3KRZA

Crystal structure of the thermostable nadh4-bound old yellow enzyme from thermoanaerobacter pseudethanolicus e39
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
335
structure length
335
Chain Sequence
b'SILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalysis with thermostable enzymes: structure and properties of a thermophilic 'ene'-reductase related to old yellow enzyme.
pubmed doi rcsb
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
source organism Thermoanaerobacter pseudethanolicus atcc 33223
molecule tags Oxidoreductase
total genus 129
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3krzA00
4ORIA 1IXQA 3EX2A 3BGJA 1HTIA 2PCQA 3DKJA 1RV8A 3LHVA 1DOSA 1K7EA 1CI1A 2QUTA 1G67A 4YWIA 1FWWA 2WV8A 3HG2A 2NWSA 4M6PA 1G4SA 4PL1A 4LW7A 4N6FA 2Y7FA 4RXGA 3P8JA 3G1AA 3F4WA 1DJNA 1TCDA 4YXGA 1WV2A 3H54A 4JN6A 2E5DA 4NVTA 1L9WA 3LRLA 1LP6A 3ATYA 3QJAA 2Z0IA 5D32A 3PG8A 4HN4A 3EKLA 4DF2A 1JR1A 2Q3RA 1A5BA 1WOAA 2Y89A 1TPH1 3W1QA 4Z1AA 5AC7A 4E2BA 4O54A 1ZAIA 3M5VA 4Q4KA 2DJXA 3LV5A 2EF9A 4O13A 3FIGA 2YW4A 2A0NA 1WDWA 1ME8A 3CEPA 3TQ0A 3NGJA 5DY3A 3R89A 4TMBA 3PUOA 4AHQA 1UASA 5EY5A 1K03A 3PBYA 2DZTA 4JTGA 4ONVA 1HG3A 5BRBA 5D05A 2YYTA 1YPFA 5FF2A 3TCEA 2CLLA 2WO5A 2GPTA 1SO4A 1X6UA 3ATZA 4NQ1A 3WK3A 4J9JA 3GDRA 3HMJG 1Y0EA 3M16A 4POCA 1WA3A 2Q8ZA 4UMAA 4FXSA 2ZDRA 3W7DA 4R33A 4Z08A 3QW4B 1V7YA 3NDOA 3T44A 2JK2A 3MP5A 2GVLA 5LHFA 1TSIA 1OJXA 3BGGA 1GYNA 1B3OA 5I3JA 1LRTA 1KTBA 2C0AA 4R34A 2Y88A 3M5XA 4K6AA 3N2XA 3GKFA 1O60A 2TRSA 1NF7A 1HUVA 3E49A 3PSVA 5BNKA 3C2RA 1LM1A 4H4IA 5CSSA 3IVSA 4AF0B 5AC8A 2YFNA 4ADUA 4K8EA 4GWEA 4Y6GA 3RLVA 3THAA 3DZ1A 4N4PA 4CCEA 2NZLA 2WSRA 1KV5A 1VR6A 1W5NA 2TYSA 5E1QA 4O19A 4IQLA 5AN7A 1NVMA 4CCCA 3G0UA 4UFKA 3GAKA 4AWUA 3O06A 3W1AA 1VHCA 5LNRA 1X1OA 4HSOA 1PS9A 3TSBA 4GRSA 3S8HA 4FNTA 3LCIA 3UNDA 5IBXA 3EX6A 4DBEA 4HNUA 2J9XA 3R12A 3FKKA 3G1DA 5F4SA 4ADTA 3RU6A 4GUJA 3QEZA 2XN2A 5D2VA 5AYZA 1LBLA 4PCFA 1GTHA 2EHHA 4AF0A 3NPVA 1FDYA 4O1AA 2FLIA 3TNOA 1PCWA 4PH6A 1FQ0A 1LYXA 4MZ1A 2FDSA 2O7SA 1OX4B 2JGYA 3WJZA 3E96A 4JS3A 2WPBA 3DHDA 4HPXA 2HMCA 2QCFA 4BWLA 5AB3A 5G1YA 3DFPA 4DO5A 1B9BA 1EIXA 4IMFA 3P7YA 4JDYA 1GVSA 2ZZ2A 2FPVA 2WKJA 5DXXA 1XI3A 3LRMA 4FB7A 4JIPA 4UFHA 4CQ9A 4BR1A 1JUEA 1SW7A 6ALDA 3TIMA 1LORA 1J5TA 1K3UA 1L2UA 2DJLA 4MPQA 2A21A 2CLEA 4O1CA 3W1NA 2CZ5A 2Y63A 4L4MA 3S1VA 2I1OA 1XCFA 2HS8A 1OX4A 1EWDA 3NQ6A 1OFRA 1L6YA 3BARA 1YTKA 4UTTC 1N8FA 3MP4A 5FF0A 3A21A 1TV7A 1TPB1 3BLEA 2Y7EA 3NM3A 1W31A 2A7RA 3BPWA 3TSDA 1VHNA 1PCKA 1X7FA 3IVUA 5GVJA 3LXCA 5C5YA 2Y61A 4KFPA 3BV4A 3KHJA 3CU2A 3I68A 3UXAA 1H61A 1JRBA 5D33A 3NEVA 1EWEA 4R7JA 4TO8A 4DPQA 1YPIA 3O07A 5EBUA 1ALDA 3VE9A 4WUIA 3MW7A 1C8VA 2NXGA 4BI6A 3O8AA 1TTPA 2YZRA 3PS7A 1Q45A 2ISVA 1NF0A 3CWOX 3B05A 1SZEA 3S1WA 2IQTA 4XTDA 4LNYA 1TV8A 5BMXA 2QCGA 4K8HA 4NJHA 3GAYA 3QMTA 1Q6QA 2J88A 1ICSA 2QDGA 2YX0A 2C15A 3TSMA 1OHLA 3UY7A 2CLIA 1G4PA 4N4QA 1VS1A 3W87A 1TPDA 3RK8A 1FX6A 2ABAA 4DBDA 3SW6A 1XBVA 2FB3A 2ZZ6A 3F1QA 3L9CA 4IXXA 2H3DA 3PBUA 3L21A 3UPBA 3B06A 1H63A 6TIMA 4O57A 4JTIA 1F2JA 3I7SA 4OBTA 1KM6A 2WOQA 2Z2UA 3LCFA 3BW4A 4YL2A 2QUVA 3BG3A 2DP3A 1UCWA 4WD0A 3RFAA 2OMAA 3EB2A 5LNUA 3W2NA 2B7NA 4O17A 3AO0A 2E1DA 1AW2A 2NXHA 3P80A 2A7PA 4O11A 3STCA 4S1FA 3W7EA 2C13A 3R13A 1UB3A 3L68A 1JQVA 4WY0B 2DZXA 2QCMA 3CWNA 1VYRA 1WX0A 1KM5A 3CTLA 5CPMA 4FIQA 3DKLA 4NUWA 4HNVA 1KM3A 3TW7A 1FUYA 4LVDA 1KV8A 1QPQA 1U5JA 4YMZA 4UFJA 3PVFA 1H60A 2C6QA 1OFPA 4TR9A 1OK4A 3GK0A 4AWSA 4XWUA 5HULA 2GUUA 3L0GA 1TYGA 4LS2A 3QW3A 3NAVA 4NZFA 3NQFA 4WY0F 3W2KA 3WK1A 3A23A 3M44A 4K7YA 3W7CA 4CLMA 2Z1BA 3STEA 3G3MA 4JTJA 5HWMA 3F03K 1L6SA 3U2OA 3UD6A 2J9YA 5H91A 1VC4A 5HWNA 3TJXA 5DBUA 3BK0A 3HQ1A 1LRQA 5H2ZA 4LUJA 2YCEA 2VFDA 4LTSA 1XBZA 2G96A 3LBCA 3YPIA 1TREA 3I7QA 4QSHA 4HNTA 3QM3A 4MZYA 1I2RA 3QC3A 4NZJA 4XZ9A 3SZ8A 5G4WA 2G97A 2Y6ZA 4JYFA 3HG5A 4GUIA 4UTMA 5LNVA 5TIMA 2FPYA 3TU9A 1TIMA 1R2RA 2RDUA 3MJYA 1OF8A 5AHIA 4Y96A 3NL5A 2YYUA 1ML1A 4ZQNA 2VKZG 4NJGA 2QCNA 3SI9A 3O15A 4WOZA 3UWZA 3HBLA 5FI8A 3FJ6A 1TPUA 1K7FA 4PTNA 1TPVA 2AGKA 3W75A 3C0JA 4O18A 1GVRA 1TRIA 3C6CA 4IOTA 3P5ZA 4O28A 2QR6A 2NX9A 3OHIA 4HNNA 1JJKA 3O6YX 3C2EA 1L6WA 2ZRWA 4AB4A 4EIVA 3PB2A 4JTSA 5C55A 3LHYA 2DZSA 4UTJA 3W86A 2BX7A 1V5XA 2V8ZA 1KTNA 1LZOA 5AHMA 4IWWA 3EWXA 4AXKA 1DVJA 4LVAA 2YR1A 4A3UA 2JKPA 3GVGA 3ZFHA 1JRCA 2ZA3A 3CIWA 2J9ZA 1K02A 3LHZA 4MUZA 1ZFJA 1SR9A 3I6RA 5AHNA 2QF7A 3EXTA 4BFAA 1LROA 2Q3OA 3QYQA 3P5YA 3M5YA 1YADA 3IIPA 5KITA 1DQXA 2EKCA 4FIRA 5K2ZA 3ZWSA 5U7SA 4UFIA 1ICPA 1I2QA 5AYYA 3I65A 1EEPA 1KLYA 3S9YA 1MZHA 3FYPA 3KRZA 2ISWA 5FF7A 5K7JA 1O5XA 1QR7A 2E5BA 2WSYA 1YLVA 3LHWA 1H7XA 1JCLA 3DU0A 2XN1A 2ZA1A 1QO2A 2V81A 5K4XA 2JGQA 1R2TA 3O6DA 3STFA 3MWAA 3TQKA 1F6KA 3DBPA 2NX3A 1S5VA 3ELFA 1VCGA 1X8FA 3G1VA 1GZGA 3B4UA 3LLDA 2A1YA 3G0SA 3M5ZA 5E0KA 3N9RA 4RKAA 2PRHA 3BG9A 3DI0A 3W7JA 3P82A 1H62A 1B57A 3C8FA 1XKYA 4JIQA 3T40A 1H7OA 4MKNA 1TQJA 2Y62A 3PULA 4KFOA 2E6FA 3GR7A 3E02A 4K36A 4CNNA 1G69A 2QJGA 2BTMA 4Q33A 1AMKA 4LRTA 2PRMA 3PWAA 3QMRA 1F7BA 