3KRZA

Crystal structure of the thermostable nadh4-bound old yellow enzyme from thermoanaerobacter pseudethanolicus e39
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
335
structure length
335
Chain Sequence
SILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalysis with thermostable enzymes: structure and properties of a thermophilic 'ene'-reductase related to old yellow enzyme.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus atcc 33223
molecule tags Oxidoreductase
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
total genus 129
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3krzA00
5FEXA 1GEQA 1QOPA 1G7UA 1L6WA 4ZQCA 3TUUA 5KINA 3F4NA 1ICPA 3S5YA 3L66A 1VRDA 5D05A 4K37A 2CLHA 2NWRA 1KTNA 1K3UA 2QCDB 5E1QA 4CNOA 1Q6RA 2G97A 2X1TA 4BI7A 4OV9A 3RLVA 4RXGA 3VE9A 4GJ1A 5HUPA 2GPTA 3QFEA 4ZQMA 3TJXA 5IBXA 3HG3A 4MY1A 1Z42A 4CCDA 1O4UA 3NYZA 2X30A 3CB8A 3LCHA 1RQHA 1I45A 1GVSA 3RFAA 3LV5A 5LNVA 2OZ0A 1I4NA 2YFNA 1LROA 4XTDA 2I9EA 4GBUA 4WOQA 4WXZA 5HR7A 3QJAA 4FXRA 2C3ZA 4K8HA 2HSAA 5KZDA 1F5ZA 1KM0A 4DPQA 2QKFA 3R89A 3DZ1A 1RR2A 3O6DA 3SECA 4O11A 1LZOA 1ONRA 3WJSA 3G1AA 1VLWA 3STEA 5KSWA 3W1QA 1GTEA 1W0MA 1TRIA 2KZHA 2WKJA 3M41A 2VXNA 3V75A 2JKPA 1X6UA 3FJ6A 1DL3A 1LDCA 2CLKA 3HB9A 4GUIA 4H6KA 4ZQRA 5I3HA 1NEYA 1UASA 3GXPA 5U7SA 4S1FA 3TW6A 1P4CA 4LNYA 4HIBA 1H51A 4RCXA 4AVFA 2C14A 3L5MA 4U28A 4Z0SA 1SW0A 3TE9A 4NZJA 3SIZA 3L21A 4GUGA 1H61A 3PG9A 2DZVA 3RU6A 5AC8A 1LBLA 5TBOA 5HWMA 4NQ1A 1WV2A 3S1WA 4O15A 4J9JA 1SUXA 3IV3A 4OBTA 4D2JA 2QAPA 2AGKA 1OFOA 4IX0A 4KKXA 1F73A 2GOUA 5DXXA 3UWVA 3STCA 4M7SA 4HHPA 2QUTA 5EBUA 2G5WA 2A85A 1JQVA 1PIIA 1WBHA 1TREA 2Z1BA 2GQAA 1EA0A 2ZA2A 1DJQA 2NUYA 4AWUA 1FWSA 2B0MA 3GVGA 3NM1A 1YDOA 5G2HA 5HINA 3TA6A 5CPLA 4JD4A 5SWUA 2ZCGA 2NZLA 4YXGA 1X8FA 4NX5A 2H8XA 2VFGA 4XKYB 3MI2A 2H6RA 3SSJA 3WJZA 4NNBA 3G8EA 4K7VA 1JCJA 1W1ZA 4LY8A 4DXVA 4FNTA 1T99A 2NXIA 3PVFA 1H62A 1KM6A 5D38A 1VYRA 1NSJA 2FTPA 3NQCA 4WXYA 1SSDA 3P84A 2OT1A 4IPJA 1ICQA 4IQLA 1G67A 3UWZA 3HMJG 1GTHA 3IIOA 4GWEA 5HWNA 1FDYA 3H55A 2H8ZA 1VCFA 1ZALA 3GDRA 5D2TA 2VFIA 2B4GA 2QCGA 3FKKA 4YCPA 3Q37A 5DXYA 1P5BA 5E93A 3LV6A 3PUEA 3C2EA 3O15A 3NPWA 4FEZA 5AYZA 3HOJA 4FNQA 5LZLA 3EXTA 3G1YA 4AB4A 1KFEA 1SQ7A 3W70A 4H4IA 1T96A 3FYPA 1WXJA 4IMEA 4JEQA 4FNSA 4BFAA 3LCWA 1P0KA 4GUFA 2Q8LA 3L65A 3NAVA 4FNPA 3Q2DA 3PSVA 5HR6A 4WZHA 4AH7A 2YW3A 3VFLA 3A22A 3STGA 3UWUA 1SR9A 3H54A 4AF0B 5KMYA 1DBTA 5LHEA 3LOTA 3P8IA 2A4AA 4KFOA 1TB3A 1JCYA 3LGEA 4IXXA 3W7GA 2A6NA 3P60A 4ORIA 1T0OA 1JULA 3G1XA 4NJGA 3WK1A 3HGSA 5AHNA 5D2VA 1GG0A 1IIHA 2WJZA 1L6YA 1GVQA 3N19B 1TTJA 2BXVA 3GAYA 3BV4A 2E6FA 2YXGA 1KFBA 3B05A 4KWWA 3B0PA 4EVZA 3OVPA 4ZMGA 3IRDA 3UWYA 3P8JA 2OJPA 1OK4A 2P1FA 2R8WA 4AMAA 3P61A 4XUGA 3QSTA 4N9DA 3NNTA 4JTLA 1W54A 2R91A 4MZ8A 4OWGA 1JCXA 3FLUA 3DFPA 2V5LA 3P82A 1YPIA 2GQ8A 5AB3A 3C2OA 4MYAA 4UTJA 3W7OA 3CM4A 2Q3OA 5LSMA 5IBXC 4YMZA 1JRBA 4UMCA 1DJNA 2XN1A 4A2RA 3OBKA 1DQXA 2CLOA 2A0NA 3LLDA 4XZ9A 3W74A 3EX4A 3OVQA 1QDSA 1Q6OA 3NQGA 5EMUA 1I2QA 3S5ZA 4BI6A 2GJLA 2E6YA 2HS6A 3MP3A 2ZRZA 3QPYA 1SZGA 5KITA 2ZDRA 3PBVA 2E09A 1TJPA 1Y0EA 1OFDA 1KFKA 1UB3A 5C54A 4O17A 4O53A 3R13A 2A1YA 2E77A 4DEFA 4IUOA 4ZQOA 4HNTA 4JTKA 1W3NA 3GK0A 1SZEA 1N8FA 1YADA 3OA3A 4CNPA 3UY7A 4WD0A 3KHJA 1EWDA 1W56A 4A2SA 4O54A 3QMTA 3OG3A 2NWSA 2OX1A 5H91A 3QF0A 1FXPA 1K02A 4ZQNA 2RDWA 5G2IA 3LTYA 3L2IA 4JDBA 3THQA 2Z0IA 3QMRA 2VELA 3T40A 4DQWA 1A5SA 2PURA 1FCBA 1LOQA 2FFCA 3RMJA 3MWAA 4L4MA 1G4TA 4HSNA 1TV5A 1W3TA 5C6MA 2P0OA 4Y90A 2GUUA 2GVJA 3IIVA 3W1LA 2JGYA 5G2WA 4HNUA 1TTQA 3NPVA 2VOMA 1JJKA 2ZRYA 4AAJA 2Y62A 1TQJA 1QCWA 2J27A 2J6XA 1H1ZA 1OX4A 4UFHA 1JCMP 1ADOA 4UNKA 1PV8A 1ML1A 2YFOA 1X1OA 2ABAA 3W2MA 5LNSA 3IVTA 4X9SA 4LVAA 3F1QA 2W6RA 3EKLA 1VHNA 3O1NA 3F4WA 1OFBA 4UMBA 3UZJA 4NX0A 3TSMA 4I9AA 1LBMA 2ZBTA 3LHZA 1ZNNA 1J4EA 4O14A 5D33A 2YR1A 5AOUA 1R2SA 2VEMA 2J9ZA 3UY8A 1FBAA 3NZRA 2P10A 1H7RA 1QNVA 4GRSA 5D04C 3HG2A 2Y63A 4OT7A 4HKPA 1MXSA 3G8RA 3NQ8A 4MLJA 5CPNA 1D3GA 1KA9F 3MHGA 1B3OA 2QCLA 4K7YA 3W1XA 1PHWA 1SO4A 1EEPA 3GAKA 1ZJIA 3HG5A 3W7JA 5D02A 1V5XA 1G6CA 2XN2A 4JR5A 3OIXA 1O5KA 4JTHA 3L5LA 3EWXA 2B7OA 1GZGA 4GUJA 5DBTA 4DF2A 2FJKA 3FJLA 5FF7A 5CZSA 3LCFA 3VNDA 3QMSA 3SJ3A 2E6AA 4M7TA 3W72A 3MYOA 1KLYA 3GKFA 1HUVA 2YSWA 1R30A 5F2IA 2DORA 2CWNA 4JTEA 2CLLA 1XFBA 2ZRUA 2E5BA 2NUXA 5F4SA 2CU0A 2ZZ4A 4IOTA 3QC3A 3RNDA 4FO4A 2PRMA 3GZ3A 1BWKA 4LRTA 1K7EA 3P5ZA 4HPXA 3T78A 3B0UX 2DJLA 5U4NA 4YLWA 4AWSA 3CU2A 1GQNA 3QW4B 4UR7A 4U4MA 4Y9AA 5E0KA 4O4WA 4FB7A 3T44A 1WQ5A 1ZENA 4WY0F 2NV2A 2V9DA 2Y70A 2YPIA 1KTCA 3TC6A 3TKFA 3W7IA 3HJZA 3KXQA 4JDYA 5H2ZA 3CTLA 2WQPA 4O12A 2R94A 3MO7A 3O8AA 4I7VA 1MEIA 1XBZA 4RK8A 4LRSA 4PEKA 4IMCA 1L9WA 4WY0B 3JRKA 4LC6A 1K7XA 3QH2A 5L6UA 3BG3A 3P62A 3W86A 3LHTA 3C8FA 1TPVA 1O94A 5FF3A 1YPFA 1OF6A 3DAQA 4O1BA 3TQKA 1WBJA 3EWZA 1XUZA 2A7RA 2XN0A 4PODA 3B04A 5KZEA 3NL5A 2ZRXA 1VQTA 4UTTC 2NUWA 1KBIA 2PE4A 3MBFA 1E51A 1FDZA 3HF3A 4FX8A 5G4EA 4OHQA 3LRKA 4EF8A 4OGZA 4H3DA 3BK0A 1XKYA 2G95A 3QW3A 3CIXA 3KX6A 3P7YA 