3KRZA

Crystal structure of the thermostable nadh4-bound old yellow enzyme from thermoanaerobacter pseudethanolicus e39
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
335
structure length
335
Chain Sequence
SILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
publication title Biocatalysis with thermostable enzymes: structure and properties of a thermophilic 'ene'-reductase related to old yellow enzyme.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus atcc 33223
molecule tags Oxidoreductase
total genus 129
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3krzA00
3QPYA 4NJIA 1SUXA 3M16A 4OQVA 3A22A 2X2GA 1VHNA 3HBLA 3TSDA 1ALDA 4LVDA 4WX2A 1D9EA 2XN1A 1H5YA 5AHIA 3QC3A 5HR7A 5A8GA 5GVJA 2YPIA 1KFKA 3WFAA 4I9AA 1PHQA 2VFDA 4MVAA 4UUIA 1ML1A 1DHPA 2NUWA 3NGJA 1WAUA 2ZA3A 1YDOA 5AB3A 1GG0A 2ZZ6A 2X1UA 3G3DA 4Y90A 2ZZ4A 3STGA 3EX4A 4DBDA 4IX0A 1L6YA 2A2IA 4OE7A 3UXDA 1XDLA 4K36A 5I3HA 3S1XA 1TTIA 2WJZA 4EVZA 4MOZA 4P61A 2Z2UA 3SJ3A 1V5XA 4AHQA 5CZJA 2C15A 3KVKA 4UC5A 1PV8A 3QQ1A 1H7WA 4PTNA 1HUVA 4XKYB 4IX2A 4QAIA 1NFBA 3NM3A 3NQEA 2TPSA 2ZDRA 3KVMA 2A7PA 2E6DA 1VH7A 1KBIA 1HO1A 4D2JA 4RCXA 3C2OA 5F1VA 3ATZA 3EX2A 4I7WA 3PUEA 1M7PA 3GYEA 2CLMA 3M5ZA 2H8ZA 4O14A 3P62A 5KINA 4M5PA 4ZVJA 1NF7A 3HB9A 3BG5A 1DVJA 3NPWA 3PR2A 4M6VA 1LCOA 1WBHA 4OV9A 1LBLA 4O52A 3UWVA 2WNZA 3MW7A 2QF7A 3GXTA 3EWXA 1GYLA 3GDTA 1RZMA 1QOQA 3QSTA 5EL1A 1S5TA 1XBVA 1JCLA 1H63A 3P80A 4ZMGA 1QAPA 2ZRUA 2RHGA 4ZZ9A 2ABBA 4G1KA 1K7EA 3MMTA 3FEMA 4WJEA 4KFOA 4LS0A 4CQ8A 1QNVA 2ZTJA 2BZNA 3TROA 1TTQA 3O6CA 2WO5A 3P8IA 3BPWA 3D0CA 3WK1A 2ZRVA 3WJXA 3ZWTA 4Z1CA 4FX6M 3VE7A 3W7QA 4LV9A 4ZQRA 4QJ1A 1OF8A 5G2WA 3W76A 1F05A 2E6AA 3HPZA 5MHBA 5C6MA 4L4LA 3H54A 1YDVA 4JY8A 4J9JA 1DQXA 3MBFA 3MO7A 1Z44A 4FNSA 3PB2A 2Y70A 3G0UA 1GVOA 1KM3A 2QCCA 4BK9A 5FF0A 2OMAA 1I2PA 4ZQPA 1KV5A 1I2RA 3S8HA 2PRHA 3W2UA 4HNTA 3R5EA 1OK4A 5AOUA 1OX4B 2RKXA 3L2IA 4AB4A 3CHVA 1VYSX 3NNTA 2CLHA 1SR9A 4EOUA 5EY5A 3H55A 5KZEA 7TIMA 3B0PA 1FWTA 1GPWA 4NX0A 2F7FA 4FO4A 1GWJA 4DELA 1T99A 1TQJA 5K9CA 2VEKA 1XBXA 4BI5A 3HOJA 5D2XA 5E93A 3NM1A 3TMLA 4LNYA 5I3JA 1WOBA 3GNNA 5HWNA 2H3BA 5LNRA 1QO2A 4MUZA 2ZTKA 4DPQA 1FBAA 4Y96A 2EF9A 1YXDA 5HWJA 2GUUA 4CQAA 3LCGA 3BVJA 1VCFA 1XUUA 2GJNA 3Q37A 1TJPA 5FEWA 3FA5A 5D32A 1GEQA 2TSYA 4MYXA 3CC1A 4UFJA 3GNDA 4QITA 3STFA 3P61A 1VJIA 3QYQA 2WNNA 1VC4A 2E5BA 3R13A 3QM3A 3L0NA 1OX4A 1G69A 3N2MA 5LGZA 4IMGA 4Z0SA 1SPQA 1JCXA 3DU0A 3EB2A 3LI0A 5IM51 3GLCA 1SW0A 4EF9A 2TYSA 2A6LA 4XBSA 3F4WA 3L68A 3NXFA 2WPBA 1MZHA 4UFHA 4YL2A 1SO6A 5FEZA 3W83A 1GZGA 2A4AA 1OFRA 3BGGA 3LHWA 2Y7EA 5I3GA 3PVFA 4OWGA 2OT0A 4RX0A 1H62A 2Y6ZA 2QJIA 2BLEA 5K4ZA 2DZWA 1W3IA 3RK8A 2X16A 2VFIA 1FDYA 1WBJA 1ZAJA 4DXVA 5U4NA 4NJHA 3W85A 4ZL1A 2VENA 4O54A 4C1LA 1FWSA 3JR2A 2F84A 3TNOA 2G97A 3NQVA 3DFNA 4A2RA 2YFNA 2Z6IA 3MBDA 2WSRA 3UD6A 4UTUA 2YZRA 4MFDA 3L66A 4XTIA 5BMWA 3RNDA 4UTLA 1TPFA 3NVTA 3S5OA 3GK0A 3ZS4A 2O7SA 4HNNA 5KMYA 3GDMA 1U83A 3NO5A 2CZEA 1QMLA 1MSSA 1OHLA 1ZHAA 3FLUA 1OF6A 1P1XA 1VPXA 3P5YA 1TMHA 1LLZA 3OG3A 2JKPA 1SZNA 4R53A 5K2ZA 3P7YA 3HGRA 2BXVA 3CWOX 3MHGA 1ZFJA 4JTJA 5CKSA 4YWIA 1FXPA 5E0KA 5FEPA 2DJXA 2O7QA 1DJNA 1FCVA 1HG3A 1ZENA 1FWRA 1KV8A 2J27A 2YYUA 5G1YA 3DHDA 5G1TA 4UNKA 5K7JA 3DAQA 4CNOA 4GNJA 2QCHA 4A21A 4JTEA 2EAWA 8TIMA 3LXAA 2YW4A 3MUXA 4PL2A 1AMKA 3GZ3A 3BK0A 3N3MA 1XL9A 1RQBA 3IIXA 3TXZA 3GVGA 1K02A 1TCDA 3IIOA 2J24A 2DZSA 2QCEA 1VYRA 5L6UA 5D33A 4PCFA 2JGQA 3PM6A 3R8RA 1W56A 4JR5A 3W70A 3GX9A 2NWSA 4K7YA 4JTKA 1UJPA 3TH6A 3LHUA 1YADA 3NQAA 1Q3NA 2VEIA 3CWNA 3MP5A 3UY8A 5AYZA 3C6CA 5K3VA 2CLEA 5BMXA 2A85A 4Z1DA 4FEZA 2YFOA 3TDFA 1Z41A 1SSGA 4O12A 4H4IA 4JIQA 3W1QA 4Z08A 3W1TA 4O1AA 3UY7A 1SO4A 3P60A 4LW7A 5LHFA 1PS9A 1LRTA 3HIJA 3RLUA 4UFMA 4P2VA 3IRDA 4JY9A 2H8XA 1O95A 1QDSA 3F4NA 5LNUA 4O4VA 5G5IA 3OVQA 1H7OA 3NPXA 4O15A 4JYDA 1A5BA 2C0AA 3O6DA 2V5BA 1UB3A 4EWND 1BEUA 3TW7A 4N9BA 4YMZA 2YX0A 4WY0B 1CI1A 2X1RA 1AW5A 1R30A 1W5QA 3BG3A 4OBTA 3W1RA 1FWWA 1TRDA 1OX6A 3UWUA 3B4UA 4XTDA 3FJ6A 3LB0A 4LC6A 1O5XA 4ML9A 3L5MA 2ATMA 3KOFA 3STCA 2YXGA 1XDMA 2YR1A 3CT7A 4WY0F 4Q32A 4FNRA 3F1QA 4XZ9A 3L21A 4M6PA 2B4GA 3W7PA 4PODA 3UPBA 3M5VA 3TC6A 3S5YA 5TIMA 1OK6A 4RXGA 1VQTA 3W84A 5FF3A 4B5NA 2PRLA 4JICA 3W86A 4DF0A 2QCDA 3LCXA 4N02A 1A53A 3W88A 5CPNA 5D2YA 3N9SA 4X9SA 1LRNA 2FPVA 3MI3A 1FWNA 1YXCA 2DP3A 4LVFA 2BSLA 2V81A 4N9DA 4M6QA 3T40A 3TCEA 1K8ZA 2Y7DA 5LHEA 3PUDA 2J9ZA 2VOMA 2V2DA 3CQ0A 3P81A 4LC8A 3MJYA 3W7IA 3DFQA 4UFKA 1G4TA 2AQWA 3A24A 3G1SA 1EUNA 4LU0A 5CZTA 3S1UA 3DKJA 1TPB1 1ZY9A 2JBMA 2A1YA 3HG5A 2H90A 1L6SA 4JEQA 2P10A 4FNTA 5D02A 4IMEA 3B03A 2CLKA 3HPXA 5HUOA 3O07A 2JK2A 1W37A 3BARA 1SZFA 3EXRA 5LNSA 3LM7A 2C3ZA 1LTDA 4UR7A 2R14A 1M6JA 4ADUA 1TJRA 1VR6A 1KLZA 5AC6A 1KM2A 1R47A 3SGUA 1LDCA 4OGZA 1SZGA 5G2HA 1GT8A 4GXMA 1X1ZA 3EWUA 4K37A 4MKNA 6ALDA 1VLWA 2RH9A 4QM1A 2NXGA 3DBPA 1VCVA 1JCNA 4O57A 1ICSA 3LV5A 1P0KA 3HF3A 2DZXA 3SECA 1AK5A 4ADSA 3HGOA 2NXHA 4GUIA 2I9EA 3M1ZA 2ZCGA 4JYFA 3LCHA 1TIMA 2TRSA 2ZA2A 3UWWA 3ANYA 3NL6A 3QFEA 4MY1A 