3W1QA 4WKAA 1KFWA 4DO5A 2VDGA 5J8LA 3AC0A 1XLLA 2FPVA 3B4UA 3PJXA 1FWFC 1BVZA 1SZRA 2DSUA 3MQTA 1TE6A 1V6WA 4EF8A 1LWHA 4WGHA 2QJJA 2VGFA 4BQ2A 3ANUA 1ZCCA 4E4PA 4MJMA 4JOMA 3WDHA 2A3HA 2OPJA 1YTEA 2Z26A 5H6HA 4YPJA 3KVKA 4R27A 4O52A 3WEZA 1E3XA 3LUTA 5DMMA 3CMGA 4FLRA 1UR0A 2Q01A 2NSOA 4KQNA 1IWAA 3VOCA 3SY8A 4MWAD 4XBKA 3ITOA 3C0QA 2EQDA 4ENLA 5BMWA 1KO0A 4MWAE 1XRFA 3QGAC 2ZUMA 1GOMA 1TWWA 4IPNB 3NSNA 2Y7EA 3GDLA 1W1ZA 2GGJA 3LGEA 5DMYA 1TQXA 3VKKA 4AZHA 1J5SA 4MF4A 3PWAA 4NZFA 3A3XA 1L2QA 1H7RA 1DJHA 4AZBA 1ODZA 3LTSA 1UWAA 2C15A 4LCQA 3E12A 1KTCA 2W6RA 2WMKA 1IEVA 5HATA 4B16A 4DJFD 3NR0A 3ANVA 6CGTA 3Q4DA 2QMKA 2VCCA 3A5VA 5EKYA 1F6KA 1XGZA 3BAJA 5CJ5A 3TFCA 2H9AB 2V9DA 1A49A 2GJXB 5A6SA 4JTQA 2XWDA 4H19A 4E4FA 4IL0A 2PDWA 1DTUA 1EXPA 1L6WA 1AQ0A 4I9TA 3UJSA 1EUNA 4LUSA 4CVUA 3I6RA 3R58A 2CZFA 8XIMA 2GUYA 2FZ8A 4AD4A 4ZVJA 3I4KA 3NZGA 4J40A 3BV4A 4XD3A 3JRKA 4XAFA 1K6WA 3MZ2A 3WKZA 4M6QA 4R34A 3VVGA 1QBBA 1K3UA 1RLCL 4AY7A 1C7SA 1UD6A 1EJUC 2GQ8A 3SN0A 3FOKA 1UCWA 1JAEA 1W1B1 2DW7A 3MPGA 1OHLA 3BJFA 1XFCA 1KBJA 1DIDA 2WK2A 4IMEA 2PDXA 3QQ1A 3ME3A 1XINA 4AZ5A 3W2NA 5H8PA 4O0QA 1Z6KA 4ZTYA 2PZNA 1E0XA 4LEFA 4LUYA 3RPMA 1HL8A 3AYRA 1JCTA 4JTFA 3VO0A 4WVXA 1FWJC 3GH4A 4J1OA 1S38A 1UD3A 1E0WA 1PTDA 2Y7FA 3EX2A 1UHVA 3LXCA 2XN1A 4A3HA 1AW2A 4AC7C 2V5KA 4B5NA 3T78A 3W1PA 3W7IA 2ZZ3A 3LENA 1N82A 1OCQA 5HMFA 3RPTA 3LRKA 1TYGA 3TJ4A 2QQ6A 1H5VA 3BL3A 3PN8A 4NNBA 3IPWA 4A8RA 5JBEA 4O1CA 4GGHA 1UOKA 4RNJA 2XIQA 1W5NA 1A0CA 3WBYA 2WBKA 3ISIX 2Z1XA 2CC0A 4XSLA 3PSVA 4ZMGA 4JTEA 3OA5A 1SMAA 3R6IA 3LCFA 5FIPA 5I79A 4X60A 3GFZA 1KFKA 1TIWA 3LTYA 2PB1A 3MUCA 2IPWA 1K7EA 2EG7A 2PE4A 2LLEA 4R7JA 1R9YA 3T4WA 1GVEA 2IW0A 4DEFA 3IJ9A 4JPGA 4JY9A 1RBLA 2VZUA 2GVEA 4PB4A 5K4ZA 3TN5A 2DUZA 