1V7YA 1OFAA 1L6SA 2ALDA 2Y85A 3C2RA 1JR1A 1EP3A 4K6AA 1WOBA 3P5YA 4K39A 3MI6A 3O16A 4UTMA 3LTSA 3EWWA 3BLIA 2NX1A 4OV4A 1YTEA 4KFNA 5K4XA 1PCWA 4LOCA 2ISWA 5DCEA 1D9EA 2C6QA 3NR0A 1OK6A 3B03A 4O28A 2VFFA 1O95A 2WNNA 3LHUA 1KBJA 5DY2A 4E2BA 5FESA 3W88A 1UCWA 3GX9A 4Q4KA 5BMXA 1WOAA 2ATSA 4XTIA 1YTKA 3DFOA 5CGQA 1XDMA 3LI0A 3M7WA 2I1OA 5FEPA 1I2PA 1K8XA 4DBDA 5A8GA 5BNKA 4GE8A 1GYLA 1TPWA 1KV5A 2V2DA 3NQMA 3KAOA 1NF7A 1IIGA 3PG8A 2E1DA 3IGXA 2YDAA 1ALDA 1NAL1 4QM1A 3UXDA 4MZ1A 4AHPA 2CFFA 1K8ZA 1EUNA 3DBPA 1PE1A 1FWNA 3DENA 2GVLA 3M5VA 1H7XA 1TTPA 2WSQA 2FIQA 5CZJA 3BPWA 3M9YA 5D30A 4BK9A 3W7NA 3W7HA 1W31A 3LBMA 3W2NA 3LBCA 5F2MA 4DO4A 3PUOA 3W85A 3NOEA 4MY8A 5F1UA 4AEOA 1VCVA 3PBYA 2QCEA 4POCA 3DU0A 1H7NA 5BRBA 1U5JA 3PR2A 3S1VA 3NQ7A 3SFKA 4GXMA 3ANYA 3W71A 3FOKA 3M43A 4UUIA 1AW1A 1UJPA 1PHQA 4JXCA 5GVJA 5ABTA 4S2CA 4UTLA 3ABSA 3PAJA 4NNAA 4MFDA 1A50A 3BO9A 3BG5A 5C55A 4TU1A 4YCOA 3N73A 5AHIA 1D3HA 3UYCA 4A3UA 1G7VA 1Z44A 2QF7A 3GIYA 4FIQA 1H7OA 3E02A 1LLZA 3HPXA 4UNLA 1TPC1 5FF2A 3WJWA 1SFLA 2QJHA 7TIMA 4IMFA 1EUAA 1LP6A 3U6WA 3G22A 4Z1BA 2H3BA 2Z2UA 2VFHA 3NL6A 4ZL1A 3ZR4A 3TU9A 1G4EA 3ZS4A 2BTMA 1OVDA 4NNCA 1QO2A 2X1UA 3GDKA 5AHMA 4UFKA 3GR7A 2VENA 1A5AA 4ADSA 3DKJA 1K03A 1MSSA 3NXFA 5G5IA 5K9CA 4MPQA 2VEPA 2Q8ZA 1VS1A 3I7SA 1O60A 5F4XA 5DY3A 1UBSA 2OT0A 1QO5A 2W0UA 2DU2A 1QWGA 3GR8A 1JCNA 3IIZA 1SO5A 5CSSA 3T55A 1W5OA 1J2WA 4IMGA 4O13A 3S42A 3LCLA 1LOLA 1KV8A 4NUWA 3THAA 5DN1A 5K9XA 4Q32A 2X1RA 5FF4A 5CPMA 4IGHA 3UZ5A 1OFEA 1QAPA 4N2YA 1TQXA 2AQWA 2DZPA 2EGZA 4MKNA 2ZTKA 3G1DA 3GB6A 4X22A 1YTDA 1M6JA 1ME8A 1WDWA 4JGDA 4IX2A 4TR9A 4WOZA 4BF9A 3LI1A 3UNDA 2JK2A 2NX3A 2QCHA 4FX7A 1R46A 3TAKA 2QCMA 1DVJA 4ZVJA 3W2JA 2V2HA 3W1NA 3DI1A 4JICA 2V5BA 4O0ZA 5D2WA 3HGOA 4Z1AA 3SI9A 4NVTA 3KVJA 3I7RA 5DBUA 2Y7FA 4Y6GA 1VYPX 1HTIA 2RFGA 4X3ZA 2WSRA 3PULA 1F6PA 3W73A 5CZ0A 3C0JA 1HFBA 2QUVA 3G3DA 3M47A 5I3FA 5C5YA 4WUIA 2QCDA 4HN4A 3C52A 3N2XA 2FPTA 3HO8A 4XQ6A 3E9AA 1TTIA 3TSBA 4ADUA 1S5TA 1HL2A 3C2FA 3LCXA 3NDOA 1BKSA 4O57A 1AG1O 4QNWA 3W7LA 4GNJA 3NZ1A 3TR2A 1HO1A 1FWRA 1VR6A 5AYXA 3TXVA 5DCDA 3HG4A 2Y88A 5TIMA 5HUOA 4AHOA 3SY5A 3PS7A 3LTPA 3ZFHA 4RV8A 2X16A 2CLFA 2V82A 1DHPA 1OFRA 3PM6A 1YXDA 3A24A 1TMHA 4LVGA 1F76A 2ZZ1A 3INPA 1HO4A 4Q33A 1RPXA 3EWYA 1OF8A 1AW5A 3G1FA 2C1HA 3NO5A 3W7QA 2E5DA 4NXKA 1I2OA 3NL3A 3A21A 4FF7A 1AK5A 1ZHAA 3I65A 4A22A 3MYPA 2LLEA 1EP2A 2E68A 1EP1A 2E6DA 3ELFA 4EOUA 3GNNA 5AFDA 2WPBA 5EYWA 3W7CA 5LGXA 3I6RA 4LV9A 3I68A 2A2IA 3BW3A 4JTJA 1JCLA 3B0VC 5LNRA 3PB0A 1SO6A 4RJEA 1L2UA 1TSIA 2BX7A 5D2YA 4TIMA 2WNZA 1X7FA 2F84A 3E12A 2ISSA 2YYUA 4QJ1A 1KM2A 4RZ6A 8TIMA 3L67A 3M44A 3NM3A 4UMAA 3QEZA 4JS3A 2BSLA 3EKZA 4ICNA 4UTIA 1DV7A 2QJGA 2C15A 4IXHA 1SZNA 3UPBA 3DFSA 1Z41A 3MP4A 3S8HA 2OMAA 4LS0A 1TPB1 4PCFA 4UTWA 3G0XA 2ZZ5A 3PC0A 4LV4A 3TMLA 4NU7A 3LDVA 3EWBX 3QQ1A 2CZEA 2EKCA 2J9XA 3AO0A 4YWIA 1FUYA 1XM3A 4K36A 1H50A 2JBMA 3NQAA 4JN6A 4PFMA 2CLIA 3LXCA 1ICSA 1GYNA 2ZRVA 2R14A 4QISA 4A29A 4MYXA 2ATMA 4DO6A 2D73A 3BLFA 4JX5A 5FF0A 1ME7A 3E0IA 2CLEA 1M7PA 2EF9A 4PA8A 1XDLA 1ZAHA 2ZQ0A 4XKYA 3G1HA 5I3KA 1QPRA 1IGSA 1F05A 4L4LA 4JTSA 4M6QA 1MEWA 4Z0JA 3EX2A 3N9SA 4O16A 5AC7A 1Q6LA 4UFLA 1KM3A 3HGJA 1XXXA 2W79A 4HNVA 1R47A 1TPFA 3TROA 3N3MA 1OABA 4O19A 1C8VA 4O1DA 5LHFA 3TJLA 4N4PA 4TX9A 4NJJA 4UR8A 1IXNA 5HQEA 1GT8A 5BOOA 1M5WA 3DKLA 4DF1A 4JYEA 1ZY9A 5F1VA 1OG0A 2J88A 5A5WA 4MIMA 3DFTA 2GQ9A 4LUJA 3W6YA 3PWAA 3W22A 2XFWA 3S1XA 4E0CA 1H7WA 2DZUA 4LW7A 3DHFA 4BWLC 1EIXA 4AHQA 4N9EA 3HIJA 2WSYA 1TO3A 1B4EA 1MEHA 1YXYA 3BLEA 3TXZA 3L68A 2EAWA 3JS3A 3UXAA 1EPXA 1NVMA 1CW2A 5D32A 1HG3A 1FY6A 3W1UA 1LRNA 3W23A 3BGJA 3MI3A 4I7WA 3NEVA 3CQ0A 4O4VA 2YX0A 3QQ0A 3P67A 1OYBA 4XBKA 3VE7A 2VFEA 2JKEA 3G3MA 3BVJA 4KWVA 4DBEA 3GDMA 1BTMA 5CZTA 3G1SA 2Z6IA 3PSWA 5LKYA 3Q58A 3IIXA 3G24A 4PL2A 1JVNA 3LX9A 4JIQA 1TPUA 3G18A 3W83A 4Z08A 3CIWA 1H63A 1LLWA 3FIGA 4HT3A 1FCQA 4RZ4A 4UTKA 1TPEA 4JTFA 3O6YX 4LWWA 1W5NA 3CC1A 4TMBA 1A5BA 3PY2A 1IXOA 1QPQA 1M7OA 3S0CA 3Q94A 4KFPA 2GVGA 3TW7A 3DGRA 5DCBA 3W7RA 1OX6A 3HBLA 4M5PA 3GDLA 1OYAA 3W7DA 1TRDA 3LCGA 4O0KA 2TRSA 3ABQA 2NXGA 1PVNA 3NL2A 4AF0A 4MOZA 1LCOA 3W1TA 4LS1A 2YCEA 4ALDA 3HPZA 4UTTA 3P80A 5FEZA 5D09A 1WX0A 3BW2A 3TDFA 1XBYA 1W8SA 3T7VA 3NQVA 2H90A 4QSHA 1ZAIA 2ISVA 3U8GA 2NLIA 3NPUA 3E96A 4I7UA 5BMWA 3TCEA 3ABRA 4JX4A 1QPNA 4N9BA 1GWJA 4NXSA 2O7SA 1VLIA 3P81A 2VFDA 1VC4A 4OU1A 3TIMA 1JUEA 1AL8A 3R5EA 3G0UA 3GNDA 2ZTJA 4Y8FA 4WJEA 5C2XA 1MO0A 4LVDA 4CQAA 1LTDA 4JIPA 4LUIA 3NVTA 3TFCA 1LBFA 2E5CA 1VYSX 2QJIA 4C1KA 1TIMA 4JYFA 3NQEA 1SU5A 3AJXA 2TPSA 3SR7A 1JUBA 2QCCA 1U83A 4JNMA 3KVMA 1KFJA 1RVGA 3SZ8A 1THFD 1C9DA 2V8ZA 5FEWA 1RV8A 3UWWA 4YL2A 4K8EA 5BW6A 2GJNA 3VI2A 3FA5A 2J24A 1QFEA 3F03K 5F2LA 3KVKA 5LNUA 1KM1A 3CWOX 2Y6ZA 2FQIA 2NX9A 3B4UA 5EL1A 3GKAA 2DJXA 2FPYA 4FXSA 2YYTA 1G69A 3M6YA 5AHFA 1F6KA 1GOXA 1C29A 1LRTA 2DZXA 4DELA 3S5OA 5G1TA 1XC4A 3LLFA 5DELA 1KLZA 2QDHA 3O05A 1RD5A 4JTUA 2ZRWA 3EEGA 3BGGA 3RLUA 3PF3A 5TQLA 3WK0A 4E38A 3C4UA 1FXQA 3WJXA 4JY9A 5HNRA 4R33A 2X2GA 1I2NA 1LM1A 3TSDA 