4M7SA 4OU1A 1RD5A 3Q2DA 5D05A 3A5FA 3QMRA 1EUAA 1LP6A 3W87A 2A6NA 3PULA 3LDVA 4XQ6A 2QUTA 1TB3A 3EWBX 3B0VC 1PCKA 4HT3A 5AN7A 3GR7A 4LRTA 3W71A 1H7RA 3TQVA 1OJXA 5I3IA 4CCDA 5BW6A 4K39A 4JXCA 1WXJA 2DZPA 2B7NA 4NT0A 1THFD 4O18A 1LYXA 1KM1A 4BWLA 3QPZA 3I68A 4GUGA 4PFMA 4NZJA 4WD0A 3IGXA 2Y88A 1F74A 4A2SA 2E6FA 3W1UA 3WJZA 4JDYA 1J5TA 1QPRA 2CZDA 2FFCA 1JRBA 3T78A 1XBZA 1VS1A 3N34A 4MZYA 5BOOA 1F5ZA 3YPIA 1AW1A 1B57A 1TYGA 3CEPA 2ZRZA 3PY2A 3O15A 1F7BA 4MIMA 5EMUA 3BW3A 1L6WA 4JX4A 1E51A 5IBXC 1F73A 4LVAA 2E1DA 1YPFA 3LTSA 2QR6A 3P67A 3S0CA 1CW2A 1B9BA 1TPUA 1B3OA 3EX6A 4UFIA 1XXXA 2E5DA 3L9CA 3LHYA 4LVBA 1QCWA 4MLJA 1JULA 4AWTA 5F2MA 3VE9A 3E12A 4N9CA 3JS3A 1H7NA 3NDOA 1MXSA 2VC6A 2CWNA 4FNPA 5C55A 3U8GA 4TX9A 2ABAA 4YCPA 3FYPA 3KAOA 4O17A 1I8JA 2X1SA 4KFNA 4FX8A 4LT9A 4NNAA 1YTDA 3G24A 1OFQA 1XBYA 3W7CA 3PSWA 1O60A 4IJBA 3LBMA 4XKYA 4GUHA 3DGRA 1EPXA 4UMAA 1SFLA 3M7WA 2Z6JA 3I7RA 1QO5A 3UWYA 4ZQNA 1QPOA 1EWDA 4WOZA 2DJLA 4UMCA 3TSMA 2OZ0A 3C56A 3CIWA 3LTPA 1W8SA 3KRSA 2W6RA 3S6DA 2JKEA 1GVRA 1YTKA 4MJMA 3S5ZA 3GR8A 1FUYA 4K6AA 1C8VA 2YSWA 3G1XA 3PBWA 2ZBTA 4UNLA 1G67A 1JUKA 1TREA 4NVTA 3TR2A 3PF3A 3T7VA 3HQ1A 1TTPA 4LTSA 5SWUA 2AAMA 5D03A 3CB8A 3O8AA 2NX1A 1H51A 1OYAA 3W7OA 4MPQA 4EIVA 3NQ2A 2QJGA 3ATYA 3SFKA 1EA0A 2Y7GA 3NYZA 2J88A 4NUWA 4KWVA 1XC4A 4ORIA 4XUGA 4YLWA 3LCWA 3W7HA 2DU2A 1QOPA 3G1DA 3IGSA 5KTLA 1EB3A 5DCDA 3SZ8A 4TIMA 2J6XA 4RV8A 1UASA 4UTIA 4Y8FA 1W5PA 4AHPA 1DQWA 5J5RA 1OFAA 4WZHA 3PC0A 4GBUA 3O63A 4IUOA 5G4EA 3SY5A 1JQVA 2D73A 2ZQ0A 2VFEA 2NZLA 1S5WA 1R2RA 2C14A 5LKYA 3QW4B 1FX6A 1EP2A 3OHIA 4FHAA 4GE8A 1O4UA 4GUFA 1OYBA 5DBTA 2FB2A 5KSWA 2HTMA 1ICPA 3KVJA 1GVSA 3PB0A 3UXAA 1BWLA 1SO3A 2H6RA 2RDWA 4UCGA 1H50A 2V2HA 4E0CA 2CZ5A 2UV8G 4N9EA 1QPNA 1UBSA 5AFDA 1KFEA 4FF7A 5FF7A 5J5DA 1OFPA 1JR1A 5H91A 4UTKA 1GJPA 3O05A 3KXQA 1PCWA 1JUEA 1YDNA 3R89A 1TPC1 5EKYA 4XBKA 4AF0B 1RVGA 1RQEA 3W2NA 4DO6A 1KFCA 1ZAHA 3N73A 4LUIA 4O28A 2Y7FA 2Y61A 3NPUA 5BNKA 3MP4A 1KFJA 3INPA 3LRKA 1W0MA 3MHUA 4OV4A 4W9TA 3S42A 3CU2A 4KKXA 3CEUA 3IGUA 1IIGA 2ISSA 3G3MA 3MI2A 1YPIA 1BWKA 3WJYA 3W22A 3W7MA 1AL8A 4ICNA 3O1NA 3LERA 3M47A 1K03A 4OHQA 5T26A 3L0KA 1KM5A 2B7OA 3LXCA 4RZ5A 2A21A 3SI9A 3OVRA 4RKAA 2PRMA 1DORA 4PA8A 4PL1A 5IBXA 3SW6A 2LLEA 1NSJA 4JIPA 2PCQA 3A9IA 4JTFA 4O16A 3ZFHA 3TXVA 1TPEA 1PVNA 4UXDA 3FIGA 1IXOA 2NWRA 2CU0A 3M43A 3CM4A 3QEZA 3W1MA 4AXKA 3E49A 5KZMA 3G1YA 3TK7A 1H1ZA 3OA3A 1W31A 2C1HA 3KFTA 3QSRA 5F2LA 3GKAA 2AGKA 2ZZ3A 2QDGA 5F2IA 1JRCA 1EP1A 3DHFA 3P74A 4LUJA 4Y9AA 3DENA 1S5VA 4JD4A 3CLMA 4LWWA 1R2TA 1Z42A 3PUOA 3ABOA 3IVTA 5LZLA 4CLMA 3NQ7A 4O1BA 3R12A 1KM0A 1SQ7A 5F4SA 2ZRXA 1KTNA 3MWAA 3VNDA 2GVLA 1F6KA 1VYPX 5AHFA 3P5ZA 3S1WA 4O10A 4M7TA 3QH2A 2NUXA 4RZ4A 1SU5A 1SSDA 2R8WA 3E0IA 2VKZG 3KHJA 1VGAA 4NNCA 4S2CA 1TV8A 1IXQA 3O6YX 2Q3OA 4PC8A 5D2TA 5F2GA 1R46A 5DN1A 3VCRA 5F4XA 3H53A 4R33A 3M41A 3NA8A 2V5LA 1OG0A 3LV6A 1ZJIA 1L2UA 4JX5A 5EPDA 4BWLC 4NX5A 4Q33A 2V0TA 2PE4A 4MY8A 4JS3A 5LGXA 3MYOA 2H3DA 4WOQA 4NU7A 2CW6A 3PAJA 5BRBA 1WA3A 1GYNA 3HMJG 1ME9A 5HINA 2YCEA 1GOXA 1N7KA 3GIYA 2FPYA 1L9WA 3PSVA 4IMFA 4JTSA 3N19B 4H3DA 1RQHA 3C52A 5EA9A 2ZRYA 3FKRA 3RMJA 4MZ8A 1X8FA 3G18A 5TBOA 3THAA 3HGJA 5AHEA 3MHFA 3QW3A 1ME7A 1LROA 6TIMA 4NXKA 3HG4A 2VEPA 2HMCA 2VFGA 3TUUA 4Y6GA 3EXTA 4GWEA 1B4KA 2HS6A 2PURA 3IIVA 3W7NA 2Q3RA 1F6PA 1Q6RA 2ALDA 4MYAA 3TIMA 4KFPA 3NZRA 4Q4KA 2OT1A 4IPIA 3TQKA 1A50A 1RPXA 1ZALA 4HPXA 2JGYA 3C2VA 1NEYA 3AJXA 3BLIA 3G1AA 2FIQA 1SW3A 1PHWA 4BF9A 4FIRA 5D04C 3NAVA 5CZ0A 3B0UX 4WY0A 1Y0EA 1I2OA 4NJGA 3BW2A 5CPMA 1GG1A 3N9RA 4FNUA 3N14A 3I7SA 3IVUA 3THQA 3PG9A 4NQ1A 2B0MA 2ZRWA 3HJZA 5DELA 2A0NA 3G0SA 4M19A 1OFDA 1P5BA 5FI8A 4CCEA 1N8FA 4O8RA 3TV8A 3QMSA 1TV5A 4UTHA 2Y63A 4X2RA 4MLRA 5HULA 3WK3A 4N4QA 3W72A 2Q8LA 1Q6QA 2NX9A 1I2QA 1LZOA 2WSYA 1A5SA 2XN0A 5TQLA 1TTJA 3EWZA 3ABRA 4JTGA 5K9DA 2Q8ZA 3U2OA 1NF0A 3JRKA 4UR8A 2DZUA 3TAOA 3PBYA 5FESA 1ZNNA 4AAJA 2I14A 5E1QA 2P1FA 1EIXA 3B8DA 1G7UA 1OFBA 2ZZ1A 4AEOA 3ZWSA 4E2DA 4QISA 3NQ8A 4BR1A 2E68A 4WXYA 1GTHA 3STEA 2BTMA 2I1OA 1KW1A 3DZ1A 1MO0A 5DBUA 3SIZA 1DOSA 4IXXA 5LSMA 1LORA 4ORMA 4O13A 3MP3A 1F76A 1VZWA 1OFEA 1X7FA 2B7QA 1BTMA 1Q6LA 1JCJA 2QCFA 4KWWA 1R2SA 3NQ6A 2V8ZA 1JCMP 1P0NA 3DFOA 2RDUA 3QZEA 1G4SA 4FXRA 4DPPA 5C2XA 2C18A 5DCBA 5D09A 3IIZA 4LRSA 1IXPA 3Q58A 1MEWA 2NV1A 2CLIA 2VELA 2QCMA 3P8JA 4U4MA 1C29A 3TMQA 4X22A 3TU9A 3NZ1A 1FCQA 5EBUA 3KRZA 5K9XA 1WQ5A 3DI0A 1X1OA 3BO9A 3C61A 5D2VA 4UMBA 4QNWA 2V9DA 1KFBA 3LCLA 1LBFA 1K7FA 5EYWA 2X1TA 4JN6A 1V7YA 1HTIA 5DXYA 1CX9A 3W1LA 4TMCA 5G4WA 3OEXA 4N4PA 3W1NA 2CLFA 3LHVA 1NAL1 1YYAA 4HSOA 3UWZA 4UIOA 2GOUA 1SZEA 3L5AA 4O4WA 3GAYA 3HG3A 2ZA1A 1IF2A 4DBEA 3ZR4A 3VI2A 3M5XA 3C0JA 3W7KA 2YDAA 1JCYA 1TPH1 3M5YA 5HMSA 4AH7A 2GQAA 1K7XA 2WSQA 3PWAA 3G22A 2WOQA 4MZ1A 3NEVA 5HWMA 3NL2A 3QMTA 3NQMA 3LTYA 2YGYA 1K8YA 5AC7A 2ZZ5A 4L4MA 4N6FA 3M9YA 1RR2A 3W2KA 4FNQA 1EWEA 3W07A 4HSNA 5KZDA 2FJKA 3QJAA 4HNUA 4A29A 2FTPA 1OFOA 3OIXA 1LOLA 1FCUA 4MJZA 5D30A 2E77A 5HJLA 1LBMA 5L9FA 3DI1A 2V2CA 4GRSA 1VHCA 3TAKA 3C8FA 