2AQWA 1OYBA 4MIMA 2XFWA 4S2BA 1N55A 1SW3A 4K7VA 2CFFA 1W5QA 4O0ZA 4JTLA 1RD5A 1BTMA 1BEUA 2CLMA 3E9AA 3ABQA 3QZEA 3GIYA 1YDVA 2X2GA 1OFDA 3EWUA 3S42A 4AVFA 2WNQA 3L2IA 3V1PA 4FNPA 1KM1A 1XC4A 3THQA 2ZZ4A 2FPTA 2J27A 4CQAA 3SR7A 4RX0A 4KWVA 3W73A 2W6RA 3W07A 1RQHA 4OWGA 2WNNA 1DJQA 2F84A 3FA5A 3GXPA 2YGYA 5CZJA 3L65A 2YW3A 3TQVA 1DQWA 4I7UA 4GUGA 4MVAA 1H5YA 1VJIA 3FLUA 5CZ0A 2CWNA 3NQAA 4JEQA 3FYOA 3W1TA 3W7PA 4I7VA 3GDLA 1RQBA 4WXYA 4RZ6A 5FEPA 3ABRA 1EUNA 4N2YA 1S3HA 4GFSA 1IXNA 3GDKA 5MHBA 2VENA 3HJZA 4O4VA 2UV8G 4N9EA 3W2UA 3HB9A 3OEXA 3I7RA 4AH7A 2DZVA 5KSWA 1I45A 2V2DA 1DORA 2VFIA 2G95A 1MSSA 4IGHA 2ZFAA 1VRDA 1TJRA 3QF0A 5I3KA 1SZNA 5J5RA 1A5AA 1LOLA 3FKRA 1WYIA 2FFCA 4I7WA 2Y85A 5CPOA 3EWYA 1FXQA 3CM4A 2BLEA 2ZA2A 1RVGA 3G1FA 5L9FA 3TFCA 4UMBA 3A5VA 1YXYA 1RQEA 2VELA 3LCHA 4XUGA 4PC8A 4RLIA 5I3FA 5I3GA 4JR5A 2YXGA 1AL7A 4A2SA 1ZY9A 2BZNA 2ZZ3A 2E68A 3PBWA 3IEBA 3NVTA 1GVOA 3G24A 5D09A 4JY9A 3NOEA 5D04C 1HO4A 2QAFA 4O16A 1LTDA 3W76A 3BW3A 1I2PA 1W3TA 4LWWA 4FXRA 4UTIA 4LC8A 3LCWA 1P0KA 4LU0A 2Z6IA 3LBMA 1FWRA 3M47A 3W7LA 3QQ0A 1YDNA 4X3ZA 4RV8A 4NJKA 3FOKA 3QQ1A 3CC1A 4EOUA 5KZMA 3W7NA 1TPEA 1A5SA 1T0OA 3KVLA 2TPSA 4B5NA 2VFHA 4GXMA 2QJHA 2C18A 3EWBX 2GQAA 3U8GA 4YCPA 3HPSA 2VEPA 3GYEA 1TO3A 3HG4A 3W1XA 4QNWA 1TPFA 4W9TA 3UY8A 3LGEA 3PSWA 4A29A 1GWJA 1VLWA 2OCZA 4HHPA 3NQMA 3MI6A 3UZJA 1Z44A 1XBXA 3OVRA 2CLOA 1A50A 3HGJA 1EA0A 4IUOA 4ZQCA 5D2WA 4RZ4A 3SSJA 2GJLA 2NX1A 3L5LA 5I3HA 2WNZA 3S0CA 2X1UA 3GDMA 5LSMA 3NNTA 5F2GA 5L6UA 4O53A 3EX4A 4ZQPA 1GG0A 2GQ9A 3ZR4A 1SU5A 1ICQA 2A6LA 3HPXA 1SFJA 4ZQRA 1WBHA 3LHTA 3VKJA 3OG3A 1EP3A 1JQXA 2CLHA 5G1TA 3NL3A 5K9CA 1Q3NA 1XFBA 1H51A 1IF2A 4AEOA 4TIMA 1S5TA 1GT8A 3ABOA 4G1KA 1G4EA 1FY6A 3KVMA 3LCGA 3QPZA 3LCLA 4KFNA 2F7FA 1JCJA 1FDJA 3HGOA 4FHAA 1KBIA 2J6XA 3Q58A 3FEMA 1EX5A 5K9XA 3TJLA 3M0ZA 3SJ3A 1KFKA 3DGRA 1OYAA 1Q6LA 2R14A 3TC7A 4ZQOA 3VI2A 4O0KA 1IXPA 3LDVA 5FF3A 1QWGA 1O5KA 5TBOA 4P61A 1PVNA 4UR7A 4IX0A 4MY1A 3VCRA 1R47A 1T8XA 3CPRA 1LRNA 4FNQA 3L66A 3CLMA 2ATSA 5D38A 4MFEA 3PUDA 1VGAA 4IPJA 2DZWA 4RJEA 4LVFA 4E0CA 3KRSA 4JICA 1VQTA 4UTUA 3IGSA 1YYAA 3P8IA 4M7SA 3NQ2A 3O1NA 1NSJA 2ZTJA 3EWZA 1LOQA 1JCXA 4LOCA 1OF6A 1F74A 1ZAJA 3LLFA 1KM2A 2B0MA 3G1XA 4FNUA 2D73A 3KFTA 1WOBA 1MO0A 3A22A 3T55A 2ABBA 3O05A 5KTLA 2NXIA 3W1UA 3W84A 1XUUA 1HO1A 3EXRA 2RHGA 3OIXA 4DEFA 1P4CA 5BW6A 1JCNA 1D3GA 2RDTA 3RMJA 4XKYB 2YDAA 5CGQA 4K38A 1TPC1 1JCMP 1ONRA 4X22A 3UWYA 4DO6A 3TW6A 3S5ZA 5DBTA 4IPIA 3OBKA 1JUKA 3INPA 3NYZA 3NXFA 3R8RA 4M19A 4NNAA 1YTEA 3DXIA 3NZ1A 3W1PA 1FCQA 2X1TA 1F73A 2BWGA 2QUUA 1M7PA 3M1ZA 2ALDA 4O12A 1AW1A 3IIVA 3UWQA 3WJYA 3MP3A 1WAUA 1UUMA 1SW0A 4NXKA 2V0TA 2V30A 5FF4A 4FX6M 4GJ1A 4IMDA 2A7NA 3N14A 1W5OA 1HL2A 3ZS4A 3KVKA 2ISSA 1YDOA 3P67A 1WBJA 5DXYA 4XKYA 1KM4A 3TFXA 1SO3A 3BVJA 3BW2A 3EXSA 1Q6RA 2PRLA 4JYDA 3G8RA 1WQ5A 3HOJA 4JNMA 4WX2A 2NUYA 3C56A 5LNWA 4OHQA 3MYPA 3W7GA 3W7OA 2YSWA 2ZTKA 3D0CA 4QAIA 3W22A 4QNEA 3DENA 4UC5A 4HKPA 4Z1BA 3KRUA 1ZAHA 3P61A 4RK8A 4IMEA 2B4GA 1QPOA 4LS0A 3LERA 5G2WA 2H8XA 1R30A 1DBTA 4WY0A 3ZWTA 3W83A 1MEWA 2RKXA 2QCDB 5LZLA 2P1FA 4LT9A 1I2NA 2C16A 4NT0A 2ZRYA 3OVQA 5HQEA 5CG7A 1EPXA 3NQGA 5KINA 5J5DA 4GUHA 5BOOA 2TMDA 1X1ZA 3Q2DA 5F2MA 3AJXA 1IXOA 5EKYA 5AC6A 5EMUA 1XDMA 4QITA 3LHUA 2Y7GA 3SGZA 4DELA 3W7IA 1Q6OA 4UTWC 3EEGA 3TXVA 2RDWA 1G7VA 3QH2A 3A9IA 1GQNA 3WK2A 2ZRVA 4JTTA 4HT3A 4JD4A 1ZHAA 2A6NA 5EYWA 5E93A 2X1SA 1VYSX 3TDFA 1Z42A 4Q32A 3C2VA 5BMWA 2QCDA 3S6DA 4EF8A 1EUAA 5C2XA 4RR4A 3S5OA 2WJZA 4FX7A 3JR2A 2ZYFA 3K30A 3LX9A 4MLJA 1BWLA 5C6MA 4N6EA 3LI1A 3HIJA 4A21A 3W70A 4LUIA 3MMTA 1SZGA 3EX3A 3RNDA 4LRSA 3P74A 1G7UA 4L4LA 1BKSA 3PF3A 1KFLA 4GBUA 3LRKA 4NNBA 5LGXA 2H6RA 1J4EA 3GR8A 3DAQA 4PA8A 1DKWA 3W2MA 3LTYA 3FJLA 1M7OA 3WFAA 3O16A 1OFOA 4C1LA 5EL1A 3GKAA 1FCUA 1OX5A 3ANYA 3N2MA 3W2JA 1SPQA 1W5PA 2QCEA 3CQ0A 3EKZA 4E2DA 4UTHA 2CLFA 3LXBA 1TTIA 2LLEA 1H50A 3S5NA 4MY9A 1WXJA 3M9YA 3IGUA 2A2IA 3LV6A 1ZCOA 5EA9A 3HF3A 1T99A 2DORA 2GQ8A 2BXVA 2WSQA 1R46A 3MHGA 1XDLA 1KW1A 3LCXA 4IMGA 4CCDA 2HS6A 3PY2A 4OV4A 3BO9A 1TV5A 4MOZA 3H53A 1RR2A 3G18A 2Y7DA 2YPIA 1XXXA 1ADOA 2VEIA 4O10A 1QPNA 2CLKA 1GPWA 1JULA 3NG3A 1VZWA 3W7RA 3GLCA 3NL2A 1W3IA 2QCHA 2OZ0A 2CZEA 4DQWA 4QJ1A 2QAPA 1ZNNA 2FJKA 1D3HA 3QMSA 3W9ZA 2ZRZA 3N9SA 1BWKA 4BF9A 3PM6A 3G1HA 1S5WA 3CHVA 2VEMA 1HFBA 4WQ6A 1JCYA 4ADSA 3NZRA 2QCLA 1YXDA 1JUBA 1TRDA 1VH7A 4X2RA 5C54A 1ZENA 2VEKA 2E09A 4LV9A 3TKFA 1W3NA 3TK7A 2J24A 5HINA 3GDTA 5LHEA 2RFGA 2QCCA 3NQEA 4O52A 3KXQA 2R91A 3EX1A 1QFEA 3DFNA 3W74A 4LC6A 4Y90A 3R5EA 1TPWA 2FIQA 5CKSA 1XL9A 4JX4A 5D2TA 3SFKA 4M6QA 1KFJA 3V75A 3W85A 1MXSA 5F4XA 3S1XA 5D03A 2P10A 4LY8A 4AMAA 5T26A 2GVGA 4QISA 2CU0A 4O1BA 2ZRXA 2CZFA 3PR2A 7TIMA 4P2VA 1W37A 5G5IA 3NQVA 4GC4A 1GOXA 3T4CA 3SGUA 3W7QA 2C14A 1PV8A 1EP1A 3S1UA 3TAOA 1DHPA 2NV1A 8TIMA 3NPUA 5DCBA 3W1MA 3GX9A 3LM7A 5D2YA 4OE7A 2X1RA 3E0IA 1LLZA 4N9CA 3E12A 3VNDA 2A85A 4ML9A 1SQ7A 4AHOA 5AHLA 5K4ZA 5SWUA 4LVBA 4WXZA 1OG0A 3T78A 5A5WA 4MJMA 3GNDA 4N9DA 1O94A 4O15A 2GVJA 4MLRA 4Z1CA 3L67A 3NQCA 2V9DA 3Q37A 