1UUOA 1B57A 2Q3RA 3LXBA 2G96A 3MMTA 4BR1A 2BLEA 4FIRA 4QIUA 4UXDA 4WX2A 4ONVA 3W87A 1FDJA 4JTIA 4UIOA 4RKAA 2Y89A 4CNNA 3KRZA 1VJIA 1RQEA 1VH7A 1W37A 2ZZ7A 1PCKA 5J5DA 1LOSA 1CX9A 2WO5A 5HULA 2FDSA 5HJLA 3A9IA 1LYXA 1OX5A 3C2VA 1GPWA 2IQTA 2QDGA 4N6EA 3UWQA 4CCCA 4IPIA 4AWTA 5L9FA 1H7PA 4MZYA 1W5MA 1TV8A 1S5VA 3NPXA 4XWUA 4AXKA 4JYDA 5I3JA 2V2CA 4O10A 3O06A 3TFXA 3RF9A 1K7FA 3BARA 3NGJA 4NT0A 4IJBA 1Q45A 2CLMA 3CHVA 3TX9A 1SW7A 4CCEA 4X2RA 1YXCA 1FCUA 2ZA1A 4HNNA 1CI1A 1BWLA 3NQ2A 5EA9A 3PUDA 4N02A 4PL1A 3HPSA 4S2BA 3NA8A 2HMCA 2ZZ3A 1H60A 3QZEA 1SO3A 5F2GA 3QM3A 4O50A 1BEUA 3W2KA 3CT7A 1DORA 1XCFA 4FNUA 3JR2A 5LNWA 1FWWA 4ZZ9A 3W07A 3EXRA 4B5NA 4UFJA 3SW6A 3BG9A 2QUUA 1JQXA 3DXIA 3HQ1A 2PRLA 2V30A 1FQ0A 1LORA 1DQWA 4QITA 2CZDA 1ZCOA 3EX3A 3SGUA 5K7JA 4JY8A 2C13A 3KOFA 3K30A 4N9CA 4R7JA 4MVAA 1YLVA 2VEKA 4UTWC 1F7BA 4QNEA 5F4WA 1GVRA 1VZWA 2HS8A 3O6CA 3NQFA 4Z1CA 3IIPA 1W5PA 1N7KA 3EXSA 2RH9A 3ATZA 4Z1DA 3M1ZA 4ZQPA 4UFIA 3TQ0A 4O1CA 1EX5A 2DZTA 3OVRA 3CWNA 3EWUA 2UV8G 3KFTA 2A21A 3DH7A 3G0SA 3VCRA 1AMKA 4RR4A 2NXHA 2TMDA 3LM7A 1JUKA 3S6DA 3R12A 3S5NA 2O7QA 3TC7A 3A23A 1RQBA 1O5XA 2F7FA 3W9ZA 1OX4B 3CEPA 4MJMA 5G1YA 2QAFA 3L0NA 3R2GA 4WY0A 5EKYA 4CQ9A 3CPRA 1F74A 3A5VA 3USBA 1G4SA 1Q3NA 2EPHA 2CZ5A 3FS2A 2FLIA 4CLMA 1H5YA 1TV7A 1RZMA 3PBUA 1PS9A 4ORMA 1KM4A 2C0AA 2FB2A 3MHUA 5G4WA 1SZFA 1MZHA 3B06A 3LXAA 2DP3A 4OE7A 2YZRA 3TQVA 3I7QA 4LS2A 3ATYA 3IGUA 5AN7A 3WK3A 4ML9A 1WA3A 3EX6A 5HWJA 1S5WA 4JX6A 3IEBA 4N4QA 2PCQA 1X1ZA 3ABOA 3E49A 2PC4A 2TSYA 3HGRA 3EX1A 3ZWTA 3W75A 2PRHA 5T26A 4XBSA 4E2DA 3M16A 4NJIA 3W76A 3ZWSA 4FX6M 2VEIA 4A21A 1LRQA 3KRSA 1XBVA 3EB2A 2B7PA 3B8DA 4DO5A 4MFEA 3D0CA 3MBDA 2YW4A 3O07A 4QQ3A 4LC8A 1YDVA 3NQ6A 3W1PA 3W3OA 1QPOA 3DFQA 2FPVA 3YPIA 3S1UA 5EY5A 5D2XA 1SSGA 2A5HA 3LRMA 2V0TA 3H53A 1GG1A 3VKJA 4GC4A 1Q6QA 1FWTA 4NZFA 2HTMA 2RDUA 3DFNA 4HPJA 1NF0A 1KM5A 1PL9A 5D37A 3W2UA 1TPH1 4JTTA 5I3GA 2ZYFA 5CKSA 2C16A 3WJYA 2VC6A 4O18A 1DKWA 1FCVA 3GXTA 3N2MA 1IXQA 4P61A 3R8RA 3WFAA 1N55A 3C3NA 1R2TA 2ZFAA 1KTBA 2Y7EA 1WAUA 2YGYA 4IMDA 3W1MA 4EWND 4DF0A 2WNQA 3MP5A 2H3DA 1TPDA 4LVFA 2BZNA 3UQNA 3OEXA 4MJZA 3KVLA 3FKRA 1F2JA 1XBXA 3MHFA 3L0GA 3LCIA 3MJYA 2CZFA 2FB3A 4O52A 2OCZA 1FX6A 4UTHA 2CW6A 3WK2A 2DZWA 3U2OA 3PBWA 2ZA3A 1VHCA 5KTLA 5K2ZA 1GVOA 4IWWA 4RX0A 5FI8A 3N14A 4BI5A 4QAIA 1QR7A 2RKXA 3W1AA 2EHHA 4W9TA 1T8XA 3TH6A 3M5YA 4EIVA 3SGZA 2Y7GA 4LTSA 4Y96A 1YDNA 1B9BA 4RZ5A 4MUZA 1VGAA 1SPQA 4JTGA 2TYSA 2QCFA 4EF9A 3MUXA 4UFMA 1KW1A 4RLIA 1OFPA 4LVBA 2Y61A 2A7NA 1UUMA 1XL9A 1KFLA 2QR6A 3QSRA 2QCNA 3G1VA 5AYYA 1YYAA 1OJXA 1AW2A 3IVUA 4R34A 3OHIA 5IM51 3TNOA 4C1LA 1QOQA 5LGZA 5AC6A 3BW4A 3O63A 1I8JA 3MW7A 3IVSA 2WV8A 4PTNA 4RXFA 4UTUA 1W3IA 1P0NA 5HMSA 3UPWA 1OFQA 4MY9A 3UD6A 1XUUA 3QRHA 2A7PA 3L5AA 3NG3A 4GFSA 2ABBA 1WYIA 5AHLA 1R2RA 3LHYA 2JKAA 4M19A 5EPDA 4FNRA 4CQ8A 1W5QA 2RHGA 3IGSA 4O8RA 1IF2A 5CG7A 5I3IA 1QMLA 2NV1A 3RK8A 4G1KA 3M5XA 4MLRA 3W84A 3C6CA 3CLMA 5KZMA 4DPPA 3N9RA 4HSOA 3QPZA 2QEZA 4FHAA 3TV8A 1S3HA 3CEUA 2ZZ2A 1TJRA 2VKZG 3T4CA 3TK7A 3W2LA 1ZFJA 6ALDA 2Y7DA 3QYQA 3S9YA 1EB3A 1SFJA 3V1PA 3GYEA 3GLCA 1TYGA 4LT9A 5D03A 4R53A 3W7PA 1ME9A 1OHLA 3TMQA 1OYCA 3LERA 3N34A 5K4ZA 4NJKA 5CPOA 1SW3A 4WQ6A 2C18A 2B7QA 1I2RA 2I14A 5K9DA 1ZAJA 1A5CA 6TIMA 3C56A 2DZSA 3KRUA 4P2VA 4M6VA 3FYOA 3P74A 2WOQA 1G4PA 3PB2A 1EWEA 1VPXA 4OQVA 3GDTA 1VCGA 1GJPA 4M6PA 1P1XA 3TAOA 5DLCA 5AHEA 1DOSA 1J5TA 5CSRA 1JRCA 1NFBA 1AL7A 3FFSA 3L0KA 3LB0A 4PC8A 1A53A 3DI0A 1K8YA 3GXNA 4TO8A 5J5RA 1Z48A 4PH6A 1H1YA 2X1SA 2BWGA 1KFCA 4GUHA 1IXPA 1XI3A 4LU0A 3W7EA 3DHDA 4UC5A 1TCDA 3FEMA 3M0ZA 4ADTA 4O1AA 4N6FA 2A6LA 2JGQA 4K38A 3C61A 3M5ZA 3W7KA 3LHWA 4UCGA 3LHVA 1GVFA 2Z6JA 2J9YA 2V81A 4BWLA 2ZZ6A 3STFA 3A5FA 5K3VA 2C19A 4NJHA 2AAMA 4TMCA 3L9CA 2RDTA 1B4KA 2B7NA 3LRLA 3W7MA 5MHBA 3W1RA 3NQDA
chains in the Genus database with same CATH superfamily
2F6XA 4UNIA 2POZA 1B9ZA 4B5XA 2FZ8A 4DB7A 1QOPA 1ZB5A 4PMZA 1KXVA 4ZQCA 1PPIA 3TUUA 3BJSA 1AZ1A 1HNYA 5KINA 3VOJA 4ATLA 5H1WA 2CLHA 1BFNA 4HZ6A 1NH6A 1U22A 3FVMA 4CNOA 4ROQA 1NFPA 4CGTA 3RLVA 2XUCA 5HUPA 4BKNA 1JI2A 1XLDA 4ATDA 3S2CA 3B8WA 4CCDA 1UKQA 2J75A 3NYZA 3K4DA 1RPKA 1I45A 3H2OA 3WNOA 3LV5A 2OZ0A 3FV9A 3AHZA 3ICJA 4LB3A 3OQEA 2V5JA 1PBGA 3PTMA 5KZDA 1KM0A 4DPQA 3ARTA 1XRTA 3VUPA 3DZ1A 3SECA 1XYCA 1LZOA 1E1EA 3STEA 5KSWA 3IK4A 3W1QA 3FNDA 1HZYA 3A9BA 2WKJA 2VXNA 2JKPA 3ITLA 1XX1A 4PMQA 3DN5A 1DIOA 4GUIA 4H6KA 4BQ2A 1VFOA 2E9MA 1BTCA 4DO7A 3ZSTA 3MKKA 4AVFA 2PLJA 3TE9A 1SW0A 3SIZA 3L21A 2ZUWA 3URQA 4R9XA 1QTWA 2D69A 3RU6A 1ZRQA 5HWMA 5BXPA 2QAPA 3QGKC 4B9YA 3GHSA 4M7SA 5LIYX 3T81A 3VOIA 1OC5A 4C6LA 1XFCA 2ZXBA 2MANA 2NUYA 4AWUA 2JF6A 2B0MA 5G2HA 1SMDA 4JD4A 2WJDA 4JNZA 1UA7A 1J93A 2ZCGA 3RJYA 2XGIA 4RDWA 4YXGA 1X8FA 1VPYA 5HJXA 1J0KA 3KP1A 2H6RA 1ONXA 2OO0A 1P6CA 4ZSUA 1TIWA 2P50A 3G8EA 4IZGA 4GZ7A 4DXVA 3L4UA 5KETA 2E3ZA 4NYUA 1KM6A 4TQTA 1SSDA 1XCWA 4V1XA 1XGEA 4IPJA 1ICQA 4J28A 1XIBA 5HATA 4GWEA 3H55A 5D2TA 3BZGA 2B4GA 1BF2A 2NQLA 1A4LA 5E93A 3L4XA 3LV6A 3BTNA 3TEVA 2X09A 1US2A 4ZGYA 3NPWA 