3KS0H

Crystal structure of the heme domain of flavocytochrome b2 in complex with fab b2b4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
211
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYGGSTYYNPSLESRISITRDTSKNQYYLQLNSVTTEDTATYFCARLFGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heme domain of flavocytochrome b2
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title Structural evidence for the functional importance of the heme domain mobility in flavocytochrome b2.
pubmed doi rcsb
total genus 37
structure length 211
sequence length 217
chains with identical sequence K
ec nomenclature
pdb deposition date 2009-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ks0H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ks0H02
4LU5L 2I5YL 1J1PL 1T7YA 1IAII 3TYFB 4ZO9A 4NKDB 2O5XL 5E7BA 3RIAF 1KPVA 1FNHA 3CFCH 3RWJB 4XP5H 3K7UA 1E4XI 3O3EB 4TVPL 3WD5L 1NCBL 1DUYA 4FFVC 3TVMB 4YHML 1KPRA 2X7LB 3D48R 2P8MB 1KB5B 5T1DL 3ULUD 3VXUE 1U8IA 1RZJH 1F3DJ 2PYEE 3V2AR 1CDCA 3BPLB 4KKLD 5JIIA 4RFOH 4PRIE 4OJFH 4LF3A 2DI8A 2GEEA 2XTJC 4PJIA 3GK8H 3RP1A 1F6LL 2BNRA 4P2OA 4YR6B 2BNRB 4P2OB 2OXGA 5IIEB 3DYMA 3S4SA 3MV8A 1IT9L 4NNXB 2ZJSH 2DWDA 5E1HB 4XNZB 3OAZK 3K2UH 1X4ZA 4TNVF 5B38A 3RWJA 4WHCA 1YDPA 3LHPL 3ARDC 2CDEB 3QH3A 5DEFB 5L88H 2DM7A 5ANME 1I7UA 2JIXB 3ZL4L 1S7QA 2EYRB 4MWFB 1FH5L 2XTLA 5FO8A 1NDGB 1B6DA 1AI1L 3B9KC 5C0DB 5ALBL 4DCQA 1NL0L 4ENEC 5FF6B 1MH5A 3IJHB 3QCUH 2GAZB 5HI5C 3SE9H 3QQ3A 3KWWA 3F7YB 3MUHL 1GGBL 4Y5YC 5DSCB 2DBLL 3WLWC 1Q8MA 2VDPH 2VC2L 1KCSL 4QHMB 2BXZA 3BIKB 3SO3B 32C2A 1EO5A 3OX8B 5E6ID 1CFTA 1E0OB 1HWHB 1A6AB 1YJDL 5EO1B 4BZYA 4CN4A 4MJ6B 2A6DB 4DGVL 5TF1L 1YECH 2YD8A 5DRXA 4JRYB 4K8RL 3C6LB 4LRIA 2NX5D 5IHZA 1YEJL 2HMID 3LS4H 5ICYB 4ODVH 5E2WH 4ORGB 5KZCD 1C7SA 5F88B 1NFKA 4FQQA 3QPXH 5J9PA 2X4SB 1NFIA 2RCSH 3DV6B 2CLVB 1GIGL 5DHVH 3MJ9A 4XXCA 1ZANH 3FO9A 3MMEA 3U4EA 1J0KA 2X5PA 3P4NA 5HHQB 1SMOA 5LGJA 1LK3L 3H8NA 4A6YL 4YHLL 1NSNH 2F54B 4FTVE 5KW9L 1HINL 4HFUH 2YXMA 3SQOL 4S2SA 4XHJD 2N7AA 3WIHA 1K3IA 2H2SD 1A7NH 4XZUB 4XCFH 3PDGA 3SKJH 4ZUSA 4I0PD 3O8XA 1OHQA 4YGVB 1DQLL 4PJHA 5JZ7C 4PD4J 3MOAL 2NX5E 3VXQB 3TWCH 1R3HA 4Q97A 5D7IB 1FYTE 1I1CA 4DN3L 3QT2A 4J1UA 1FIEA 4YFLI 3QRFM 5D7IA 1A64A 4HWNA 3K1DA 4WFED 4NQEB 4XAKD 4KXZH 1IEHA 2NNAA 4WGVB 5JW4Q 4AQ1B 3IDNA 4M5YH 3OXSB 1J0IA 1ES0B 4JHAL 5I75C 3F7VB 5HSFA 4R4FL 3LN4A 4HH9A 3WJJA 1FRGH 3M1BA 4I8DA 2HVKA 3KHQA 3FQRB 4TSCH 3WFHB 4OCRL 4P4KB 2Y06H 5CEZE 3S98A 1FYHB 1G0DA 4LGSB 4XPBH 5IESH 4TTGA 1HNFA 5CD5D 2JLLA 1X6LA 4NRYB 1W72L 1P1ZB 1P6AB 2PYFB 5C0BE 4HJ0C 1BD2A 1A9EA 3DBXB 4LU5H 4OD3L 5EUOB 3N1PC 1LO4H 3BVNA 5I19L 4NZTH 3DECA 2ICWJ 1KJ2L 4YPGA 4I77H 4MXVE 4UINL 5C08D 1RHHB 1PZ5A 4JQVC 3PG2A 3ET9F 4LQFL 4Q6IC 1DQDL 3RKDD 2IAMB 2BNQA 5D1XA 2RGSA 3NIDE 2X4QB 2MFNA 3UTZB 4S11A 2ZKHL 2CK2A 1KB5A 1R24A 3S4SG 5E1AB 5KG9A 3RVUD 3QUKA 4YLQT 3KPSA 1EBAA 5E99L 5DUPH 5JW3L 3QUYC 4CJ1A 2ICEA 4EN3C 2IAMD 5DI8B 1S7RB 3IJYA 4RZCB 5GGVH 4Q9QL 1VSCA 4S0TD 3H9ZA 5I1LB 3THML 3VD4A 5C0AE 2UZIL 4TPRL 5KSAC 3CPLA 3DHMA 3ULVE 5EO9B 2AABL 5GS2H 5DJYB 1T89A 4LLWA 2PCPA 3QIBC 1VKXB 1UYWH 3NH7L 2M26A 3W0WD 4MQ7B 4XP9H 4NOFA 3RVXC 4OZHE 4X5WA 2EYSB 4HPOL 1KT2A 3M17B 3NGBC 4UMGA 3VDAA 1ZVSA 1GC1C 4PJEA 3UTQB 3DVIA 5DRZB 4KJWC 2A9MH 3OV6A 4N1HB 4PGJA 1A3RL 4DJMA 5E8NA 1UCBL 4CVXB 3MZGB 5FB8A 5TQ2L 4HUUA 5F70A 5HHOB 1C16A 2F5BL 2HLFD 1A22B 4MDIA 2QKIB 4YHZH 1L0XA 1KACB 5ETUB 1T2XA 3MODL 5FEBA 1NFDB 1PYWB 4AMKH 4R96A 3VG0L 1DBKH 5EUKA 4JZNB 4NP4L 1U8PB 1J11A 4CAGA 2VLRB 2GTZA 4JDTH 3C5SA 4JO2H 4AEEA 4QCIB 2Y6SC 1CFSB 4OBSA 1JWSB 4MD5B 4XBEL 4L8DB 4PJFF 4WFGD 3BQUB 3S5LA 5FO9B 5C6TH 2F15A 4ZTPL 1G9MC 1CICC 3UAJC 1C5BL 4XNYH 1K6QH 2XTJB 5DQJB 3FT2A 1WBXB 4NT6B 1I9JL 4I3RL 3WBDA 2MCPH 4O2EA 4XP1L 3CFBA 4FFYL 1BZQK 3FFCD 2H8PA 3ARWA 2A83B 3Q3GB 3KPOB 4PLOB 5FHAL 4V2BA 4YDJA 4DAGL 3CK0H 4ZFFA 2DL9A 1TJIL 4JE4B 5DGRA 4HT1H 3MV7B 4ELKA 3P4LA 5HHNA 4OI7A 3UJTL 1BZ7B 3MXWH 3N9GL 1IEAB 5HHNB 2WWMC 1DQLH 5C6PB 3GSWB 1V3KA 4WHTB 2YBRB 1JNLH 1BIIB 4G7VL 3VFNA 2ESVE 1VFMA 1YC7A 3ZO0A 2CUIA 3O9WD 4CN6A 1ZVHA 2AJ3B 2CDFB 3W39A 4M7LT 3WS6A 4JFOB 3RL1B 1MJUH 2H2PD 5I1AA 5KVDH 3P73B 4KC3B 2MWCA 5TE7H 1MFDH 5TDOB 2ED8A 4Z7VE 5GGQH 1LO3H 1QYGH 3QDGB 2BFVL 4ZNEA 1DFBL 2Q86B 4MJ5A 3MSPA 4UTBH 3MQIA 3C6LC 4MSWA 1R3JA 1JPST 3CDGB 2R2CA 2X1QA 1B0GB 2ICCA 5E5MA 5F1NB 5J6GA 2V17L 3QO1A 4O2FA 1YN6A 4P3DB 4OLVL 1CICD 1S3KL 4I0PA 3UAJD 1CI5A 1KCVL 5CCKH 2Y5EA 2X1WL 4AY0A 4FTVA 2WANA 1X5KA 3FQTB 4BQCA 2BOBA 2WWKT 5BMFL 2P24A 4XVTL 2O5YL 4TQEL 5FGSA 5EBWA 1I1AA 2VH5H 1ZVYA 1DE4A 4P9MH 4I77L 1D5IH 2BNRD 4P2OD 3MJ8B 4LLMA 4UINH 4NDMB 1AP2A 4LK4A 4QRTA 2BJMH 4RMRA 4PJDB 5KVMC 4TNVK 3T0ED 4RMQA 2YA1A 1D5BB 1RZKH 1BPVA 1P7QA 1QSEA 5IHUH 2FIKA 1OGAA 4K3GA 5GHWL 4ONHA 4K3HA 2FH8A 4X83A 4FZ8H 3CJJA 2BRRL 4U1NA 3LRSB 5T3XH 4LARL 5C2BL 4PJ9C 1CL7H 3IKCA 4Q9QH 4LOUC 1N0LA 5ESVB 1J86A 4N8VA 5F9AC 5KS9B 2EDFA 3V6FB 1I7ZA 5LWYH 2APBA 2DL2A 3BP4A 1KJVB 3SKOB 4JQXC 4P46D 5J56B 1FG9C 3CU1A 4U1SA 4XVSH 4CN1A 4X8XA 3SOBL 1PQZB 4Y4KC 4K3JH 