1K8YA 1GVFA 1FWNA 3T7VA 2I9EA 1SSGA 2HTMA 3PUEA 4KKXA 4NX5A 1QOQA 4HSNA 4OQVA 1I8JA 3LTSA 4K37A 1SSDA 1GEQA 4AWTA 3W7KA 2OJPA 3GB6A 4NX0A 4RCXA 3IVTA 4Z0JA 2PURA 4IXHA 1KFBA 3M6YA 1LCOA 3BLIA 4LVGA 2A5HA 3RLUA 1B4EA 1PIIA 1K7XA 1VCFA 3PB0A 1PE1A 1P5BA 4MJZA 2BSLA 1FBAA 1FWSA 2DZPA 3OA3A 4NU7A 4IX2A 3L0NA 4CNOA 2V82A 3VE7A 4A2RA 3DFOA 3R2GA 3TA6A 5AOUA 2NUWA 3C4UA 2GOUA 4NJJA 2A4AA 3TX9A 5LKYA 2RH9A 1KBJA 4EVZA 2NLIA 2EAWA 5LNSA 3RF9A 4UUIA 2E77A 4YLWA 3NO5A 1LBMA 2ATMA 2NWRA 3A5FA 1NEYA 1K8ZA 1N7KA 2O7QA 3DFQA 3L5AA 1OK6A 1YTDA 1UJPA 3TC6A 5F2LA 3IGXA 2ZZ1A 1TTQA 1QAPA 5CZSA 4M7TA 2OT1A 1QCWA 2DU2A 4I9AA 3HO8A 1D9EA 3W72A 2JKEA 1UUOA 4S2CA 1QDSA 5DLCA 4ZVJA 4NJIA 1ZALA 3TAKA 3NA8A 1TJPA 2E6YA 4OV9A 2P0OA 3W71A 5DCEA 1J2WA 3C52A 5IBXC 4UTKA 4DF0A 2VOMA 3HG3A 3C2FA 1F5ZA 1KLZA 3USBA 1THFD 2TSYA 3UWVA 3B04A 1C9DA 4O8RA 5AHEA 2EPHA 3QSRA 4U4MA 3KAOA 5A8GA 4UTTA 1XM3A 4IMCA 4C1KA 1AL8A 5HUOA 3W7MA 2H90A 3UPWA 1MEHA 1LOSA 1IIGA 1OFAA 1FXPA 5CPNA 3MUXA 1VPXA 2JKAA 4MY8A 4BWLC 1OFEA 4FF7A 3G3DA 3B03A 1OYCA 1GTEA 2H3BA 3JRKA 4DPPA 1F6PA 3QSTA 4UCGA 1W54A 1OVDA 1CW2A 2OX1A 1KM0A 4ZMGA 2NV2A 1W0MA 4FEZA 1H1ZA 3HGSA 2JBMA 2XN0A 2QDHA 4QIUA 4UTLA 4JDBA 3KX6A 4WZHA 5FEZA 1OX6A 1W5MA 3MI3A 1IIHA 5KZEA 4IJBA 4Z0SA 5G2IA 1H7PA 1E51A 1VCVA 3TR2A 3W88A 3QFEA 3WJSA 3MHFA 2E6AA 3N73A 3NR0A 5I3IA 3A24A 3LOTA 2EGZA 2AAMA 2C1HA 4JXCA 4K39A 2ZBTA 4O50A 3C2OA 5CZTA 5F1VA 3O63A 4X9SA 3TV8A 4U28A 3P62A 5HWJA 3SY5A 1TQXA 4UMCA 3KVJA 4GUFA 2VFGA 2GJNA 1SO6A 1AK5A 3TUUA 4Y9AA 1PHQA 5ABTA 4UIOA 3UWWA 3NL6A 2WQPA 3MYOA 3IRDA 4MYAA 3UZ5A 1AW5A 3GNNA 3LTPA 5LGZA 1TTJA 3N19B 3OVPA 4UXDA 3O6CA 1W56A 3W23A 1FCVA 2OT0A 2CZDA 3U6WA 5KZDA 2R94A 4Z1DA 3LXAA 1QNVA 2ZZ5A 4JX5A 4RXFA 1G6CA 3G8EA 3FS2A 4DO4A 1Z41A 1C29A 3B0VC 3GZ3A 3C61A 4E38A 4XTIA 1I2OA 4AAJA 2ZZ7A 2VXNA 3IIZA 4O14A 4A22A 5HUPA 1A53A 4UFLA 2V5BA 4JTUA 4N9BA 3VFLA 5U4NA 4H6KA 3QRHA 1QPRA 2QKFA 2Q8LA 1KFEA 1LLWA 3STGA 3NM1A 3IIXA 5IM51 1GYLA 4LS1A 2FQIA 4BI7A 4CNPA 2Z6JA 3SECA 3C3NA 5AYXA 4JTFA 2B7OA 1LDCA 4H3DA 1ME7A 2PC4A 5KMYA 3ABSA 3CEUA 3WJXA 2NUXA 1M5WA 4AHPA 4ZL1A 2C3ZA 4CQ8A 3GXTA 3P84A 4EWND 3G0XA 4UNLA 1H7WA 4BK9A 4YCOA 1DV7A 4PFMA 4ZZ9A 1P0NA 4OT7A 3G22A 5D02A 1GJPA 5EPDA 1YXCA 5FEXA 4ZQMA 4OU1A 3MI2A 1M6JA 4TX9A 2B7PA 1RZMA 4M5PA 3PBVA 3PAJA 4MZ8A 4NXSA 5AFDA 2QJIA 4HIBA 2G5WA 3L0KA 3QPYA 3WK0A 3M43A 1Z48A 3M7WA 1FDZA 4TMCA 4JGDA 1G4TA 5CPLA 3NQDA 4UTWA 4UNKA 1FWTA 3IIOA 3G1SA 3DFSA 3UQNA 5HR7A 4FNSA 3LB0A 2VFFA 1KA9F 1NFBA 1UBSA 1H7NA 1SUXA 1XUZA 3Q94A 4O4WA 3DFTA 1SZFA 1OFQA 3H55A 4DXVA 4MFDA 5AHFA 4JX6A 5K3VA 5G2HA 2V5LA 3SIZA 3NPWA 1EP2A 4PODA 4PL2A 3UWUA 3G1YA 5DN1A 1QO5A 3GXNA 2B7QA 3MO7A 4FNRA 3B8DA 3PC0A 3MBFA 1IGSA 2E5CA 2PE4A 4JTKA 4D2JA 2V2HA 3IV3A 4MYXA 2W79A 3W7HA 4Y8FA 1OFBA 4ICNA 4O1DA 3UXDA 5G4EA 3W1RA 3MBDA 3CT7A 3KOFA 3TMLA 2QEZA 1LBFA 4NNCA 1RPXA 1OABA 1QOPA 1K8XA 3P81A 1H7RA 1O4UA 2FB2A 5D2XA 3FFSA 4XBKA 5F1UA 2ZQ0A 3BLFA 1XBYA 1P1XA 3W1LA 1W1ZA 1F05A 2V2CA 4PEKA 2FTPA 5D37A 3MHUA 3TXZA 3HGRA 3NQ7A 3NPXA 4JY8A 5HJLA 5F4WA 4EF9A 4XQ6A 5FEWA 4GE8A 1VLIA 3CB8A 1TB3A 4JYEA 4QQ3A 1A5CA 1F76A 4GNJA 4R53A 3CIXA 5DY2A 3DHFA 4TU1A 2R8WA 3WJWA 4XBSA 3TH6A 2ZRUA 3F4NA 4HPJA 2HSAA 3B0UX 1JVNA 1AG1O 5D30A 1VYPX 5DELA 4JTHA 5DCDA 1PL9A 4WOQA 1QMLA 4ALDA 4UR8A 1ZJIA 1H1YA 3DH7A 3P60A 1PHWA 4N02A 1GVQA 3TMQA 2VFEA 3EWWA 4DF1A 1B4KA 1EB3A 4KWWA 2YFOA 2ZCGA 4JTEA 4ORMA 1R2SA 3B0PA 2X30A 3L5MA 1O95A 5F2IA 2VC6A 1GG1A 5FESA 1FCBA 1SFLA 2X16A 1KFCA 4UFMA 4FX8A 3M41A 3S5YA 4RZ5A 3W2LA 3BG5A 3N3MA 1NAL1 5TQLA 3HPZA 5HNRA 2DZUA 1TMHA 4M6VA 3UYCA 2Y70A 4QM1A 4OGZA 1CX9A 1U83A 1W8SA 3NQ8A 2I14A 2W0UA 2CW6A 4BI5A 2H8ZA 1DL3A 2KZHA 3N34A 3W3OA 5CSRA 5HR6A 3JS3A 1T96A 3DI1A 2C19A 3W6YA 1MEIA 3PG9A 3LI0A 1ME9A 4LV4A 3TE9A 2E6DA 1I4NA 5K9DA 4WJEA 1KTCA 1SO5A 5HMSA 3TROA 4FO4A
chains in the Genus database with same CATH superfamily
2PZNA 3LN3A 2QXWA 1IXQA 1ISYA 1EQCA 2PCQA 2ACQA 3F4DA 3LHVA 4A8RA 3BCJA 4GXPA 4ZODA 3KS5A 4YWIA 4MJ2A 1OD0A 5FIPA 4M56A 2Z1KA 4PL1A 3N2TA 4N6FA 1HKKA 2EBNA 2GDUA 4S39A 2WMIA 4JN6A 4M3PA 2UY2A 3J7HA 3MPGA 1JPDX 4GH3A 1XH0A 3EKLA 3GUGA 5BYWA 4U5IA 1XD1A 2AL1A 1V3IA 4O54A 2DJXA 2EF9A 2YW4A 2A0NA 4R9XA 2YB1A 1ME8A 1EQPA 3USZA 4LUSB 4QBXA 4QEHA 1NDZA 1HVXA 2Z1SA 2GYIA 1ITXA 2HNEA 4JTGA 1K4GA 4ONVA 5GNXA 5D05A 3CAQA 2YYTA 2DFAA 1QW8A 1SO4A 4WKAA 4XO6A 3AMGA 5DO8A 3K8MA 5JU6A 1KRCC 2V69A 3JVAA 3UGVA 1OZMA 4YHEA 5HXMA 3W7DA 3CIVA 3WNKA 4ATDA 1S38A 3AMCA 3WDJA 4GQQA 1Q6GA 2HISA 4XAPA 4CN1A 1GORA 3IK4A 2XVGA 2XZ7A 4IP7A 3VIIA 4JIIX 2Z7KA 3MUIA 5LHFA 4B3LA 4Y9PA 3AHVA 5I3JA 1UD2A 2C0AA 5IHRA 4LUSA 4NSBA 4ZB2A 1TCMA 3AQUA 1PX3A 3IVSA 4K8EA 1O1ZA 4HCHA 4N4PA 1KV5A 3GW0A 4FOKA 4QTGA 1NVMA 1EYEA 1ONXA 1OT1A 3CUFA 7XIMA 1DJGA 3GAKA 2WK2A 2PLJA 4B16A 5CQ1A 3CHEA 5LNRA 4HK5A 1PS9A 3TSBA 4F9DA 2WB5A 3UEQA 3F4CA 3EX6A 4BHYA 4XBJA 3RU6A 5FOOA 4GUJA 2YJQA 7TAAA 3AALA 3RXZA 4R5EA 2BB0A 3UXLA 4PCFA 3DIPA 2OVLA 4MAZA 3AHXA 4O1AA 4A8IA 2D0FA 1TWSA 4EXBA 1EJRC 4MZ1A 2XISA 2O7SA 3MSDA 3WJZA 3OLEA 4LUTA 3TLLA 3WD4A 