2FB3A 1PE1A 1QWGA 3NQDA 3HO8A 2XFWA 4LVGA 4UTJA 1O94A 5C5YA 4Z0JA 1LLWA 3M6YA 2Y62A 2GJLA 4MY9A 4PH6A 2NXIA 4WUIA 5DY3A 2G96A 2GQ8A 1JUBA 3TW6A 3NQGA 2YW3A 5A5WA 2FQIA 2HS8A 2Z1BA 1TPVA 4CQ9A 3LHZA 4JGDA 4S1FA 2ATSA 3GKFA 4BFAA 1XCFA 2ZZ7A 3OBKA 1OX5A 1SO5A 3CTLA 2C13A 1YTEA 4NNBA 1H7XA 3LBCA 2CLLA 4AWUA 3LGEA 1H61A 2WKJA 4O0ZA 3GAKA 5CPLA 4HNVA 2CLOA 3LRLA 4LV4A 2QAPA 3IV3A 1M7OA 2RFGA 3E02A 4UTTA 2E6YA 3G8RA 1WOAA 1LM1A 4ONVA 4FB7A 3FFSA 4IMDA 1ZAIA 3L67A 1UUMA 2HSAA 2QCGA 4IQLA 3UYCA 4ALDA 3P82A 3I6RA 1T0OA 3USBA 3W9ZA 4Z1AA 3NQCA 2NX3A 4FXSA 3EKLA 2X30A 1XFBA 3EWYA 2QCNA 2WQPA 3L5LA 1U5JA 3VKJA 3NR0A 4IMCA 4DQWA 4JTHA 3TQ0A 3ELFA 1OABA 3HGSA 3C3NA 3IEBA 2BWGA 3N2XA 4YXGA 1J4EA 4NXSA 3QF0A 1W5NA 4AHOA 3B05A 2VXNA 2XN2A 4QIUA 4DEFA 4EF8A 4XWUA 2YYTA 5HQEA 4IPJA 4JX6A 3A21A 3T44A 3V1PA 2E5CA 3KRUA 3O16A 1MEIA 4HIBA 4HN4A 3BLEA 5FEXA 3GDLA 2B7PA 1HL2A 1FDZA 4LY8A 3G0XA 4TU1A 3FOKA 3G1HA 4N6EA 4GJ1A 3S1VA 1YLVA 1XUZA 2GVJA 2Y85A 4DF1A 3GDRA 1KTCA 5CZSA 3TJXA 3TX9A 1KTBA 1GQNA 4TR9A 1BKSA 3W74A 3LLDA 3B04A 3EXSA 3UWQA 1DKWA 1QR7A 2A7NA 3TSBA 1ME8A 4O0KA 2VFFA 4CNNA 5I3FA 1OYCA 4GUJA 3NG3A 2BX7A 4O50A 4HKPA 3A23A 5U7SA 3W7DA 2QAFA 5F1UA 5AHMA 1FDJA 3TFCA 3DKLA 1B4EA 3OVPA 2R91A 3EKZA 2C16A 4QQ3A 1MEHA 4DO4A 3TKFA 1D3HA 4JNMA 1G4PA 2OJPA 3TJLA 5AYYA 2ZZ2A 3TE9A 3HPSA 5HR6A 3AO0A 4IGHA 1WYIA 4NJJA 1C9DA 3FKKA 1A5CA 3QRHA 3W1PA 3W75A 5C54A 1H1YA 1QPQA 1WDWA 5DXXA 1Q6OA 4RR4A 1T8XA 3L0GA 3UNDA 5AHNA 3ABSA 4K8EA 3UZJA 4TMBA 2QUUA 1ZCOA 3LHTA 3NQFA 1EP3A 2ZYFA 2P0OA 3SR7A 2ISWA 1JVNA 4A3UA 5AC8A 1T96A 4HPJA 3W1AA 5H2ZA 4I7VA 3W2MA 4BI7A 1D3GA 3PBVA 3LXBA 2W0UA 3E9AA 2V82A 3LOTA 4Z1BA 3W6YA 4AF0A 3S9YA 4A22A 3WJWA 3CIXA 3BV4A 2EPHA 1WV2A 5AYXA 1DL3A 4IWWA 2FDSA 2A7RA 4RK8A 3W23A 3T4CA 4UTWC 1KM6A 1W5OA 2ZFAA 1W3TA 3EX3A 3EX1A 3EEGA 2VFHA 4PEKA 1FXQA 3C2RA 4JTLA 4AWSA 3LRMA 5F4WA 1JJKA 4X3ZA 2DORA 1W5MA 3TA6A 3ABQA 1DV7A 3MI6A 1XKYA 1G4EA 3RFAA 3W3OA 4C1KA 3FJLA 4UFLA 4ZQMA 1SFJA 3E96A 3W7JA 1A5AA 2FPTA 1W1ZA 4DO5A 2WV8A 4ADTA 3DH7A 5LNVA 3NPVA 3IIPA 2QCLA 1M5WA 1QFEA 4N2YA 3W2JA 3I7QA 3W1XA 2OX1A 1EX5A 1HO4A 3W7LA 2VEMA 4O53A 2GVGA 1AL7A 2QKFA 5HNRA 1YXYA 1AG1O 4U28A 1J2WA 5K4XA 3C2EA 2IQTA 1VCGA 5CSSA 2J9XA 3WK0A 2J9YA 2ISVA 1I4NA 4GFSA 3RF9A 3EWWA 3C4UA 1KA9F 1TV7A 2TMDA 1JQXA 1O5KA 1ONRA 3GDKA 3LCIA 3M44A 3O06A 3S5NA 3LX9A 5KITA 2JKAA 1G7VA 2RDTA 4IOTA 1TQXA 1AW2A 1KBJA 3NL3A 2GPTA 4E38A 4TO8A 1TRIA 2NV2A 3PG8A 2Z0IA 3V75A 4RLIA 4JTTA 3T55A 5HUPA 4YCOA 4LOCA 1GTEA 2CFFA 1IXNA 2QCDB 5D37A 2NUYA 3NOEA 4JDBA 2KZHA 4K8HA 1KM4A 1LRQA 2EKCA 5D2WA 4FX7A 4RZ6A 2R94A 4UTMA 3A5VA 4K7VA 4WXZA 5G2IA 5CG7A 1XI3A 3GXNA 3PS7A 3IVSA 2FLIA 4O1DA 3GB6A 3M0ZA 4R7JA 5DCEA 4ZQCA 2PC4A 1FQ0A 1F2JA 4LS1A 3SSJA 4E2BA 1I2NA 2CZFA 4R34A 1H60A 2V30A 1ADOA 1FCBA 4O19A 3QQ0A 1VRDA 3CPRA 3W7GA 3G1FA 1G6CA 2C6QA 3G8EA 3BGJA 2Y89A 3K30A 1TPDA 1WX0A 3DFPA 2DZTA 4O11A 1TO3A 1TPWA 2G5WA 1DBTA 1OVDA 3LLFA 3I65A 3LCFA 2G95A 3F03K 3C2FA 3BW4A 1W54A 3WK2A 5FF2A 5FF4A 3P84A 3W2LA 4H6KA 1ICQA 1NVMA 3NL5A 2QUVA 1GVQA 1Z48A 3B06A 3R2GA 3TC7A 2C19A 3UPWA 4OT7A 2A5HA 1X6UA 4UTTC 4AMAA 5CPOA 3PBUA 1EEPA 5DLCA 3DFSA 1W3NA 4JYEA 4S2BA 1K3UA 3UQNA 2DZVA 2GQ9A 4WQ6A 1S3HA 3U6WA 1FY6A 5ABTA 4GC4A 4HHPA 2QJHA 4MFEA 5D38A 4BI6A 4NJKA 3SGZA 4NZFA 1HFBA 4RXFA 4IXHA 4FIQA 1Q45A 4UTWA 2E09A 1TSIA 1I45A 3HG2A 2QDHA 2EGZA 2QEZA 5CGQA 3RLVA 3W7RA 3BG9A 4LS2A 3FYOA 4K38A 4QNEA 4DF2A 3LI1A 3Q94A 3MYPA 1VLIA 4RJEA 1IGSA 3BLFA 3DFTA 3VFLA 2W79A 1SW7A 1DJQA 1N55A 1UCWA 5LNWA 3KX6A 1XM3A 1K8XA 4POCA 1KLYA 5I3KA 3RU6A 1KFLA 3TFXA 1PIIA 3FS2A 1LOQA 4I7UA 3G1VA 5AHLA 2NLIA 4JTUA 4ZQOA 1LOSA 1UUOA 5DY2A 2WNQA 1GVFA 4CCCA 2OCZA 1P4CA 4QSHA 3UZ5A 1H7PA 1IIHA 1RV8A 3W73A 5CSRA 3DXIA 4CNPA 3WJSA 2EHHA 4JTIA 1PL9A 4O1CA 3KVLA 3GXPA 3L65A 4AVFA 3W7EA
chains in the Genus database with same CATH superfamily
3E0VA 2PODA 1SUXA 3ZVHA 2X2GA 1VHNA 4AD3A 2IKHA 4A3QA 3S2JA 4LVDA 3U57A 3WH5A 5I2UA 1QI5A 3IUHA 5AHIA 4P8WA 1FP9A 5A8GA 4TV5A 5GVJA 1JPMA 4WSJA 1YHTA 3DFYA 3RN6A 1KFKA 4Y2WA 4H9MA 3HV8A 2VFDA 3CWHA 1PUDA 4B5TA 1HGWA 2BBFA 3LUTA 3STGA 4NRSA 5DT5A 2A2IA 2QLYA 4OE7A 2BP1A 3UXDA 1KRCC 3S1XA 3OGRA 2H9AA 3ERPA 1VFTA 1WPCA 2CIPA 1TMQA 4MAZA 1W1A1 3V18A 4GO8A 3T0DA 2VCAA 3VIFA 1Z32X 3KDNA 5AZ1A 3N6JA 3OGSA 3ARPA 3NM3A 3GTFA 2TPSA 4PB4A 2AMXA 1VH7A 4D2JA 1U22A 3Q4DA 3C2OA 4RCXA 3EX2A 1EQCA 2EPOA 1M7PA 3GYEA 3EDJA 4O14A 2B81A 2HNEA 3BICA 4ZVJA 2EPKX 2OFJA 3HB9A 3BG5A 4DUVA 2ZE0A 1SJDA 3HV9A 4M6VA 1WBHA 5FKYA 1KC7A 1OZMA 4GX9A 5REQA 1OC6A 3B8SA 3B9NA 3NZGA 2IPWA 1P43A 4AIEA 1GYLA 3JW7A 3MB9A 3GDTA 1RZMA 4GI8A 3UESA 3EAUA 5EL1A 3BANA 4PUMA 3F2DA 1XINA 4LAKA 3T0BA 2ZRUA 2ZUVA 2G3NA 4QFUA 4UWMA 2WO5A 1BSIA 1IEQA 4DX3A 3SADA 3BL3A 3BPWA 4URIA 2ZRVA 4L64A 4LSBA 1BHGA 4JAWA 2XJ7A 3UG3A 1JNDA 1Q85A 5G2WA 2F2HA 4WGXA 4MNMA 4HP5A 2WSPA 4L4LA 3H54A 3RPDA 4JY8A 3MO7A 1OCNA 1SM9A 4CEUC 3VVGA 2Y70A 3G0UA 3CQHA 1K77A 2J8GA 4X63A 2OMAA 1W9VA 2EXOA 4HNTA 4YNGA 3L2IA 3CHVA 2CLHA 3NNTA 1KXHA 3V0SA 1SR9A 1MNZA 2G4FA 2X42A 1V51A 7TIMA 3B0PA 