4HWBL 4D0CB 1V3JA 4GRLB 3SKNB 4YO0B 2KKQA 2VMFA 3GMMB 2IG2L 4KJYB 1Q9LA 1LQSR 3L3IA 3VFPA 4OZFH 4HIIB 4PJCF 3JV0A 4LFHD 4PJGA 3HC0B 4TVPH 4HKXB 5FM8A 5E1AA 4EKXA 1AIFA 1WT5A 1MHEB 2GUOB 5D5MB 4P46B 4PS4H 1JTOA 5LCVH 3ZDYE 3UTTD 4WUUD 1MELA 1M6OB 3JZ7A 2BVEA 1NEZG 3IGAA 3PV6B 1N6QH 1WISA 4L9LC 3MA7B 5AWNH 1NCDH 2BVPA 3IU3A 3Q48A 3ARFB 1IL1A 2Q3ZA 1QP1A 5CWSA 5ENWB 4F58L 2EYRA 4N9GA 2AK1L 3O2DL 4OTXL 5C9JB 4JY6A 5CZVH 1W0WB 1BD2B 3ORJA 2L7UA 5ABDE 1QSEE 3VXRB 4OM1H 3BEVA 3IRZA 4K7PX 1S78C 1OP3H 2I60H 3UDWA 4RX4D 1MUJB 1DVFB 1UJ3C 4RISL 5DD5L 4X6CE 2DD8H 1IZJA 1NMAL 2NY5C 5F7LB 3GJFK 4MNHB 3PWPE 3MLPA 3MTRA 4EOWL 3DX8A 2DLEA 5TFSL 3BPOB 4LRIC 4MA3B 3CK0L 5GGUB 1U8IB 2NR6D 5IW1A 4G8IA 4V1DB 3F7PC 4YXHH 1MCNA 5IW1B 2MKLC 2JK5B 4E42A 3RA7H 4S1SH 1NMCB 4JM2D 3DVGA 1YN7B 4GAJL 4D3CH 1KC5L 5AZEL 3L3JB 1Q9WA 4HKZB 5FB8B 4CDGC 4OCMC 1EGJA 4WFFE 3BPNB 4Y5YB 1UA6L 3MOBH 5DVMA 4J3OC 1UH4A 2ZG3A 4RIRA 1CQKA 4NUJA 4MHHG 1JNNH 1UM5L 3HR5B 2WQRA 4IRSA 2Z9TA 1MRCL 4OT1L 5EBLA 3WN5A 2DTMH 4AT6A 1EMTH 3A6CH 5EN2B 4P5MA 5IB1B 3LQAH 4J6RL 1NDMB 5C0EA 3DX6B 1LO3L 1VEPA 1OAQL 3L3OA 3BZEA 5KVGL 2XQYK 3Q1SL 5T1LA 5EU5A 1ZANL 1P2CB 3ZYOA 1N6VA 3K4DA 4NQSB 5C08A 3CIQA 1IGTA 4LIQL 2VAJA 3C2AH 1YJDC 4NNYB 5HI3C 2NY7L 5IQ7H 1S7SB 4I2XB 4HKZA 3VXSE 4J3TA 4M6OH 2BNQD 2Q3AA 3Q6GH 5CZKA 2YPLE 1AY1L 1J87A 4FQLL 4K23H 5SX5H 3VRLE 1PBYA 5FUZL 4Z7UE 3PWLB 2AEWA 4YHOL 1M1SA 1FZJB 4XNUL 1YUHA 4PJEF 3ROOA 3TO4A 5JPNA 1MJJA 3TH2T 1WC7A 4BZ1L 5C0GB 1JGEA 3CVIH 3M8OL 2CLZA 3F62A 3UEZA 5D9SA 5ISZA 3QPQD 2VUYA 3X11B 4C83B 2HKHH 1CXKA 2YUZA 4TN9A 2BVOB 4WUKL 1H5BA 4TRPL 3TBTB 3ULSB 5IV2A 3BHBA 4U6XB 2O5ZH 3BE1L 5HI5D 5I1DA 3QQ4A 2VLRD 5F7DA 1LP9A 4MNGE 4BSWA 4U1NB 4LARH 4FQXB 2A0LD 1FRGL 2HJLB 3OB8A 1HH6B 3RX7A 3EYUL 1E4KA 5ERWB 5MEOA 4Y88A 4PV9A 4KH2A 2CKBH 4X4XB 5DC9B 1A4JB 4G8FB 4PLJC 3QIUA 4PJDA 2DDQH 1A02N 4KZEL 3EDEA 3F7RA 3B9VA 3HRZB 4NDMA 4BSJA 3EOAA 1MREH 4ZSOB 3X13B 3A6BL 4N68A 1I1YB 3TNNA 4PJEE 1HDMB 4LCWD 2P8LA 2V5MA 1FORL 5E24E 3B9KD 3HZVA 3P0YL 4WO4C 3RWIA 5KSAA 1P7QD 4HK3J 3BN9D 2MTPA 1MJ8H 1XGUA 1WBYA 3MLRH 4WV1B 3PHQB 1P4IL 2NZIA 1T89C 2ARWA 3A6OA 2Z93A 4Q0XL 1I7ZB 1AD0A 4XZUA 5GISH 4F7PB 3FQRA 3BW9A 5J6GB 3NPSC 2VITA 1VEMA 4RMVA 4NQCD 3HMWH 1NSNL 4XC1H 1ITCA 1CLCA 1U3JA 1WTLA 3DVNB 5J3HC 4F9LA 4K94H 4OLZL 3ALPA 3GSNH 4WU7A 3SKMA 2EKSB 1P4BL 1QPPA 1T1YA 2GSIA 3D6GA 3A67H 3RX5A 1KPRB 2X7LA 5D93C 4HIIA 3T3PE 1B0RA 3RWGA 3PWJB 2D9CA 3GEWB 4CMHC 1X7QA 4XPHH 4GG6F 1CE1H 5GXBB 2VZSA 1FDLH 2GSGA 4IOSD 4QXGH 2P5ED 1A7OH 1OQXA 3LMJH 2OJEB 5T3ZH 5TFSH 2B4CH 5JA8B 3VFSA 4OIAA 3REWB 1DUZB 3SCMA 4EBQL 4HIHA 1FVEB 2XICA 1ZT4B 4WU7B 4P4KD 3BP5B 4UAOB 5EBMA 4YJZL 4TSCL 1UFUA 4Y4KD 4NM4H 3LV3A 5DMYA 4XPBL 3GSNA 5BV7C 4I4WA 3OPZH 8FABA 4JDTL 3VW3H 1UGNA 4MVBC 1J05B 3C6SB 2P4AB 3HAEB 4G9DA 1LE9A 3EOBB 1MUJA 2ZUVA 1RSFA 4MD4B 3HKFA 3CSYB 1Q9KB 3LVEA 2W9LA 3KPRD 5MP6H 4MXWL 4Y4HC 5I1JL 3C9NA 4GKZA 4JFDD 4YXKL 3ZT6A 1C5BH 4YO0A 4JY6B 3ZDZE 3U30C 4BJLA 2VDOL 3GMPB 3HG1D 5JQHC 3DVGB 4X0KA 4KXZI 5CZXD 3KR3L 4RCAA 5C0RH 4DTGL 2ZKHH 5CGYD 2HVJB 1CFNA 1WICA 1N5AA 3P4MB 1I9IL 4OFVA 4HIEB 3LEXA 1HCFX 1T21B 5CEZH 2ZSWB 2CDGB 1ZMYA 4JZJB 5GZND 2VR4A 2F54D 1YC8A 3MRMB 3GHEL 5E6ZA 3RTQD 1JYXA 2VLME 3OKOB 3TC9A 3MFFB 5HDQL 4H20L 1M4KA 1A7NL 3EFDL 2E8ZA 2X44D 4NKDA 4OZ4A 3V0WH 1U8NA 5I1IL 4X9GA 3DO7A 1RIUH 2R8SL 2FYYB 1ZGLA 1IVLA 4L1DA 4DVBA 2FWOA 4HKJA 5E2VH 1F13A 2DJ4A 3BPNC 5CSGA 2IBGA 3SJVB 1KJMB 4FXGB 3MNWA 1NGYB 3C6LD 3GKWL 2YSSB 3BH8A 1JPSH 3CXDH 4ZQKA 4OQTH 2WWKO 3GMRB 5DJCB 4Z7QE 1Z9SA 4ELKB 4BQ9A 2DIBA 4YBQC 2BHUA 2QHLA 2F5BH 4P59H 3T0WA 5DWUL 5H8DA 1YNLH 3TNMA 5IB5A 1A6ZA 3U36A 3ULVH 1KCVH 1UWEL 1DBKL 1IILE 4Y2OA 4XMLL 4KZEH 1S7XA 5FFLA 2CK0H 2GQHA 3QFDB 1RMFH 3W5MA 1AE6L 5BMFH 5TH2A 4JHWL 4WI3A 1TZIA 2FYYA 2GJ6A 2R23B 2XZAL 3C09C 5ELIA 5GS1C 3DSFL 4NKIL 5BJTA 5I8KL 5DEGB 1U0QA 4JKPH 4URTB 4V1DE 3L7FA 3DXAE 4LEXH 3I50H 1TETL 3IKCB 5HGHB 1S5IH 4JDZB 3QFJE 4RX4A 3VH8G 1XEDA 5D7KD 2Z91A 4KGJA 1WF5A 4Y89A 3LDBC 3MRIB 3TT1L 3W11D 2C9AA 4G8FA 2CO7B 3MRPA 1CL7L 5HYSA 1JZ6A 4R7NA 4R6UA 3VXUA 4HCRL 1WT5C 4MD0A 4E41A 4FQXA 5C0CD 3O2VL 1FVCA 4LIQE 4LP4A 4OFIA 4GUPA 3U4BL 1U36A 4JVPA 5L6YL 3L5WA 4BA8A 4L9LA 8CGTA 4FQCL 3SY0B 2EC9T 4JFQB 1EFXD 1T7XA 4QXGL 1UWXH 1AQDA 4KUCD 2BVOA 1QBBA 2NXYD 3R1GH 2FR4B 3QCVH 3RWFA 4MCYB 5BJTB 2VXSH 3TV3H 1MHCA 1F6AA 1DQMH 3T3PF 1JGUL 3DPBA 3LKOA 4YIQB 1S9YB 4P23A 1NC2D 4Z0BH 4R7DA 1QRNB 4KHXL 3D18B 4KVCH 2NLJB 3PWPB 4FTVB 1UQSA 1IGIH 3WD5H 3STBA 3DIFA 3ARGD 2P1YA 2YRLA 4P3WA 4JFXA 4EEEA 3HS0B 4POUB 4H88L 2MMXA 1S9VA 3ZE0F 2PW2A 4FNLL 4YHZL 5I73B 3IDJA 3EUUA 4M93C 4NHCH 1INDL 3QUZC 4KAQL 4M8QB 1QNZH 2XA3A 1CLYH 3G5YA 3T1FB 5AD0B 1LK2A 4YE4H 5HVGB 5B22A 4PV8A 4OZIA 1NGPH 2OR8A 4M6MH 5D2NB 5D6CA 4ZS6D 3LIZL 1KB9K 4XCCL 3BZFA 1UH3A 1KULA 1I9RL 4NM8H 2QKIA 1T3FB 4AL8H 4L4TE 3RVTC 4HEME 2A9NL 1OT2A 3RZCC 4FFYH 5DT1L 2P47B 3ARBC 3GSNB 3N85H 1NL0H 1RZIA 4HGKC 1GL4B 5BS0E 2R4SL 2N4IA 5FIEA 4XNQA 4MNQD 1T1YB 3K80A 1DQJB 3D2UA 4H20H 2MPAH 3QEQE 4X5WB 2XKUA 2NY3D 3B9DA 5DMIL 5A2JH 1NJ9A 1MCFA 4JFDA 