2HMCA 1XSIA 4GY1A 5AB3A 5G1YA 4DO5A 1E1CA 4JDYA 1BPLB 4GGBA 2J75A 2BY0A 2XH0A 1AQFA 2WKJA 5DMNA 3RM9A 3N2OA 3WEZA 3LRMA 4UFHA 3PZUA 5CC3A 4I5UA 1JUEA 1LORA 3UJSA 4QR6A 4GVIA 4AZ5A 3LSCA 5DQPA 1DXFA 4W5ZA 1UWUA 2CLEA 1WP6A 4PB5A 3ORWA 1XCFA 2HS8A 3TYUA 3H2OA 1X6LA 1EWDA 3NQ6A 4F9JA 1OFRA 1B90A 3M0YA 2WM1A 2VC9A 3VDHA 2NQJA 1XRVA 2IKIA 1PCKA 2UY3A 1X7FA 2NT1A 2Y61A 4KIEA 1CNVA 3BV4A 5M1TA 4PCSA 3TZFA 3GG7A 2PTYA 3VINA 4F48A 1XHGA 3T2OA 2ZVIA 3RIKA 4C5YA 3IJ6A 2YZRA 4BQ3A 1YIXA 1K9DA 1PAMA 1BLIA 1IE7C 2V63A 2J7FA 3CWOX 1XGDA 3B05A 4LNYA 2QCGA 3WNPA 1RP9A 4W5UA 4NJHA 3QMTA 2WZHA 1Q6QA 1SFSA 5E6ZA 3AUJA 4CGTA 4WR3A 2E7FA 3TYZA 2YX0A 3S9IA 1TPDA 1VJSA 3OVGA 4IL2A 4DI8A 2ABAA 1PBGA 1REQB 1UHVA 2ZZ6A 3F1QA 4D9PA 6TIMA 3I7SA 2OODA 4GIRA 3CAVA 4WD0A 2YZ5A 2OMAA 1TFVA 3GFXA 4A8NA 3VDGA 2ASHA 2B7NA 4MKVA 3MUY1 4W89A 3V36A 4J3XA 5CPSA 3GXIA 3W7EA 2C13A 2UWFA 1BYDA 1K6AA 1EDGA 1XYZA 1JQVA 4WY0B 2DZXA 3IPWA 4FIQA 4LVDA 1REQA 3GY1A 3HA1A 1KV8A 1QPQA 4E2VA 3PPCA 4FXJA 3NFUA 3P93A 1OFPA 3JZUA 3UA3A 1S2VA 4QJ5B 3ZJ6A 2BNJA 1TYGA 2VD9A 1DE5A 4LS2A 4JQAA 4NZFA 5A6LA 3UVIA 3WK1A 4Y2WA 4P7NA 4PSRA 1XIMA 4LPCA 5HWMA 1BVWA 3F03K 3BMVA 3KCOA 1UZ1A 2J9YA 1VC4A 5HWNA 4MWAB 1M9HA 3MA8A 4IGSA 3U2EA 5H2ZA 4RUBA 3V5FA 1J0HA 8XIMA 4LTSA 4IIFA 4PMUA 1TREA 1HX0A 1XIHA 3QM3A 3AFBA 4DNMA 4NZJA 3PZVA 5G4WA 3AIWA 3WNOA 3HG5A 2AQOA 2ZX9A 3MMUA 1VEPA 2WMJA 1E40A 1R2RA 3F2CA 5AHIA 1TX0A 1E5JA 3IACA 2YYUA 1E70M 2VKZG 1MW1A 3SI9A 3UWZA 2Q02A 1MXDA 3RDKA 1FKWA 1JPMA 1POJA 1TPUA 1QUMA 1J11A 1TJ0A 1GKPA 4IOTA 1P48A 1W9XA 1PX8A 2REQA 2ZUWA 1QI2A 4HNNA 4KMQA 1JJKA 1L6WA 2ZRWA 1EIBA 4JTSA 3G77A 4KEZA 1V5XA 4PTWA 2KX9A 2DIEA 3CUIA 1EH9A 1GOKA 2VJXA 1KFWA 4LVAA 2YR1A 4A3UA 4UOZA 1A4LA 3GVGA 3MO4A 3B8IA 3VD3A 2ZA3A 3WNLA 2EG8A 4NASA 3EXTA 2X42A 2Q3OA 1IR2A 3SRFA 4AQLA 3IIPA 1E6SM 1DQXA 1UR1A 2EKCA 3T8QA 3VNYA 4Y7EA 1JG9A 4GYPA 5RUBA 3KCLA 1E9ZB 2YXOA 1MZHA 1P6BA 3KRZA 3O9NA 5FF7A 4L1GA 3NURA 2VR5A 3LHWA 2D2GA 3DU0A 5ECVA 3CUZA 1R2TA 1W9BM 1S5VA 2ZXQA 3QOMA 1GZGA 2A1YA 3WSUA 4XV0A 1KR1A 1J6OA 4K8GA 2O9PA 1V3JA 2VO5A 1BGAA 3P82A 1EX1A 1FH7A 1R3TA 4ECLA 4YTQA 1H7OA 1FFRA 4MKNA 1TQJA 3U57A 3PULA 4KFOA 1UMLA 3HJEA 1G69A 2BTMA 4OECA 1ECEA 4TV5A 1CT5A 2OB3A 1LQAA 3QMRA 2E8ZA 3W81A 2AQWA 1OYBA 3S6OA 3CUHA 1KD0A 2GQ3A 3KOXA 3EKGA 4K7VA 2CFFA 4O0ZA 1GZ1A 4KF1A 1V0KA 5D4YA 4GYKA 3TN4A 4CKQA 3TC3A 2BOFX 1UQYA 2CLMA 3QZEA 4ICMA 4DM1A 3GIYA 4ZR8A 4GZJA 3ME3A 4Z2LA 2WNQA 1Q6FA 1DYSA 4Z1YA 4DAFA 1KXQA 2J27A 4KWVA 3W07A 1DP0A 3E0FA 2YGYA 3RITA 5A8OA 1H0IA 3L65A 1BQGA 2CHOA 4GUGA 3K5XA 1H5YA 3NQAA 4D6HA 1FH8A 4JL2A 5FEPA 3PN8A 1EUNA 3HPAA 1IHIA 4GFSA 4XVEA 3MS8A 3CL7A 5A69A 2VX5A 3GBDA 5LIWX 1NDWA 1PTGA 2BHUA 1VRDA 3WDQA 1TJRA 3LPGA 1MW3A 4D8ZA 3BOFA 3VOFA 5I3KA 1A5AA 3ARPA 4FPSA 4EACA 2VHLA 2FFCA 4I7WA 2Y85A 1VIWA 1NU5A 5CPOA 4KWOA 1FP8A 3WLTA 5L9FA 4JQ1A 1P0EA 2YBUA 1WE5A 4UMBA 4XUGA 4PC8A 5I3FA 3QV6A 1I1WA 4A2SA 5DANA 4RPQA 5E0FA 1OM0A 2BZNA 3IEBA 3LZ5A 3M0KA 5TNVA 4HA3A 1XIJA 3GHSA 1HO4A 4NIRA 3W76A 2R1NA 3VVGA 5FCZA 3WQDA 1V3HA 4WDWA 2BY1A 3LCWA 3ARRA 4LU0A 3BLKA 2Z6IA 1E6XM 1JIBA 2XWDA 1PIGA 3M47A 4LALA 3W7LA 4UCFA 2OZTA 3QQ0A 1JGIA 3WH7A 3ZLHA 6XIMA 3KZPA 4HU3A 5FJOA 3GXFA 5KZMA 3W7NA 2X05A 5BRPA 2OOGA 3VA8A 2GK1B 4E4PA 1G5AA 3KVLA 3WKZA 3TTQA 1WDRA 1FH9A 2QJHA 2C18A 4GXMA 3NGFA 2GQAA 2ANUA 4EXQA 1AMYA 4YCPA 4XX6A 2VEPA 3OGSA 1TO3A 1XR2A 3KLKA 4QNWA 3APTA 4W9TA 1NIUA 3SQLA 2POZA 4DIAA 4HHPA 3OYXA 2E9LA 1Z44A 4G1NA 2G8ZA 4ZQCA 3SSJA 2GJLA 5FJTA 2WNZA 3OZOA 3S0CA 4W8BA 3DN5A 2X1UA 3GDMA 4WSHA 4KRTA 2YCLB 3BLLA 3D3FA 1YDYA 3CYJA 3EX4A 3CBWA 1GG0A 2GQ9A 2GK1A 1ICQA 1DPMA 4XISA 2DVTA 1EP3A 1YE4A 1ZJAA 3NL3A 4AEOA 2HROA 4MSSA 4X60A 3LCLA 3QV8A 3HGOA 1EC8A 1PKYA 1GZJA 1FWAC 4GVFA 1KWGA 3Q58A 4IL0A 1EX5A 4DVOA 3SJ3A 1KFKA 4A8LA 2VDHA 3H7VA 4ZQOA 2J62A 1W2VA 3R94A 5FF3A 1QT1A 1QWGA 1OEPA 1O5KA 3H2FA 1S39A 1R9XA 3VCRA 1QRQA 1T8XA 3TJIA 3T2QA 1LRNA 3RM4A 3NZGA 4S3BA 2OGJA 4IPPA 1VQTA 3P8IA 1QI3A 3NQ2A 3O1NA 1DEDA 4NAFB 3GTFA 3VIJA 4Q4SA 9XIAA 4DWDA 1ZAJA 5LYRA 2B0MA 3G1XA 4FNUA 4HB7A 1RUSA 2D73A 3T55A 1F4AA 3W1UA 1HO1A 3EXRA 2RHGA 1I6NA 1PZ1A 1JCNA 3QY6A 1QHZA 1FWBC 3UJ2A 4AY7A 3KTXA 1JCMP 4X22A 3TW6A 1MZRA 1BYBA 5DBTA 1F3XA 4Y9MA 3CV6A 1WXZA 3NYZA 5JQ9A 3W29A 2BWGA 3H12A 4PRWA 4JBRA 4O12A 3IIVA 2WMKA 1M41A 1VBUA 1WAUA 3MP3A 5EMJA 1UUMA 2V30A 4FX6M 3PFMA 1PDYA 4GJ1A 4IMDA 2GL5A 4NYYA 1HL2A 2PAJA 1ZCCA 2ISSA 1YDOA 3P67A 4HPNA 1WBJA 5REQA 3G5EA 1SO3A 3BVJA 3SRKA 4H9UA 3HOJA 3LD5A 3ZO9A 3CS2A 4R3UA 2DGAA 3MYPA 1LUCB 4L1WA 1ENUA 2RJGA 4PUMA 1QI4A 1B9ZA 2ZTKA 3D0CA 4TV6A 5BU9A 2FZMA 1UUQA 1U1JA 5A6KA 2ONEA 3CO4A 4UC5A 3LPFA 3KRUA 4BF5A 1MNSA 3P61A 1VPYA 1FWEC 1IT8A 1Q2SA 4PB4A 3QR3A 3FEQA 3HFTA 4IIGA 3XIMA 2W3ZA 2J74A 1XYFA 4JNZA 2ZX5A 1CGYA 4WLCA 3ZWTA 1POKA 4H6EA 1MEWA 2RKXA 3W83A 2VCBA 5LZLA 2P1FA 2CLPA 1I2NA 1C9WA 5GJMA 4NT0A 1S2UA 2ZRYA 1UH3A 3OVQA 2QGHA 3NQGA 5CG7A 5KINA 5J5DA 3LMZA 5BOOA 2G37A 3CUGA 1SMAA 1A3HA 3Q2DA 1BGGA 5EKYA 1XDMA 1C8QA 4HP5A 2BODX 1RY0A 4IGNA 3QLDA 3EEGA 3TXVA 2DDXA 3BXWA 1EZWA 1GQNA 