2OVLA 1QK2A 1QK0A 4H9TA 1GWJA 3UZWA 4BI5A 5E93A 1UC5A 4G8TA 1LJYA 5I3JA 4MUZA 3QV6A 5FSDC 4Y96A 2NQ9A 4UOQA 5HWJA 4HTYA 5IFPA 3URAA 3A4AA 2IQ0A 4L56A 3AYTA 1VCFA 2C7FA 3ITOA 1XUUA 1CT5A 2GJNA 1JDFA 2QIIA 1REQB 3FA5A 4MYXA 2MUCA 4UFJA 3GNDA 3U4AA 3STFA 4L9ZA 1BXNA 2YL9A 1JPDX 2CWXA 1VJIA 1D2KA 3UG4A 2E5BA 3R13A 3ES7A 3P3BA 4HSHA 3LNMA 4ZO6A 1P48A 1AFSA 4Z0SA 1F4HA 1JCXA 3W00A 4C6QA 3LI0A 3SUWA 4EF9A 2TYSA 4DUOA 2A6LA 4XBSA 3AXMA 4YHGA 3L68A 4MNJA 1J11A 5GJNA 2W5FA 5FEZA 3ZR6A 2DVXA 4DJFC 1O1ZA 3LY0A 4OOZA 3RK8A 2VCCA 1ZAJA 5A6KA 5U4NA 2F38A 1VFHA 2DIJA 4O54A 4QQUA 3JR2A 4KETA 4FOKA 2O92A 2PBOA 4MJ4A 2CHOA 4US6A 4UTUA 2YZRA 1LUCB 3ITVA 4D6CA 3BTNA 3ZS4A 2O7SA 3R1ZA 1CWYA 2DZBA 3GDMA 1MSSA 1FKXA 1OHLA 3KOYA 1P1XA 3B8UA 1LLZA 1V3JA 2JKPA 1SZNA 4R53A 4D9PA 1BGAA 3VKAA 2DFAA 3CWOX 3MHGA 2PDLA 1QOXA 1NDYA 4HNCA 4MADA 4YWIA 1FXPA 5E0KA 3QLLA 2DJXA 1VKFA 2VX5A 2I5GA 1ZENA 3HN3A 3QN3A 2J27A 2R9RA 3G1RA 5B7ZA 5G4HC 5G1YA 3DHDA 3DAQA 2QCHA 4QLLA 4ZSTA 2EAWA 3ZLGA 2PWGA 3SQMA 2YW4A 3LYEA 3BK0A 2YOCA 3TXZA 1G9HA 3UNTA 4AIOA 4DJFD 4M8UA 4YVXA 4GH1A 1DWGM 1HJSA 5AVNA 3PM6A 4KRTA 3J7HA 4K7YA 3BV7A 1VENA 1YADA 4WDXA 1Q4NX 4PUNA 5BMXA 2A85A 1E1FA 4IFKB 4QRNA 1Z41A 4Y9MA 3W1QA 5IFTA 3I3EA 4LW7A 4B15A 4JKKA 5GNXA 4JY9A 4Q8TA 5I6SA 3F4NA 1UPPA 4O4VA 1POKA 3SRFA 4JYDA 3VFCA 1UWSA 2C0AA 1GYMA 1UB3A 4AFYA 3WDRA 2XVGA 4YYCA 1W6TA 2YX0A 2DT0A 5BU9A 3ALGA 4J35A 1AD4A 4A35A 3K4DA 3PANA 1EQPA 3W1RA 1TRDA 3WL1A 1O5RA 1M41A 3LB0A 4ML9A 2YXXA 3L5MA 1XLFA 3STCA 1XDMA 2YR1A 3CT7A 1ITCA 4Q32A 3GNRA 1R87A 4N42A 4GLEA 1U33A 4M6PA 2B4GA 4M3PA 5LA1A 3GTHA 4UOZA 1ONXA 2ZADA 3GH7A 3W84A 4E3VA 2XGIA 3VOCA 3POHA 3W88A 5CPNA 5D2YA 3N9SA 3UFYA 4X9SA 2GOKA 3MI3A 4XAFA 4NASA 5I3DA 4LVFA 1TA3B 3AIUA 2V81A 4L6OA 4GI6A 1AZ1A 4K1GA 4P8XA 5LHEA 3BCFA 3OHMB 4AU0A 3SUUA 4XD3A 3MJYA 2PDPA 4F79A 4Q4QA 1Q6FA 1G4TA 3A24A 3G1SA 3S1UA 1ONWA 2IW0A 5I5RA 1ZLPA 2G0WA 1XLGA 2W3ZA 3FX4A 3SBFA 1ZY9A 1B54A 3LNPA 3OBAA 2H90A 1A5NC 2VD8A 4GZIA 2P10A 1E43A 4IMEA 3BAIA 3B03A 2ZVIA 3HPXA 2JK2A 3I3BA 3PHAA 3BARA 5DX7A 1VFOA 2PWFA 2ACSA 1RY8A 1LTDA 1UH2A 4RE3A 2CEQA 1EF2A 1KLZA 3WQDA 5AZ0A 4D6IA 3A3XA 4OGZA 3GVQA 3ISIX 3AWNA 3VIHA 5M2FX 2CNCA 3EGJA 3DBPA 1CIUA 2BY2A 1RCQA 1P0KA 3HF3A 4P8UA 2DSKA 3BAJA 3LCHA 1TIMA 2ZA2A 5CLWA 2PDGA 3ANYA 1X97A 3QFEA 3EA2A 1WDDA 3OJGA 4U31A 3KP0A 1B5TA 1H0IA 3QMRA 1LP6A 3W87A 2WZMA 3PZMA 1F3EA 2QUTA 4JPGA 4MB5A 1TX2A 3B0VC 1BRLA 4DZAA 4RL3A 3CHEA 2RJHA 3TNBA 1E1CA 4GY0A 2QVHA 5LXEA 3KCOA 5H1WA 3AIQA 4GNVA 2OGJA 3I68A 4PFMA 2BS9A 3IGXA 3UA4A 3RPMA 1V0NA 1UZHA 4IP7A 4BKNA 2HPIA 2A3CA 2FFCA 1XBZA 3E0WA 3MV11 1RY0A 1E5JA 2XIBA 2BNJA 1F5ZA 3CYJA 1R9XA 4A3HA 3E6EA 1NARA 1OT2A 2ZRZA 4TVCA 3O15A 1F7BA 1F9CA 3CH9A 4IHCA 2WJEA 2Z4GA 2VYOA 5IBXC 4LVAA 4IFOA 2WJFA 1ISYA 4H6EA 2OELA 5AECA 4HHHA 4IPPA 3WL0A 2VRJA 3RJYA 4JNYA 3CUGA 1B3OA 1UH3A 1W3LA 5LYRA 3WFZA 2E5DA 3LHYA 1QCWA 4MLJA 5F2MA 1I1WA 4HZ6A 3VA8A 4FNPA 1QNRA 3EA3A 1V3MA 2E4TA 1TV2A 3KHDA 4ZOCA 1Y5WA 4O17A 1I8JA 2X1SA 3U2CA 4F0RA 5I07A 4NNAA 3DBNA 1YTDA 3RAOA 1GW9A 3GS6A 1K4HA 3GHRA 4XKYA 4GUHA 6ENLA 2XINA 3ZJ7A 4C6IA 3MKCA 2ICSA 3UWYA 4ZQNA 1QPOA 4FLOA 4NAFA 2DJLA 4TTGA 1W2PA 1W8SA 1BVZA 2W6RA 1GVRA 3BLPX 2XTKA 3EOLA 4K6AA 2YSWA 1TG7A 2ZBTA 4JTAA 4CN4A 1JNEA 3L4YA 4NVTA 3T7VA 1Q2RA 4AX7A 3UGRA 1B1YA 2AAMA 4GXWA 4F9JA 4OJYA 1IZJA 2VD9A 4L9XA 5D03A 3CB8A 2FHCA 4KPLA 1RH9A 3UCQA 3ATYA 3SFKA 3NURA 1EA0A 3F5JA 2E8ZA 2ESCA 4XUGA 3LCWA 3WLMA 3G1DA 5CBBA 3R94A 1GVEA 2WZIA 3TQPA 1M04A 2OZTA 4IIDA 3O0KA 2DGAA 2V3DA 2PAJA 3CQKA 4RV8A 3GNXA 4UTIA 3K1DA 3R10A 4AHPA 5A94A 1DJZA 2UY2A 5J5RA 1OFAA 2HE5A 4GBUA 5BRQA 3SY5A 2VTFA 3R25A 2D73A 1AQMA 1GZ1A 2PGEA 4R7OA 3SCNA 2VFEA 2PZ0A 3WBWA 3D47A 5C7VA 5LKYA 1UJQA 2HWGA 1MNSA 3SRHA 2WAGA 5M5DA 3B8VA 2HTMA 2YCLB 1S5MA 3UXAA 4PTDA 1SO3A 2RDWA 4PMDA 4AZ6A 4E0CA 2CZ5A 2G8ZA 1LL6A 3VNKA 1C8YA 2VGFA 2BHZA 2X7VA 1F8IA 1FH9A 2E1WA 3RM8A 4UTKA 3O05A 3KXQA 1V3HA 1HJWA 5TD4A 1J12A 4F40A 3QC0A 4AQLA 4DO6A 1O6IA 2DUXA 4E8DA 3VOJA 1W0MA 3MMDA 3MHUA 3WQ6A 5FJRA 4HCDA 1YPIA 1BWKA 5JBEA 3WJYA 4ICNA 5RUBA 1ECQA 1A5UA 3LERA 1NU5A 5T26A 4RZ5A 1TJ2A 3LXCA 2A21A 3T2OA 4RKAA 1DORA 2Z28A 1MWOA 1Q4WA 3ZJKA 4JIPA 2PCQA 3VM7A 2Z26A 3ZFHA 3HURA 3UGVA 4UXDA 4H83A 3AMKA 3A3HA 5FD0A 1HXJA 3E49A 5IDIA 2DW6A 1DE6A 1PPIA 4LQ1A 4C6JA 2DT2A 3MKVA 4XK2A 1KCKA 4ERIA 3KFTA 2AGKA 3QVQA 1R0MA 2ZZ3A 2QDGA 3P74A 1Q6DA 4Q4RA 3DENA 4ZCWA 1R2TA 4LCSA 1HQTA 1Z42A 5LZLA 3NQ7A 1SJAA 3F4DA 1B3YA 1KTNA 3AHYA 2XVNA 1Z7AA 3P5ZA 4UCFA 3S1WA 4IQEA 1HJXA 4M7TA 3QH2A 4O10A 4RZ4A 1SU5A 4MWAA 1VPQA 4DJDA 4KGJA 2BY1A 1QRQA 1UKTA 4ZEPA 1E9IA 1ZBWA 1TV4A 4TX8A 4JX5A 3VC5A 1QW7A 1FVPA 3WQCA 2RDXA 3FN9A 4GXPA 4ZBCA 3PAJA 4FF5A 4P7RA 1GYNA 2OR2A 4PRTA 1N7KA 3VIOA 4JFWA 5ABFB 2XU2A 4H3DA 1KCZA 5EA9A 1VBHA 1S39A 2ACRA 3HGJA 4HGXA 4S3EA 5A8MA 3ONBA 5G1MA 3QW3A 5I77A 4NXKA 3HG4A 2VEPA 2HMCA 3VDBA 2OKOA 1XCWA 4Y6GA 3EXTA 4GWEA 5KZ6A 4IJRA 4PMYA 1EGZA 2PURA 3WELA 1B0IA 3PPHA 4GY1A 4F66A 2ALDA 3MCMA 4MYAA 1POJA 4KFPA 4Q4KA 2OT1A 4CN1A 4KCTA 2X8RA 3H4XA 3TQKA 4S3AA 2PDYA 