5L2KD 4OV5B 3O6ML 2LU7A 3NTCL 2EIBA 1EAJA 1XGPB 3A0OA 5H35B 5C92A 2YN3A 2C26A 3AMLA 1HXYB 4X6CF 5CBAB 1NEZB 1SJHA 1Q9KA 1PYWA 4K8RH 1NBYB 3G6AA 5DJAB 4CNIA 2HFFB 3EHBD 4L29A 2Y36H 4UB0H 3T77B 4PS4L 2BSED 3O4LB 2EH8H 4JFFE 1PD6A 4U1JA 1H3PH 3OKOA 3L3JA 1T2QL 5F1OB 4MJIA 3OR7A 4QRRE 2GTZB 2QADB 1RD6A 1Q38A 1RY7B 3ZKND 2QADD 4KFZC 4WRLA 3ECBB 2DQEL 1CXLA 1K4CB 2AXGB 1IQDB 4KRMB 3B2UD 4NQCA 3RL2A 4KROC 1W8NA 4HDIA 3AFLA 2FJGB 4HGWA 3WFBL 3JXAA 4JVWA 3NZHL 5DVNA 4ODWB 4XH2B 4CU6A 3RNKA 1VGEH 3VGGA 2HKHL 1T0NB 5LBSH 5TQ0H 2QSQA 5D71H 2HLAA 2NY1D 4HZLA 4PP2A 2JB6A 4TRPH 2YZ8A 4OGAD 1INEL 1ZT1A 2EYTB 2JB6B 1HH9A 3JV5A 4U1HA 4C55A 1GOFA 3U36B 4OLUL 3LHPH 5L88L 2EH7L 4K8RD 4DEPB 3RY6A 1E28B 5I0DA 3SGKA 4XVUC 1F4XL 4OCWH 1KTLB 1BQLL 4M6AA 3F58L 4OKVB 5IBLD 4M5YL 3HMXA 2GJJA 3VXPB 4MCZA 5DD1H 5D8JH 4QYOB 3O0RH 4YDLC 2FLRT 5CEXB 3U4BH 1T1ZA 2VLRE 1GOHA 4FQCH 4QRUB 3MLXH 4C83A 2GW5A 4KI5F 1XR8A 5D9SB 2NW2A 5KAQG 1OOAA 3MRNA 4Q6IA 4XRCA 5CD3A 1JGVL 5IEKA 1FL5B 4NO5A 3MLWL 4C56D 1JF6A 1EEYA 3O8XB 2YR3A 4HXBL 1NGYA 2R56H 2OLDA 4U1SB 2HT2C 1EHLH 1CDJA 5EPMB 4KHXH 5C0FB 1QFPA 4KK9C 2JB5H 5D96B 1XF2A 3HN3A 2VTFA 5LAXB 3OJVC 4JRXB 5I75B 4GUPB 4RQQA 1MVFA 1BREA 2VZVA 4MA1C 2R29H 2F53A 4M61B 1BFVH 1DN0B 1FNSL 1REIA 4PB0H 1FHGA 1NC2B 2D03H 3G04B 4ORGA 1G6RL 3LKQB 3B2VL 2VN7A 4MSWB 2OTPA 3P9LA 2DQIL 3OSKA 2GJZA 3P9MB 1UM4L 1I7RB 1U3HB 1X5XA 3RTQA 1FO0L 3GSUB 5EIIA 4NQXA 1CF8H 4N9OB 1WBYB 1FIGL 3IJSA 3OR6B 3CMOL 3RWIB 5B38G 2VL4A 3PP3H 5FYJE 4HIJA 4OGYL 2HT4C 5T3ZL 1RUKH 3C08L 5I30H 5CEYB 4FQ2L 2R1XB 2W60B 3PGDB 5LXGH 4L8SA 4HFWB 4GS7C 1JVKA 4QHUA 3S3SA 4CGTA 3ARGA 4G80B 3U4AA 3S34H 4U1GC 4BZ2H 4KJWD 3O6KH 1R3LB 4GJTB 4OD2B 3FTGA 5D1XD 4LRNH 4UIKH 5TE4H 5F9OL 2DWEB 4PJBB 2V5SA 1XGTA 4L8BB 3VGHA 2PTTB 2NY2B 4X8JB 1KB5L 2X89D 3HCVA 1XAUA 1F4AA 2F19L 1BWWA 1HKLL 5EZIL 1TMCB 1T04A 3TBSB 5KSAB 1N3NA 1OP5K 4JO1L 2A1WH 2C7UB 5FGRA 4EI5D 3GUTB 2EDEA 1VB9A 5IBLC 3QNYA 1PX4A 2Q7YB 4ISVA 2CR6A 4UB0L 1IL1B 4J7RA 3GSUA 5EIIB 3KR3H 1LP9F 3EKCA 4LHUD 5I18L 4LLQA 5IVXA 1ORQA 1FNEB 3BPCA 1CIUA 3B8SA 4WCYL 6CGTA 4DGYH 2ED9A 3MFFA 3KDMA 4HF5L 5DI8A 4LKXB 3SDAC 2HTKD 3FO0H 5JW4M 4DZBA 4XNMA 4MNQA 4POZC 3HE6B 3QI9C 1Y6NR 4PRHD 3UTSD 4PJGB 4U6YA 2J6EA 1QFOA 3WFBH 2OP4H 1E4WL 2X4TA 2AKRB 2AXFA 2ZUQB 1S7SA 4I2XA 2AKRA 3OXSA 4Y4FC 2V5TA 3SO3C 2IAMA 5M7QA 1RJZA 4LQ1A 2JJUA 3B2UC 4NPYA 4ZAKD 2H1PL 2P8MA 5F1SA 4TSBH 4X4ME 4RSVA 1Z5LA 4LSRH 3M17A 2PXYB 2X4NB 2LE9A 4W6XB 4N5EC 5FCUH 1JP5A 5EIVA 4OV5A 3GB7B 4WEBL 3AS1A 3RVVD 4DWHA 3UBXB 1JNHB 1W0WA 5EWIH 4WHYH 2W65B 1A7PH 3VJ6B 5TE6L 5SWZE 1YMHA 1TPXC 2VLJD 2PXYD 1TJHH 5KTEL 5IIEA 1JZ4A 1NFDA 2BVPB 4KVNH 7FABH 1RZIB 4G9FE 4HDIB 1R3KA 3O3EA 2VR9A 3KXFA 3O3UN 4I9WE 4BQBA 3ALWA 1UG9A 2X09A 3H7BB 5DHVB 5DLML 1LILA 3LEVL 3RDTA 1N2RA 2X4QA 3UTZA 1CXEA 2YD1A 3DX6A 1J1OL 1A2YB 2VDLL 3TCXA 4ZFZA 2IFGA 2IAND 1F90H 5FYKH 3VFGH 5T3ZE 5GS1B 2ZOKA 4NNYA 2ESVD 4LHUB 3IXTA 1P9MA 3I50L 1BIIA 2D0GA 5LQBH 2DIAA 2VDKL 2Y72A 1CTNA 1G7MA 4AM0B 1MY7A 5GRYA 3G08A 2J88H 1F58L 1CFTB 4HHAB 5EO1A 5IMMB 5EIQA 2WINA 3IYLW 5HPMA 5EN2A 5DZLA 3DLQR 5I8CA 3ZHLA 4C59B 3CU7A 1EVTC 1EX0A 1NGWA 1MCPH 3MV8E 2FH6A 1PVHA 4BKLA 5TDOA 1G6RH 5GQBA 3WNMA 3E3QC 3CDGA 5I1GH 5J9PB 2CH8A 4HT1L 4YBHA 3HNSL 1S7TA 5C8JB 4LLYA 2PW1B 3IU4L 4YDJB 2DQUL 3QBTB 1D9KB 1XGYH 4AEHL 4YHYB 1KIPA 4E5XA 1K4DA 3MACL 3RUGF 1HH9B 4I18B 5J1TC 1XF2B 2F58H 4HJGB 4G43B 9CGTA 3NOIA 3VFOA 2C4XA 4M7KH 3HC3L 2XWBA 4EUPA 2NQCA 2XTJE 4U1KB 2AEQH 4G5ZH 4PLKD 2APFA 1QEWB 1GXEA 5DF0A 1I7RA 1OAYL 5EUOE 2RQ8A 3NAAH 2P5WE 5HYJB 2YD9A 3UC0H 3QDAA 4WU5B 4ONFL 3L5WB 5DUBB 3WEXA 1G0XA 4JO1H 4ETQB 2H32B 2P7TB 4X4YA 1DTUA 3W0WE 43CAA 4JM2F 4YE4L 1I8KB 4U1IB 2OM5A 3B9KB 3NACH 1JCKA 1F6AB 3FZUD 4NO3A 3UP1A 3RAJL 4Z77A 3TYGH 2H6PA 3SKOA 1VFOA 1BEYL 2PW1A 2HTKC 1OAKH 3X13A 4RBPK 2HN7B 1U3HC 3V6OE 1EAPB 4L4TD 3SKNA 2AS5M 4I0KA 4WDIB 3GBLA 4U31A 3VXMD 4LHQB 4X4XA 2A73B 1OSPH 3QUMB 3BP6B 1KYOK 1QFHA 5FKAB 3KYOA 4J4PD 1JZ7A 2C4FT 4IRSC 5FYKD 4Y5VA 4Y2DA 4YDIL 1HHJA 3C5JB 3PUCA 1U3ZA 4EI5A 4L4TB 1MWAH 5D2LF 2GCYB 4R8WH 5DRWA 4D0CA 3PV6A 3IFLL 5CBEB 5GRJH 4DGIL 3AU1B 4PJCE 5IVXB 1RIVH 1EHXA 3EO1B 1NLDL 2VXUH 1WWCA 1Z9MA 1C7TA 3N1GC 1GAFH 4RAHA 3MRQB 1ADQL 1YYLH 4MJIB 3C5ZD 3BWAB 5I1LA 5HPOA 5IFJA 1FE8L 1ZHKA 4XXDA 1G7IA 3S4SB 3IXAB 2CQVA 2VISA 5IMOB 1K4CA 2AXGA 2BNUB 2CJUH 1BOYA 3MNZB 4MAUL 2QV2A 3B3IA 4OI8A 2WBWB 3GKWH 4XCNA 4XBGB 4LPYA 2BNRE 3HI6L 3IDJB 3Q1SH 1SYVA 2FX9L 5SWSA 4OQTL 1NBVL 3J7HA 4KI5E 4GRWB 1NUFA 4PJHF 3H7BA 2BNQB 4LIQH 4UDUB 3FO1A 3L3GA 1NJ9B 1CDIA 4P57B 3U1SH 1DBBH 1K5NB 2G2RB 4IMLB 3VXRE 5EU4B 4X0KB 3QXDA 1LO0L 3K4AA 3RJDA 5JQ6H 1SM3H 3UPRB 1ZGLB 5DTFA 4LCWA 4O51B 4GG6B 5H35A 1EEUA 3QI9B 1X5HA 1JNHA 2DI9A 4XXDB 3RI5K 4XNXH 2BSTB 3T8XA 4OFDA 1N5AB 3ZKXB 1YQVL 3HUJA 4PRHE 1L6XA 2V9QA 3I9GL 1T7WA 3U48A 1JHLH 3VFTB 4FABH 1OY3B 4KI5D 2PXYA 4HBCH 2X4NA 1UH2A 1ZWIB 3HTLX 4WHYG 2D3VA 4YAQA 3ULVD 2GT9B 1SQ2N 4GRMA 3H9SA 1FNGB 1YMMB 2OR9H 3HC4L 4Z5RB 1KLGA 3S6CA 4PBXA 2NY3B 5DYOB 1LK3H 3GMNA 3QIUC 4MJ5B 1KLFA 1MCJA 5GGTL 1L9NA 1T83C 2PTVA 