4NYUA 3B8TA 3WK2A 2X41A 5EYWA 3LNPA 3H24A 4IPNB 1X7IA 3NXLA 1VYSX 3I3DA 1V0MA 3WNNA 3ZT5A 3CUJA 4EF8A 4RR4A 6REQA 1HKIA 4KWSA 3TN5A 4FX7A 2YLAA 4C91A 4IM4A 2G3NA 3THDA 3HIJA 5IHSA 3MMTA 3VKCA 4CQBA 4AEEA 2E28A 2E40A 1BKSA 3T07A 3LRKA 4US5D 2H6RA 1J4EA 4GNKB 3LS9A 1DKWA 3T6CA 3G6MA 5C9ZA 5C8BB 1JL8A 3WFAA 4R88A 5EL1A 1VB9A 4Q22A 1FCUA 4Z2GA 1AQ0A 3TR9A 1SPQA 4DWSD 5LXXA 4F0SA 3EPMA 2FVMA 2EPKX 8CGTA 1BYCA 3M9YA 3IGUA 2A2IA 3AAMA 3VIHA 3VO0A 4C6CA 2WSQA 3M0XA 3MHGA 2PDFA 4H7VA 4CCDA 3TTYA 3BO9A 4QX4A 3H53A 2J77A 1WNOA 3O2LA 2WVTA 1C7SA 2CHRA 3W6MA 1P0BA 3SUWA 5C0QA 1VZWA 4Q8WA 1C7TA 2IKHA 3KE0A 4ACZB 3DHUA 2CZEA 3W9ZA 3QMSA 3ID7A 4IG2A 4XZNX 1BWKA 1XKJA 3PM6A 3CHVA 5CBBA 4WQ6A 1UR0A 1JCYA 4AYGA 4ADSA 3NZRA 1YXDA 4GYPC 2XH7A 5EBAA 2XSAA 4X2RA 3BOXA 3MUZ1 1UG6A 4ZOBA 2XYLA 5A8NA 1W3NA 3TK7A 3UR2A 2Z7GA 3ENLA 1IT0A 2EPOA 5CG0A 3WY1A 2RFGA 3N6JA 1TPWA 2FIQA 2PUZA 5D2TA 1UKQA 5HNNA 3BOLA 1KFJA 4GMEA 1MXSA 5F4XA 3RHGA 2WW5A 5T26A 1S1RA 1S1PA 4CQCA 2ZRXA 4JEJA 3PR2A 4QG9A 4GI8A 3IUHA 1HVQA 3T4CA 3N18A 3SGUA 3WH6A 2C14A 2TODA 1PZ2A 1HNYA 4UBPC 3LM7A 3MUAA 5D2YA 2ZE3A 2X1RA 3RLGA 2MNRA 2VDGA 3SAZA 5C7VA 4N9CA 4US5A 3E12A 2TAAA 1X98A 1RCXB 2JFEX 2P3ZA 3FA4A 1SQ7A 2OGYA 3ZJ7A 4WXZA 3T78A 4HOZA 5A5WA 2OPJA 4N9DA 4DWSA 3OZMA 1W3JA 1W1VA 3DCPA 5HMDA 3B9DA 1K8YA 3GIQA 1QNPA 5AY7A 2A3AA 2I9EA 2NW0A 3PUEA 2J47A 4KKXA 1QOQA 2FVKA 4PUNA 4C60A 1ZUAX 3GVVA 3MY9A 1GEQA 5T9CE 3SUTA 4RCXA 5JBFA 3WELA 2ZX6A 4C6BA 1EC9A 5I78A 3PB0A 4JHMA 1FHDA 3OA3A 1GVYA 4UR9A 3DFOA 1JCTA 4LEFA 3R2GA 3TA6A 2QNEA 2J13A 1RJPA 3C4UA 4A05A 1KBJA 1BVZA 4EVZA 5FJIA 5LNSA 2V5JA 3P2VA 3GUWA 1F9CA 1F07A 3NO5A 3WQEA 2XDFA 1LBMA 2NWRA 1V6YA 3RO8A 2ISDA 4LJ3A 4D72A 1UJPA 3IGXA 2PD5A 2A3BA 1PYFA 1H0GA 3AWOA 3GC4A 4M7TA 2OT1A 5CZSA 4B5VA 2IS7A 1XQKA 2DU2A 2WSKA 4I9AA 3VC6A 4DZIA 4NP7A 1D9EA 3BCFA 4GXWA 2JKEA 1UUOA 2Z28A 3WLHA 4ZVJA 2GWNA 1X6NA 3JW7A 3TAKA 4J3WA 3GG0A 1CZ1A 2CBUA 1AQMA 3W71A 3NTYA 4MHBA 5DCEA 2WWDA 4UTKA 3KWXA 3HG3A 3C2FA 2C7FA 2JQXA 1VF8A 1UA7A 3DUGA 4DUWA 1THFD 3TA9A 3H21A 3B04A 2GGIA 5AHEA 3QSRA 4QE5A 3MSRA 2BXYA 4HU0A 5A8GA 4UTTA 3FVDA 2YL9A 1W3HA 4ERAA 1AL8A 2QPXA 3UPWA 5FSDC 1ZB5A 3M07A 1FXPA 3AJ7A 3MUXA 1VPXA 2O4MA 1XLBA 4CD8A 3G3DA 3B03A 4DPPA 3QSTA 1W54A 3DC8A 1OVDA 3VABA 3II1A 4RE3A 4XO7A 2OX1A 1KM0A 4N42A 2J8TA 2NV2A 1CWYA 1QNRA 3LUTA 3NCOA 2JBMA 2XN0A 4MMWA 4QIUA 1VFFA 4UTLA 2OZ3A 4KS0A 5CJMA 4IJBA 4KGJA 5D8ZA 1H7PA 1E51A 4G8TA 1NTHA 4ZTYA 3QPEA 4KCVA 4DZAA 5I3IA 6ENLA 3LOTA 1HJWA 2C1HA 4K39A 2ZBTA 3C2OA 5CZTA 5F1VA 1DWJM 2P5NA 2DT0A 1E1EA 2VGBA 4U28A 2QW5A 3AIQA 2V3EA 5HWJA 4DBWA 3SY5A 1C3FA 4AMCA 3VOCA 3CK5A 2VFGA 3TUUA 1SVDA 3N4EA 5ABTA 1BFNA 2QPSA 3PTDA 2XIOA 3NL6A 2WQPA 3H22A 3P3BA 3W25A 2BVWA 2BFGA 3LNMA 3N19B 3OVPA 3O6CA 5M2FX 2OT0A 2ZOXA 4ASTA 2CZDA 4E2OA 1TWZA 5KZDA 4NRRA 4Z1DA 1XLIA 3LXAA 2G4FA 4JX5A 1G6CA 4DO4A 1J93A 3C61A 2PLKA 4E38A 4XTIA 1YKWA 3UP8A 5JH2A 1I2OA 4LB3A 2ZZ7A 3IIZA 3SJNA 1P7TB 4MDPA 4UFLA 3ZMRA 1KCKA 2FVLA 4N9BA 2IPWA 1GKRA 4H6KA 4RL3A 1HQTA 1CDGA 4CN6A 4PCTA 3STGA 3WQ5A 5IM51 1K9EA 4LS1A 4CNPA 1E0VA 1ODUA 1LDCA 3B40A 4H3DA 1ME7A 3CEUA 3WJXA 4MUPA 1M5WA 4ZL1A 2C3ZA 3P84A 2WLYA 4EWND 1XIBA 5HQLA 3W28A 1H7WA 4C6IA 3TP4A 4IIDA 1GQIA 4YCOA 5EPDA 3MI2A 4P8VA 1EFZA 2Z00A 1P7TA 4BEQA 3PBVA 3ZXWA 3PAJA 5CPTA 3O0KA 3L0KA 5A6JA 3M43A 1GOMA 3UG4A 5EGRA 3XISA 1GOWA 3OO2A 4JGDA 4PMVA 1FWTA 4WSKA 3GG1A 3G1SA 3AYRA 2PDWA 1R87A 3LB0A 3VGEA 3S2LA 1SUXA 3Q94A 3DFTA 1WO2A 4PMNA 5I6SA 3K13A 3QN3A 4JX6A 2V5LA 3OOQA 3GBEA 1TE6A 3G1YA 1G94A 5DN1A 4OBSA 4FNRA 3M0HA 4A6GA 1IGSA 2E5CA 1XV8A 3R58A 4YVVA 3WQWA 2W79A 3V1HA 3GHTA 4O1DA 1QNQA 4KCWA 4H01A 1AFSA 4HZ7A 4U3AA 3UJFA 2OKTA 1LBFA 4NNCA 1AZ1A 1OABA 3W82A 3P81A 3KLLA 1DJXA 2ZUVA 2WMFA 3PJXA 2GLKA 3BLFA 3SO7A 4U5KA 3MTWA 1P1XA 5I7GA 1W1ZA 1F05A 4KEUA 2HXUA 3NWRA 2J7EA 3HGRA 3NPXA 2BGSA 3B8SA 1ZJBA 4XQ6A 5EMYA 4EPDC 3BE7A 1ZU8A 5AVNA 4GNJA 1DJZA 3FHQA 2PWDA 3CIXA 3PP7A 4TU1A 4C6QA 2HSAA 1AG1O 1X39A 1EGZA 3IS4A 4MB1A 5D30A 4F2TA 5DELA 5DCDA 3KDOA 3VKKA 4I6KA 3BLPX 3P60A 9CGTA 5I2UA 2VL4A 3QV7A 3TMQA 1Y65A 1C8XA 5BOFA 2VFEA 1AD1A 4JHZA 3VNKA 1W9PA 2VGFA 2YFOA 2ZCGA 4HU8A 3B0PA 4YTTA 2X30A 3L5MA 2VC6A 2WJFA 4AD0A 1FCBA 2BY3A 2I57A 2DV0A 3HPZA 3T8LA 3UYCA 1KNWA 4TVCA 1PYMA 1W8SA 2J66A 3L23A 2GGHA 4BI5A 2H8ZA 5HR6A 4HZMA 3A3WA 1YNYA 4PEEA 4M81A 1EF2A 3JS3A 3WD0A 4L9YA 2EPMX 1MEIA 3P6LA 4HYVA 4HVXA 4AZHA 3PWGA 1ME9A 4LV4A 4RDVA 2E6DA 1O66A 3G6LA 4WJEA 2WJEA 1AJZA 4FO4A 4DHGA 3GTNA 2JIWA 1XLAA 4DBUA 2L5HA 4AY8A 3R0KA 2AKZA 1KGXA 1XLDA 3NJ3A 3CL8A 4DZHA 2E3ZA 4GVGA 2J6VA 1G67A 1Q6CA 3E0WA 2OQYA 3Q45A 2VWTA 2WV8A 5BXSA 1G4SA 3GVWA 2Y7FA 3P8JA 4HYRA 3F4WA 3UBPC 2DUXA 4B3KA 4IIEA 4GKLA 4Q6JA 1FVPA 1WV2A 3UR5A 1MUMA 3LPPA 1LQ0A 2Q09A 3ATYA 4IFOA 2Z0IA 4HN4A 4DF2A 2XFYA 1A5BA 1WOAA 4JFTA 1TPH1 3DYMA 5AC7A 5GPRA 1ZP3A 2KAUC 1KR0A 1ZAIA 3M5VA 1WZLA 3RO6A 3LV5A 1PKNA 3WUFA 4O13A 4XZMX 3MCMA 2X1IA 4IH3A 3N6HA 1QHPA 1VPQA 5DY3A 5EY5A 3H26A 2DZTA 3UZZA 4PUUA 1GVEA 5HK4A 3M0VA 3C3UA 4AD1A 4I3GA 4XIAA 3BQ5A 4C6JA 1RVKA 2WCSA 2PWHA 1O6IA 