1A50A 4KRUA 4B5WA 4ZXOA 3Q45A 1GHSA 2YJQA 2JGYA 3C2VA 1GZJA 4IGSA 2CZVA 3NAVA 3RX4A 4MPKA 4C7FA 3B0UX 1Y0EA 1EBHA 4J40A 1I2OA 4NJGA 2HISA 1UP0A 3I7SA 3IVUA 3THQA 3PG9A 2B0MA 2DT1A 1IZKA 5DELA 1ZBVA 1OFDA 3FGCA 1N8FA 3TV8A 3DYPA 3VDCA 4CCZA 4AY7A 2Y63A 1ADSA 4A3RA 3WK3A 2OWXA 1Q6QA 4RW5A 2XGBA 4WSKA 4GYPA 1TTJA 1MQQA 3ARTA 4AZCA 1NY1A 5FESA 1CXLA 1IZCA 1GJUA 2I14A 4XD4A 1EIXA 2ZZ1A 3NSMA 2B31A 4E2DA 4IJCA 1W32A 4WXYA 2FMNA 4Q7NA 1EA9C 4Y8EA 4EAMA 1DOSA 2PDKA 5LSMA 1OFEA 1JDEA 2NT0A 3K8KA 1BTMA 2V8ZA 1P0NA 2RDUA 4PB3A 1G4SA 4DPPA 5C2XA 4CU6A 5JBDA 5DCBA 5XINA 1IXPA 2NV1A 3W6MA 3WQOA 4BEUA 1FHVA 3CBWA 1MDLA 3RR4A 3KCLA 3TU9A 4GVFA 5K9XA 1HKIA 3ES8A 3HQPA 2H9AB 2O4MA 2VX4A 3KBJA 2V9DA 4S23A 1OBAA 3PP7A 1V77A 4J3WA 4R9OA 1P0EA 3CZLA 1HJUA 3W1LA 1RVKA 1ODZA 2CLFA 4W8BA 4HSOA 5PTDA 3OA5A 1SZEA 3FK4A 3BJSA 2D2HA 3OLIA 2PDFA 4H7CA 3C0JA 3CB3A 1E4MM 2D0GA 5HMSA 2NVCA 3M5YA 4AH7A 3ZSTA 1FWIC 2Z25A 2BOFX 3MVTA 3VDHA 3WG6A 2WMGA 2WOQA 4MZ1A 5HWMA 3UJ2A 4C6EA 4O1FA 5REQB 3SB0A 4UQDA 1DTUA 5C9WA 2JEPA 2FGBA 3BURA 1FHUA 3W2KA 4FNQA 3W07A 1ESWA 3BZJA 3MVIA 4F2UA 1TR1A 2FJKA 4XVDA 1HF6A 4EPEC 3QJAA 1S1RA 2VR2A 2R6OA 4LPCA 4OFCA 3DUGA 4MJZA 1LBMA 4GRSA 1MVYA 1PE1A 5AKQA 5JH2A 3K8MA 3HO8A 4UTJA 3CT2A 4X0NA 1Q7MA 1LLWA 4W4QA 1ECEA 4PUJA 4CU8A 4BFAA 1OX5A 3CASA 3GC4A 3CTLA 2PTZA 5CC5A 4NNBA 4WVXA 4XZHA 3A3WA 6PTDA 3LBCA 1UKOA 2PU0A 3TP4A 2QAPA 3IV3A 1DTNA 2RFGA 2PGFA 3UCDA 3E02A 3V5OA 4B5UA 4C6LA 2ZXDA 3W29A 1H1NA 4MWAC 4DJDC 1EOKA 3RX2A 3IRSA 1UUMA 4JIHA 1SJBA 4ALDA 1V4YA 1A4MA 1E0WA 1W9BM 2MANA 2DSZA 3AFBA 4ATLA 1VIZA 2VQUA 4I9TA 1MFVA 2WVVA 1PAMA 3SQSA 2L5HA 5EMMA 1PZ0A 1LG2A 3OBEA 5CPSA 4K68A 4NXSA 2DW7A 3OW1A 4NKCA 4AHOA 4W84A 3WD2A 2ZX6A 4G5DA 3ARUA 1O5QA 3WNNA 3T44A 3O16A 1HKVA 3KWXA 1FHDA 1GQIA 3WH6A 2JFEX 1JCTA 3DC0A 3G1HA 3L4XA 4LH8A 1XIJA 1J9YA 3T4WA 4GJ1A 2OODA 1XUZA 2PU1A 3GTNA 2Y2WA 4P8VA 3GDRA 1KTBA 1UZDA 4OECA 3N2OA 4TR9A 4KH2A 4HYWA 4ROPA 5A2CA 1XX1A 3W74A 3LLDA 5T8GA 3B04A 2DT3A 1N8WA 1NWRA 1QR7A 2A7NA 1ME8A 3WDJA 3RLGA 2E8YA 3I4EA 4DAIA 4GUJA 3LPPA 2QV4A 1GOWA 1C7TA 4X9YA 4I6KA 4DI9A 5U7SA 2WWCA 5FJJA 3HPFA 2CXEA 3DKLA 4JFVA 3EKZA 4JTCA 1CGVA 1Q8AA 3PZTA 1D3HA 1G4PA 4D8AA 4E3TA 2QYGA 3HPSA 3UJRA 4IGHA 1DIKA 1W9XA 4NJJA 4OTKA 3ZT5A 1C9DA 3ALFA 3W75A 3QFWA 5JVLA 4FLQA 5AHNA 2OSYA 3UZJA 2DH2A 4DWSB 3NQFA 3WF1A 2ZYFA 2P0OA 3SR7A 4F8XA 1CNVA 3W1AA 3AROA 4JZ5A 3ITTA 5JIWA 2Y8KA 2F6XA 2OGYA 3NYDA 3N25A 2Q6ZA 4Z1BA 3W0KA 4GYFA 3NEHA 4M24A 4A22A 1AJ0A 1ITUA 1I75A 3BV4A 1BXBA 1WV2A 5A6BD 1DL3A 3D5HA 1VEMA 2A7RA 3LBOA 3T4CA 3NXLA 2CERA 4D6EA 3AJ7A 3RR1A 3EEGA 2VFHA 1PZ1A 4GACA 4N7QA 1FXQA 4JKMA 3VILA 1OWQA 3WSUA 5F4WA 2PPGA 4X3ZA 3TA6A 4AVOA 4PUDA 4XAGA 5T91A 3W3OA 5GJMA 1JL8A 4UQCA 3DN5A 2OXNA 1JZ5A 1PX8A 4YTTA 3MCOA 1XIFA 3E96A 1A5AA 4KBXA 3WLQA 3GC2A 5LNVA 3IIPA 4Q22A 2WB5A 1R3RA 2OYMA 1GGOA 4N2YA 3ZXWA 4OBRA 2WBGA 1YNYA 3ABXA 2GVGA 4J27A 2P0IA 4P7OA 1YXYA 4YVVA 1AG1O 4NZ1A 1GOQA 2IQTA 1VCGA 4GIRA 1JF6A 2J9YA 1I4NA 4GFSA 4AX6A 2C91A 3EWWA 7REQA 3GU9A 1O5KA 4HCLA 2DSWA 1S46A 5JBFA 2AQOA 4PN2A 1A3HA 3W38A 1W2VA 1AW2A 4M1RA 3CV1A 4E38A 4QJ3B 4S39A 2NSOA 2VX6A 5HANA 3PG8A 2QZRA 1WKEA 1FH7A 1K70A 3R0KA 3T55A 1GTEA 1PO9A 4FI4A 5D37A 1GK8A 4JDBA 3WD4A 4MGGA 2AMGA 3N12A 2QMKA 3IV8A 2O9RA 4E5TA 3A5VA 4K7VA 4WXZA 3WUFA 5G2IA 4B5VA 2J79A 5CG7A 4GGHA 1NTHA 4AEEA 4U2YA 2YL5A 3RX3A 1XRFA 3IVSA 4GA8A 2FLIA 4O1DA 1IWBA 5ABEA 4AC1X 1F2JA 4LS1A 4PGLA 2V30A 4XV0A 3K30A 2WBKA 1PTGA 4XSMA 1TO3A 1TPWA 1OVDA 3LLFA 4GJJA 2G95A 3LCFA 3F03K 3PAOA 1W1B1 4ZXLA 3PTDA 3W2LA 1ICQA 1NVMA 3NL5A 2QUVA 2CPUA 3PNUA 2Z1VA 1Z48A 3VAVA 3N17A 4CNSA 1F6YA 4OT7A 2A5HA 3UXIA 1X6UA 4LALA 3WFLA 1R9ZA 4MKVA 3NDYA 2DH3A 4S2BA 2P50A 2FVKA 1YE6A 3BLDA 3GIPA 2GQ9A 4WQ6A 1DIDA 4GC4A 4HHPA 2QJHA 2VMFA 2F61A 4FOJA 3RLHA 3UW6A 5D38A 3UVIA 4BI6A 2EKGA 1B3XA 4WEVX 3SGZA 1JD7A 1TE1A 3SRKA 1N82A 3VKCA 2Z24A 5CAKA 1ODUA 1VBUA 5C9XA 3ORWA 1WKDA 4MF4A 4UTWA 1P1MA 1TSIA 3GFXA 2AOSA 2VDHA 1AH0A 1T6MA 3BG9A 3FYOA 1HNYA 1Q6CA 1BRLB 2JIWA 5A95A 1PKMA 1IGSA 1E1CB 3VFLA 2HBVA 2W79A 1DJQA 3VMOA 4ZE4A 4C6DA 5LNWA 3AZRA 4Q8NA 3M46A 1LOQA 3G1VA 2NLIA 5DY2A 4CCCA 1JEZA 3ARWA 4QSHA 3N11A 1Q5MA 1F07A 1H7PA 1UZ1A 1IIHA 5CSRA 4MNKA 4FAMA 3VM5A 3GXPA 1KQYA 3W7EA 3QPYA 4NJIA 3M16A 5BU6A 3A22A 3W82A 3ITGA 3HBLA 1XF0A 3TSDA 5BRPA 4WX2A 1Q13A 7CGTA 2VVNA 2BDQA 1C90A 3M0HA 3VUPA 2YPIA 4PUKA 2R1KA 5FA5A 3AI0A 4GX8A 1PWLA 3B3DA 3IAPA 4UUIA 4GOAA 4GJIA 1DHPA 2NUWA 5EMJA 2ZA3A 1YDOA 2WM1A 4H8VA 2FHBA 4Y90A 2ZZ4A 1L6YA 3BOFA 3SCTA 2POTA 2WHMA 3OOQA 5CPQA 1XDLA 3CMGA 1QI4A 2G41A 1I9CB 1TTIA 4U5KA 1RA5A 2OQHA 4H7VA 4EVZA 1S2UA 3SJ3A 2GJXA 1UYQA 2V38A 5CZJA 1X1NA 4UC5A 4E4FA 3E2QA 3S6OA 1H7WA 4PTNA 4XKYB 4IX2A 4CD6A 3SIMA 2A7PA 2ZC1A 1KBIA 1HO1A 5HNNA 3PUEA 2R24A 3PWIA 1M68A 2CLMA 3M5ZA 6XIAA 2H8ZA 2GGIA 4KEVA 5KINA 1E71M 4A8LA 1JPKA 3A9BA 3V0TA 3NPWA 2XVKA 3W4RA 2WNZA 3TOYA 1IGWA 1IWAA 3UJSA 4GCAA 2QF7A 1NOUA 2E9BA 3GXTA 1GKRA 2XVLA 1PTAA 1QOQA 1XYBA 4KT2A 3MC5A 2I57A 1H63A 1OG6A 5FAJA 3UCCA 2V3GA 2QGYA 1BD0A 4CQ8A 3BAYA 1GUVA 4LS0A 