2W79A 5A6JA 3OW1A 1OQFA 3T0DA 1KLYA 3KP1A 4O0ZA 2AMGA 4OE7A 4W7WA 3QKZA 1W9DM 3ARUA 5E09A 3VOJA 5TF0A 2CKSA 4B3ZA 3ONBA 4YCPA 4I5RA 1MVYA 4ILSA 4F0RA 4LAKA 3PG9A 2PDIA 4MZYA 1NVMA 2GWGA 4J3VA 4GISA 4DJEA 4J2PA 3LTPA 3GTHA 3UJ2A 5E9AA 5AVHA 3DYPA 3QR0A 1SUXA 2XJ7A 4O13A 2VX6A 2Y8KA 3S6TA 2W9MA 4QDWA 1E72M 4H6EA 5K4XA 2QCDA 4ZCWA 3EWUA 2BTMA 4ZQMA 2ZRUA 3TN3A 4HPXA 3NL6A 3WDIA 2FHCA 2YCEA 5AECA 4DIAA 4P8VA 3N3TA 3H70A 1K8ZA 2VKZG 1JZ3A 2RJGA 4Q4MA 1TB3A 2VVSA 1U1UA 5DCBA 4IT1A 2PBGA 1PS9A 3BCDA 2F61A 4O0KA 4QSFA 3BAYA 3CTLA 4FLOA 4JXCA 4JQ1A 3PB2A 3P84A 1VGAA 1OF6A 3IVUA 1X98A 1GT8A 1TO3A 2VEKA 4K8EA 1ALDA 4GIYA 2VQUA 3OYXA 1DJNA 1GVOA 3E96A 3APYA 1V7YA 1CBGA 2AKZA 4PSPA 4Y7EA 3S4TA 3PS7A 4XVEA 5T91A 2J8TA 4QE5A 4K6AA 1EUAA 1W9UA 3NQAA 4PMRA 5G1TA 2D23A 3FS2A 3D46A 3VILA 3WEMA 4BQ5A 3ATZA 1ONWA 4JQ4A 5J5DA 1MDLA 2ZRYA 1I0BA 5CGTA 1GW1A 2CCRA 4AVNA 3BDKA 1R9XA 1C3FA 5GVJA 3V7PA 2Z2AA 3GH5A 4MKVA 3LPOA 1XD1A 4TQTA 5CSRA 4PL1A 1E15A 3SUWA 1WXYA 4XTDA 5D32A 2WM1A 1OCJA 3BW3A 3AALA 3C2FA 5HDRA 3SIMA 1XLJA 2WHKA 3GWQA 4MJ2A 3RU6A 3SCVA 2O9PA 1EC7A 5DO8A 1QOXA 4GC3A 3AO0A 4DBDA 1EEXA 3QW3A 1E4MM 3ABQA 1BWVA 4Q6JA 2YIHA 4JN8A 1JPMA 4UQAA 4FXJA 2PWUA 5M17A 4DM2A 1KWKA 4HIBA 3I6EA 3VNYA 4DAIA 4J3XA 4CU8A 1E1CA 2C16A 1S2UA 4PH6A 4Z2LA 1W91A 2QCGA 4OOZA 4PFHA 1LLWA 4QS5A 3TC3A 1VHNA 3AHYA 3CPUA 3H24A 1TCMA 3CHVA 3Q94A 3KEHA 2VQTA 4MM1A 5L9FA 3BLOA 3D0CA 4CCDA 1LBLA 2ZA1A 1E6QM 4UQ9A 2OKTA 2PLKA 4S3DA 1HZYA 1DJGA 3KRZA 1OX6A 3CQKA 5T9BG 1QO5A 2ZUNA 1UH4A 2XIOA 1OIMA 4AMCA 4CKQA 1RJRA 2CESA 2YBUA 1XH0A 3WLJA 4JTAA 1YYAA 2PWHA 4GUFA 3AS1A 3RMJA 4DUXA 3CB8A 3IANA 4AD0A 1GG1A 4MZ1A 1HVQA 1PYFA 3U6WA 1NWRA 1NP0A 1PIIA 2P1FA 2E4TA 4L1GA 1YQ2A 1GOQA 4E38A 4J5NA 3P80A 4UFJA 2J7FA 3PBUA 2WQPA 4BEUA 