3U4FA 3M16A 2FFIA 1U1HA 4FXSA 4AY1A 3AXKA 4Z08A 3QW4B 4XG1A 3NDOA 4QP0A 2X2YA 1Z9AA 2JK2A 4GCAA 4C6FA 4WGXA 1JZ3A 3KZSA 1Q5MA 1TSIA 3BAYA 3EPOA 5LIKX 4NZ1A 3OLIA 2GOKA 1LRTA 1T8QA 1KTBA 3M5XA 4K6AA 3GKFA 4HA0A 2UY5A 4DWSC 1HUVA 5BNKA 2CBJA 3QV9A 4AYSA 1M01A 1LM1A 2EEXA 2WAGA 5AC8A 2YFNA 5KEZA 2IW0A 4GWEA 1CB2A 1KXVA 1R3QA 4Y6GA 3I3EA 5HBFA 4WDXA 2NZLA 4AD4A 2IMRA 4CEXC 2WSRA 1VR6A 5E1QA 4UTFA 4O19A 4ZBCA 1DWAM 3GNPA 3WFZA 4C65A 1V0LA 1WDSA 4UFKA 1GW1A 3VK5A 3O06A 3W1AA 1VHCA 2PA6A 1X1OA 4XVDA 4JPGA 3SCOA 4GRSA 3BJSA 2VX6A 3S8HA 1OC7A 2VURA 4HNUA 1T6MA 4GQGA 3R12A 1Q7MA 3FKKA 1OCNA 1NWUA 3G1DA 5F4SA 4L4PA 3L12A 1JPKA 3WL1A 1LBLA 4S38A 5A6BD 4D1JA 1FDYA 4RNFA 4LYKA 2FLIA 3TNOA 4YTRA 1PCWA 3VNJA 1WZKA 1JF6A 1FQ0A 3OJGA 4QDMA 2Z25A 4DLFA 2A3EA 3H2AA 3F5LA 2QCFA 4GKTA 3KP1A 1E9YB 3WZ0E 4BWLA 3DFPA 4JKKA 4IMFA 4AZ7A 4NZCA 3BZGA 3RU8X 4HMEA 2C0HA 3C0QA 1XI3A 4FB7A 3L7RA 4E4UA 4S3DA 1B0IA 2Y1HA 4E8DA 3TIMA 1LWJA 1JZ5A 3DGBA 1EOKA 3TYAA 4UQDA 1JFHA 4CVUA 3T2PA 1J5TA 1CXKA 1K3UA 3T4WA 4AXNA 3PAOA 2DJLA 4MPQA 2WLZA 3EBVA 4NILA 2CZ5A 3PZQA 4FLOA 2Y63A 3WCZA 4R7OA 2EJAA 4AC1X 4UTTC 1N8FA 3GNXA 2DQXA 3A21A 1TV7A 3BLEA 2Z24A 1J0YA 1W31A 3BPWA 1E15A 3N2BA 5TF0A 3IVUA 4BCEA 5GVJA 3KHJA 3CU2A 1PSCA 3SRHA 1H61A 1JRBA 3NEVA 1EWEA 1PWMA 4BEUA 4TO8A 1RA5A 2FTYA 1I75A 1J8VA 1HW6A 3PS7A 1Q45A 4W8AA 2ISVA 1JZ6A 3ALGA 1J0KA 3BAIA 3WH9A 5FJUA 3VNMA 1FP9A 3M7SA 4QDPA 1XLJA 4OUIA 3BQ6A 3SEPA 3TSMA 3WMLA 1OHLA 2O9TA 2QGYA 4EK7A 1TWIA 2VCAA 4KRUA 2GGGA 1XBVA 4EKJA 4PMZA 2GZXA 2FB3A 3WQ6A 2FGBA 3WD3A 3L9CA 3PBUA 3VKDA 4GQBA 4C6OA 1M03A 3WLQA 4ZO9A 1JZ7A 5A6BA 4LYPA 1V0NA 3BW4A 1JFXA 1OT2A 3P0WA 1E5NA 3BG3A 1UCWA 3RFAA 4O17A 4LBRA 2NXHA 3P80A 3CQHA 3GU2A 3UVAA 3ZT7A 2A7PA 4S1FA 3UT0A 1HGYA 4D6EA 4D8LA 3MMWA 5IDIA 1VFOA 1VYRA 3TTOA 4HNVA 1E0XA 4X0NA 3TW7A 3VD5A 2GUYA 1QWKA 1H60A 1RLCL 2C6QA 3QZAA 4AW7A 5LIUX 1ADDA 3BMWA 4AWSA 4BJHA 3L0GA 3QW3A 2ADAA 1V4YA 1UPMB 3W2KA 2XIIA 5ABHA 3RX3A 3S2NA 1UP3A 2X09A 3M44A 4JAWA 4K7YA 4CLMA 1D8CA 3STEA 1K6WA 3AISA 5IDZA 1L6SA 3K8LA 3QY8A 4PZVA 5H91A 3TJXA 1GJUA 4CU8A 3W27A 1J01A 1KKOA 2PGFA 3TTEA 3A6OA 4LUJA 4TQTA 2YCEA 2VFDA 3CXOA 1S5NA 4DZ5A 3TYCA 1GGOA 1MW2A 4LAOA 3I7QA 1GUVA 1CXLA 3QC3A 1XYAA 3SZ8A 4DJEC 1T40A 3HTWA 3DYOA 1KWKA 5DMYA 4UQCA 1J96A 4X61A 5TIMA 4HSHA 2FPYA 1TIMA 2RDUA 2XM1A 2WHLA 2DSKA 4Y96A 3HQNA 3GWQA 4HGXA 1ISWA 3HBLA 4L6OA 1IZCA 3TCSA 5DT7A 3E38A 3FJ6A 3UESA 2QJMA 4PTNA 3C0JA 3GU9A 1CEOA 3MKKA 3Q65A 3H2NA 3P5ZA 3LU2A 3GW3A 3C2EA 3H4WA 1EXBA 4AB4A 2D1ZA 4D6IA 5BZAA 3I4EA 3PNZA 3WQGA 4F79A 3ITVA 5AHMA 4LY4A 3G1RA 4IWWA 4AXKA 1OADA 2Y5EA 3VOIA 1Y7VA 2PGEA 3ZFHA 3AIBA 5I09A 2R24A 3KL5A 3LHZA 4R9OA 4CNSA 1ZFJA 1SR9A 4ES4A 1XRSA 2PB1A 4ZE4A 1NWRA 3SN1A 2RJHA 1ZJHA 3VNIA 2DH3A 4JN8A 1KLYA 5HA7A 2Z4GA 3O0FA 4U3CA 3FYPA 4GK8A 3AMLA 3AC0A 1HL9A 3ZR6A 1QW9A 2E5BA 3V4BA 1YLVA 1UIPA 1QO2A 4TOQA 2JGQA 1EF3A 2GJRA 1F6KA 4LANA 1ZSXA 2NX3A 4J2MA 1X8FA 3G1VA 3LLDA 3M5ZA 3UW6A 4M8UA 4RKAA 2PRHA 1OIFA 3AMDA 1TUXA 4XUYA 2VDIA 3KBNA 3CZ8A 4AIOA 2C91A 4MB4A 1XKYA 3T40A 1K4HA 1M7XA 1UWTA 3O7UA 5E0CA 2ZICA 3ITYA 3CQJA 3V0TA 4G9PA 3D3AA 2QJGA 4PTVA 4LRTA 2I5GA 1ZGDA 2PRMA 1RHCA 4S3CA 3GXMA 3E2RA 3AICA 4MIMA 4S2BA 3OZYA 3R4IA 5EB8A 1OG6A 1Q7QA 4IJRA 1XYMA 4MPKA 1TX2A 1YEYA 2X2GA 4XZWA 4RZBA 4M6UA 4AVFA 2UY4A 3L2IA 4FNPA 3KOZA 2FPTA 5TAOA 3W73A 2W6RA 1GW9A 2OWWA 3AMKA 2F84A 3FGCB 3FA5A 4H19A 5CZJA 4GBDA 1XIDA 3OGRA 1VJIA 3BWWA 1LJYA 2CWNA 4ENLA 1TVLA 4WXYA 5I07A 1XISA 4IFKB 3ABRA 3EMQA 5ENLA 1AH3A 1V08A 1IXNA 3MV01 2FMNA 3FDKA 1XJBA 1J2BA 4N9EA 3QHNA 1XSKA 3LLXA 4AH7A 5KSWA 2VFIA 3BANA 4IGHA 1MSSA 3VD4A 2O9RA 2PPGA 4YYCA 3AROA 1MUCA 3FKRA 4ATLA 1FXQA 3CM4A 4A3QA 2ZA2A 3WLJA 1MYRA 3GFYA 3A47A 1DXIA 4K68A 3A5VA 1YXYA 1RQEA 2VELA 4RLIA 3VOJA 5BXRA 2YXGA 4IFKA 5FL1A 2G3MA 5D09A 3WDIA 4JY9A 3NOEA 3WENA 1MVYA 5FJPA 4O16A 1LTDA 3WLOA 3KM8A 4HU4A 4UTIA 4LC8A 5KETA 1IEWA 3LBMA 4ZO8A 4QE1A 4G2DA 3P0XA 4RV8A 4P5UA 3FOKA 3QQ1A 3CC1A 3VIFA 3KBWA 4W84A 2YCKX 3A9BA 1TPEA 4RV3A 1WZAA 1A5SA 1JDAA 1T0OA 3FHAA 1F3WA 4TVUA 4B5NA 3E2VA 3M0JA 4ZTXA 3U8GA 2PDKA 2FJUB 3HPSA 1PUDA 2YA2A 2XVKA 4GFIA 4Y9NA 3CPUA 3W1XA 3WQVA 3R0DA 1PEZA 1A4MA 1TPFA 3BAJA 3UY8A 2WANA 3LGEA 4A29A 4M24A 1GWJA 3MUCA 1UPPA 4PR4A 3MV11 1YMYA 4HTBA 3BTNA 3NQMA 2CLOA 1IGWA 3HGJA 4IUOA 1W1TA 2HVMA 3MWCA 5D2WA 2BGNE 1HN1A 5I3HA 3L4VA 5F2GA 1H4PA 4PTMA 1KBKA 1R38A 4IPLA 1SU5A 1BF2A 4MNMA 1XYCA 4H8UA 3TYDA 1WBHA 1UC5A 4OIFA 3LHTA 2YKKA 2HDJA 5G1TA 1WUEA 1Q3NA 1IF2A 4A4AA 3ABOA 1E4LA 3GH4A 4G1KA 4Q4OA 1FY6A 3K1DA 3Q4DA 3QPZA 2F7FA 1U30A 1NP2A 5HPOA 3N4FA 1MQPA 1G1YA 2J6XA 1XPGA 3TVAA 4EAYA 2PTXA 3DGRA 3N25A 3WDHA 1OYAA 1Q6LA 3TC7A 3W0KA 4F66A 4UNIA 2VGGA 1IXPA 1TV4A 3UPMA 1VFUA 3QFWA 4JN7A 4MY1A 4WIWA 3CLMA 4MFEA 3AXIA 4L65A 1WXYA 3KRSA 1QNOA 4UTUA 1YYAA 4M7SA 2Q01A 3U2ZA 1NSJA 2I17A 1LOQA 5CBIA 4GA8A 4LOCA 1SZRA 4F0KA 3NSXA 1D7KA 4M82A 4JQ4A 3CMGA 1BRLA 3E3HA 1E3XA 3KFTA 2FZ8A 5BWFA 1UD8A 1CCWB 5KTLA 1DXEA 3W84A 1XUUA 3BICA 3WDRA 1W6TA 4DEFA 4DBSA 2RDTA 3RMJA 5CXPA 1XW8A 2YDAA 5CGQA 4K38A 1EJXC 1TPC1 