5AYZA 3I4EA 4D6IA 1EXBA 3EXTA 4ZOBA 1S2TA 3U2CA 3W70A 1AMYA 1T96A 4UOQA 4IMEA 1IT0A 2YL5A 5C2CA 3L65A 4MHBA 4QS6A 1FWFC 5A6JA 2Z1KA 4HJFA 4WZHA 3EGJA 3MCMA 2YW3A 1SGJA 5HMEA 3A22A 1NJJA 1B30A 4L1XA 1DBTA 4B4HA 3LOTA 4LYKA 3W7GA 5I03A 4E5TA 1W3HA 1T0OA 4L6DA 4A8IA 3CQKA 1TX0A 1TE1A 3WK1A 5AHNA 2VQUA 1R9YA 3GHRA 4KWSA 4KRUA 3PP7A 4M24A 4PUJA 2FHCA 3IPWA 2F6UA 4HNOA 3BQ6A 5REQA 2J47A 4H8VA 2FVMA 2C1IA 3B05A 4NKCA 2G4FA 1BQCA 5EMKA 4ZMGA 3UWYA 1FHVA 5A6BD 3P8JA 5BU9A 4MG4A 1C8XA 2C79A 1D2KA 2PCEA 2A3EA 1JPHA 4JTLA 3SGGA 4TTUA 1W54A 2JALA 4OWGA 1JCXA 3FLUA 3BAYA 1HKJA 5IDZA 4UTJA 1PZ2A 2E8YA 5IBXC 1JRBA 4W5ZA 3NVDA 4DLMA 1DQXA 1LG1A 4G7FA 1TFVA 2A0NA 3CV2A 4XZ9A 4S39A 3OVQA 4D6CA 1Q6OA 1ITQA 1I2QA 4C6IA 3S1GA 4GX8A 2AMXA 1A5NC 2E67A 3MP3A 1SZGA 2E09A 2YA1A 1UB3A 4O17A 1H0IA 4O53A 4YS1A 2VCBA 4ZQOA 2A3HA 4QG9A 1SZEA 2IXUA 4KEMA 3KHJA 3K8LA 5FJIA 3OG3A 1HGYA 1K02A 4ZQNA 4F0RA 1OSEA 1QWKA 2RDWA 3GTNA 3VIHA 3T40A 5HQMA 1QNPA 2XG9A 3WF4A 2E28A 3EWCA 1LOQA 1VBHA 4FXFA 1Z7AA 1W3TA 5CSYA 3IIVA 5TAOA 3W1LA 3CAWA 3L4WA 5FJTA 3NPVA 5ABHA 4UZSA 1JJKA 4AAJA 3V4BA 1QCWA 5BWFA 3WUFA 3LLXA 3BOXA 2F8QA 4GOAA 4GZEA 4UFHA 3MSYA 3GU2A 1ZJBA 1LT7A 5I24A 1XIFA 1FP8A 2VGGA 2GDVA 4Y9OA 5LNSA 4LAUA 4X9SA 4LVAA 4Q4SA 1DWIM 1R3VA 3F1QA 3AIVA 4L1GA 3OODA 3N25A 5H8MA 1E4NA 2ZUMA 4ICMA 4YU1A 1EJSC 5M1TA 4NX0A 4P8VA 4GGBA 3FDKA 3ZR6A 4YHEA 1HL9A 1FWJC 3UY8A 1XYFA 1FBAA 3SM0A 1YBQA 2X7VA 4Q8TA 4S3CA 4M51A 2Y63A 4OT7A 3ARPA 5GJMA 3GW0A 3QKZA 1ZJAA 3KCLA 3B97A 2CCRA 1PHWA 1ZJIA 3W7JA 5D02A 4WGXA 4GQQA 1V5XA 3F4DA 2XN2A 3OIXA 4JTHA 2FGLA 2Y4SA 2JE8A 3L5LA 3EWXA 2B7OA 3GWQA 3MSDA 3FJLA 3VNDA 1E0VA 1M7XA 1KLYA 3MANA 1QI5A 4H7VA 2DORA 2CWNA 4F2UA 2XIIA 3V16A 1D7KA 1I75A 3QC3A 3RNDA 2PRMA 3ONCA 4QXIA 5LXXA 4DYKA 1C9WA 2YCKX 5CJNA 2VD9A 2DJLA 3WLJA 5T91A 4YLWA 2ZUNA 1JYNA 3CU2A 2J4GA 1UMYA 4ZB5A 3QW4B 3EPOA 2UWFA 4U4MA 3MUIA 2JIWA 3T44A 3RLGA 2NV2A 2Y70A 3HM7A 4NI3A 3KXQA 4X60A 3TW9A 1Q7ZA 4AD5A 4C1NB 4O12A 2R94A 1V79A 3C8NA 4WKAA 3H2MA 4LRSA 4IMCA 4HP5A 1HN1A 1FHDA 1L9WA 3CAKA 3R0UA 3KBVA 5GNXA 4LC6A 1DJXA 2O92A 1UUQA 3BG3A 2BGNE 5C71A 4CQCA 3RXZA 1O94A 3CYVA 5FF3A 1OF6A 3WX7A 1UZ1A 3SQLA 2HQAA 1WBJA 1XQKA 3EWZA 2PDUA 5I78A 5DT7A 2IKJA 4FF5A 3CQIA 3R1ZA 2NUWA 1KBIA 5HDRA 4US5A 3GBEA 3GQYA 5RUBA 2C8NA 1KXQA 4C6BA 4EF8A 1RLCL 3EAUA 3CIXA 1QI2A 2INZA 1V7YA 4JTRA 5TD4A 3SCRA 2W27A 1V6VA 1R8LA 3C2RA 4K6AA 1OD0A 3N2CA 3CT2A 2G0WA 3MI6A 2YZ5A 3LTSA 3E0LA 2HRWA 1NDWA 2OSXA 1DWAM 3GYCA 4G7EA 4GKLA 2PA6A 2DUZA 1NOWA 3EB3A 3NR0A 5M17A 4WK9A 1BHGA 4I3GA 1MFUA 1PJ9A 2HZGA 3VIGA 1GKPA 3LHUA 2GSEA 1KBJA 3MVIA 4E2BA 3W88A 1EPVA 4Q4KA 4GINA 1WOAA 3L12A 5I79A 2YDSA 3JZUA 3AXHA 2I1OA 2PZNA 4ZE5A 4DBDA 2RDXA 4LH8A 4PMNA 1CBGA 1TPWA 4KCUA 3KAOA 1KXHA 2Y24A 1BXBA 2OQYA 1J10A 1YX1A 5E09A 3VM5A 4YN5A 2E8ZA 1C7TA 4B3ZA 1QW9A 3T0AA 3M5VA 2PP3A 1JEZA 1XSIA 1P0DA 2BASA 1OEPA 5D30A 4OJYA 3AYTA 4BK9A 3UXIA 1W31A 2IKIA 4B92A 3LBCA 3PUOA 3MUCA 4PGLA 2WZTA 1W9BM 4H9UA 3PBYA 3QZAA 5BRBA 2CHRA 3UG5A 3SFKA 3R8GA 1PHQA 2HCVA 2FZBA 4ERIA 4JFTA 4UTLA 1Z89A 1RBAA 4MFDA 3IUDA 4PTDA 1EZ2A 1PTAA 2ON3A 3HPFA 1D3HA 3VIFA 2P88A 5FOOA 4IGMA 1H7OA 3LPFA 4PB4A 3CMGA 4J3TA 5A69A 3TWAA 3GY1A 3HFTA 4ZL1A 4H01A 2BV9A 3U5YA 1OVDA 4LUSA 4NNCA 2VO5A 1J18A 2PWVA 2CBVA 5AHMA 1MZRA 3ITGA 1Y5WA 3DKJA 1K03A 1EJRC 5K9CA 4JNYA 4OUEA 1O60A 1WDPA 4MNJA 1DIKA 2Y5EA 3WFLA 3U0HA 1QWGA 1GJWA 2DSWA 1SO5A 2D23A 4O13A 5T9CE 3UR8A 2YBVA 4MWAE 1UYQA 4JCMA 2IQDA 5K9XA 3RO6A 1EDQA 2E0PA 2DVXA 1QAPA 2EBNA 4GYFA 3V5FA 1BWVA 2AQWA 2EGZA 4MKNA 3G1DA 3GB6A 1M6JA 1H41A 4IX2A 2OWCA 4JEJA 4O0QA 2JK2A 4FX7A 3TAKA 3QBUA 2PWFA 5BYWA 3W2JA 4H7ZA 3GNPA 3GVRA 3BAIA 2ZOXA 4B2DA 4UQCA 4GO8A 4CEXC 1PX3A 3KLLA 3I7RA 4EXQA 4RE2A 3ECQA 2O55A 1KRCC 3C0JA 3BCFA 2QUVA 3M47A 4WUIA 3N2XA 3WL0A 4XQ6A 1S2WA 1PSCA 1GUVA 4ILSA 1SJDA 1S5TA 3C2FA 2WANA 2PODA 1WXYA 3H2CA 3JZEA 3UNTA 2POTA 4GGHA 4W88A 5CAHA 1LWJA 1VR6A 4S3AA 4XAGA 4B3LA 2PDYA 5HUOA 3M0JA 3PS7A 2EPNA 2V82A 1OBAA 3CMJA 5GPRA 3ZMRA 3C2YA 4ZO8A 1YXDA 1K9TA 3RR4A 2XM1A 4LVGA 1F76A 3UGRA 4DWSC 5REQB 1HO4A 4Q33A 1RPXA 1KBLA 4H2HA 1AW5A 1CECA 2C91A 2FGBA 3G1FA 1IEWA 2PPGA 3ZLGA 3CMFA 5H6HA 3P14A 5A6TC 2E5DA 1TV3A 4A3QA 3E0FA 1UWTA 3A21A 4FF7A 3CGTA 3GNOA 1RUSA 1ONEA 1EP2A 1EP1A 3VO0A 2E6DA 2WPBA 5EYWA 2A2IA 1UBPC 3GXFA 5LNRA 5IFTA 3TYBA 1L2UA 4HPNA 4DM1A 4AC1X 1X7FA 5EBAA 1EBHA 1KM2A 1J8VA 3EBVA 3QEZA 2BSLA 3QHOA 1YNQA 4XAFA 4ICNA 4TVDA 4DBSA 3W01A 1DV7A 1A3XA 4IXHA 3KTCA 3DFSA 3MP4A 2OYMA 3E6EA 4LS0A 3WMLA 2ZZ5A 2YKKA 1K4HA 3EWBX 1FOBA 4IL2A 2HVOA 1OGGA 3NWRA 2J9XA 3P0WA 1QW7A 1FUYA 4EPKA 1G0CA 4JN6A 3ZR5A 1IT7A 1M03A 3T4WA 2G4JA 1ICSA 4GY1A 4QISA 4A29A 4HMEA 3BLFA 4CU7A 3TLQA 1DIEA 4F4RA 4RZBA 3LQGA 5HMFA 4XD5A 5I7GA 3G1HA 5LXEA 3OP2A 1Q7MA 1IGSA 3H7UA 4L4LA 3RIKA 1MEWA 2CYGA 3EX2A 1X39A 4S3BA 5AC7A 3GUGA 1KM3A 3GHUA 2W79A 3N3MA 4O19A 1TR9A 4NJJA 4RE4A 2XH7A 2D0GA 1M5WA 4NI8A 4K8GA 5A5WA 1JDAA 1QHPA 1UROA 4OFCA 3BICA 4I6VA 3DFTA 3W6YA 3S47A 3PWAA 4LW7A 1M7JA 4AHQA 5E9XA 5A1AA 3HIJA 1MEHA 3S2NA 5HNUA 1RCXB 2AGTA 4XAYA 1IZCA 