2ZBTA 4QE1A 4W7UA 5U4NA 3BMVA 4PMDA 3HN3A 1V02A 1EJTC 5FAJA 3NAVA 4QLLA 1Q2RA 3W87A 4HSHA 3TU9A 2CIPA 4R7OA 4ADTA 4PUEA 5LNRA 4GZ7A 3M16A 4X2PA 4DYEA 1C7TA 3MT1A 2ATMA 1XSJA 3TH6A 1AJ2A 5CPMA 3UZXA 5DRCA 2CLIA 2A6NA 1ZU8A 3L68A 2H6RA 4YS1A 2E77A 4GNKB 4Z1AA 1QBAA 3UR7A 4D6JA 4IGNA 3H53A 1OABA 3VIJA 4F2UA 3A24A 5FEZA 3RJYA 3W7RA 3QJAA 4GNVA 4O15A 4RPQA 3BOLA 3C2VA 4FSAA 5LXXA 2W4XA 5GNXA 3RCNA 4Z2GA 1V77A 2WAGA 1A80A 2X0YA 2BG5A 3K4AA 4EPKA 2E8YA 1WOBA 4QEHA 3N6HA 1QPQA 3L7RA 2DZBA 5TAOA 5E6YA 1DTNA 4EPBC 4WKHA 4QNWA 4UR7A 2O9TA 1AL7A 4ZZ9A 1VFOA 3M7SA 1QNPA 1IT8A 3C8NA 4KBXA 1Z42A 3BC9A 3CL7A 1WKEA 2WJDA 3W7DA 1H49A 2I57A 2HXTA 2J62A 4WZHA 3VGHA 1SZNA 3DECA 3HG4A 3B9EA 1GUVA 4UQCA 1U30A 3A4XA 1N8WA 1D9EA 3XIMA 3PPGA 3NGJA 2D3LA 5A5WA 1NSJA 4LC6A 1H7WA 3VIIA 4ZB2A 2F38A 2J24A 4A29A 4RKAA 1KWGA 4RLIA 1J4EA 1AZ1A 1XISA 2CWNA 2E9LA 2Q3OA 4W5UA 3OZOA 1J5TA 2QCNA 3TJLA 4P7OA 3BLEA 1R86A 3T4CA 1YXYA 3V3WA 3EPMA 3W81A 3EXSA 1X1NA 2WVVA 1ISXA 3ZOAA 5HMDA 4C6BA 3VD4A 1Q3NA 2XG9A 4H1ZA 3MO4A 1KRBC 4M81A 2R14A 1UD5A 1B4EA 1H41A 4ROQA 4KT2A 3LLDA 1H50A 1LM1A 2WV8A 3S83A 3VD5A 4GKTA 1R9ZA 1YX1A 2I1OA 5HOSA 4H9XA 4NJIA 3PZ9A 3L9CA 1CB7B 3S5OA 4KEUA 5CKSA 5C0QA 3QMSA 5EBUA 4QAWA 3NGFA 2KZHA 2PC8A 5E1QA 3AIVA 1Y7VA 5FEWA 4AISA 4ZO8A 2D0FA 5I23A 4JTJA 4ZEPA 3S3GA 1PO9A 2GJXA 3GUWA 5LA2A 4QCFA 2XM2A 1FOBA 4AHQA 2J7BA 3S6DA 3ZM8A 1Q6LA 2NXGA 3LV5A 3M5VA 3UFYA 4PYSA 2QGYA 4LCRA 3RLHA 2HK1A 2DV0A 3G1YA 2Z24A 4RJEA 2QUTA 4EX4A 3ARVA 3EMZA 5EGRA 1HJVA 4BJHA 4XZNX 1PJ9A 4TR9A 4UNIA 3KVJA 1GQKA 1XIGA 4DBWA 4LAZA 4Q8UA 4JQAA 1BKHA 1KXQA 3H8AA 3CUFA 2BHUA 2DJLA 1CECA 3UWVA 3WD3A 5T26A 3RMEA 3G3MA 3PFMA 4ZOCA 3HPSA 2YDRA 4WJ8A 2HE5A 1D8CA 3W86A 3EAUA 4HT3A 1RV8A 2F84A 2PU1A 4LVFA 3BG9A 4HTBA 3VFCA