1GQJA 1QNVA 2ZTJA 3H4GA 1L0PA 3NGFA 3TROA 5A6LA 3P8IA 3LGGA 9CGTA 1CGYA 4GKLA 1G94A 4PBGA 5HXMA 4LANA 2FMOA 2V5CA 4ZQRA 3W76A 1F05A 2E6AA 2XSBA 5MHBA 1J6PA 5C6MA 5GJPA 4DAFA 1VBRA 3WDQA 5FOOA 3PB2A 5I09A 3VIIA 1C9WA 2IKJA 3VD4A 4ZQPA 1KV5A 3C86A 3A6OA 3QY6A 3GFYA 5AOUA 1OX4B 4AB4A 1VYSX 4GINA 1XIIA 5KZEA 5BXPA 3E1F1 3Q67A 4E2VA 1FWTA 3TW9A 4RE4A 1FWJC 4DELA 1T99A 2VEKA 2V5JA 3V16A 1JGIA 3HOJA 1G1YA 5D2XA 2J47A 9RUBA 3WLHA 1E0TA 1FBAA 1KO0A 2EF9A 3R8GA 2ZUWA 4ACYA 5TAOA 3TC3A 1B9ZA 3CQIA 1UWQA 4LNCA 3Q37A 5CC7A 1TZZA 5FEWA 2PDBA 1VBJA 1GEQA 3G6LA 4F4RA 3W02A 4QITA 4ZE5A 1EIBA 2PB1A 1WUFA 4C60A 4E4UA 3P0WA 1BG4A 3QM3A 3GUGA 3N2MA 4HHMA 5LGZA 3RXZA 5C7HA 5A8NA 3EB2A 2HJPA 8XIAA 3GLCA 3UG5A 3F4WA 1S3TC 4UFHA 1NM9A 1GZGA 2A4AA 1CXEA 3EDEA 2C0HA 4WGHA 3H23A 2OT0A 4RX0A 1H62A 2BGNE 1W3IA 2WNWA 4Q8UA 3BAKA 4DXVA 3W85A 4ZL1A 5IXEA 1JFHA 1Q66A 4B4HA 2VM8A 3UYIA 2G97A 3WX7A 2V5KA 3DFNA 2Z6IA 2C1IA 2QULA 3UD6A 3M64A 3GNPA 1YDYA 4XTIA 3RNDA 5FAGA 3NVTA 3VIKA 2OO0A 3ICJA 3S5OA 4HNNA 1AQFA 4ES4A 3NO5A 1QMLA 1A5OC 4GYKA 5CPTA 3LS9A 3N18A 4JCLA 3P7YA 2VQTA 3LQLA 4MWAB 2A3BA 1ZFJA 3EWDA 5CKSA 5D8ZA 4OZOA 5FEPA 1DJNA 1HG3A 1UR0A 4YU1A 1W17A 1I6NA 1DIOA 5G1TA 1C8QA 2W61A 1L6FA 1UA3A 4UOJA 2GDQA 2I5QA 4C90A 1CTNA 4DJEC 3VOIA 2PEVA 1UD3A 1ZRQA 4KMQA 1ZTVA 3FHQA 2W63A 2DQXA 1VP5A 1OY0A 2DZSA 2QCEA 5L6UA 5D33A 4PCFA 1VJSA 1OCQA 1SYTA 1B90A 3CHDA 3H21A 4JTKA 1SFSA 1XH1A 3P6LA 1Z69A 2XH4A 4YYFA 1L8PA 4PCNA 3CWNA 4DI8A 3MP5A 1W9PA 3GDBA 7TAAA 5AYZA 3FW6A 1EDTA 1RBLA 2V69A 4Z1DA 4DZIA 3S2LA 4ZOBA 1GJWA 4LF2A 2VWSA 3AS3A 3UY7A 4FOUA 3P60A 1HL9A 1KXVA 1PS9A 2IKIA 3RLUA 3HIJA 4P2VA 3IRDA 2H8XA 1XLBA 4V27A 3QV9A 1QWKA 5ECVA 5D4YA 2CKSA 3P93A 4LYPA 2V5BA 1RUSA 1WE5A 2X05A 3GW0A 1XIBA 3AUJA 4GG9A 3VZXA 4XISA 5M1TA 3H2OA 1CI1A 2D2OA 4CEXC 1W5QA 2PDIA 3UWUA 2YKKA 3FVDA 4Q8PA 3B4UA 3VNMA 2D3NA 3SY8A 4DJED 1UD5A 3PJUA 4YTSA 4DNMA 3UG8A 2ZX9A 1CXFA 2ATMA 3FGCB 4PTXA 4GIEA 4IFKA 4WY0F 3STPA 1RJRA 4EKJA 2HE8A 3WMLA 5XIAA 4QJ5B 1CLXA 4MWAE 3TC6A 1HJVA 2ZX7A 3H4WA 3S5YA 5TIMA 2VI0A 4AZCB 1VQTA 2HVMA 1ZQ5A 4JICA 5CJ5A 3W86A 4DF0A 3THDA 2D20A 4L1XA 2PGRA 2D24A 4V33A 4DLMA 3O7UA 1Q7ZA 1FWNA 2DP3A 1E73M 5F7UA 4CKQA 1E56A 3TYUA 1UR9A 4FZIA 2NV9A 1WDRA 2QF8A 3T40A 5ENLA 4Q8QA 2Y7DA 2HV5A 3R79A 2BOGX 4WDWA 2IS7A 2OG9A 3CQ0A 2OSWA 3EMQA 3A4WA 3P81A 4J7RA 1EYEA 3W7IA 4UFKA 4LU0A 3OYXA 1TPB1 2A1YA 1DJXA 1WXYA 4LYKA 1FA2A 5AC4A 1F61A 2VRQA 3AISA 3B4YA 1RK5A 3O07A 1K9DA 3CAWA 4XZWA 1SZFA 3NIYA 3EXRA 1H5VA 3BMWA 1CB7B 2R14A 4ADUA 3H7VA 4AC7C 3VKBA 4Q6JA 1LDCA 3B9OA 1SZGA 5CBIA 5G2HA 1X1ZA 2G3JA 6ALDA 1ISWA 4QBXA 4QM1A 1FWDC 4O57A 1ICSA 5FCZA 4XSLA 4GC3A 3SECA 1AK5A 3LSCA 4ADSA 2NXHA 4GUIA 2I9EA 2ZXBA 2TRSA 3UWWA 3GQYA 4MY1A 4M7SA 4YTQA 3BAXA 1G5AA 1UD8A 4V1XA 3AIWA 4AD2A 1EUAA 2A6NA 3LDVA 3EWBX 4HT3A 3W71A 1H7RA 3TQVA 5BW6A 1AQHA 1WXJA 2B7NA 4NT0A 1EH9A 4O18A 3WMSA 3QPZA 4AZHA 2ZUNA 4GUGA 2PDWA 4WD0A 5A6AA 1F74A 2E6FA 5HMFA 3TA9A 4W89A 1GQKA 1J5TA 1QPRA 4RNHA 2CZDA 5HMEA 3WF0A 3AMCA 1JRBA 2O55A 4RW3A 3A4JA 1ZJBA 5BOOA 3ZT6A 3YPIA 2I7GA 4GQ0A 4PULA 4M29A 3GG0A 4MIMA 1UPMB 2J7GA 5HQMA 5EMUA 1EZ2A 5AY7A 1S2TA 1HKKA 2G4JA 1E0VA 4Y7EA 3TN3A 1K1DA 5I78A 3FSUA 1F73A 2WCSA 2E1DA 1YPFA 1XYLA 2ANUA 3LTSA 3ZQ9A 3XINA 4JHMA 2OYLA 4UFIA 2XIOA 4AWTA 3PN8A 1EC7A 1H7NA 3VZYA 3NDOA 4I8YA 1KGWA 1W1PA 1PWMA 3AXIA 4TX9A 2ABAA 1QXLA 3EPMA 2EG7A 4DLFA 2J75A 4KFNA 4FX8A 1XH2A 1IQ8A 3SAZA 1I1XA 1TFVA 1BGGA 2WVVB 2P88A 3E5BA 4UMAA 2Z6JA 3U2ZA 4I6VA 4A8IA 1V3LA 2OZ0A 5DANA 1OB0A 3CUJA 1V6WA 2EPMX 4HMDA 3SCVA 3S6DA 2JKEA 4AZGA 4QE5A 4MJMA 1R3QA 4XD6A 3S5ZA 1QBAA 2IPJA 2X09A 5C71A 1C8VA 2ACUA 1XLCA 1Q2SA 3SCPA 3TLQA 4HU8A 3ZLFA 2HNHA 3O8AA 2Z7KA 3L2LA 5D9NA 3KBMA 2NX1A 1FFRA 4MPQA 3VIJA 3NQ2A 4K1WA 1CDGA 3PBMA 4NUWA 3LENA 3BMVA 2YB4A 4ORIA 1QOPA 1HKMA 1ZS2A 3SZ8A 1EYWA 2J6XA 3CHFA 2O9TA 1UASA 4Y8FA 3F2CA 3BC9A 3LZ3A 4L1WA 3AMGA 4C6FA 4OIFA 3C8NA 1DYSA 4NF7A 4YTUA 4LFYA 4IUOA 2E9LA 4YTRA 3OZPA 2ZQ0A 3GR4A 3GC5A 1DJYA 3QW4B 1NP0A 2ZUMA 4WKAA 2XDFA 4FHAA 2IMRA 1O4UA 1E9ZB 4GUFA 1OYBA 3NO1A 1CXHA 3MUAA 3KVJA 5C70A 1GKPA 4H19A 4UCGA 2V2HA 1WDSA 4BQ5A 1V93A 3KL0A 2WHJA 5E9XA 1WB0A 5FF7A 3C0LA 4B2DA 1Q6GA 4PFHA 3C0QA 2OQLA 1EF3A 1JUEA 1TPC1 3TTSA 5EKYA 1XLKA 3KEHA 1C8XA 4H9UA 5HPOA 1ZAHA 4JTQA 2Y7FA 3INPA 3DGBA 4W88A 4OV4A 4WDUA 1JDCA 3CU2A 3IGUA 1IIGA 1OADA 3G3MA 1NFPA 1XPYA 1RCOB 3CUIA 3QBUA 1CGUA 2J13A 4DZHA 4XO7A 4J4KA 2GDVA 1K03A 4QEHA 5JQ9A 1KM5A 2B7OA 5HBFA 2PRMA 3TEVA 2YIHA 3JVAA 3SW6A 1B3WA 2LLEA 3EB4A 2CYGA 3GXFA 4JTFA 3BGAA 4B3ZA 4O16A 1CGTA 3M0VA 3B40A 1PVNA 2HZGA 1IXOA 1X96A 2CU0A 4MUPA 3M43A 3CM4A 4GKTA 3OU8A 2DZAA 1Q6EA 2VR4A 4P7NA 1XG3A 3QGVA 4G7FA 4PMUA 3ITCA 5GQBA 3E2RA 4NAEA 3WLSA 5CCZA 4Z2JA 1J79A 3H2CA 1JZ3A 3QQWA 3OIHA 2WZEA 2YB1A 1JRCA 1EP1A 3VUSA 7REQB 4C5YA 3MSRA 4DYKA 4CD4A 1S5VA 1VIWA 4JD4A 1S2AA 5BWFA 3PUOA 4KW2A 3IVTA 2GSJA 1I0DA 3LN3A 4O1BA 4CLMA 1E15A 1SQ7A 5FJUA 1JYXA 1M65A 2ZRXA 3MWAA 1XIEA 2GVLA 1XRVA 4B3KA 1F6KA 3VYLA 1KR0A 2G50A 5AHFA 3CUHA 3M0YA 4YHEA 1CXKA 1CGWA 3E0IA 4MMWA 1P0DA 