1HKVA 3A3XA 3IUDA 3UWYA 3WQPA 2OEKA 4DO6A 4DO7A 3IJLA 3WN6A 5A95A 4Q8QA 5IFTA 4M19A 3DXIA 3QOKA 1F73A 4LNCA 3M1ZA 4KBXA 4LQ1A 1GQJA 2ALDA 1J6PA 3WJYA 1U1UA 5FF4A 1IZJA 2A7NA 3KVKA 3CV7A 4PCNA 3QTGA 4F3HA 5DXYA 4B92A 5FSEC 3FW6A 3V0UA 4OBRA 4JYDA 4RE2A 4JNMA 5A6MA 3URBA 3TWBA 4CQDA 2NUYA 1QASA 1QW7A 3W7OA 1NQKA 3MVTA 2Y0FA 4M29A 3OODA 4Z42C 2VEGA 4EE9A 2J7CA 7REQB 4IIBA 1L8NA 4ML4A 4Z1BA 2PDXA 3W53A 1QPOA 2VRJA 2ZIDA 1E4MM 3R8GA 1RCOB 5DF0A 2ACSA 2FHCA 2FGZA 3D46A 2E1WA 1R30A 1PZ3A 1TZZA 3N17A 1GOQA 2YXXA 5HQEA 1EPXA 3EA3A 2TMDA 3U0HA 5CEWA 1IXOA 2AGTA 4QITA 3IJQA 2XM2A 3LHUA 5T91A 4DELA 3OGVA 4IIHA 4PRRA 7REQA 4JHOA 4UTWC 1Q6OA 3B9EA 3W01A 1P43A 1KGWA 2PP0A 1CGVA 1EO5A 3IJDA 3BURA 5G1MA 3QHOA 4MADA 3SCQA 2BOEX 3K1GA 4JD4A 5IRPA 2A6NA 4H8HA 4HA4A 1C8YA 3C2VA 4GABA 2OSYA 1LQ2A 1VFMA 2RUSA 3SSZA 2WJZA 2O4QA 3JR2A 4WHBA 4MLJA 5C6MA 3GVQA 3EOEA 4N6EA 3H2EA 3LI1A 4A21A 1PKLA 2ODOA 4LUIA 4P7RA 1JPHA 2PF8A 3P74A 1G7UA 4L4LA 1Q85A 4LF2A 4GBUA 1XLLA 4NNBA 2WZIA 1V3LA 2BG5A 3ANVA 1TR1A 4C6LA 4GQ0A 5HPCA 5A6SA 2ALRA 3QYSA 4C1LA 4XZIA 3N2MA 1W5PA 1TTIA 2D2JA 1H50A 4MY9A 1ITCA 4HOXA 2I16A 2FDMA 3LQGA 5EA9A 2DVUA 3EOOA 3BAKA 2BXVA 4WJ8A 3N9KA 2HS6A 1W9UA 6PTDA 2G3IA 1IYXA 1RR2A 2ZKMX 4E3VA 1Q13A 4PULA 4IP5A 4O10A 1I9CB 1FWJC 1GPWA 3GE7A 4Q8MA 3W02A 1XYLA 3NL2A 1W3IA 3DG3A 4DQWA 2FJKA 1D3HA 3ANUA 3N9SA 1BXCA 2UZ9A 3PTMA 3EYPA 4BF9A 3G1HA 1TIWA 2F2KA 2VEMA 4ZENA 1H2JA 5T8GA 3CQIA 3S47A 5C54A 3PTKA 3VDBA 5CCZA 1Z32X 5HINA 3GDTA 3AOFA 1K8CA 5LHEA 8A3HA 4OJYA 2QCCA 3G2GA 3T0BA 2X0HA 3NQEA 1Q4NX 3EX1A 4MDOA 2WXDM 3V35A 1QFEA 3W74A 1BVNP 1ZBVA 2J7GA 3V75A 2PP3A 1IEQA 2P10A 3APGA 4AMAA 4I6VA 3H23A 4PTDA 1XGZA 4J40A 2CCRA 6A3HA 1UYQA 1LWIA 1W37A 2HQAA 5G5IA 1BWVA 4WVXA 3UWEA 3FCPA 4XAZA 3LZ3A 4HOWA 2D20A 1PV8A 2DPEA 3ES7A 4QEEA 1E4IA 1EJSC 2QIWA 4OE7A 5LIYX 4UZUA 2PU0A 1LLZA 6CGTA 5LIXX 4PBEA 3VNDA 2A85A 4ML9A 3AIEA 3PJWA 4L6DA 3PZNA 2FH8A 1R6WA 1EGVA 4AHOA 5AHLA 1S3TC 1SM9A 4IQEA 1M65A 2G3FA 3N12A 3VD7A 3MZ2A 5CGTA 1O94A 4MLRA 4Z1CA 4FR1A 1MI3A 5JUVA 4C6EA 1GVFA 4ROQA 5HJYA 4GZIA 2AMGA 2CESA 2QDEA 3NZQA 2HTMA 4NF7A 5I24A 4JTDA 4HSNA 3WBWA 3LTSA 5LXEA 5CH9A 1SSDA 1YW1A 2OJPA 3GB6A 4NX0A 3IVTA 2WZTA 4O1EA 1GNXA 1NWSA 2PWFA 1KFBA 5CPQA 2A5HA 3BZJA 3KS6A 1QK2A 1P5BA 3AHYA 2BSLA 4NU7A 4IX2A 3L0NA 3V18A 2FTWA 1JZ2A 1Q65A 4EPEC 2R6OA 4LCQA 1JEZA 1F8MA 2A4AA 4X2PA 5C2GA 4ZCWA 2EAWA 3QZ6A 3EZ4A 4UUIA 3SCWA 1HGWA 3OBEA 2XIMA 5A8QA 4LUTB 2YA1A 3E6EA 3A5FA 3C5QA 3DFQA 1E1CB 1YTDA 3TC6A 1XH2A 4L7ZA 3EAUA 3EWDA 1LG2A 1QCWA 4DUXA 1ZL1A 5I03A 3HO8A 1JPIA 1NWTA 5DLCA 3T08A 4NJIA 1TJPA 3ARUA 4JTAA 4OV9A 1WKEA 1FTXA 2WVSA 3PZTA 3TN3A 1J2WA 3KOWA 5IBXC 3U3HA 2VOMA 1F5ZA 2QS8A 3F5JA 4R7WA 4K2SA 3VGGA 5CC5A 3UWVA 1N82A 1C9DA 5LA0A 4O8RA 3N15A 1J0ZA 1EBGA 1HKMA 1Y5WA 4WKHA 3B8VA 4F0RA 2X0SA 4LEQA 1N8WA 1XM3A 3ITGA 5HUOA 3FSTA 2DH2A 1IIGA 3KHDA 1GHSA 4I9JA 1OFEA 4B5XA 4JZ5A 4GGHA 1UH2A 3S2CA 1TMQA 1OGBA 1MFUA 1H1ZA 4MGGA 3A64A 2QDHA 5FEZA 1UKPA 3BH4A 1TZ9A 2VYOA 3FJ4A 1V93A 9XIMA 3QFEA 4UOQA 3WJSA 4KPLA 4A3RA 2E6AA 4EANA 2AAMA 1EC7A 4L5ZA 4DXXA 2E67A 3KW3A 5CBJA 3TV8A 2PU1A 3CYVA 1RP8A 4UMCA 4DJFD 2GJNA 1SO6A 1F61A 4Y9AA 3GD6A 1H3GA 3VMPA 4LXFA 2VZVA 3WBXA 3SRDA 1A5LC 4MYAA 4QG6A 1FHUA 4TTGA 1US0A 3W23A 4D6DA 1FCVA 4JCLA 2R94A 4XD6A 1WDDA 2OO0A 2ZZ5A 1WKDA 4RXFA 1V6VA 3G8EA 4LAZA 1Z41A 4Q4RA 3B0VC 1QK0A 3TOYA 3UG8A 4GHRA 1KCXA 4AAJA 1WKFA 4O14A 3R79A 1A53A 3VD9A 3IRSA 5U4NA 4F0LA 3QRHA 2C1IA 3RLHA 3WBEA 4BF7A 1UC4A 3GZAA 4DN1A 5C9UA 3L4UA 5A2BA 1TKKA 1RPKA 1GYLA 5ECUA 3URAA 2JE8A 2FZBA 1JNEA 4F2BA 2B7OA 2Y8VA 4TUFA 1XLMA 1BQCA 2NUXA 2J4GA 2EJ1A 4B5TA 3GXTA 4TX6A 4BK9A 1ZPTA 2X7VA 4ZO7A 4FALA 4PFMA 1GOOA 4OT7A 5D02A 3WD1A 3WLKX 1GJPA 5H6HA 1VJZA 1YXCA 4H7CA 3VKBA 2QPUA 1I60A 1JDEA 3EOSA 3S6TA 1JDFA 5CAHA 1KRBC 4MZ8A 1NFGA 3TJ4A 4HIBA 1ELSA 4ZFMA 2G5WA 3QXBA 3N11A 3WK0A 4Z2HA 3M0IA 3M7WA 1FDZA 3CUXA 2VGIA 7ENLA 3AS2A 5CPLA 3NQDA 2VRQA 3BMXA 4UNKA 2PDCA 3IIOA 4ILSA 1OD8A 1KCLA 5HR7A 4FNSA 3MSYA 1NFBA 1RBAA 1UBSA 1H7NA 3OA5A 3GTXA 1SZFA 3NYDA 3NUKA 1A5MC 2FH6A 3NPWA 2OXNA 2QVNA 1EP2A 1SJBA 1W1B1 3NOYA 1S2TA 2PDIA 3B8DA 1VKFA 3PC0A 5C9RA 5JMUA 2PE4A 4DJFA 2REQB 4D2JA 2W27A 3EDFA 4ICNA 3UXDA 5G4EA 3W1RA 2SFPA 1QJWA 3KOFA 3VGDA 1RPXA 4AIUA 5E5CA 4KERA 2XG9A 1O4UA 1GQKA 4RDWA 3DYPA 5D2XA 3K2GA 4XBKA 2OO6A 5F1UA 3UR8A 3UCDA 1XBYA 1Y8BA 3W1LA 2FZNA 4JOMA 1Y5XA 2FTPA 4L64A 3HQOA 3MHUA 3R8HA 3AHTA 4JY8A 5ABEA 4E8CA 3ARXA 2B81A 2NSOA 4EF9A 4KT2A 1JAEA 3CB8A 1DWFM 4AWEA 1TB3A 4PMXA 4QQ3A 1JYVA 1A5CA 1F76A 1AVAA 2NQLA 3F5KA 4R53A 2HWGA 3PWIA 5CSYA 2IKGA 3EA2A 3GH7A 3WJWA 2ZRUA 1MQRA 4AUBA 2V5DA 1VAHA 2QT3A 2F6UA 4ALDA 4UR8A 1ZJIA 3VYLA 2FMOA 2QIIA 1KXTA 1FWHC 4N02A 1CBGA 2VOTA 3EWWA 4DF1A 1EB3A 3F2DA 1O95A 5FESA 5A1AA 2F6KA 4W7VA 1KFCA 2D0GA 3UXKA 4RZ5A 1KGUA 4GYFA 1P0DA 1JD7A 3N3MA 3IAPA 2Y70A 1VD6A 1U83A 5B7ZA 1FHLA 4S3FA 2CW6A 3GRIA 1TELA 4XD5A 3N34A 3W3OA 1UD4A 4JL1A 1EJUC 4U2ZA 3PG9A 4LAMA 4WJXA 2JEPA 5K9DA 3DDMA 1PDZA 4FP1A 3TROA 4V27A 4OFCA 4AU0A 4ZE5A 3UU0A 3HN3A 1J79A 3R1ZA 1H11A 1E56A 