5IHLB 3TT1H 3T4AA 4G8GA 2X4SA 1NUNB 1HOCA 4YXHL 3BAEL 1XF3A 2ZCLL 5CINH 3EYUH 2R1WB 4KJQD 5DMIH 5T1MB 5DVLA 3EZ8A 1AR1C 3WFDL 2FX8H 3CFJB 2CKBL 1AO7B 4XAKE 2DQUH 1RZ7H 2YEZB 5C2UB 2QEJA 3RWEB 3L3HB 3IDMA 2VLMD 3OKKA 3WNNA 1EK3A 1HHGB 5GRUL 2E7LA 1J1XL 3FRPG 1MRCH 4PRBA 4JKKA 1MFCH 1UKQA 2F8OA 1VFAA 1Z0MA 3KS0H 3LS5L 5C0GA 2FEEL 3MOQA 1GOGA 4JY4A 4X9FA 4QWWD 3H3PH 5C09E 5BV7H 2Q1EA 2ZG2A 4Z7WA 3MLVL 3KXFB 3EYSL 4Q0XH 3HI5H 2DM4A 5E94A 1JWMB 2FD6H 5H37G 4YIQA 1I85C 1JMXA 2D03L 1OD7A 1C08A 3UTTB 1MPAH 4M4PA 3LRSA 5EC1A 1MFAL 1NKRA 3QQ9D 4HWBA 4MMXC 5SV3A 5GZNC 4GMTH 3D39A 4OLEA 4M3JA 5EH1A 4MB4A 2ID5A 4K71C 1QLRB 2AQ1A 3QIUD 1JI2A 1IGML 2RAMA 5AEAA 4P23B 3MCKA 4P3CL 4YR6A 5I30L 1BFSA 3GSRA 4Q9RL 1OAUH 4Y5XC 4JPWL 4F8TA 4UQ2A 1ETZA 2NXYB 4NKMA 4ZAKB 1RFDH 2PYED 4HG4K 3GJFA 2WAHA 1JGLL 4OFYD 3FJTA 3QH3B 5DEFA 4C58B 1RUMH 4EDWL 1YPZE 3CVHA 3CZFB 4IJ3B 5HTSA 4IRZL 1J5OL 2F54A 4UUJA 1TVBB 1MCWM 2P7TA 4M61A 4X4YB 2DYPB 3ROLB 1I8IB 5C0CB 1YEGL 2DYPA 2XNAA 1NCCL 2QQLH 4GG8B 1JZ3A 3RY6C 1GC1L 2K3TA 4DKFH 4S10A 5GRJL 3BD5A 3KLAA 3MBXL 4NSKB 1OGAB 4PJ5E 5DJXB 3KPSB 3VG9B 4M8VA 3GI8H 5ECJE 3RVWC 1N5YL 3QUMH 1KELL 1WFNA 1OPGL 4JFPB 1TJGH 2PYFA 4N0FA 4G6JL 1OB1B 4HPOH 4BM7A 4F9PA 3BGAA 1RZGB 1GGIL 4OQ1A 4QOKE 4LL9A 3G5VA 3OKEB 5KSAD 1P4LA 1JTPA 5HVHB 5FKAA 4OFPA 1SEQH 1FZOA 2NY2D 1VADB 3FTGB 3BUYB 3B4NA 5D1XB 3ULUC 5DJ6A 3SCMD 1HYRC 2C5DC 2NNAB 3STZA 1I7TB 3TBSA 3ULVC 1D7FA 1KIRA 1OP5H 2NLJA 2Q7YA 5E4EB 1UB5B 3Q5OA 4J4PC 4KUZH 5D1ZB 1U91A 3ELAT 3LD8C 3TYFA 5JDSB 5C07E 3HR5A 4IRSB 3DETC 2PYEB 3IFNL 4X98A 3V7AG 2DQFB 3GMOA 4LKCB 2R2EA 1CE1L 3PF2A 3RNKB 1G7LA 3L9RB 3EOAB 4V2CB 4JJHA 4YHIB 2OJZL 4TNWK 3T0XA 4X6DF 4OGXH 1SHMA 4LFHG 1CBVL 3EO0A 3P11H 4G6ML 2FL5B 2X4TB 3ZKXC 3FZUC 1RUAL 1KTDB 4ELMA 5I1CH 3FQUA 4TUOA 1ACYL 3GM0A 5DA0B 4QTHB 4JRXD 5HHOA 3E2HB 1IM3B 4HLZH 4FQJH 5DHYB 3FFCB 4PUBL 2EICA 2FBOJ 4K3EL 5CHNA 4Z7WF 1CR9L 1EH9A 5MENE 3O0RL 2VITB 2CDGA 2KZ1B 1D5ZB 1HZHH 1F4HA 1N26A 4DK6A 4X98B 3S35H 4XCEB 3O8XD 1ZT4A 5E00A 4ZS6C 5HGDA 1LEKB 3L3KA 1OM3H 2EYSA 4M7LL 3FQXA 3HG1B 3SCMC 2EXWD 1RVFH 3ZTJG 5I18H 5IBTH 2CLRB 1X5LA 4JM4H 1ZGLP 2VIRA 3CLFH 3BT2L 1DBAL 3WN5B 1M7XA 4R0LB 5BV7L 5EBGA 5KANI 4QYOA 1QVOB 3ULUH 1JK8A 4NZDA 4FQXC 4KUCF 4G8GD 3LKPB 2VDRL 1D3CA 4CRPA 1C08B 3MJ9H 2XXCB 1FFQA 5JIKA 2E9BA 2R1YA 5FDWA 4IDJL 4Y4KB 2BX5A 1R3JB 3F5WB 3W9DB 3O3DA 3G5ZA 5ALCL 4GRLC 3X12B 4NQSA 1FNSH 4U1HB 4XVUD 5JZ7D 3L5XL 1TVHA 1A3LH 4Y2DD 4J3WA 4AYFA 4AEHH 1BF8A 4BQ8A 4WUUE 1NUGA 2CLRA 1D5IL 5FM4A 1HIML 3MV9E 1C5CL 1FO0H 4ACPA 5DD3L 1RJLB 5EWIL 4WI4A 4ZD3L 5FYJU 4KMTH 1AFVH 4OF8A 2P5EB 4XCEA 1S7QB 5FECA 1T1XA 3QXTA 1NMBL 4EXPX 2HT4D 3VFVA 3ZE2E 4X6EB 2CKBA 2N1KA 2GAZA 2Y4SA 3UJJL 1WWAX 5MHSE 2AAVA 3G5ZB 4WFHD 1XGQA 1IFHH 1WZMA 1A14L 2EXWC 1IC5L 5DJXA 5C1MB 4HULB 5EPMA 3TA3C 5MEOB 3MRFB 4M00A 3DSNA 1XMWA 1U8QB 3QQ9C 2XKNA 4JG1L 4JDZA 4HWBH 1ZLWH 4HZAA 3EYVB 3FN3A 4NWUL 2VE6A 3MYJA 2IPKA 4UTAL 5BQ7A 4POYA 3WNKA 2DICA 3VCLA 5CGTA 5FOJA 2Q76B 4OCSL 4GG8A 4MJID 4ZNCD 3VG9C 1TZIB 1I8IA 2GJ6B 2R23A 4MXVF 1HDMA 3EGSB 3EO9L 2KL6A 4ETQA 5EU6B 4U3CA 1D5XB 4B0MM 4PJXA 4AL8L 2R2BA 3CZFA 2OCFD 2R4RL 1ZT7A 2C7UA 1PEZA 3EDJA 3UTPD 2IQAA 3DI2B 4W68A 7CGTA 2FHFA 1Q1JH 4XP6L 4FQXD 5T5NF 5E8PA 3OKEA 3GJEA 3O2VH 3VXMB 3QO0B 5AYUH 4ZUUA 2OMBA 3WXWH 1PZ5B 3NH7H 5DMGD 2AQ3A 5ICYA 3JUZA 3S7GA 4J1UB 3K4ZA 5DD5H 1EJOH 1G9EA 1CVSC 2FO1A 3IETB 3V8CA 2MHAA 3OKMB 4NKMB 3AMKA 3QIWC 4KTYA 3UBXG 5C0NC 4L3CA 4PJ8A 4G6AD 4QF1A 5HGAB 3P73A 2PO6A 3SGEI 2DTSA 4CW1B 3LQMA 5EUOF 4XPFL 1G1CA 4NRXB 1DQML 1TPXB 1TQBC 4GW4A 5ANMB 3BKCL 2D9QB 2EE3A 3C5JA 2DQJH 1NC2A 3G04A 1BQHG 4LSUH 3GUTA 4GT7A 5EU3B 3PP4H 1T2QH 1IC7H 4MB3A 4O00A 4H1LA 2D7QA 1QRND 1ZLUH 1UEYA 4AEIL 4HC1L 1EHNA 4H5SB 4OZGB 3V5HB 1R3KB 4F37F 4NO0D 5DGQA 2PETA 4H26A 1HEZB 1W72B 5CMAA 2HN7A 3L3KB 1OM3L 3D2UD 3GZKA 1G7LB 4P9HL 4NHCL 4KJPC 1NH6A 1Q72L 4QXUL 4U6TA 2VN4A 1Q9LB 5K93A 5ITFB 1CLYL 3GI9H 2FATH 2F74A 3BT2H 3DO7B 4NCC2 4HWZA 2HH0H 1WBXA 3CXHJ 4JVUA 4YHNB 3WLBA 5LQBL 4P5MB 3FQUB 3W82A 2E7LC 3U9UB 4FQIH 1B9ZA 3SE9L 3RDTB 3OHXB 4MMZC 4PJ5D 1XZ0A 2HVKB 4X4ZA 5IFHL 4MA3A 2I9LB 4PJAE 4Z0XB 3SDXF 5EU6E 2KBGA 1RULH 2XI9A 3S97C 1V8HA 4WFFD 2YKLH 1F4WH 5AZ2H 3B6SB 2FB4L 1TENA 2OMNA 1O0VA 1JNLL 4G7VH 2ZOLA 4XNMB 3BKJH 1GZPA 4LASH 2JELH 4V1DD 3S5LB 2VXUL 1A6UH 1FV1B 4Z7VB 5JDSA 1KPVB 2EE9A 1G7MB 5GS0C 5T3XE 5J6HB 2NY6D 2D31A 4JZNA 5JNYB 1NKOA 3LS4L 4W6WB 4PRNA 2EEDA 1WTGT 1XGRA 2FLBT 4HUMB 3QUXD 4M5ZL 5FYKU 4IOFC 1CFSA 3V6ZB 5F7UA 4WTWA 2ITCA 4LCYB 1LE5A 1GJIA 1NQBA 2P5WA 4ZFZB 2IANB 4J2XA 4JO3L 3QUKB 4CVXA 3I84A 3QIBD 4YHLH 3CSGA 4A6YH 2Y07L 4LMQI 1IC1A 1WBZA 5DQ9A 1HINH 4HFUL 4MDIB 3SQOH 1CFQA 3E6HB 4YDKL 5C3LD 2WUBH 2PTUA 4K07A 2VLKE 1NCAL 5HPMB 1Q9OB 1WGOA 1J12A 3KYNB 1DN2A 3H42H 5IJKA 4L8CA 5IQ9A 3UTTE 3QWOA 1WZLA 4OCXH 1OSZB 1S7UB 3DMMA 3SBWC 4EN3B 1I8KA 5EOQL 4P5TB 3RPIB 4GRWH 2VQ1B 1ZSDB 2P8LB 1QSFE 3MBEC 5EU7C 4EUPG 1BVLB 4C56A 3MYZA 5HGBA 1A6VH 3I02B 3RTQB 1PAMA 3Q5TA 2CIIB 4ZDHB 2M1KA 4JHAH 1L0YA 1UM6L 3RWHA 2VOTA 3MNVB 3FB5B 3MXVL 5ACMA 3V0VB 3KG5A 1EO7A 