3KHJA 1PX4A 1IXQA 1BQGA 2J7FA 4GBDA 1UR8A 1A5LC 4GPNA 5DN1A 3VCRA 3T07A 5F4XA 4PUEA 4R33A 1MMFA 3GG8A 3T81A 3LV6A 1ZJIA 4F0HA 3W24A 5EPDA 4KCWA 4Q33A 2PE4A 4JS3A 4WOQA 4NI3A 1XC6A 2ONEA 2EG8A 3CZEA 1WA3A 3BXWA 5CC6A 3WQWA 1ME9A 5HINA 5CC3A 2YCEA 3GZAA 4RPQA 1GOXA 1JDDA 2DPEA 3UF9A 5C9RA 1GCYA 2XIIA 1L9WA 3PSVA 5E9AA 2XG9A 3WBXA 4O0QA 3URBA 3O9NA 3GO2A 3THAA 1GPFA 2RGLA 4GQRA 3MHFA 1J93A 2OEMA 1GVYA 4FS9A 2EO7A 1ZB5A 4WJ8A 4GQQA 5LXXA 3WUGA 2VFGA 1DJWA 2POZA 3IIVA 2Q3RA 1F6PA 5JIPA 3WH9A 1Q6RA 1BYBA 4W8AA 3KL3A 3K4AA 3KTSA 4PMJA 5FJOA 3UPMA 2QPSA 1ZALA 3B9EA 2Q8XA 5FL0A 4J3XA 1PHWA 2Q02A 2OZ8A 4LBRA 3SCOA 4QDPA 4ATWA 4IL0A 4WY0A 3MPGA 5DT7A 5CPMA 1GG1A 3N9RA 2XFRA 2ZXQA 4B3LA 2PUZA 3MV01 3MUIA 2ZRWA 3HJZA 4M19A 1P5BA 1DXFA 5FI8A 4CCEA 3QMSA 3R7MA 1W9UA 4UTHA 3BOXA 4MLRA 5HULA 4IZGA 1J0IA 2NX9A 1M03A 4S3CA 1LQAA 1I2QA 2WSYA 5TQLA 2HDJA 2GDUA 1D8CA 2DZUA 3IWPA 3IJQA 3TTEA 1ZNNA 3HFYA 4AXNA 1JG9A 5E1QA 3B8DA 2BHYA 3BCDA 4D1JA 3NQ8A 4AVNA 2E68A 2ZIDA 3STEA 3SCUA 1WKFA 2BTMA 3AS1A 3DZ1A 3SIZA 1TUFA 1VAHA 3ITXA 4GY7A 3QV8A 4ORMA 5M03A 1D3CA 1VZWA 1OC7A 3TVAA 1Q6LA 1BF6A 4EAYA 1XRTA 3BE7A 1KCLA 1JCMP 2C18A 1OIMA 4H8HA 4FXJA 3DIPA 2CLIA 3MZ2A 8A3HA 2VELA 2QCMA 3ZM8A 3VOHA 4GI4A 3MA8A 4U4MA 4WLCA 2WC3A 3TMQA 4PMVA 4X22A 1KBKA 4RUBA 3H6OA 2HBXA 3VPLA 2WPGA 1X1OA 5A2BA 5D2VA 5ABGA 3SCQA 4QNWA 3AICA 3BH4A 2GJXB 2NQLA 4H2CA 4HQVA 1RLCL 1K7FA 4JN6A 4PCSA 1V7YA 1HTIA 1ZJHA 1UOKA 3WLRA 4JFUA 2Y8VA 3SSZA 1G01A 5DXYA 4TMCA 1TV3A 5G4WA 2YBTA 3GRIA 4BHYA 4N4PA 3H22A 3W1NA 5I24A 1NAL1 1RCXB 3UWZA 1Y5XA 2GOUA 3L5AA 3HG3A 4KIRA 2ZA1A 1IF2A 4DBEA 2YLAA 4UQBA 2ZUUA 3VI2A 1A49A 3W7KA 2BGQA 2YDAA 1OC5A 1K4GA 2Y4SA 4MB3A 1OM0A 2ZKMX 3NEVA 1PYMA 3NL2A 3QMTA 3GM8A 3NQMA 4ZFMA 2YGYA 3CL8A 3S46A 3QGAC 3UEQA 4N6FA 2CBVA 3M9YA 1RR2A 1EWEA 4HSNA 4GO9A 1GVIA 2CESA 3TTQA 4HNUA 4H2HA 3LG3A 3OODA 1YX1A 1LOLA 3ZVIA 1FCUA 3WDHA 3S83A 2E77A 4MDPA 2DIEA 4Q6XA 2VC7A 5L9FA 3U5UA 2V2CA 1A80A 1QWGA 3NQDA 1XISA 3EKGA 1XFCA 3CZKA 1W3JA 3MKKA 4O8AA 4QSFA 4US5A 1CEOA 3M6YA 2WC7A 2QUMA 4MY9A 4ZODA 4PH6A 2NXIA 4WUIA 2A3HA 3UZZA 3SDOA 2WVTA 1R3VA 3CYVA 4QR6A 2HS8A 4CQ9A 2ATSA 1XCFA 1SO5A 1NOWA 4WCJA 3VGBA 3OLGA 3VXGA 2CLLA 4LX4A 1H61A 4O0ZA 5CPLA 4HNVA 4LV4A 4Q4SA 1PX3A 4ZB0A 2Y0FA 2YA0A 3DDMA 3NOYA 2VO5A 4IMDA 1BWVA 1S2CA 2FZ8A 2YDQA 1JZ6A 3P82A 4OUIA 4LUSA 2NX3A 3FJNA 3EKLA 1C93A 2X30A 4HK6A 3EWYA 1A4LA 4IMCA 4DQWA 3GYCA 2PTDA 2WXDM 3VMPA 3C3NA 3IEBA 2BWGA 1U1HA 3NCOA 1W5NA 1KXQA 4ZB5A 3B05A 4Y9PA 4DEFA 4EF8A 2YYTA 3OQEA 4XX6A 2FZMA 4JX6A 3GXIA 3P2VA 3FDKA 4EANA 4B91A 3G5EA 1MEIA 2HQAA 4HIBA 4HN4A 1U30A 2B7PA 1HL2A 2WMIA 4LY8A 3M07A 3F5KA 4NHVA 3AXHA 4TU1A 1WZAA 5D9MA 2D1ZA 3FOKA 2G37A 2YCJA 5CLTA 3GNOA 4QJ4B 2YBUA 1UH4A 2GVJA 2Y85A 3TX9A 2FJUB 1GQNA 2UY4A 5CGMA 4YN5A 3QV7A 4PUUA 1BKSA 1PKNA 1XR2A 1N8IA 4C7GA 3EXSA 5A6JA 3UWQA 1DKWA 3S1GA 4UBPC 2WYSA 1KKRA 1CBGA 4O0KA 2HVOA 1MRQA 5I3FA 1OYCA 2UY5A 2R1MA 3NG3A 4CD7A 2BX7A 3VNYA 4HKPA 3A23A 1XLDA 3W7DA 3ITYA 2QAFA 1R3TA 4PMOA 2OX4A 1LL4A 3OVPA 4QQ3A 3MUCA 4XZNX 3TTYA 4DO4A 4GQGA 2ZZ2A 3T05A 3TE9A 3BLKA 4P7QA 1TJ0A 4UR9A 1NH6A 3VINA 4HNOA 3R8HA 1A5CA 1RXOB 2ZWZA 1H1YA 6A3HA 1QPQA 4RR4A 3L0GA 4ZR8A 2DDXA 2QUUA 3LHTA 3RHGA 3RJXA 2YCKX 3KOWA 2X2YA 2ISWA 5KETA 4A3UA 4AG0A 4FPSA 4BI7A 1AVAA 1D3GA 3PBVA 1YW1A 1J18A 3LXBA 1SVDA 1V3IA 2V82A 1WCGA 2F6KA 2D69A 2GLKA 4AD5A 3CIXA 4H04A 5LIWX 4RK8A 3W23A 4RDWA 2ODOA 1W5OA 5D8WA 4W87A 4PE8A 1QHZA 3B0YA 4PEKA 3ZR5A 2G3FA 3LRMA 1SMAA 1H3GA 1JJKA 2DORA 3ABQA 2GGJA 5GNZA 3S2NA 1XKYA 1G4EA 3RFAA 4DWSA 3U7VA 3EEZA 4C1KA 2J8TA 1CYGA 2OOGA 4UFLA 4Z17A 2OLAA 2PP0A 3SEPA 1Z6KA 2WV8A 2P76A 2Y5SA 3SCWA 1IYXA 3AWOA 4F0MA 4PZVA 1QFEA 1WXZA 4CQBA 1EX5A 3RU8X 1HO4A 3W7LA 1AL7A 2X7WA 4XIMA 5HNRA 4U28A 1LWIA 3C2EA 2PDMA 5CSSA 1XIGA 2J9XA 3SCSA 3WK0A 1UKPA 1TV7A 5T9CE 1EO7A 3W6LA 1ONRA 3GDKA 3LCIA 3S5NA 2JKAA 4P7LA 1X8CA 4AZIA 1G7VA 3S2MA 4LCRA 2PDUA 2FVMA 1XD0A 3EBVA 3GVVA 1XG4A 6XIMA 1UWTA 3DYOA 3RRAA 3PFMA 1TRIA 3N2CA 3UR8A 2NV2A 3W81A 2Z0IA 4RLIA 4JTTA 1PB0A 1KRAC 3CHCA 5FSEC 3U0HA 2PLCA 2NUYA 1YIXA 2OQYA 2IUZA 3NOEA 2KZHA 3IJ7A 1KM4A 5CZKA 2EKCA 2I17A 5AC5A 1JD9A 1V6TA 4UTMA 4KWOA 2OYKA 4HNLA 3POCA 4L6HA 2D3LA 4NI8A 4C6CA 3E2VA 3PS7A 3AZTA 3S9IA 3GB6A 3K2GA 3VD5A 4BA0A 1FQ0A 3SSJA 4E2BA 1I2NA 2CZFA 4R34A 1ADOA 1KRMA 4O1EA 3W7GA 1EGVA 3RCMA 1TZ9A 2C6QA 3BGJA 3DFPA 3VGGA 2G5WA 3QY7A 1TVNA 3OO2A 3BW4A 4D6HA 1W54A 2E3ZA 2QPXA 4IH3A 4H8UA 3KWSA 5FF4A 1TUXA 5C8BB 3ZO9A 2W66A 4H6KA 2OWCA 4ZB2A 1KQZA 3H7RA 4HU0A 1F3XA 3H7UA 3UPWA 3VX0A 4EK7A 4ILSA 5DLCA 5I79A 1MRAA 1W3NA 2DZVA 3GD6A 1LWHA 4MB1A 3MCNA 1FY6A 4IMAA 2CLPA 1BAGA 1Z89A 3KW3A 1P6CA 4MFEA 2FZBA 1OGGA 4DN1A 3TZFA 4BEQA 5HA7A 4NZFA 1EHAA 3PBGA 4IXHA 4FIQA 3DECA 3OQ8A 2E09A 1H4PA 2PP1A 3GBDA 5J8LA 2EEXA 3OZMA 1I45A 2J78A 2WJDA 1UP2A 1IEVA 4LS2A 1KRBC 3L4UA 3D46A 4RJEA 3DFTA 1ADDA 1N55A 4HK7A 3ANUA 4Z42C 2HVNA 4JBRA 1K8XA 4POCA 2Z00A 4M82A 1EBGA 1KFLA 3TFXA 4I7UA 5EMKA 1JYVA 5TF0A 4JTUA 4UZSA 4Q4MA 1GVFA 2OCZA 1SFTA 1P4CA 3B0XA 1XKJA 1KFWA 2GZXA 2FH6A 1RV8A 3W73A 3KZPA 