3EX2A 3BGJA 1HTIA 3POHA 3VGHA 3WLSA 4AZ6A 3WD2A 1PXGA 3CLWA 1ZBKA 1DOSA 3EDKA 1K7EA 1CI1A 2QUTA 1F4HA 3WQ4A 4CNUA 4GY7A 1FWWA 3FYYA 3N6QA 2DSZA 4RXGA 2QUNA 1T7LA 2D23A 1TCDA 4YXGA 3T0AA 4PUWA 1L9WA 3LRLA 1LP6A 2E4TA 2WKGA 5I5RA 4QHRA 3PG8A 3UETA 1W3LA 4DUVA 1JR1A 3IAQA 2Q3RA 2Y89A 3W1QA 4Z1AA 3ARWA 4UQBA 4E2BA 1B54A 4JQ2A 5AECA 2PWEA 3W26A 5E9XA 3SCVA 3FIGA 1WDWA 5CJNA 3TQ0A 3NGJA 4TMBA 1UASA 1K03A 3AUOA 3L4ZA 2PC8A 4K1GA 1HG3A 5BRBA 1H5VA 3WBAA 1NQ6A 1YPFA 5FF2A 2CLLA 2EO7A 2DSWA 1CGUA 4YN5A 3ATZA 3AU2A 4NQ1A 3U9IA 3WK3A 4P7QA 1UROA 3HMJG 1MRQA 4POCA 3ICJA 1P6CA 1WA3A 2Q8ZA 4QSFA 3RG6A 3WX7A 5F7UA 3NZPA 1FWCC 3M46A 4R33A 4HMNA 3OLGA 4XAYA 3GO2A 2V6AA 1Q8AA 1KQYA 3T44A 2J7DA 3R0UA 1VIZA 1W17A 2OQHA 4TVDA 4HHLA 1OC5A 4H9TA 2WHJA 2PDUA 1GYNA 3VDCA 1B2YA 4GX8A 2Y88A 1O60A 4HBKA 4P8UA 3PSVA 3EB3A 2VUNA 5CSSA 4DYEA 2YLLA 4AF0B 3ES8A 4ADUA 2GSEA 4DLMA 4Z2IA 2OKOA 3D5HA 3RLVA 1WB0A 3DZ1A 5E9AA 5GJNA 3URNA 4W8LA 4I9TA 3ZZ1A 4AWUA 4QLKA 4AVOA 3QR0A 5IXEA 3TWAA 3WDPP 1SGJA 2A3LA 3NVDA 1SJAA 3I6EA 4FNTA 3UNDA 3VUPA 1UD3A 2WWCA 1L2QA 5I79A 1LT8A 5D2VA 5AYZA 1GTHA 2A3CA 5XIAA 2EHHA 4AF0A 3NPVA 2NQ5A 1E6ZA 4PH6A 2HVOA 4W87A 1LYXA 5HATA 2P88A 1RK5A 1OX4B 3RYSA 5GQBA 3E96A 4JS3A 2WPBA 2VI0A 4HPXA 3WF2A 1EO7A 1TJ2A 3P7YA 3IWPA 5DRCA 2PTZA 2ZZ2A 3EA1A 2FPVA 3IUIA 3HM7A 4I5XA 4WDTA 4JIPA 4CQ9A 1TR9A 2XH4A 1ZBWA 2FHFA 2YCIX 1C93A 3ECQA 1L2UA 4QQUA 4BKNA 3W1NA 4L4MA 3S1VA 2ON3A 2DEPA 2I1OA 4HJWA 1OX4A 4EPKA 1XQLA 4GZ7A 1L6YA 3BARA 4YIWA 5FF0A 1TPB1 4I8DA 5HNUA 3NM3A 3T9PA 3TSDA 5CAKA 3LXCA 3URQA 4KFPA 4ZGYA 3A4WA 4X0VA 1PZ0A 3I68A 3UXAA 1ZZMA 4R7JA 4DPQA 3N3TA 5EBUA 1ALDA 4AD5A 3MW7A 1C8VA 3HQPA 5BXPA 4NY2A 4BI6A 3O8AA 4PN2A 2OG9A 4JIRA 4AISA 4Y8EA 3SADA 4IISA 1J12A 2EG6A 2IQTA 3L2LA 3VDAA 4K8HA 5DEZA 3ZR5A 3GAYA 3XINA 1AJ2A 1UWSA 4J27A 3V3WA 2AKMA 5M03A 3UY7A 2XZ9A 4FAMA 1XIIA 2POTA 5REQB 3W87A 4B5UA 2AAAA 1FX6A 5CGMA 4JFWA 4PMOA 3RCMA 5FAGA 4GINA 4H7ZA 3WLMA 2Q6ZA 5E70A 3UPBA 3OYZA 3OQEA 1A0DA 3B06A 3POCA 4JTIA 4OBTA 1KM6A 3GG8A 1RBOB 3CH9A 4KWUA 2WOQA 2Z2UA 2PTDA 3LCFA 3E5BA 4YL2A 1ISVA 2DP3A 3R10A 1LWHA 5LNUA 3W2NA 2BVTA 3AXXA 1R3VA 3BJFA 4DJDA 3T42A 2XGIA 4LCRA 4JFUA 2FZ9A 2XINA 1XSJA 2ZUNA 1W91A 3R13A 3GC5A 1UB3A 3L68A 3KP0A 3KCJA 2XH2A 4FF5A 3CWNA 2Y4SA 1WX0A 3CTLA 5CPMA 1KM3A 1IR1A 4QFUA 2AQVA 1J18A 4L80A 4GISA 4GH1A 3V16A 1OK4A 2PDHA 4GC3A 4WF7A 4NL1A 4XWUA 5HULA 3DECA 2PS2A 1PKMA 4URIA 1VEOA 1M53A 3NAVA 3DEQA 3THCA 3FAXA 3NQFA 4GX9A 3KBVA 4WY0F 2CXGA 2JIEA 3W7CA 2Z1BA 3G3MA 4JTJA 1K70A 3CMJA 3U2OA 2DUAA 5DBUA 3VOGA 2ZC1A 5E09A 1PX4A 2OLAA 2BMBA 6REQB 3KTSA 1BXBA 3YPIA 2E0PA 1HP4A 4QSHA 1EKOA 2E9BA 1N2VA 1HJQA 1QXLA 2BDQA 4WCJA 4JYFA 3SUVA 1IZKA 3CH0A 4UTMA 2O9OA 4PFHA 4CD5A 5CJ5A 3TU9A 1U22A 3KBJA 3MJYA 3NL5A 3TEVA 1R5YA 1ML1A 2GWGA 4ZQNA 2QCNA 1E6NA 1MXGA 3H8AA 1W1PA 1XX1A 4WOZA 2GUBA 3DFHA 2CIPA 1W8GA 3KOYA 5A3HA 2HXTA 4DJFC 1K7FA 5C2CA 2PBOA 1TPVA 2XUCA 3BJTA 4BA0A 3V0SA 4O18A 4DNHA 1TRIA 3WEMA 3C6CA 3WG6A 4O28A 2QR6A 3GHUA 1EL3A 1X38A 3MANA 5C55A 1YRRA 2BX7A 4DX3A 1LZOA 2WKLA 2CERA 1DVJA 1MFVA 3NSMA 4IG2B 1K02A 1FWFC 4MUZA 3I6RA 1E3ZA 1E0WA 2DT3A 3QYQA 4J1OA 1YADA 5KITA 4UFIA 5AYYA 1EEPA 1I1XA 3L4XA 3S9YA 4ROPA 4E4FA 1UZDA 1O68A 3S1GA 3OU8A 3P14A 1QR7A 4K1WA 2INEA 3SURA 1JCLA 4YU1A 1NELA 2V81A 5K4XA 3O6DA 3PFRA 3MWAA 3TQKA 5D9PA 3DBPA 4S3AA 2HEJA 1HXJA 3MU7A 1SR0A 2VQTA 3DI0A 2CBVA 4V1XA 1B57A 3E0LA 5MKGA 3DBNA 2NVCA 4IP4A 1VBJA 4EX4A 3GR7A 3SY1A 3E02A 4CNNA 1QBAA 3CB3A 5H8MA 2CPUA 4Q33A 2G0WA 5ABGA 5GNZA 4C7GA 2V5KA 3M0MA 1VFLA 3ABXA 3LK6A 1F7BA 2XFWA 1RJQA 1CENA 3IGHX 4TX8A 1W5QA 1DIEA 2FKPA 1R8LA 1RD5A 4J7RA 1BTMA 2CETA 2QYGA 3E9AA 3DC0A 5A2CA 1CYGA 1F3EA 2Y5SA 1YDVA 3EWUA 3DERA 1BF6A 3WH8A 4Q6XA 3S42A 3WUBA 1F8IA 3IJ8A 3V1PA 3T81A 4DWSB 2ZZ4A 4CQAA 4OWGA 1FWDC 1S2AA 2WNNA 1DJQA 4WGHA 2YW3A 4U2YA 3VIPA 4IGMA 4I7UA 3UG5A 4M51A 4MVAA 1E4NA 3FLUA 1U2YA 1US2A 2R1MA 4WK9A 3FYOA 3W1TA 4I7VA 4D1IA 1RQBA 1V02A 4RZ6A 2VUYA 3I3BA 3LG3A 4N2YA 1S3HA 8XIAA 2YBVA 5MHBA 2VENA 3AI0A 3HJZA 2HJPA 3IJIA 3HB9A 2WCAA 1DORA 2ESCA 4FOJA 2G95A 5TD4A 3F4VA 4HTYA 1VP5A 4MNKA 4DY1A 3LQLA 1RVGA 3G1FA 4OUEA 3TFCA 2F38A 4GLEA 1JDCA 2GGEA 2DIKA 5AYBA 5I3GA 2Z1XA 1AL7A 5HMFA 1ZY9A 2ZZ3A 4HNLA 3PBWA 4QJ4B 4GACA 5FKYA 1NARA 4FOUA 3IK2A 5D04C 1V6UA 2QAFA 3A4JA 2ICSA 4QCFA 1W3TA 1FRBA 4LWWA 2NV9A 2GVEA 1FWRA 4MB5A 1YDNA 5JBEA 4X3ZA 4NJKA 3RMEA 4YTSA 3S3GA 3CHFA 2C71A 2ZC8A 2V3FA 4IQDA 2DSUA 1BSIA 4JQ3A 1YNQA 4Z2JA 4JTCA 3S9ZA 4UQ9A 4JTQA 1E9LA 3PANA 1TG7A 2EPNA 2CWXA 3PSWA 4LFYA 4Y9OA 2OCZA 1O1HA 4MM1A 1OB0A 3SN4A 1A50A 1EA0A 1G01A 4RZ4A 4YWSA 3L5LA 1N8IA 1OQFA 3CT2A 4Q7IA 1A5OC 5LSMA 2W61A 3GNRA 3NNTA 3ITXA 5L6UA 2VWSA 1W9DM 3ZR4A 1EHNA 3HPXA 3FSUA 3GHRA 4G6CA 3RX4A 3VKJA 3OG3A 3OP2A 3ZJ8A 3ZQ9A 1JQXA 3AZSA 2CZVA 5K9CA 1GT8A 1UOZA 2IXUA 1EXPA 4KFNA 2YDQA 1JCJA 1FDJA 1EBHA 2OYKA 4FHAA 3WIJA 3WLIA 4PMRA 5LA1A 1KBIA 1WAWA 3FEMA 5K9XA 3TJLA 3M0ZA 4NKCA 2HE8A 2JEQA 3STPA 3LMYA 4D8AA 4O0KA 2YB4A 2JALA 4DJED 2O0TA 1DE6A 4Q7NA 1QI0A 2VVSA 1J9YA 1WZMA 4FNQA 2ATSA 3VILA 5D38A 1Q7ZA 3MKVA