1ZA3A 2R1YB 1K8IA 4KK5C 4D0BB 1Q9OA 4O02L 1TCRB 1X5JA 3MRIA 5CUSL 5TE4L 3NFNB 4KKAD 5DQDH 3TJHD 3QNXB 3MLZH 5GGVL 3JWDL 1KPUA 4NFCA 3N06B 1KSRA 1VESA 1EJOL 1C5DA 4RA3A 5GJTH 3ULSA 1QLEH 2VQUA 1D5BA 1GGIH 4QGTA 3UYRH 4I3GA 3FMGH 1DL7H 1YYLL 3QQNA 3S88H 3IDYB 4WFEE 4NQEA 5EULV 2JJWA 3EO1A 4GMSH 4Y1AE 3WEXB 4OLXL 1R3IL 1KUMA 3MA9L 3MRRA 3KXFE 2YPKA 4ERSH 1A6PA 3SY0A 4OSUL 2FO4A 3NN8A 2HFEA 2C1PA 5FUOH 4EI5B 3LKQA 4RFEB 3GGWB 2J2ZA 4U1IA 3X3FH 4GXUN 2EZ0D 3UZEA 3OTTA 2AJSH 1S7TB 3EIFA 4EUPB 1CICB 3ZTNL 4KWUA 5IB2B 1CXHA 3BRFA 5FGCE 4OZFB 2F53D 4NC1E 5CJQH 1PLGH 5BVPH 3FN9A 1M7IB 3OG6B 5FAAA 1JF1B 3QZWA 2CDFA 3SE8L 1MNUH 3DIFB 4MXWH 4U33A 3PGDA 2W60A 4YXKH 3ARBD 3WFZA 1J8HA 4IHOB 3IFPB 1LDPH 3L3DB 1RZGA 3WLBB 5DJ0B 1X5IA 3VD7A 1DSFH 2J1KA 2UWEE 1CBVH 1M71A 3B9EA 1IKNC 2QLVB 3MUY1 1ZKAA 3VI4E 3EOTL 1CFVH 2R0ZH 5IKCA 3WIHL 5FOBA 1H3WM 2B5IC 3P4NB 3FB7B 2NMSA 1AHWB 2HA1A 4MXQD 3R8BB 1QKZH 3MLYH 1QRNA 2WLZA 1ERNA 7FABL 4DKFL 1ORSA 4OKDA 2FCBA 4F7TA 1V7MH 5GS0D 3MGTA 1HZHL 3O3AB 5DLMH 4JR9H 3SPVB 1OWRM 4X6BA 5FO7A 4X7DC 1HILB 2I07B 3MXWL 3N9GH 3MNZA 2IC2A 3ARZA 2XPGA 4X6FB 1VENA 2IADB 2ADIA 3OGCA 4GQ9H 3S5LG 1FNGA 4GRLA 4RGMC 3PGFH 1VDGA 4NZUL 3U9PH 3CX5J 1U8NB 3ZYJA 3BQUD 1UVQB 3E8UL 4PJ5A 3TESA 5E56A 2A2QT 4PRPD 3HFMH 1IBGL 1FLRL 2FJFB 3SDYL 1S7WB 5FK9B 5D1QC 1SEBB 2OTUB 4X7TB 2IPUG 5F72S 3VRJB 3MA7A 4X7SL 1ZLWK 4L5FL 2XOTA 2UZXB 3UTSA 4G8IB 4A2MA 4HIHB 1BBJB 1YDPB 4G42A 4RGOL 4Z7QF 4DN4L 3DX7A 5IVZA 4XWOD 2FZ3B 4OZHF 1A6ZB 2DLFL 3CVIL 4H8WL 3HI1A 4GMTL 4L3AA 5IOPB 2R15A 2WLYA 5DDHA 1QA9B 3LKSB 4JCMA 4KJYA 5TH2B 4M62H 4HWZB 1JPGA 2FDBP 2HRPH 4XVTH 2IANA 2O5YH 4TQEH 4FQ1L 1SY6L 4XWGH 5FCUL 4LLVA 4YDVA 3JV4B 1A6VL 3BHBB 3TP4A 4IIQC 2C3VB 3QHFH 2GK0A 4OZFG 4JPWH 4ODWA 4XH2A 4CVUA 1XGRB 1I1AC 3L3HA 5CP3A 3VD5A 2WSKA 5HI4D 5BCAA 3IT8D 1WWWX 4PJ8D 4PGCA 5I1CL 2FGZA 2B1HH 3SDCD 2X70B 4PJXF 2PO6D 1U8QA 2IAMC 2X40A 4UT6L 1BM3H 2H2PC 3CCHA 3MV7A 1J5OH 1UACH 3VD3A 3AY4A 4FG6C 5J1SC 5IVOA 3WSQL 1CQYA 3P4MA 5L7XL 3IF1A 2GYSA 2AJXL 2EIZB 3VA6A 5F9DC 1MSPA 3K8LA 3LEVH 4YHPA 1WAAF 5EORL 5T1KA 5I1KL 4F80A 1MCQA 5LJYH 3IAPA 4GKNB 3WL9A 4PJ9A 4AT6B 4LLVB 4YDVB 2GT9A 5E6IA 4L9DA 5I1AB 4LCCB 5B39B 4NQXB 3K74B 4Y16B 1I3VA 3P0YH 1KELH 2G75B 3GDBA 3VMPA 2YSSA 3BH8B 4UIMA 3ARBB 3S37H 1BLNA 2MQ3A 1R3IH 3MA9H 4MHHI 4RAVA 3TJEH 2C3HA 1XIWC 1MIMH 3BZEB 2YWZA 3IDMB 4Q2ZA 5CFHA 4NYLB 5BXFA 2LU3A 1FBIH 5CEYA 5DZNA 2ZUTA 3TIEB 2VDRH 3QZWG 5HVHC 1IARB 5BOZG 5BRZA 3CFDB 3BD4A 5GGVY 3H7LA 3MBED 2OQJA 4G80A 1FJ1A 1ZOXA 3HMXH 4M48H 1LEGB 4UV4H 4WJ5B 4GXVH 5HDOA 4PJ7A 3U6RA 1UJ3B 3ZDYF 4ZO7A 4N0CD 3KNBA 4MX7A 1F02I 3DJ9A 4HUVB 4G6FD 1RK1B 2PF6A 4L8BA 5DFVC 3HG1E 3CVHB 4Y8AA 4NNPL 4WU5A 1JUFA 2X41A 4Y1AA 3U7WH 3SOBH 4OZGE 4FA8A 5I9QB 5BVJB 4MWFA 1FFNB 1A21A 1X5FA 1QFUH 3AM8A 5BVJA 1XGUB 1AP2B 4M4RA 3HUJE 4NQED 5T3XD 4N8VG 1NMCC 4FQQB 1AQDB 2IALA 4R2GC 3GSXA 2E9IA 3CFEB 1EDQA 2E9JA 4DW2H 3NIGF 5F8QC 3GJFH 4FP8H 4PJ7B 3QULB 3B5GA 3O11A 3MLTA 4KMLB 3WXVH 4I0PB 5KVFL 4HLZG 3STLA 4EOWH 1G7PB 2B8OT 1W0VA 1ZE3C 2IQAB 4HK3N 1NCBH 2NTSP 2W91A 5JO5A 3G08B 3UXFA 4WUUB 3MUGB 4I4WB 1MLCB 4PRPE 2JF1A 3LEYL 1P4LB 4ONFH 4LNRA 4WENB 5GGSB 4FMFA 4JY5H 5GGRB 3ZT5A 5IHZB 4GAJH 4XCNB 3BPOC 2H3NB 2Q6WB 2Q8BH 4D3CL 2DQFA 3GMOB 4FQJL 1QSFA 4N1EA 2PXYC 2VO5A 3P0VH 3QDMD 5ID1B 5INCA 4K8RC 4JFDE 1MY5A 1KENH 3ES6A 5SWZD 5I76B 4HIXL 3V4PL 1P7KB 3BUYA 2XQYG 3MX0A 4JFOA 3RL1A 2DQTH 3CFIC 1IT9H 5A16A 1EMTL 1UXSA 3WJLC 1BGXL 2Z8WC 1H3GA 4I0CC 4ZTPH 3TBVB 3CLFL 1EFXB 3JBG7 4HGMA 5IFHH 5FKPB 1XH3A 2DF3A 4L4TA 4M1GL 2OR9L 4PV9B 2QHRL 3VXMA 4LNRB 1WQVT 1MOEA 2ICWI 5IJVB 3SKMB 4X9BA 5T5NG 1BJ8A 2FZ3A 2LVEA 1VFUA 2FEEI 4OZIE 4N0YL 4LCIH 2PR4L 2VAAA 1U95A 3BN3B 4XNUH 2LQRA 5DJ8A 1G0YR 1DVFA 4NN5C 3LQAL 1EXUB 4NPYB 4WV1A 4NC2B 4OQTA 5HJ3A 1HIMH 3TO4C 1WCBB 3CLEL 4PRPA 2GFBA 4PBVC 3ZYZA 5F9WC 4JQXA 4PD4K 1SBSL 2BVTA 1T1WB 3F12A 5DJAA 2BK8A 4CNIB 5HBBA 3C2AL 3MRJA 4Y5VC 1IGYB 5AAMA 5TE7L 3QXDB 1RZKC 1ZHBA 1QYGL 5MHSD 4U1JB 1BQHB 2A74A 2X1XR 3H9SE 5DD1L 5EDXA 1MLBA 4W70A 5L7XH 1T3FA 1CTOA 5DJZB 1KTLA 3QDHA 3SPVA 2XZCH 2XZAH 1JK8B 3GSQB 1CD8A 1TNMA 1AC6A 4OI9A 1TZHA 1B4RA 3RUGE 1J18A 5AAWA 2ZP0T 5L0QB 2YD7A 4XT1C 2MQCA 2OJEA 3T65B 1ACZA 3G5YB 3T1FA 3VGAB 1MIML 3ARRA 3O9WB 4Q7DA 3MRDA 1JRHH 3EYFB 1YPZF 5BZDB 4Q9RH 1Q0YL 1XR9A 4YFDB 4MB5A 2YC1A 3PJSB 5HYQB 3H9SD 3MV7D 4UQ3A 4R90L 3QDMB 3FFCA 1FGVH 4MX7B 4DFIA 1AGEA 2YKLL 4U3HA 1D5ZA 1AGEB 4FZ8L 4AIOA 1Z9LA 2BRRH 5T1KD 1E27B 4IDLA 4Z7OE 5A1AA 4JREB 2YK1L 2AGJH 2P44B 4BH8A 2OSLA 4WW1A 2ORBH 3C60B 5C2BH 4PJ9D 4PRBB 2W9EH 4LCYA 4XP6H 4ZFFB 2Y06L 3WHE1 3VWJC 3VI4F 1F6FB 2A77L 3MRDB 3D39D 4OD1H 3QDME 4RFEA 3BIBX 4NQVB 4J8RB 2ZOKB 4AENB 4NQVA 2X4PB 5T1MA 3SGDH 3QA3A 4ZUUB 4NGHL 3VRIB 4NBXB 2AJUL 1U92B 3BZDA 5IK3A 2ADJB 3EW3B 2G5RA 1JPTL 2B4CL 4P2RD 1HHGA 3X3FL 5D7LD 3TH3T 1TIUA 4L3EA 3RWDB 1ITBB 4JRXA 5F9OH 5HHOD 1YEFH 2DQGL 3FQWB 5KVEL 1KB5H 2H9GB 3V7MA 2ZNWA 1S9VB 2NY4C 1NFDE 3FCTA 1ONQB 2QQNL 5D2LA 1Z9OA 3INUH 1U2HA 1TVBA 2YPLB 4PY8I 5JW3H 5KSUA 1MHPL 2CUHA 4F2MB 3TPUB 1NEUA 4N0UB 5IEKB 3NCBB 4MCZB 