4BCEA 1B3YA 1WNOA 1CW2A 1XYLA 3CZ8A 1FY6A 1XIDA 1LRNA 3Q45A 4O4VA 2WSKA 1CIUA 1G1YA 3CB3A 3P3BA 3P93A 3VE7A 3FSTA 4KWVA 4DBEA 3GDMA 3S83A 2Z6IA 3Q58A 3G24A 1DJHA 4MUPA 3URBA 2OSYA 2DIJA 1JVNA 3LX9A 4JIQA 3LQLA 3LMYA 3NFUA 5CGMA 3W83A 3UG3A 3WQCA 4RZ4A 4LWWA 3O6YX 3F2BA 1W5NA 4TMBA 3PY2A 1E5NA 3GU9A 2D2JA 5GNZA 3G5EA 4U2YA 2GVGA 3LZ3A 4GYPC 4H04A 5DCBA 4M5PA 3ABQA 4W8BA 2NXGA 4WR3A 4HZ7A 1W1IE 1LCOA 4LS1A 1MDLA 1V6XA 3TN3A 3P80A 1EJWC 2RUSA 3S2MA 1WX0A 2WHMA 1I0BA 4F79A 2V5KA 3ITVA 3NQVA 4QSHA 1ZAIA 3SQSA 1FKWA 3E2QA 3S2LA 3U8GA 4RNJA 3AMLA 3E96A 1PDYA 3TTEA 4IGSA 4N9BA 5E0FA 4MWAD 4NXSA 1TJ0A 1QRQA 2PBOA 1JUEA 1ZBWA 2QMJA 2WXDM 2ZTJA 4WJEA 1QI3A 3WF0A 3L2LA 1Q85A 4LVDA 3T2OA 1LTDA 4LUIA 2VCCA 2E5CA 3EDFA 1HKIA 4WRHA 3C0SA 3GDBA 4JYFA 4PMVA 3IAPA 3SR7A 2PMQA 3BLDA 2PGFA 1RK6A 1ONWA 2V8ZA 4GNKB 5FEWA 1RV8A 2AAAA 5BW6A 2CERA 3WENA 3F03K 5F2LA 3KVKA 4V33A 3CWOX 1NU5A 5IRPA 2Y6ZA 4I5RA 2C1GA 3RM4A 4M6UA 2NV9A 1F6KA 1LRTA 1A47A 1QBAA 4DELA 4H8UA 3N6JA 1H0GA 3ITYA 3R10A 1XC4A 4QE1A 4HOXA 5D9MA 4OBRA 3DUGA 1KCKA 1RD5A 3RLUA 3DC0A 3NUKA 3TP4A 3S9ZA 3WK0A 3WQ6A 3DERA 1U5VA 3LYEA 3WJXA 1PUDA 1V0KA 5HNRA 1MXGA 2J7CA 3WY1A 4XSMA 4GVGA 1EF3A 3MMTA 2BLEA 3VDHA 3RRXA 3PJXA 1HT6A 1XH1A 3W87A 1UH3A 2UY3A 4IT1A 4JOMA 3KRZA 4PMYA 4W85A 1VH7A 3K5XA 2OSWA 1PCKA 2FDSA 1V0NA 3C2VA 3QYSA 4NZ5A 2CC0A 3NZGA 1DXFA 3UWQA 4IPIA 4K68A 4NP7A 5AY7A 4AWTA 1W3KA 3VKBA 4MZYA 2YJQA 1TV8A 4DUWA 1PIGA 2V2CA 4O10A 1US3A 3PANA 4S23A 3W02A 2XISA 5CC7A 1JNEA 3RF9A 4D6DA 3BARA 1E43A 3APYA 3ES7A 1GVYA 2DVTA 4DRSA 3VA8A 3TX9A 3ZVIA 2PDGA 3FYYA 1CI1A 3ME3A 2BHUA 4Y9MA 3NA8A 3T0CA 1JD7A 3RU8X 4FP1A 1S38A 3CT7A 1MW3A 3JR2A 1FWWA 1GQKA 3ARQA 1C8QA 4B5NA 4QE5A 4UFJA 3SRKA 2QMKA 2QVHA 2VWTA 3ANUA 4JZ5A 4H9ZA 2PRLA 4DI8A 4CN1A 1FQ0A 1G01A 4W87A 1PWLA 3BJTA 2EEXA 5K7JA 3QR0A 1B3XA 5I02A 3KOFA 4N9CA 2XIQA 4U10A 4ZTXA 1SJCA 1C3FA 1SZRA 2DEPA 3KDOA 1XYZA 5LIKX 2EG6A 1I1XA 1W5PA 3ATZA 5D4YA 3G77A 4ZQPA 1AJ0A 3UCQA 1W1VA 3O7UA 3KFTA 3W0KA 4HK5A 3KZPA 3S5NA 1XP3A 5AVNA 3GTXA 3R2GA 4B5WA 1QATA 3A4AA 1CGVA 3OQ8A 2HBVA 2EPHA 5DMNA 1H5YA 4QHRA 2YCLB 4ORMA 1OM0A 4PN2A 1KM4A 4CD7A 2FB2A 3EZ4A 1XLMA 1SZFA 1MZHA 3B06A 3T07A 2DP3A 3TQVA 4CQDA 5FAJA 4GI4A 4Y8EA 4GQBA 4XIMA 4BEQA 5HWJA 4ZE4A 1F3WA 5A2AA 2CHOA 4U31A 3E49A 3ABOA 2ADAA 2TSYA 3HGRA 3ZWTA 2PRHA 3VD7A 4ZTYA 2WZIA 3AIWA 1NWSA 4NJIA 1V3HA 3B3DA 2W9MA 3USZA 1XBVA 3EB2A 1FWEC 5HJYA 3ABXA 3KUMA 3WBXA 1DE5A 1W1YA 2Z4GA 3NQ6A 4QP0A 3UZZA 3W3OA 3DFQA 2FPVA 5EY5A 2OGYA 2A5HA 3MPGA 1IE7C 1GKQA 4DVOA 4IPNB 1XLGA 2DH3A 3DFNA 2RDUA 4W84A 2ZYFA 1U5HA 3OO2A 4AY8A 3WJYA 1NWUA 3IJ6A 3V1HA 4P61A 2PZ0A 1S2UA 2Y1HA 1XICA 3C3NA 4DWSD 5CQ1A 3IGHX 3N2OA 3WDHA 1TPDA 4LVFA 4GZIA 3LNMA 1REQA 4MJZA 4FSAA 3EB4A 1OCNA 2FB3A 2FJUB 1Q2RA 1PDZA 2BS9A 2CW6A 3WK2A 2DZWA 5KTLA 1VHCA 4HNCA 4IWWA 5FI8A 3W1AA 1JAEA 2XVGA 3GXDA 4W9TA 4GD0A 4PFHA 1LWIA 3M5YA 3TH6A 1DXIA 2Y7GA 1YDNA 1HX0A 2BVYA 1VGAA 1SPQA 4NSBA 1AJ2A 4EF9A 1IYXA 1B3WA 3WLMA 4RLIA 2BY3A 1I60A 3WF2A 1UUMA 5A8NA 1DJYA 1KFLA 3GNXA 1F8IA 3JU2A 1PYMA 3G1VA 3DG6A 5AYYA 2FDMA 1YPXA 3IVUA 2XIMA 1BAGA 3BW4A 2WV8A 2WNWA 4PTNA 2Z28A 4UTUA 1P0NA 4C6KA 1TV4A 4MY9A 2FKPA 2ACUA 4PB5A 3SN0A 1U1JA 2A7PA 3L5AA 3ES8A 3RLHA 4L56A 3UFYA 5H8PA 4GFSA 3UXKA 1R2RA 1EF2A 1XSKA 2QUNA 3IGSA 3PTDA 1GVEA 3PPHA 5ABGA 5JBEA 1BGAA 3ITXA 4G1KA 3M5XA 1GOOA 4QLKA 3TN4A 2BOGX 1V93A 5KZMA 3QPZA 2OEMA 5CEWA 3TV8A 1GVIA 4U3AA 3W2LA 6ALDA 1EB3A 3GHTA 1TYGA 2PB1A 2ZC1A 1FWGC 4R53A 1FKXA 3VYLA 1OYCA 3LERA 1J2BA 3QY6A 2XGBA 1JPKA 1TMQA 3V0TA 1ZAJA 3TTOA 2WW5A 4KCWA 3KRUA 4P2VA 1DJWA 3H21A 2W4XA 3H70A 4LUSB 3B8IA 1TJ1A 4LEFA 4CVUA 4OQVA 3QGAC 1VCGA 1P1XA 2QXWA 2NVAA 1AL7A 1EDGA 2V3GA 5J04A 1KRAC 1K8YA 1HJXA 2A79A 1P43A 4TO8A 4PH6A 1H1YA 2X1SA 2XVLA 3BLPX 3W7EA 3DHDA 3M0ZA 4O1AA 1VBRA 4XX6A 3N1AA 1WZMA 4UCGA 3LHVA 1LQAA 1GVFA 2Z6JA 2XYLA 2VEFA 2C19A 4NJHA 1KR0A 1UWRA 1IZKA 1M3UA 2RDTA 2VOTA 5MHBA 3SIMA 3R7MA 1VF8A 1GCYA 2CHNA 1CXIA 3WUBA 4GKTA 3II1A 3HPAA 5A8MA 1GEQA 1U30A 1KKRA 2GJXB 4Q7NA 3F4NA 1ICPA 3S5YA 3L66A 1VRDA 1BVZA 3BMVA 4HU0A 1R3SA 3WLHA 5ENLA 1K3UA 2GLKA 2QCDB 4ZXLA 5E1QA 4CNTA 4Q4QA 2ZUUA 4KPLA 4OV9A 3WNLA 4GJ1A 1OT2A 2VYOA 3TJXA 1R3RA 3HG3A 1Z42A 3MA8A 2WB5A 2J7GA 3NJ3A 3RFAA 4HCLA 5AVHA 4KGJA 4Z2JA 4GBUA 4WOQA 3RUBL 3UERA 1NELA 1C8YA 3RCYA 3AS2A 2HSAA 3OLGA 1AVAA 3R89A 3ZT5A 1RR2A 3O6DA 5EFDA 3T0TA 2QPSA 1YMYA 1VLWA 2Q09A 3E38A 2WBGA 1O12A 3FJ6A 3VGGA 1DL3A 2CLKA 3HB9A 4H00A 2XHYA 1NEYA 5U7SA 9XIMA 3B9EA 1H51A 4EKJA 4HQVA 4RCXA 4XAZA 2C14A 4U28A 3HQOA 4Z0SA 3NCOA 4NZJA 4GUGA 1YNYA 3UESA 1BYDA 4F40A 1LBLA 4XUYA 2J8FA 4L9XA 3S1WA 1LQ2A 4O15A 1SUXA 4J3WA 3IV3A 4A35A 1OC6A 2PF8A 4IX0A 3GFYA 3J7HA 3VPLA 2QUTA 2JIEA 1KXTA 4J35A 4HZ8A 1JQVA 3VFCA 3GH4A 2ZA2A 1EHAA 2HE8A 4I6KA 3W6MA 4HZMA 1FWSA 3SJNA 1WE5A 4QBXA 1Q13A 2WVVA 3NM1A 3BMWA 4G9PA 3C0LA 5XIMA 1FWAC 5CPLA 5E6YA 3CUIA 1E70M 2IKGA 1KGWA 1FH7A 1W1ZA 4FNTA 4ACZA 4B16A 2NXIA 3PVFA 5D38A 5LIWX 1NSJA 3NQCA 2X05A 3P84A 1P7TA 5DO8A 2FZDA 2PAJA 1GTHA 1VCFA 3GDRA 2BY2A 4B15A 2QIIA 5DXYA 2EG8A 4RL3A 3C2EA 2E40A 