2WQDA 1PL9A 4O1CA 3L65A 1IHIA 1K9EA 3L4VA 2R1LA 4ROQA 2I16A 1D9EA 2YZ5A 1QW8A 5HJXA 3TWAA 3M7SA 4L61A 3SY1A 1IEIA 3WFAA 4I9AA 1IEXA 1YQ2A 2V6AA 5FJIA 4MB4A 2Z29A 4B9ZA 2DIKA 1FRBA 4HJFA 2VUNA 4YWSA 4JL1A 2YBVA 4DBDA 4IX0A 2XVPA 1ISVA 2ZX5A 4K36A 2Z1KA 2XWDA 5I3HA 3W53A 1JXKA 2JF7A 4JKLA 1NFGA 1XP3A 2WJZA 1BG9A 4MOZA 2Z2UA 2C15A 3KVKA 4J3ZA 3VO0A 2DQWA 4AEFA 1H2JA 3QQ1A 1XLHA 1NFBA 1ZSXA 3NQEA 2E6DA 5F1VA 3ATZA 1HVQA 1JZ7A 4I7WA 3OZOA 4PSPA 1WDQA 2X40A 4KERA 3P62A 2GGGA 1NF7A 3MSDA 4OV9A 2WMKA 4LCQA 4O52A 1QHPA 3UWVA 2WKLA 2HK1A 1C7SA 4B92A 4QS5A 4M80A 4NYYA 4LB4A 4DWSC 1OINA 3K1GA 2VGGA 1JCLA 4ZMGA 4R3UA 2REQA 2RHGA 4ZZ9A 2ABBA 1K7EA 3W25A 3MMTA 3IK4A 4KFOA 3UWEA 4BZYA 1TTQA 1J0YA 3L7RA 1MDRA 3D0CA 4EXBA 3WJXA 5E70A 1HL8A 4Z1CA 4V2XA 3L2MA 5DEZA 4OVXA 4PBFA 3PPFA 1GOMA 3T0CA 3W37A 3VE7A 3W7QA 4HA3A 5CJNA 4QJ1A 1OF8A 5E0FA 3U3HA 3WCZA 4PMZA 3HPZA 3FYYA 1Y7VA 3QZ6A 3MBFA 4J9JA 4W85A 4FNSA 1GVOA 1KM3A 1E3XA 4J5NA 4QE1A 2O0TA 1TIWA 2QCCA 4BK9A 3EWCA 5FF0A 1I2RA 1XYAA 3S8HA 1LLOA 2F6UA 3W2UA 1LG1A 4NZCA 2RKXA 1AQ0A 4M6UA 4EOUA 3H55A 2XYLA 1IE7C 4Q8WA 1LQ2A 4FO4A 4GI9A 2QV5A 5K9CA 3OLEA 4DBSA 3VZZA 4QX4A 3VD9A 4LNYA 1GQLA 3KBVA 1WOBA 4HB7A 1QO2A 3SCRA 4DPQA 4A8RA 1LWJA 1YXDA 2GUUA 3ARVA 3UBPC 4MAVA 4AWEA 3QTGA 2TSYA 4H7ZA 1FWHC 1XYZA 3WNOA 4W7VA 3VNLA 4DBUA 3CC1A 4JL2A 4DXXA 3IGHX 4F0KA 3VX1A 2WNNA 4J3TA 2VP8A 5CSYA 3QZAA 1OX4A 1G69A 4IMGA 2PWUA 1FKWA 1SPQA 5CQ1A 3DU0A 3N2TA 1SW0A 1BXCA 1I0BA 3NXFA 2WPBA 4JQ4A 2E25A 1MZHA 1SO6A 1OFRA 2Y7EA 3PVFA 4OWGA 2QJIA 2W91A 3B8TA 2DZWA 4R88A 3E2SA 4YS1A 4AISA 2VFIA 3MANA 1WBJA 5EFDA 3SN0A 4NJHA 4NAEB 2VENA 4GZEA 1UWAA 1UWUA 3TNOA 1Z8AA 3CPGA 1EXPA 3AU6A 2WSRA 3CXOA 4MFDA 3L66A 2A3AA 2J7DA 4UTLA 1HN1A 1TPFA 3M6DA 4ENLA 3PZVA 3M0LA 3GK0A 1XIHA 5KMYA 3WH7A 3I3DA 1U83A 2CZEA 1MXDA 1ZZMA 1ZHAA 3FLUA 2NVDA 1TMHA 3IJLA 3I6EA 2IXUA 1Z9AA 4H8NA 5K2ZA 4C91A 3WLKX 4JTJA 3WDIA 3AOFA 3ZYZA 1S2WA 2G3MA 4AY8A 4D8ZA 1FCVA 1FWRA 1KV8A 3REQA 2PF0A 4I5UA 3CO8A 2QQ6A 1CZ1A 1IT8A 4CNOA 4GNJA 4A21A 3DYMA 4JTEA 4LF1A 8TIMA 3LXAA 1M9HA 3EYPA 4PL2A 4ZOAA 3URQA 1AMKA 2WK2A 3KCJA 3RDKA 4DYEA 2VZSA 3N3MA 3PZ9A 1RQBA 3IIXA 1J0JA 3GVGA 1K02A 4CUCA 1TCDA 2J24A 1GONA 1VYRA 1L2QA 2R82A 1MW0A 3UJEA 5BZAA 3W70A 2NWSA 3N15A 3N4AA 3NTYA 4PMXA 1UJPA 3TH6A 1VD6A 3UXLA 1PJ9A 3LHUA 1TVLA 3NQAA 2VEIA 1K6AA 4JOMA 2VR5A 4Z2IA 1B30A 1YNPA 2CLEA 4RDYA 2JALA 4H01A 1EL3A 2YFOA 3TDFA 3LMYA 1FP8A 4Z08A 4QGCA 3W1TA 4O1AA 1SO4A 2Z2BA 5LHFA 3IARA 2NW0A 1OZQA 1P6BA 1O95A 3RIKA 1QDSA 4NZ4A 1A5MC 1H7OA 2OB3A 4C7DA 2F9RA 3WENA 5HOSA 3NPXA 5IHRA 1JFXA 1MUWA 3V4BA 2FDMA 1A5BA 3O6DA 3CK5A 2DY3A 1HKJA 1BEUA 3L4TA 2J7HA 3AAMA 3TYZA 4N9BA 4YMZA 2ZDSA 3GU2A 4WY0B 3BG3A 4OBTA 3AIEA 1OX6A 1K8CA 4KF1A 3CH0A 4LC6A 2O56A 3S6TA 3UU0A 1R9YA 3WF4A 3D6NA 1EC9A 3O3RA 4V1YA 1EC8A 1D7FA 4FNRA 3F1QA 4XZ9A 3D3FA 3W7PA 4DO7A 3L12A 4G1NA 3VC6A 1OK6A 2J7BA 3VIMA 4RXGA 2GVYA 4LBSA 3O2LA 5FF3A 4B5NA 2PRLA 3CUFA 4HPNA 5E0CA 2QCDA 4N02A 4E4PA 1A53A 4DJFA 1H41A 5H8MA 2BSLA 2WVUA 4R27A 1DWIM 1RJPA 4M6QA 1K8ZA 3FA4A 3FDGA 5GNYA 2D0HA 2VOMA 3BLLA 3T0AA 3TJIA 4LC8A 3K13A 3WNKA 3VKKA 1X6NA 3DKJA 3ARRA 4IF2A 1PKYA 3VNIA 5A6MA 2JBMA 3HG5A 3IACA 4OOUA 5CJMA 3RYSA 5D02A 2Z2AA 2JF6A 3GTIA 5C9ZA 2GSEA 4CGTA 2XH2A 5B80A 3H2MA 1W37A 3SN1A 1DJGA 5LNSA 3F5LA 1R8LA 4IISA 4Q4OA 1TJRA 4Z1YA 4S38A 1KM2A 1EGMA 4MJ2A 3SGUA 4ZFCA 1RALA 4JIRA 1GT8A 1LT8A 4GXMA 1R86A 4HVXA 4K37A 4MKNA 1VLWA 2NXGA 1VCVA 4H9YA 1U1JA 3LV5A 3A47A 2DZXA 2PCEA 4IIGA 3WQGA 1M3UA 3HGOA 1WO2A 4JN8A 3V36A 3ARZA 2BV9A 4JYFA 3LD5A 2VT0A 3NL6A 4OU1A 1RD5A 3WH8A 4QCFA 3A5FA 2E67A 1VBGA 4XQ6A 2QW5A 3N13A 1PCKA 4J2PA 3GR7A 4LRTA 5I3IA 4K39A 2DZPA 1OGBA 3NFUA 4PTVA 3CV7A 3LPFA 1UIOA 4H9VA 2J66A 4NZJA 4ICMA 3CIVA 2Y88A 3E38A 3W1UA 3WJZA 4JDYA 1L6GA 4G2DA 3CAKA 1M7JA 2J7EA 3T78A 4WRHA 4S3DA 4IQJA 1EJRC 1V79A 1JAEA 3N34A 4MZYA 2PDNA 4EACA 1AW1A 4REQB 1W1YA 1DJHA 7A3HA 1J0KA 1B57A 1M1BA 1TYGA 4X60A 3USZA 4XVEA 3BW3A 1L6WA 4JX4A 1E51A 4AMCA 4R7WA 1E4NA 2QR6A 3P67A 5I0DA 1CW2A 3NSNA 3WEZA 4JFSA 1B9BA 1D7KA 1TPUA 1YE4A 3EX6A 1JPHA 1XXXA 1Y8BA 3H12A 4LVBA 2AL2A 3VE9A 4DY1A 3L23A 3E12A 4N9CA 2VC6A 1E6RA 2CWNA 5C55A 3FYPA 4KS0A 5A6SA 1GORA 4LUSB 3AS2A 1ZL1A 1UHVA 2A79A 5DMLA 3HQNA 1TWIA 3E5PA 1OFQA 1H11A 1XBYA 3F4VA 3PSWA 1O60A 4IJBA 2NQJA 1QI0A 2RJGA 2Z7GA 4ZTXA 1QO5A 9XIMA 2J74A 3G77A 3VMNA 1EWDA 1B3ZA 4WOZA 1UMLA 4UMCA 4WHBA 1YRRA 4FR1A 3LTPA 1UMYA 3KRSA 1YTKA 4ML4A 1KKOA 1IWPA 3GR8A 3VGFA 1FUYA 3B8IA 1TWDA 4B9YA 1JZ8A 4UNLA 2UY3A 3QR0A 5CH9A 2ZICA 1TREA 2CITA 1EPVA 2WMIB 3TR2A 3HQ1A 1TTPA 2J62A 4LTSA 3WNPA 3M0XA 2Z27A 4RE2A 4IPLA 3R6IA 1RP9A 1OT1A 5HMDA 1TJ1A 2XZ9A 1PKLA 2TODA 1ZGDA 1J2BA 2Y7GA 1SMDA 1XC4A 4YLWA 3MMUA 4XIAA 3W7HA 1RP8A 5KTLA 3IGSA 4DIAA 2CXGA 1EB3A 3KS5A 5DCDA 4PCTA 2ISDA 4TIMA 3V5FA 3KRBA 1W5PA 3CNYA 4ZA0A 1DQWA 1ONEA 4WZHA 3PC0A 4LJ3A 5G4EA 1NP2A 3II1A 4QG9A 1JQVA 5JMUA 4IIFA 4PR4A 2BFGA 3TN4A 2NZLA 4B4FA 3KDOA 2JEQA 1S5WA 1CCWB 2C14A 1FX6A 1EP2A 1RK6A 1C92A 1OCJA 3APTA 3LZ5A 1UC4A 4GIAA 1QNSA 4QXIA 5BOFA 4I3GA 2FB2A 1ICPA 3APYA