5IROC 4PLNC 2OTWB 4LP5A 4F58H 2DQHL 2X4PA 1NFDF 4TPRH 5TJWK 2VXQH 3D9AH 5E8EA 3LKOB 4M1DL 4WEUD 4FRWA 1ZLUK 3H3KA 1HXMA 4Q2ZB 4PGDB 5IWLC 1AGFA 2VABB 1CS6A 4Y16D 4WCYH 1G7IB 4ZUSB 1PY4A 5KS9A 1IEAA 4JHZA 3ABZA 3KLAB 1KG0A 3PHSA 3BSZL 1HQ4B 4L4VA 3H3BC 1BAFL 3FL7A 4RWYL 1A3RH 4MNQE 1VERA 2ZUSA 1IAMA 5JLZB 1KN4H 1ZHLB 4OUUA 4NWTH 5DQDL 1MAML 2F8VA 3BDYH 3O6MH 4YXLH 5DJ6B 5AZ2L 3SDCB 5HGAA 4N5ED 4JFFD 2NY6C 3NFPB 4GRWE 4KHTL 3BP6A 4H1LH 2JELL 2Z92A 5I1JH 3L6FB 5D5MA 5I74B 1YNKL 3I6KB 2FR4A 4ONOA 3E6FA 2GFBB 2UY6A 2YUVA 5CBEA 1TQCC 4NZUH 3U9PL 1P7QB 4UNUA 1XFPA 2WBJA 1FV1A 1ZK9A 1A0QH 5IGXL 3C8KB 3E3QE 1E6JL 1RJCA 4TSAH 2DIJA 5EZJA 3A6CL 1F11A 4J3VA 4OZIB 2VL5B 3SDYH 5JHLH 4TYUA 1NAMB 3BWAA 4EXKA 5K9OA 4KK6D 5I6XC 2VWEE 4WI2A 2Y6SD 3DBXA 2YD5A 1CN4A 3ULUL 5IOPA 2DOCA 4WDIA 4B53A 4WFGE 4F57L 1GGUA 3HS0A 5FYJL 4PREA 1KNOB 3P4OA 4DAGH 1YNLL 4G8GB 1SYVB 3QDJE 2UVFA 3MRLA 4NUGL 4QRTB 3ULVL 1O5DT 5IEHA 2WUBL 1H0DB 5DQ9B 3UJTH 1HXYA 2R0KL 2X6MA 3OWEA 5CZXC 3AY4C 2DLIA 3VE0B 1OTSD 4JQVA 4Z0XA 3B83A 4F9LC 2FIKB 5E2VL 2FRGP 2SEBB 5IW6B 1DSFL 4NBYB 3ARTA 3EBAA 5F6IB 3MRQA 3UZQA 2IBZX 5ESQA 1AD9B 2EH7H 5E00B 1MJUL 5I66A 4ZSOE 5C3TA 4KMTL 4WUKH 4R90H 4IIQB 1QSZA 3FB8A 4H1LB 4OFKA 1T21A 2Q8AL 4R96B 4ELMF 2DMBA 2BSRA 1NLBL 4MD4A 1UKSA 3AREA 3V9FA 5D70H 5CMAB 5E2TH 3BRGC 4OD2A 3WV0A 1QBMH 1ZLVK 4Z78B 5KZCB 2F74B 3IU4H 5JUEL 1HOCB 3IKKA 5JXAL 5L6YH 1RK0A 3T0VA 4EQ2A 4JRYD 1JN6B 4Y5XB 3QCTH 4IRSD 3QDMA 3A6BH 5KS9F 3LSOA 1VPOL 3CDCA 1F3RB 4NGHH 2ARJB 3NIFF 4WI5A 1A4KB 4M7LH 2L7JA 2HLAB 1A4KA 4IJ3C 1ZXQA 1M05B 1NGXB 5DMKB 4LOUD 4I18A 4P2YA 5L8LB 2BVQA 4WI9A 5FA3A 3SGJC 4Y1AB 2B0SH 1JGUH 12E8H 1JWSA 5CEXA 1KBGH 5I8CB 3IJYB 4RZCA 3MROB 2CRMA 4LSQH 4UT7H 1MCKA 1HHKA 1T5WB 3H9HB 4E9LA 1A2YA 4XC1L 1V3MA 1RV6X 4JM2B 5D5MF 4F37K 3MPCA 4KKNA 3DWTA 5FYLD 5AG9A 4ZOCA 1U8KA 3QP3A 4ESKA 1QVOA 2A6IB 5C0AD 1YEDA 5FHBH 3HZVB 1CF8L 3F7YA 4PR5B 2GK0B 1V5JA 1MCSA 4ZQKB 1NDMA 4PY8J 5C0EB 5TPWH 4M1DH 4EIZC 3KPMB 3BIKA 4FQ1H 1UEMA 4XWGL 4RAVB 4CU7A 3HB3D 4QHMA 4AM0A 2B4CC 3PDOB 5DRZA 3K81A 4DW2L 1URLA 2QSCH 1FYTB 3OAUL 4Y4HB 4N0UE 1DVFD 2I26N 1QFWI 4J12A 4DUVA 4XRCB 1DCLA 3OB0K 5IQ9B 3DROA 3CH1B 1NAKL 4YGVA 1A7OL 3U30B 3VXSA 1ZS8A 4HUUB 3VXRD 4JAMA 4JFHD 1P5UA 5DD6A 3MRPB 5FYLL 4F2MA 1YMME 4HXAL 3MV8B 1IZKA 1R5IB 5D2NC 1IQDA 4YFEA 3KNBB 3RIFK 1IAIH 3VXOB 3UPAA 3IDIA 2F54E 4YH6A 4MJIE 2DJUA 3VXOA 4LPVA 2AJXH 4RNRA 3BDYL 4DK3A 1WJ3A 1NCWH 3S35X 1YPZA 3OG4B 5DHVA 4LAQH 5HI4C 4NHUB 5AWNL 2NY1C 4DKAA 1L4IA 2Q86A 4LDEB 2MPAL 3DUUB 4ZODA 2VLKB 1GH7A 3PDOA 4PG2A 2AK1H 1A3QA 1UB6A 4G43A 4HJGA 3W2DH 2YRZA 3LIZH 3QIUB 1I1FA 1Q72H 4QXUH 4MAYD 4FQHA 5DVKA 1A9BB 3HRPA 4EN3D 1R3HB 2IADA 4NKOB 4WW2B 1R5VB 5IFJB 4GRWF 3EFFA 3FO0L 3D3VA 4JRXE 5FYKE 2GSIB 5D6DA 3MUGA 1PKQE 5HHVH 1AGDB 4MNGB 2YA0A 3VXME 4LNVA 5DS8B 3JWDC 1KIUA 4Z7WE 3KXFD 3MLUH 2VB5A 3MZTA 1S7XB 5L2JA 1RPQA 2IWGA 4L5FH 1LDSA 4OLWH 1OVZA 5JMRA 5EU3A 4EUPH 5I15H 3VDCA 2HMIC 1XGTB 5F3HB 1CU4H 4PJBF 5DFWH 1BJ1J 5JTWA 2ZJSL 1FGNL 5DA4A 3IJSB 1F3JA 1UZ6F 1Z6JT 1SY6A 1MI5D 2JJSA 4I9WD 1S8DA 3T0EB 3BO8B 4LVNB 1JYWA 1SBSH 1OCWL 1ZHNB 5I17A 3MLSH 1I9JH 4I3RH 2FSEB 3WE6A 1MLCA 2NY6B 1AO7D 2V5YA 4RMSA 3N50A 4ISVB 5E4IA 3DNKA 1U42A 3MREA 1XF1A 2ZUXA 2PW2B 1V7NL 1HILA 1CD1A 1NCTA 1BBJA 2R2HB 1NLBH 3AREB 3VXQA 4X7EC 1I8LC 3H2WA 3CSYA 3KPPB 1AR2A 4OCWL 4PGZA 4LPCA 5JHDA 4KK6C 3LPGA 3EO0B 4BH7A 2VDPL 3IFOB 4X6DE 5DC4B 4P23C 1ND0B 1NUDA 4GAGL 4S1DD 3T08A 4Y4KA 3W9DA 2XWJB 5JOEA 3VH8A 5JUEH 5D8JL 2XG5A 1AHWA 4D2NA 3FAWA 5K9QG 4PJ5B 4QTHA 2EDNA 2QQQA 3S36H 3ARYA 1J1XH 2I27N 5EORH 5CLWA 3QDGD 2X4UB 2HVJA 1NEZA 5C0BD 5D1ZA 4AIXA 4HFWA 1JGVH 3QI9D 4WTXA 3SQBA 1FAKT 4OCXL 2FATL 2G9HB 2EXYC 4KJPD 3P77A 1BFOB 1B6UA 2X2YA 4APQD 3IU3B 2HH0L 2H26B 4E42B 4WI8A 3HG1A 3HPJB 4JB9L 3T2QA 1GIGH 3IDXL 3KPPA 3D2UB 2F5AL 2O5ZL 3BE1H 2JB5L 4F7CB 5CD5C 4NO0B 4MAYC 4WWKC 5FGBC 3PWJA 3C6SA 3TIEA 4U6YB 3QQ3B 2CPCA 3MGOB 1P6FA 4Z95H 5BRZE 1AIFB 5J1AB 2H2SC 3T1WA 4O58H 2E9WA 3DX9A 2W0FB 3RWHB 1BBDH 3D85D 3ARBA 2A83A 4JN1H 4K7PY 5BV7B 1UJ3A 3FOLB 1S9WA 3KJ4B 5H37H 3ARDA 4RGNC 2AW2A 4FFZL 1AGCA 4V1DA 5K33A 1PKQA 4UU9B 1L7TH 3RY4A 32C2B 4MA1B 4DN3H 1MFEH 3C5ZB 4HCRA 1G6RB 2X1PA 4JN2B 5IMMA 1U58A 1G84A 4NRZA 1NDGA 1QLEL 4QHLB 5LG1A 1OF2A 1E6OL 3VJ6A 3T8XB 2CLZB 5DEZA 2AEQL 3EDKA 2J8HA 2WBJD 3TFKC 4MGXA 4IRZH 3JWOC 5I71B 4Y5YA 1N0XL 4OKVA 1OTTD 2FEDC 4EI6B 4RAUA 3GMQA 1X5AA 4R4FH 4GKNA 2VYRE 3V4VH 2UYLB 5IWLA 2W0FA 1MQ8A 2QQNH 4GAFB 1I1RA 5FO8B 1NCWL 4L8SC 3LD8B 3JVGA 5B3NA 3V5DB 3KPOA 1G7PA 1ZT1B 2EYTA 2FX7L 3UROR 1KYOJ 3D25B 5T33H 1ZLVH 4K9EC 1QO3A 2Z91B 3D9AL 4K3JL 1VFBB 5C07B 3RAJH 5J57B 2GJ6D 2KQMA 3HPLA 5HHMB 4PJIB 3W5NA 2W0PA 1QLRA 3ZKSD 2OK0L 1N7MH 3WUWB 5E9DE 3S96A 1WAAA 1S7VA 1R5VA 3W0WB 2G60H 4UU9A 4ODSH 1NCNA 3W0WA 1X9QA 5EUKB 2VDQH 2B39A 2VXVL 1FVCB 5CIPH 3NFNA 4P4RB 3EOTH 4QNPF 4MA7L 4NFDA 4LRNL 4LSTL 3DUUA 3V95A 1KJ2A 2BHYA 4YZFF 1CDYA 5DJDA 3PHOA 2ORBL 4R8WL 1CK0H 2VSCA 5I15L 2Z35B 3FRUB 4YXLL 4O02H 3TN0A 4OV6F 3PGCA 2IPTH 2OP4L 3QULA 3QA3B 3DV6A 4ALAL 1YN6B 4U1LA 2AJYL 4IOIB 