4C65A 2CXGA 3HURA 5JBFA 3HOJA 4FNQA 1SQ7A 4LUYA 1POKA 5A6LA 1CNVA 3WG6A 3SUSA 1JPMA 2EPMX 1WXJA 5BRPA 4BFAA 1Q4NX 3LCWA 4BHYA 5C9UA 3ARYA 2QDDA 3NAVA 4F0SA 1W91A 4FNPA 1EO5A 4CU8A 1UR9A 3H7RA 3PZIA 2GDUA 3TR9A 2ZE0A 4R7OA 5FJOA 1N2VA 3STGA 1SR9A 3H54A 3BOFA 4AF0B 5KMYA 3PAOA 3U7BA 2VGFA 1JULA 3I6EA 3DESA 3UXLA 3MCNA 4E8DA 2JQXA 3EOEA 1TZZA 1DXEA 1NTHA 2OEKA 1V3LA 1GG0A 3VD4A 2G41A 3WN6A 4QDMA 5JU6A 3N19B 2BXVA 3A4WA 3GAYA 2E6FA 3T2PA 1KFBA 3GS6A 3K1DA 4KWWA 7PTDA 1D3CA 1L6FA 3DHPA 3IAQA 5C2GA 1XIGA 2NQ5A 2FZNA 1OK4A 3SFWA 2P1FA 4AMAA 4F0HA 4XUGA 1ESWA 4AZIA 4A05A 1RP9A 3DFPA 3P82A 1YPIA 1KWKA 3C2OA 1PZ1A 4MYAA 3W7OA 3HMCA 4KS0A 3CM4A 2J7EA 1XLBA 3FJ4A 2Q3OA 3FX4A 3WH7A 4WSHA 2GGEA 5LSMA 4YMZA 2CESA 5FSEC 3N04A 2XN1A 4A2RA 3OBKA 1R3YA 4GVIA 3WNPA 1DHKA 4J40A 3QVQA 1BVWA 3LLDA 4AZCB 1TWDA 3NQGA 3I10A 4BI6A 4FOKA 1E1CA 3D3FA 3QPYA 4Q6JA 5KITA 1TWWA 8RUCA 1OFDA 1KFKA 2X40A 3R13A 1MMFA 1AZ2A 2WCSA 3GK0A 2WWDA 1N8FA 1Q6EA 2XH4A 2GK1A 3WF3A 2Q6ZA 4HNLA 1MXDA 2NWSA 4W86A 3QF0A 5G2IA 2Z1SA 4AUBA 2Z0IA 1GOKA 4DQWA 2PURA 2PDMA 3IRSA 2FFCA 4JFVA 4L4MA 3R0DA 5E9AA 4HSNA 5C6MA 3O9NA 2GUUA 2PWEA 4M80A 3WLPA 3ARSA 4HNUA 2BGSA 2XIOA 2Y62A 3LD5A 3VGHA 2J27A 4L4PA 4RDYA 4C7GA 2GYIA 1JCMP 1BLIA 4L80A 1XHGA 2YDRA 1R3TA 1X1OA 3LY0A 3W2MA 4G5DA 3IVTA 1ZSXA 3QOKA 1B3ZA 1Q6DA 1S2CA 3WDPP 4FZIA 3EKLA 1MRQA 3BV7A 3OIHA 1RA5A 1VHNA 3F4WA 3EDKA 4UMBA 2WVUA 3VD3A 1OCQA 4MB4A 3TSMA 1AH4A 1LBMA 2ZBTA 2C71A 1ZNNA 3GG8A 5MKGB 4YTQA 2XFFA 5AOUA 1R2SA 4FXJA 2PDFA 3NZRA 1HVXA 1H7RA 4DY1A 5A6AA 3DCPA 4HKPA 1MXSA 2R1LA 1ZGDA 5CPNA 1D3GA 3MHGA 1B3OA 2OO6A 5CZKA 3GXIA 4HPHA 1CLVA 1SO4A 5A8PA 4AZ5A 2H9AA 1G6CA 2Z00A 1O5KA 1R87A 3EPNA 3LA4A 4GUJA 3K1GA 1WUEA 3V0UA 3TYCA 2FJKA 3SJ3A 2E6AA 4W7VA 3MYOA 3KS5A 1HUVA 4GK8A 1R30A 5F2IA 2CLLA 2E5BA 2NUXA 4Q8MA 2CU0A 2ZZ4A 1VENA 1TR1A 4YTTA 2UY5A 3WH5A 4F3HA 3GZ3A 1Z8AA 2PBGA 4CNUA 1K7EA 2DW7A 1ITXA 3B0UX 3VOGA 3CS2A 3UA3A 2HDJA 3TTSA 5U4NA 1RCQA 2FH8A 3VNMA 5A6BA 3ZZ1A 4UR7A 2YL8A 1P7TB 5E0KA 5D8ZA 4E3TA 1ZENA 4JIIX 2YPIA 2X2YA 5LIXX 3TKFA 3HJZA 5JIPA 3W24A 4Z1YA 2WQPA 3CUZA 3QHMA 3M7SA 4EE9A 3O8AA 1MEIA 2JFEX 4RNFA 1WUFA 2DDXA 1PB0A 4GC3A 5ECUA 1HKKA 2PC8A 1NM9A 3ZT6A 3LHTA 3C8FA 4MSSA 1DJIA 1DYSA 1YPFA 1Y5XA 1XLLA 3TQKA 2ESCA 4AD1A 1XUZA 2A7RA 3B04A 4IP5A 3L4TA 3PBMA 3NL5A 3TYZA 5HBFA 4UTTC 4JFWA 1ZPTA 2PWDA 3MBFA 4EK7A 1U2YA 4OHQA 1LUCB 1EIBA 3PFRA 4H3DA 3E5PA 3QW3A 2VEGA 3MMDA 3QTPA 3VXGA 1L6SA 2ALDA 5FIPA 3P5YA 3BOLA 4K39A 4GG9A 4RW3A 4UTMA 5C8BB 2NX1A 4OV4A 4IGNA 4ZEPA 4H9TA 4GZJA 3T9PA 3W53A 1D9EA 4UQEA 1XPGA 3MS8A 1UH4A 3BJFA 1WO2A 5A2BA 2IUZA 2QGYA 4KBXA 2OELA 4S3DA 3GX9A 4DJFA 3BWWA 3MMUA 2ATSA 5JMUA 5CGQA 4MF4A 5FEPA 3PWGA 2PF0A 1K8XA 4GE8A 2V2DA 4B91A 3NQMA 1NF7A 4WDTA 2NQJA 3PTKA 4H9MA 2E1DA 2CITA 2ZX6A 1EHNA 4EWJA 1NAL1 3BGAA 4QM1A 3RR1A 1WDSA 3WYZA 3H22A 4AZGA 1KQZA 1PE1A 1FWNA 2GVLA 3SURA 1TTPA 2WSQA 3BPWA 2ZUVA 3UA4A 3WH9A 4DJDA 2FMOA 4X63A 3VD5A 3W7NA 3W2NA 4DO4A 4QQUA 4UR9A 1VCVA 2QCEA 4PUWA 3FEQA 4URIA 1NDVA 1HP5A 3NYDA 1VBUA 4GXMA 3K2GA 3W71A 3WQGA 4DWDA 4UUIA 4F0LA 4CKQA 5AYIA 2XH2A 4DAIA 3ABSA 3PAJA 4NNAA 8A3HA 4HCDA 2RJGA 3BO9A 3S5SA 3V0SA 4TU1A 4YCOA 3EMQA 5GJNA 1W3LA 4NASA 1G7VA 1Z44A 3GIYA 4OIFA 1KWGA 3E02A 3HPXA 1UWAA 4UNLA 3GTHA 1J0HA 5FF2A 3WJWA 1SFLA 1VIZA 3ARZA 7TIMA 1EUAA 1LP6A 3U6WA 1WAWA 1PO9A 2V5DA 3NQBA 3ZR4A 4AC7C 1G4EA 4JTQA 4AG0A 2YIHA 2VZOA 3GR7A 1XLAA 1A5AA 1OGBA 3CWHA 3PPGA 3D47A 2W3ZA 4HOWA 2VEPA 2ANUA 2Q8ZA 3I7SA 1XLJA 2YCJA 5DY3A 3WD0A 4F0MA 1QO5A 2W0UA 3KL0A 2DU2A 3GR8A 1JCNA 1A5LC 2OOGA 1E9YB 4DM2A 1W5OA 2C0HA 3QXBA 2NSOA 5MKGA 1LOLA 1KV8A 5DN1A 3NXLA 4P7LA 5CPMA 1Z6KA 2QHAA 4NZ1A 2WC3A 3ZJ8A 1K9DA 3RX4A 1YTDA 1ME8A 4WOZA 4JGDA 4BF9A 3LI1A 3UNDA 2QCHA 2GGGA 3PPCA 4QSFA 3W28A 2QCMA 4ZODA 4ZVJA 4H1ZA 1C90A 3LZ5A 3DI1A 1ZZMA 2V5BA 4FK9A 3AICA 2XWDA 3HGOA 1VBJA 3SI9A 4YTSA 3WQ8A 3KBSA 1EGMA 3BLKA 2I57A 2RFGA 3W73A 1HFBA 4P8UA 3G3DA 2WJEA 5ABEA 5I3FA 5C5YA 4HN4A 2FPTA 3HO8A 4HA3A 1TTIA 4ADUA 5EMJA 1Q5MA 3LCXA 3KOYA 4XD6A 2CIPA 1BKSA 7TAAA 5IOBA 2HEJA 4O57A 2BVTA 3DDMA 4QJ4B 4AFYA 3W7LA 2X0HA 3NZ1A 3TR2A 1R3WA 5CLWA 5AYXA 2BY0A 3AHVA 1GORA 3RPMA 1OB0A 4S3KA 4U5KA 4AHOA 4C5ZA 3CASA 4PSPA 3ZFHA 2YCIX 3N2TA 4RV8A 3SQMA 3WLRA 2X16A 2CLFA 1HL8A 1DHPA 1OFRA 4L7ZA 3NGFA 1RSCA 4F9JA 1TCMA 2HXUA 4FAMA 4F2TA 3EWYA 1NARA 1UJQA 5XINA 4RPQA 1WZLA 1I2OA 3NL3A 1ZHAA 2WSPA 2FFIA 3MYPA 3SY8A 2E68A 3ELFA 4LSBA 4EOUA 1T6MA 5LGXA 3I6RA 3BW3A 1GZ1A 4RPPA 4RJEA 2PTWA 2CKSA 1NY1A 1WDDA 2GWNA 4TIMA 2WNZA 3D3AA 6ENLA 2YYUA 4QJ1A 4RZ6A 1XH0A 3M44A 4JS3A 3EKZA 3T6CA 2Z2AA 5HANA 4DN1A 2IW0A 4HYVA 3WO8A 1A4MA 4Z2LA 1O68A 1UD3A 3BXWA 3VOCA 3VOFA 3S9IA 1JPIA 4LAMA 3UPBA 1Z41A 3SRHA 1TPB1 1KCLA 1M1BA 2XVKA 2CETA 3G0XA 3PC0A 1P6WA 3TMLA 4AX7A 2QJJA 3BURA 3QQ1A 1NDZA 3CXOA 4PTVA 3CZEA 2CZEA 3KTSA 4YWIA 1VD6A 1XM3A 1ZQ5A 4K36A 3NQAA 2CLIA 4RNHA 1ZCCA 3LXCA 4CN6A 3IACA 2ZRVA 2R14A 2OG9A 4MYXA 4AZHA 4MJ4A 3NURA 4JX5A 2OB3A 5FF0A 3CUGA 5JVLA 1ME7A 3IARA 2CLEA 1ZAHA 2ZQ0A 4GJIA 4AYSA 2VM8A 1BYAA 3MT1A 2VRJA 1QPRA 3F5JA 1BF6A 1FP9A 