3DUSB 4GQPH 4PG9B 1MAJA 1VGKA 2XFXB 1GPOH 3HAEH 1EFXA 3OKKB 5IT2H 1A7QL 5C08B 2AJUH 1LO5A 5IP4A 1T20B 3D3VD 5HHOE 5DJ2A 4JRYA 1G6VK 2YD3A 4NC0B 3VWJA 2HT3D 5F9WB 5CKAA 1VFAB 1DJSA 1KOAA 1HQRA 2D4FA 3OGCB 1BP3B 4KRPD 2F8XC 5I76A 4OSUH 1HHJB 3GM8A 4S1DC 1ZA6B 4EJ1C 4CL7A 3IFOA 5AD0A 1YNTB 3IDGA 3U46A 3GSVA 1E4WH 1I9IH 5DUBA 5L2KE 1RZJL 4OZHA 3P9MA 2GJZB 3DXAA 3HCVB 3MR9B 3AS3A 3D0VA 1HK6A 1FVEA 1CDGA 1WEJH 1B4JL 4TSBL 1C1EL 2IF7A 3WFCH 3CVHH 4N8CH 3AREC 1PSKH 2UWEF 1EUTA 2E27L 2D7MA 1N6UA 4GW5B 2FECI 2Z8RA 5C0AA 1HI6A 2DKUA 1CGYA 4RGMB 2EE2A 3NZHH 3K2UL 1OTTC 2FEDD 3G5VB 5C6TL 2XY1A 5KSBF 4QTIL 5IKCB 2CRZA 5CP3H 4JM4L 4LVHC 1A9BA 5J06A 1TZHB 1BFOA 5DURD 1F3JB 1OAZL 3QHZH 4ZYKB 3NPZB 1LHZA 1ZTXL 3BJLA 3MV7E 4LSVL 4U7SA 4OAWA 1KNOA 3P4OB 1I3UA 5E2WL 2IBZY 1T03H 2W07A 1U9KA 2XWJA 1T66D 2EDHA 3BZ4B 3RHWF 5E8NB 2AJVH 3VI3F 5JPMA 1XCQB 2BDNH 3SJVE 1BQLH 3CH8A 3MLYL 1QKZL 3F58H 5DWUH 4HS3A 5MI0B 1KCSH 5IEHB 1NBZB 1AD0B 1JPFA 3QYCA 4GXUM 5J8OA 3U9UA 3RWFB 3WSQH 5KW9H 3OKNB 2SEBA 3MUZ1 1BD2E 5FYKL 1XIWA 5HHPA 4JFEE 3REWA 1YNKH 5GRUH 5KOVC 5I1KH 5L2KA 3C5SB 1IKNA 4NN6B 5BZWB 5IGXH 1QTYT 2NCMA 3RVUC 3R06A 3NFSH 1N64H 1WCQA 4JFPA 3UTQA 3MACH 4G9FD 2NX5B 1A7RH 5ADPL 3ZT7A 2VKXA 2BY1A 3CNKA 1HSBA 1WSST 3RVTD 4NO2B 3I75B 2EDTA 4ZOEA 1TETH 2XPGB 1MCEA 3E8UH 5E6IB 1YY8B 2PCPB 3CUPA 1QSED 3C5ZC 1IFHL 1KEGH 1JRHI 4F7EB 1NC4B 4J3XA 1TTFA 3HE6D 4PJEB 4HV8B 5ILTL 1KT2B 5MEQB 3L5HA 4M02A 3L3IB 1IAOB 2P5WB 5CILH 2WIIA 5ICZB 3VFRA 4N0CC 4BK5A 2FJFA 2ICEB 2NY2C 4PB0L 2EXYD 3UX9B 3ZE1E 1CFQB 3KS0J 2ZPKL 4UOW0 5KS9E 2W65A 3KPNB 3ZKMC 1OLLA 2F58L 1BWMA 5ISZE 2JIXD 3IDYC 4UT9H 1AGCB 2BSSB 5HHPB 2HG5A 1CIDA 5DK2A 4MJ6A 3MV9D 3OL2A 5DK2B 3TYGL 4NZTL 1MJJB 4JANA 1RIHH 5DD0L 2VXSL 5A2KH 3SDDB 4S0SD 3CMGA 4I5BA 4C57C 4BUGA 2XWTB 1Y0LA 5F1IA 1U6AL 5C09A 1CYGA 1AJ7L 3QXAA 4OF3A 4K94L 4OLZH 1GC1H 3TJHC 3L5IA 3OJDB 1A6WH 4OCRH 1D5XA 4OB5L 4DVRL 4QOKD 3SJVA 5E99H 5MEPB 2RFXA 1G9NL 3WJLA 1GPOL 4FZEL 3FQWA 5DJCA 1Y6KR 2BOBB 1A1MB 5FECB 3GB7A 2Y7QA 3TO2B 3RDTC 1RJYB 4DOHE 4OCYL 3PV7A 3EYVA 1GAFL 4XPTH 5EZOL 1NCUA 2DLGA 2A6JA 1L6ZA 1U8JB 1QR4A 2DAVA 2LAAA 3HRZA 5IBUG 3T2NH 2I5YH 2QBWA 1FVDB 3QXUA 3HZYA 5B3JE 1PFCA 1WV7T 4I0PC 3KYKH 4KQ4L 3U83A 1P9MC 3TIDB 4NQDD 4LSQL 4UT7L 5HHQA 5F7WC 3AUVA 4OZGF 3ZSSA 1NBVH 1GGTA 3N85L 3O45A 4UV4L 4F33A 1C1EH 5GSRA 2KH2B 1G7QA 5FKPA 2C1PB 4R4NC 3NIFE 2BOCB 3V8OA 1IGTB 5ACLA 2B1AH 1IKFH 4M6NL 4QXTA 3V6BR 1ADQH 1TVDA 4QHUB 4TVSa 4N0YH 4PJIE 3U7WL 4LPTA 3GHBL 2IMNA 4P49A 3BEWA 4PRIA 3OAUH 4H26B 4F15C 4ZS7H 4R7DB 4JY4B 4IOIA 4G6KL 2FHCA 5F88A 3D87B 4Y7MA 1R0AL 4ZUWA 5DMJB 4O4YH 3N1FC 4Y8DC 4PRDA 4HBCL 3ROOB 3QWQB 4PGBA 3NFPA 3VRLF 5E8OB 2EEAA 3FFDA 1AI1H 3QEHA 2EH8L 2HKFH 2IH3B 1MEXH 2Q8AH 4F7PA 4MDJA 3QCUL 2V2XA 1TITA 4K7FB 4GW1B 4K9EH 1SM3L 2XKSA 1G1YA 1R24B 4Z7VF 2APWA 3I3DA 2X89A 5I2IB 1G7HB 3S36L 4WIQA 3LEYH 4WWKA 4AIZB 5CS7A 1T83A 1FAIL 4OGZA 2FX8L 4LCUB 1QSFD 1J1OH 2XFXA 5GJSL 3FT3B 1OGTB 5JHDE 3BRDA 1B0RB 1ZHKB 1KCLA 5E8PB 5ISZD 4HUWB 1Q94B 3FT4A 3QR2A 4Z7UA 3RUGA 3ZL4H 1MRFL 5TF1H 4D0DB 1EO8H 3D1MC 3HC4H 2CXKA 4TTDC 5HYEA 4M7ZC 2IFFL 1ODAA 3ARFC 4MQXD 4ZUVA 4P59L 2J88L 1RUPH 1IM3A 3ZYIA 5H2BA 3V6OA 1EEQA 1GGBH 1UWXK 2EDRA 1RAMA 2VC2H 4WI6A 4JN1L 3S3JA 1G9ML 4JKWA 3BZ4A 1TNNA 3UTOA 1M6OA 3UBXA 1IC4L 1QSVA 4OLVH 4YK4C 1IGFL 1MF2H 1F4YL 1KEMH 4HUWA 3AAZA 4NQTA 3WMSA 1OCWH 2YPVH 4POZD 3VGAC 1L0QA 3GMQB 3HAEG 4TVPE 4EI5C 5MI0C 1E6OH 3AXLB 1RJZB 1XGYL 4PR5A 1MFDL 3C9NB 4GKZB 5JXED 1JE6A 4IRJD 3LKSA 5C9JA 1N0XH 1J0ZA 5KAQF 1S7UA 3DMMB 5C0IB 5JW5A 2Y5TB 4PJAA 1RUQL 3GO1L 3MGOA 5FDWB 3O6LH 2FD6L 1RZKL 4J3UA 2DQCH 1H15A 4NKQB 4XNZC 1A6WL 2NXYC 3ARDB 4E0RA 4MYWB 1DVFC 1XZ0B 2DDQL 1NCCH 1G9NH 1I8LA 5C70A 2OZ4L 1MREL 3WS3B 4YNYA 5DRNB 2JIXA 2XZCL 5JIPA 2YN5A 2J8OA 4RRPG 1JNJA 3ESVF 2NTFB 5EZLB 1FFNA 4XVSL 1U2CA 4JGMA 2Z31B 1AHWC 4ZXBB 3GMLA 2WQ8A 1JGLH 2W0LA 3QG6B 5TGBA 3RGVB 4DVBB 4KRPC 5IHUL 4H0GA 4ENED 2W38A 3EOBA 5DFTA 2HYMA 1H8NA 5J11C 2NZ9D 3K1KC 4KVCL 1ZEAH 2D7NA 5D1ZC 1WIPA 4BH8B 2R1WA 1U8MA 2D7OA 1N2RB 1EIBA 5DHXB 1JL8A 43CAB 4KDTA 1B2WH 2HJLA 1PLGL 1X6NA 1MCBA 1BAFH 1FZKA 1K9TA 4HWEH 1MRDH 4X6DA 5C71A 2ATPB 2WW8A 2RHEA 3RWDA 3VU2A 3PQYB 4OF6A 1U8OB 1GHFH 4PJ7E 3MV01 4FFZH 5F7FA 4HX1A 5GRVK 4K94C 5DZOA 2QQKL 5D7SL 4GH7B 1NGPL 5FUCC 1YEIH 4QXWA 4DGIH 1UZ8B 3BFOA 3E1F1 3JUYA 3VFTA 1NFIB 1XIWD 3L5JA 5D72H 1NLDH 2RB8A 3TT3L 2LABA 1T4KB 5HD8D 3P2TA 3SE3C 3IFPA 2J4WL 4XPFH 1A0QL 4S1QH 4RISH 5IB1A 4BFGA 3TBYA 1D9KD 1DBML 3QIWD 4G9FA 4PB9L 4LSUL 1A1NA 1XF4B 5H94B 5I17B 3RIAK 3HNTL 3BOVA 4OGXL 3CFCL 3D25A 1OGAE 5CD3B 3QXAB 3SEPA 3V52H 1FCGA 2R4SH 4O2FB 3IS0X 1C8PA 2LFGA 2FX9H 2OI9B 1F3DH 5E5MB 5F1NA 4KKCC 5ADOH 2V2TB 5KVEH 2J8UE 3VW3L 4R0LC 1NAMA 2H45A 1ACYH 5FYJH 3CVHL 4S1SL 4X99B 4XXCC 4M43L 5LKNA 4O2CA 1HN1A 3BP7B 5K59E 2KQNA 1X5YA 4GQ9L 5A3ID 2BCKB 1I85A 1EEZA 3MOBL 5IMOA 3FHAA 3TM6A 4QKXB 2R0KH 1LEIB 4NP4H 3CC5B 5D1QB 5IB3B 3T0BA 1T1XB 3MREB 5DJ2B 4Z8FL 1CGSH 2AI0L 2BMKB 4YPGB 4TUJA 2DQDL 2VXQL 1E4XL 1SVCP 3X11A 1GYAA 5TDNA 4PLKC 1JHLL 5L2JB 2ESVB 2N7BA 3BESR 4YBLC 5GRXG 1J9CT 4EVNA 4ODTL 5I6XB 4QHNA 5D7KE 2P5WD 5TE6H 5ACZA 1MQKL 3WFHA 4P9HC 4Q74A 1CK0L 6FABL 4PJCB 3QDJD 4QRUA 5ENWA 3AVEA 3C87A 1S7WA 3PIQA 1UQSB 4PJAF 1L7IL 5CAYB 2YMXL 1KN4L 1TDQA 1IGFH 1BQUA 1XH3B 5ESVA 3P0GB 4EIGB 3U7YH 1X44A 1OB1A 1VGEL 5F1KC 2MKWA 3NA4A 4JFYB 4QOKA 1V3LA 4Z7UB 3B3IB 3MJ8A 4YHOH 3SJVD 4Z6AT 4R26L 4WTZA 1MAKA 3WJJC 5JNYA 5EB9A 4M9OA 4EDXB 2VLJB 2HRPL 3OZ9L 1N64L 4KHTH 2ADIB 3MRBB 4M7JH 4NJ9L 4MQ7A 5CIPB 1LD9A 3U82B 3DGGB 4LLDB 3B5HA 3WDJA 1P7KA 4P4KC 4N0UA 5K9JL 3EJZC 4AK1A 4HKBA 1VPOH 3VE0A 1PKQB 2YD6A 2IPUK 2AV7A 3BX7C 5KVDL 1RUQH 3GO1H 3VGBA 5B8CA 1JPGB 4ZOAA 3RUGB 4OF7A 4Z7NE 1T04B 5DMGC 1BX2B 3FO2A 4G3YL 4ZG1A 3U0PB 5BOPA 3RFZC 3N1QC 3DOSA 5D5ME 5FUZH 2ENSA 2CGRH 3HI5L 2I07A 4L29B 3H9YA 5BO1H 3UTSB 3VXUD 4M93B 5IJVA 5DUMH 1HQ4A 2XG4A 1QRNE 2EDQA 3OQ3B 4JANB 2FBJL 2H26A 3AC0A 2X4RA 1QZ1A 5I1HH 2LTQB 3HNSH 3KLSA 1HSBB 3LRGA 4EN3A 4JFDB 3G6JA 3QISA 2NX5A 3SN6N 2P46B 1IGMH 3VXNB 1P2CA 4XMPL 1FORH 1MCLA 5B39A 2R69L 5I16B 1SJHB 5D7IF 2HJFA 5ESAA 1T03L 1QG3A 4ODSL 4HS6A 1NAKH 2C1OB 2GCYA 1S9WB 3OKNA 2Q87A 5DHYA 5FOBB 3MRMA 2B20A 5EA0H 3QWRA 1FZJA 1U93A 2X4OB 1BF2A 2DMCA 1YZZA 4JFEA 4R2GB 1HE7A 2ICWB 5BW7C 3DURB 1Q9WB 3MCLL 3EJYC 3PABA 5I8EA 3REVB 3RPKA 1T0MB 3T4AB 3EYOA 4Y4FD 2UZYB 3V5KB 1U3YA 1I7UB 3FMGL 2AJYH 4YHNA 4LKCA 2CDEA 2I9TA 4GMSL 4TULH 1AO7A 2X4RB 5JDJA 3MLRL 5IVXF 2YPKB 4TNWF 2BHZA 3JTTA 4UV7H 5GSRB 1XR8B 4ETYA 1MFBL 2K9UA 1GVIA 5J13B 5IW6A 1IGIL 1KXVC 2QSVA 2V7NA 1RHFA 4EBQH 3CFBB 1O7SA 3GSWA 4HS6B 5CILL 4HUKB 5CJOH 5K9KA 4JY5L 1M7IA 1MCCA 5F6HJ 2VZOA 4HUVA 3P0VL 2A1WL 1AXIB 4YWGL 1EGJH 1FPTH 3QAZB 1CD0A 5C0BA 4P48A 4NQEE 1A1MA 2CD0A 3IFLH 3MYJB 5L9DH 5FHBL 3QWOB 1FNFA 5IR1A 4Z5RA 4O9HH 4XVJL 5FCSH 1RZFH 3OKLB 3LDBB 1Y0LB 3QNXA 5F1IB 3MRHA 1CLZL 4QRPD 4OM1L 2QR0A 4FXKB 5F8RC 5GS2D 4FQPA 4I48A 1Q0XL 5KSBE 4C56B 2X9XA 2I60L 2MOVA 4MCYA 3GNMH 4Y0GA 1F11B 2VZ3A 1OAZH 1YEEL 3QHZL 4M1GH 1INQA 1HWGB 3I3EA 2O5XH 1QHPA 4XWOC 5DR5L 4MAUH 3V0VA 4Y19E 2V5RA 3CX5K 3RKPA 5JOFA 2P45B 3PL6A 2BC4A 3HB3C 1OWWA 1X4XA 2YMXH 5SWSE 3D85A 1HH6A 3ESUF 3AB0C 5CEZL 4JR9L 3BD3A 3LQZB 3V6FA 3ARDD 1RURH 3I6LD 1B0GA 4LVEA 1G7JA 5FV2A 5T1DH 4C56E 1KC5H 5AZEH 1D6VL 2WBKA 1L9MA 1K8DA 3LPWA 1BOGA 3V6OC 2DJSA 3ZTJH 2AEPH 4NZRH 2F9BT 3O2DA 3MJGX 4OCYH 1ETZB 3EOYG 4K3DH 4QY8B 5F6IC 4PRDB 4JGUA 1BHGA 4JO2L 3ES6B 2EDJA 4ZUWB 4AG4L 2DD8L 5C7XL 2BCKA 4LSPL 1BJMA 2FGWL 3VFPB 5D2NA 2P24B 1AKJD 1JGEB 3OXRB 1J0YA 4MAYA 3I9GH 2IFFH 5E03A 5ICXA 2OL3L 5FXCH 1A7RL 5ADPH 1K3ZA 3KYOB 2ADGB 2VLKA 1FN4A 4N0FB 2BC4B 4HC1A 3LN4B 4HH9B 3RU8H 1DBJH 1JPSL 2FJHB 2R39A 1WAAE 2BOCA 4JB9H 1FNAA 1RULL 5E9DA 1TTUA 5CJBA 3TVMC 1INQB 5B4MC 5IQ7L 5C86A 1MIEH 4D9QE 4G42B 2CUMA 2J7LA 4DOHB 5HDQH 1ZHLA 3LPFA 1R5IA 2ITDA 3QUYB 3D18A 5ALCH 4XAWH 3WFDH 3L1OL 3GBML 5I1IH 2WP3T 4M62L 1A3LL 4HKBB 5JPMB 4F7MB 3O4LD 1CGUA 1FG2A 3KPLB 1C12B 2EE6A 4KDWA 3M8OH 4O4YL 3DRTA 5FYJD 4UT9L 1JPFB 4EDXA 3HZMA 4KJQC 2AJZB 5SV4A 4ZD3H 2BSTA 2WM0A 3M1BB 4M8QA 1A1OA 4Y2DC 3CFKB 3DXAB 3PWUB 3MFGB 4PJFE 5L2KB 35C8H 4G8EA 4M6OL 4FFWD 1MWAA 2NY0D 4APQA 3Q6GL 3ZZ1A 3QIWA 5BRZD 2VUOA 3ARSA 3PIQB 3MBEA 4K23L 3QUXC 4PJ8C 3TN0D 3TZVB 4UQ3B 4L1HA 4MNQB 3DTXA 1AJ7H 2H32H 3BGMB 4BQ6A 2KZWA 3BMWA 3L7EB 4AEFA 3EYQD 3ILPB 3DVFA 4CADB 1QR1A 3KYMB 3I2CL 3FT2B 4NT6A 4MNHA 2EIDA 2G5BA 2G75A 4X5XA 2OS7A 3MRGB 2J5LB 3RZCB 4HXBH 1MI5B 3GFUA 2NY0C 3D0LB 3OF6D 2EEBA 3NABH 4X80H 4E41E 3GMPA 5HXMA 2ATKA 4KQ3H 4P9ML 4F7MA 4QF1B 1CDBA 4XPTL 5D6CB 1JPTH 2X4OA 1UM6H 2J8UF 1T7VA 4J8RA 2G60L 2HTLD 1RUPL 4P5KA 3T0AA 1U93B 2EC9U 3BP5A 4OLXH 3UPRA 4M48L 2HRLA 3U2SB 2NPLX 4WI7A 3VFNB 3ZHDA 1T0MA 4LAJH 3BGMA 3EO9H 1YY9D 5GRZA 5GS0L 4QNPE 1ZV5A 1MRDL 8FABB 2ZUQC 1U8PA 1IGYA 3B2VH 1PDKA 4PYHA 2ZSVB 4H5SA 4OZGA 3V5HA 2D4DA 1T80A 4PFEA 2GITA 1QOKA 4F7EA 3IAGC 4FTVD 5EBMB 5J89A 4D9RE 5KN5A 3TBYB 5J3HD 2JE8A 2IPTL 5DYOA 4DFHA 3SDXE 1KN2H 2VIRB 1INDH 2XQBL 5HHXL 3QEGL 4OGYH 2FNBA 4H25A 1N5YH 3S88L 2LAGB 3EGSA 4UBDD 1FL5A 1TJGL 4NO5B 4X5XB 3LOWA 1P4IH 5M95B 4FG6D 1QFWM 3JWNC 1BVZA 3WN5C 4LHUA 4HAFA 3HUJB 2JCCE 2RBLA 4ODXB 1KXQE 5L8KB 1QRKA 2A6DA 4RWYH 4KZDL 5T3ZD 1T1ZB 2XKNB 5IB5B 5LCVL 5HHME 5I74C 1QO3B 1T6WA 1EERB 1JV5B 5GSVB 4M43H 3MJ6A 3LZFH 3VXSB 1MJ7H 3UMTA 3S36X 1LMKA 5F6HI 1CLOH 1ES0A 4RGNE 2VZ1A 3ALXA 5GPRA 4LMQE 3QPQC 3Q2CA 5A2LH 3TCLB 3KLDA 4EZMA 3EAKA 4ZAKA 3SDDD 3WFCL 4XHJC 1NGZB 5ACZB 5SX4H 4UIMB 1I4FA 2ADFL 4PRNB 1LP9B 4JO4H 1K85A 1N59B 4X4MA 4KPHH 4QHKI 3LB6D 1ADQA 5IJKC 3LH2H 1CFVL 3D3VE 4M1CC 3FQNA 3OKDA 4XP9L 2ED7A 2HJKA 4TUKL 4K7FA 1P84J 4GFTB 4WUUA 1U58B 3BP4B 6FABH 4CBPA 5D2LB 4FQIL 1MIEL 3T0DA 5D4QA 2OL3B 3LKRA 1NGQL 3O11B 1IAKB 2XV6B 5JLZA 1GHFL 5CJXC 2CRYA 5TQ2H 1FLTX 4OJFL 4OLYH 5GGRY 5GGSY 2PR4H 2W9DH 3MMEB 3TNMB 3TH4T 1NC4D 3K8MA 4KDTC 4Y19A 3QUMA 3UTSE 3WNOA 5ID0A 3L3DA 3O6FD 4KTEL 1A6UL 3WLWD 1EBPA 4AH2A 3MV9A 1X5ZA 4FABL 2X4UA 5K9JH 5HI3D 2HLFC 3NBNA 3D69A 4EQ3A 3NIGE 2ESVA 5KSBA 2Y36L 4QY8A 3P9LB 4KKAC 1RVFL 4MZ2A 4S1RH 4ZPTA 4HEPG 5JMOC 4PJHB 3NFSL 3W11C 2PUQT 3O41A 4F8QA 4OZFA 3VWJD 4LCUA 3DUSA 2R0WL 4K2UL 4WWKB 4CKVX