5D8WA 5HNTA 1TV2A 4Z0JA 3M0KA 4JQ2A 4O16A 1V8EA 1JG9A 1R47A 1D7FA 3TROA 4XZMX 3WQWA 5LHFA 1C8VA 4HJWA 3TJLA 5IHRA 2XSAA 4PBEA 4UR8A 1IXNA 3CO8A 3DKLA 1ZY9A 5F1VA 1DEDA 3VMNA 4WVXA 2XFWA 3S1XA 1WKFA 1H7WA 1EX1A 3MKCA 1EIXA 1S3TC 1OADA 2WSYA 1TO3A 4H6QA 3RMEA 5ABFB 3BLEA 1EYEA 3BCDA 2EAWA 4GISA 3SUUA 1SMAA 4GCXA 4M56A 4WEVX 3CPGA 5D32A 1HG3A 3AIEA 4NRSA 4MPKA 4CUCA 4M3PA 2INEA 4QS5A 3NEVA 1TWSA 2ZVRA 3P67A 3CUHA 1OYBA 4IQJA 4XBKA 1G5AA 4AY1A 2PDXA 2JKEA 3G3MA 3BVJA 1S2AA 1BTMA 1PTGA 3AIUA 5XIAA 9XIAA 4Z08A 1H63A 2OYLA 4UTKA 4KMQA 3R25A 4C5YA 1A5BA 2QLYA 1QPQA 1A5UA 3DBNA 3TYDA 1E71M 4KFPA 2FYMA 1FWHC 4AIOA 3NZQA 1OX6A 1TRDA 3LCGA 3FA4A 4O0KA 1PVNA 3W1TA 3H26A 1QOXA 2IS7A 2YCEA 3HPZA 4UTTA 4ROPA 5FEZA 5BU6A 1DP0A 3BW2A 4FOUA 1XBYA 3P6LA 1W8SA 2GUBA 1XRVA 2A3AA 1DWJM 3OLEA 1JDCA 1J0JA 1OCBA 4JX4A 2ZXQA 1CXFA 3WQFA 2O7SA 1OG6A 1VLIA 3QV6A 1E6RA 3MY9A 2YL6A 2VFDA 2OKOA 1L6GA 1JDEA 1IWPA 3GNDA 4FLRA 4Y8FA 3TYEA 3NEHA 1R5YA 2RGLA 1AQHA 1UP3A 1VPQA 2J25A 3TN5A 3TCSA 3POCA 2QJIA 4C1KA 1W9DM 1TIMA 3NQEA 3M46A 1JUBA 1U83A 3PWIA 3ZXWA 1A49A 1IR1A 2JEQA 7CGTA 4W93A 4XG1A 1KFJA 3HA1A 1E0TA 2G3FA 1C9DA 1H09A 3UWWA 4YL2A 1AQFA 3CIVA 4K8EA 3VI2A 4PULA 3VNLA 1DPMA 2QF8A 3TJIA 4YNGA 3CZJA 2PP1A 1NOUA 3GO2A 1BD0A 3GKAA 4FXSA 4P7RA 1G69A 3VIIA 3CL6A 1JZ2A 4DAFA 3NOYA 1MNZA 5DELA 3SADA 6XIMA 2QDHA 3DG7A 4E3VA 1UHVA 4L9YA 4GO9A 1W9UA 4HA1A 3VINA 2Q71A 3M4HA 5TQLA 1JXKA 2DT0A 2GSJA 3WIJA 2V3EA 4E8GA 5EU9A 1I2NA 1LM1A 1SR0A 1XIHA 1UUOA 1B57A 3CZKA 5C0QA 1UKPA 2Q3RA 3LXBA 2G96A 1DJZA 4I8DA 4IH3A 3BC9A 2YOCA 4FIRA 4UXDA 3ZQ9A 1FDJA 4UIOA 3A3XA 4RKAA 4OVXA 4CNNA 3REQB 1VJIA 4D72A 1XGZA 2AL2B 1EGVA 2WO5A 5HULA 1JNDA 3AHXA 4WLCA 4N6EA 4CCCA 2GUYA 5L9FA 4MM1A 1W2PA 4E8CA 1XGDA 4AXKA 2CXEA 2GWGA 3FSUA 4E4FA 2P53A 2J7FA 2XM2A 3AYVA 3TFXA 1UC5A 4LYPA 1UZ4A 3NGJA 1FH9A 4NT0A 3UJEA 4TX8A 4HA0A 1GPFA 3CHVA 1SW7A 4X2RA 2Q01A 2ZA1A 3K4WA 1BWLA 3NQ2A 3PUDA 4S2BA 2D0HA 3QZEA 2G3IA 3CTTA 3EOUA 1B5TA 3ISIX 3LMZA 2BB0A 4V1YA 1DORA 3APTA 4Q8NA 4GMEA 1UKSA 4C6QA 3W07A 3SW6A 2GGIA 4HBKA 3GIQA 4RV3A 1E5JA 1UD8A 3DXIA 3OPSA 3ENLA 3M0XA 3HQ1A 1PWMA 2R82A 4QLJA 4RDZA 2CZDA 3THCA 3CL8A 1EJUC 1WPCA 3IJQA 4AZ6A 3FN9A 4JY8A 2QT3A 4XO7A 3K30A 1HJSA 4C6PA 4MVAA 1YLVA 2FZMA 3POHA 2WK2A 1XYBA 3STPA 5F4WA 4F9DA 3O6CA 5A6MA 2F38A 3TOPA 4Z1CA 5E5CA 4W7UA 4DWSB 4GI9A 1PAMA 2HXTA 2PDPA 5DQPA 1XF0A 2Z27A 2CEQA 3TQ0A 4O1CA 1A5KC 1XRSA 4RR4A 4A8LA 3L4YA 1E0XA 1Q63A 2TMDA 4JL1A 2O7QA 3TC7A 2VZUA 3N6HA 3A23A 1RQBA 3OA5A 1OX4B 2XJ7A 4US6A 4MJMA 3A6OA 3UG8A 3VIMA 5EKYA 1SM9A 4J2MA 2NQ9A 3UWEA 1Q3NA 4HK7A 2CZ5A 4B5UA 2FLIA 4IG2B 4R85A 1GOIA 4BF7A 4I9TA 2OZ3A 2C0AA 3MHUA 1IEVA 1JPDX 3PTQA 1RK5A 3H4XA 3IANA 2YZRA 1UIPA 2J79A 3WDRA 1XD1A 1CXEA 3IGUA 1WZAA 3BAXA 2WMIA 1LL7A 3HN3A 3VK5A 1JIBA 4AD2A 3AXKA 3E5BA 4I9JA 1QI4A 1X1ZA 3EX1A 2GFTA 1W3JA 5T26A 3M16A 2A3CA 2I16A 5M03A 1O66A 4EP8C 1XKJA 3WEOA 1OY0A 4WSJA 3B8DA 4MFEA 2VUYA 3MBDA 3O07A 4LC8A 4D6GA 3N4AA 3W1PA 1QW8A 2X7WA 3WEMA 4C7DA 7ENLA 1QPOA 3IJLA 1UWUA 3YPIA 4L6OA 4L65A 5KZ6A 1XG4A 1EC7A 4IF2A 1GG1A 4LBRA 1Q6QA 1BG4A 2HTMA 4HPJA 4AIBA 4J3XA 4INFA 1PL9A 5D37A 3W2UA 5I3GA 1X38A 5A95A 1PZ0A 1HF6A 3V18A 3ITOA 1FCVA 4BF5A 3GXTA 3N2MA 4IIBA 3ARWA 2CPUA 4FLOA 1UKTA 3PJWA 4KETA 2VGBA 4D8LA 1J11A 4V28A 2BXYA 3W4RA 1NOFA 3KBWA 2HV5A 4W4QA 1KTBA 4EWND 3W1MA 1MDRA 4OOZA 3S3GA 2WNQA 1Z9AA 2BFGA 3WBYA 3CK5A 4L5ZA 4AY7A 3H4WA 3FKRA 3L0GA 3U57A 4O52A 3FVDA 2OCZA 4UTHA 3U2OA 3PBWA 1EL3A 5K2ZA 1GVOA 4RX0A 3N14A 1E6QM 2QPUA 4BI5A 1GHSA 2PDWA 1V6YA 4LAZA 4Z2HA 2XU2A 4Q4OA 3BH4A 4RZ5A 1PKNA 1UG6A 4EAYA 4JTGA 2TYSA 2ACSA 4W8AA 2O9RA 1XLCA 4EACA 1AD4A 4H6RA 4UFMA 1QNRA 5CAKA 1EDTA 4MAZA 4LVBA 3CJPA 4X0NA 4HYWA 4JFSA 1XL9A 3LSCA 3ANVA 2Y8VA 1TWIA 2QCNA 1OJXA 2QJMA 3OHIA 2G3MA 5IM51 3TNOA 4C1LA 4GQ0A 4P8WA 1RY8A 3MW7A 3O63A 1I8JA 3IVSA 3R94A 1KKOA 3SY1A 3W25A 3Q65A 2PTDA 2Z1WA 4LQ1A 4ZO9A 1OFQA 4LXFA 1NQKA 3UD6A 2PDLA 1XUUA 3QRHA 2P8CA 2ABBA 2D22A 1XISA 2JKAA 4CQ8A 3QKEA 7ODCA 1QMLA 2NV1A 4IIHA 1IWBA 1RP8A 3N9RA 4HSOA 3DECA 3UT0A 3SCSA 3T0BA 1S3HA 3CEUA 2ZZ2A 3TK7A 3KZSA 4IJCA 4GJJA 3PZVA 2VR5A 4EX4A 4XVDA 3GYEA 4LT9A 4GYJA 1MW0A 3W7PA 1CGXA 1ME9A 5K4ZA 3T8LA 1ZP4A 4DZHA 1SW3A 4WQ6A 2B7QA 3VNYA 2I14A 1A5CA 6TIMA 4JKLA 3C56A 4C7FA 3GD6A 1G4PA 3IJ8A 1DIDA 4QX4A 2A3BA 1OC7A 3Q67A 3ID7A 1EOKA 1EQPA 4G7EB 1J5TA 5CSRA 4J3SA 5JBDA 1WP6A 2WMHA 1KC7A 4H9YA 3DI0A 1ZTVA 3AXMA 4Q8VA 1KGUA 3GXNA 4JFUA 1V51A 5G1MA 2XFRA 1UR3M 2BWGA 2ZX5A 4GUHA 3H6OA 1Q6CA 1BYBA 4LU0A 2Z29A 4UC5A 3FEMA 2BVWA 3W26A 1CGTA 3OB8A 1UPMB 4KT2A 4EPDC 5JUVA 1FWIC 2VDHA 2J9YA 1UQZA 5K3VA 2XGZA 2HNEA 2D2GA 4H2CA 4MB1A 1RH9A 4S3EA 4HA4A 2AL2A 5FEXA 4Q4RA 1W17A 2J66A 2E9LA 4ZSTA 4YVPA 1G7UA 1A5MC 3E2VA 3WEZA 2YLLA 4R3UA 2YCLA 5CCZA 2EKGA 3EA1A 3EOOA 3TVAA 5D05A 4K37A 4IP7A 2NWRA 1KTNA 3SUWA 4TXEA 2X41A 2G97A 1ZP3A 2X1TA 4RXGA 3VE9A 3QY7A 5F7UA 3QFEA 1K4GA 3AHTA 2KX9A 3PJUA 1KGXA 1Q66A 1D8WA 1R7AA 4MY1A 3H2AA 4MKVA 1MWOA 3H24A 3KBJA 2ZX7A 1EJXC 2YFNA 1LROA 1Z32X 2I9EA 1X7IA 1EJTC 5DMMA 3CUXA 4FXRA 2WM1A 1JZ8A 2C3ZA 4K8HA 3TN6A 3BAWA 1F5ZA 4CEUC 3IJDA 1DWFM 2QKFA 1NDYA 4IPPA 2YXOA 5CJ5A 4O11A 3WJSA 1MUMA 5I77A 3G1AA 2D2HA 1GTEA 3MSRA 3M41A 1CLKA 5DANA 3V75A 4LGXA 3N2BA 5LA2A 1L8NA 3L23A 3JVAA 4KGLA 4UQ9A 4A8RA 2ICSA 5I3HA 3GXPA 4MDOA 3A47A 1X96A 3TW6A 1P4CA 4HIBA 3UVIA 3L5MA 3H12A 3D5HA 3QC0A 2DZVA 5TBOA 4NQ1A 1WV2A 3WLOA 2AKZA 1S1RA 1EJVC 4GY0A 4J9JA 1DTUA 4OBTA 2Y5SA 3SRDA 2AGKA 2GOUA 3UWVA 3STCA 3AALA 2WZHA 2WC7A 2I5QA 5JIWA 3BZJA 4QG6A 5EBUA 2G5WA 3UU0A 2A85A 1OZQA 2BXZA 2PDCA 2UBPC 1PIIA 1XLFA 2VP8A 1LL4A 1TREA 3ONBA 2GQAA 1EA0A 3OGSA 4RE3A 4Y2WA 1QI0A 4B5VA 4BS0A 2Q02A 2OXNA 3SDOA 5FJJA 1ECQA 5CXPA 1BKHA 2R24A 1J0IA 1KB3A 4XD3A 2NZLA 3OLDA 5DFAA 4YYCA 4NX5A 1S5NA 2H8XA 2YBTA 5HK4A 3MI2A 3WJZA 4LALA 4NNBA 5CGTA 4K7VA 3WLKX 4ACZB 1AH3A 4LY8A 4XZWA 4FLSA 4AEFA 1H62A 2F9RA 1LJYA 2FTPA 5M2FX 4JQ3A 3OHMB 1CENA 2OT1A 5CPSA 2BMBA 1G67A 3UWZA 4UWMA 4HN8A 2BOEX 2H8ZA 1ZALA 1R0MA 1CT5A 3REQA 4OBSA 3RCNA 2QCGA 3FKKA 3Q37A 4KQNA 1P5BA 2XPKA 4AEEA 4Z2IA 1YE6A 4FEZA 4BEUA 2OTDA 4D1IA 3N4EA 4UCFA 3G1YA 1KFEA 4H9VA 3MDWA 1V6UA 1V7AA 3FYPA 4KCVA 4JEQA 4MNMA 3RM8A 2Q8LA 1FH8A 2OZTA 3Q2DA 3PZ9A 3UWUA 5LHEA 4KFOA 1TB3A 3ZJKA 3VIOA 1TX2A 2A6NA 1XIJA 1MRAA 1J9YA 4ZOAA 4GBDA 5EFFA 2BDQA 1H4PA 3DGBA 1Y7VA 3MTWA 2PD9A 3N29A 4P8XA 3CAQA 2FVLA 3KE0A 3PHAA 2CBIA 2WC4A 1L6YA 1TTJA 2NT0A 4GIEA 1E15A 3BLLA 3BV4A 2YXGA 2V6AA 2YDQA 4AXNA 3AZSA 3B0PA 3SRFA 4Z17A 1ISVA 4EVZA 1G94A 2ZUSA 3P61A 3QSTA 4N9DA 3EKGA 3ZJ7A 4B5SA 3NNTA 4Q8OA 3N12A 2EJAA 1E4IA 4GA8A 5IXEA 2V5LA 4MADA 3VTRA 1PZ3A 4PRTA 1W9PA 2QV5A 5CBBA 1LQ0A 2YXXA 2VMFA 3ZVHA 4UMCA 2VJXA 4AVOA 1XW8A 1UD5A 2Q8XA 4D6EA 2CLOA 2YBUA 4GIAA 2J62A 3WF1A 1OINA 3BL3A 3EX4A 1P1MA 1QDSA 4KCTA 2VI0A 5EMUA 3S5ZA 1R7OA 3GZAA 5C9RA 1P0EA 2E6YA 3WMBA 4B2DD 2WMGA 4PZVA 3QR3A 2ZRZA 1F61A 4AX6A 1TJPA 1QHOA 5C54A 3ITCA 4DEFA 2E77A 2OGJA 4JTKA 1W3NA 1YADA 4CNPA 3UY7A 4WD0A 2ZDSA 1EWDA 4A2SA 4DJEA 2IXVA 1NWRA 2WYSA 4IMAA 2OX1A 4M8UA 1CLXA 4ML4A 3LTYA 3L2IA 4JDBA 2OYKA 3I3BA 3FAWA 4JTCA 2OVLA 2XINA 4IIGA 3F4CA 3MWAA 2PU1A 1G4TA 1TV5A 2P0OA 4QG8A 3RILA 2JGYA 1KCZA 1TTQA 4MNKA 5EB8A 2J6XA 2HBXA 1H1ZA 1P6BA 4HHMA 2J78A 4UNKA 4NAFA 3VMOA 2AKMA 1PV8A 1ML1A 2YFOA 1Q65A 1JXJA 1IEIA 2ABAA 3R0KA 2WM0A 2BGQA 4LAOA 3VDGA 4PR4A 3TLLA 1OFBA 5A6SA 1ITUA 2DT3A 4XISA 4TVUA 2VD8A 4I9AA 3LHZA 3R11A 1J4EA 5D33A 2YR1A 3AMKA 9RUBA 1VEOA 1W2VA 3QOMA 1BXCA 1HKVA 4WGHA 1QNVA 3GG7A 4GRSA 5D04C 4UQBA 3APGA 1ZL1A 4WF7A 3G8RA 3OLIA 3NQ8A 3WBEA 1KA9F 2QCLA 3GM8A 4EAMA 1A5OC 5D9OA 4LX4A 1HW6A 3T42A 4C6DA 3UETA 1F9CA 1F3XA 4JR5A 3SCOA 3F2CA 1JGIA 1GZGA 1XPYA 2Y8UA 5FF7A 5I5RA 3LCFA 4MDPA 3QMSA 2OLHA 4M7TA 3PZOA 3VC6A 3W27A 5CPQA 3KWSA 4JTEA 5F4SA 4IOTA 5FSDC 4AU0A 1TZ7A 5JH1A 4FO4A 1BWKA 1C93A 2OODA 4AD3A 2ZVIA 1FFQA 3AXXA 4AWSA 2D20A 1GQNA 4RUBA 4O4WA 4ZOCA 4FB7A 1WQ5A 1MFVA 4WY0F 2V9DA 4LB4A 1KTCA 1LT8A 3TC6A 3W7IA 3GG0A 3GG1A 4JDYA 5H2ZA 3CTLA 3L2MA 5DEZA 4JTDA 1JFHA 2E7FA 3T09A 2E25A 1GW9A 3MKVA 3MO7A 4I7VA 3UGVA 1XBZA 4RK8A 4XKMA 4WDXA 1KRBC 4WY0B 1B1YA 1K7XA 1HIZA 4PMOA 2BNJA 3W86A 4QE4A 1TPVA 1EC8A 5J8LA 2W5FA 3DAQA 4O1BA 1VB9A 3WQOA 1EYWA 5PTDA 3WSUA 3F5LA 4CCZA 3JW7A 2V5CA 3PZQA 4PODA 5DRCA 5FD0A 4QJ3B 2DGAA 4A3RA 1XR2A 1VJZA 2ZRXA 2WKLA 1VQTA 1VFSA 3S6OA 4D8AA 1HVQA 4FX8A 4IFKB 3RO8A 4C91A 4OGZA 1V3MA 3BK0A 4PCSA 2G95A 4L4OA 1OFAA 4C6CA 3T0DA 2Y85A 1JR1A 1EP3A 1WOBA 3U4FA 1E6XM 4JTAA 4QCFA 1NIUA 2E1WA 4KFNA 5K4XA 4LOCA 2ISWA 3WZ0E 1OK6A 3B03A 1V08A 4UZUA 3OOQA 4E4PA 1O95A 2WNNA 1QNSA 3TONA 2GDQA 3K46A 5DY2A 5FESA 4GFIA 5BMXA 3RHGA 1XDMA 3LI0A 4HHLA 2VWSA 1BRLB 1I2PA 4Z2KA 2D0FA 4QGCA 4BQ3A 1KV5A 3EOLA 1YE4A 1IIGA 3PG8A 1PXGA 2DZAA 5BRQA 2PWUA 2YDAA 4PUDA 1B2YA 3LPGA 1EEXA 5TF0A 2OLSA 4AHPA 2CFFA 3IJIA 1SVDA 1EUNA 3DBPA 3DENA 4EPEC 4XZHA 1H7XA 1HQTA 1MI3A 3M07A 1CPUA 2W91A 4C6OA 3LBMA 3VKCA 1ODUA 4XAPA 3UCCA 4JQ4A 3W85A 3NOEA 4FR1A 1R86A 4AEOA 4POCA 2GK1B 4KESA 3S1VA 5A2CA 1XCXA 2W92A 4J3UA 3ANYA 1VEPA 3FOKA 3M43A 2DUXA 3BCJA 4GI8A 1AW1A 2WBKA 4JXCA 1X97A 4CD4A 3W37A 4A8NA 4HU4A 3EEZA 5FJRA 3ZJ6A 1V3JA 1IEQA 3CHFA 3BDKA 5CJMA 1A50A 4ZFMA 4GVFA 5C55A 5AHIA 3WH8A 1A3HA 1XLKA 1EOMA 3MV11 4FIQA 3TQPA 3M0HA 3MSGA 1RJQA 3BQ5A 2QJHA 6A3HA 3WNMA 1ENUA 2DUAA 4Z1BA 2Z2UA 2VFHA 2Z26A 3NL6A 3CZGA 3ZS4A 3GSMA 3MWCA 3GUWA 1QO2A 5HAOA 3GDKA 6TAAA 1VFUA 1X6NA 3AIRA 3LK6A 5DMLA 1CTNA 5G5IA 4MPQA 3BSGA 2I9UA 1YW1A 1VS1A 1GEHA 1QU4A 4PMJA 4GY7A 5F4XA 3DC8A 1UBSA 2OT0A 4M0XA 2IPJA 2DW6A 1JDFA 2R1MA 5A3HA 3EMZA 3IIZA 4X61A 1J2WA 2DQXA 3DYPA 4QROA 4Q32A 4IGHA 3UZ5A 5DMYA 7REQB 4CU6A 4PEEA 4N2YA 3R4IA 1QK2A 1WDWA 3UBPC 4Q8WA 2NX3A 2FHBA 3ALGA 2V2HA 5EMYA 3W1NA 1CWYA 2WPGA 2VZTA 4CD5A 3QTGA 1EH9A 4O0ZA 3D6NA 4G8TA 3WD3A 1LG2A 3M0YA 5D2WA 3GH5A 3PJTA 3S4TA 1DWGM 3H2NA 3CHDA 3KVJA 5DBUA 2Y7FA 3IUHA 4Y6GA 1VYPX 2G37A 2WSRA 5CZ0A 4DUOA 2WLYA 5CBIA 4QDPA 2QCDA 3LENA 3C52A 3RM9A 3OJGA 2ZWYA 3E9AA 3H7VA 3TSBA 4HSHA 1HL2A 4IL0A 1JYWA 3EYPA 1V77A 4R5EA 4GXPA 2G8ZA 2BHYA 2C7FA 3C86A 3B9AA 2WZEA 1U1HA 1J96A 3CUJA 2BODX 3HG4A 2Y88A 3LTPA 2VC5A 4KIEA 1YQ2A 4TX6A 4X0VA 3PZMA 3S6TA 3PM6A 2OZ8A 2XSBA 4PB3A 3A24A<