3KS6A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 1.80 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
GMTRIASHRGGTLEFGDSTPHGFTATAAMALEEVEFDLHPTADGAIVVHHDPTLDATTDMTGAIVDMTLAKVKTATIRYGAGSHPMTLEELCALYVDSHVNFRCEIKPGVDGLPYEGFVALVIAGLERHSMLERTTFSSFLLASMDELWKATTRPRLWLVSPSVLQQLGPGAVIETAIAHSIHEIGVHIDTADAGLMAQVQAAGLDFGCWAAHTPSQITKALDLGVKVFTTDRPTLAIALRTEHRMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (17743486) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.80 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Hydrolase
total genus 85
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ks6A00
1ZCCA 2OTDA 4Q6XA 4F2BA 3KS6A 3RLHA 3MZ2A 3OHMB 4RV3A 1T8QA 2O55A 1DJYA 5T91A 3V1HA 3EA2A 4GNKB 3EA1A 5PTDA 2P76A 3H4WA 4R7OA 1QATA 3I10A 1GYMA 4I90A 1VD6A 1T6MA 6PTDA 3RLGA 3CH0A 4S3GA 2OOGA 3EA3A 7PTDA 4I9TA 2FJUB 4I9JA 3QR1A 4QJ5B 1DJXA 4QJ4B 2OR2A 4QJ3B 4RW5A 1DJZA 4RW3A 1O1ZA 4F2TA 2PLCA 2ZKMX 1PTDA 3PTDA 5T9CE 4I9MA 1DJWA 4I8YA 3QVQA 3QR0A 3KS5A 4OECA 1V8EA 1DJHA 3L12A 1PTGA 1XX1A 3NO3A 1AODA 2PZ0A 3V18A 1YDYA 2F9RA 4F2UA 1QASA 1DJGA 5T9BG 3H4XA 3V16A 2ISDA 2PTDA 4PTDA 1DJIA
chains in the Genus database with same CATH superfamily
4RNJA 1LUCB 2QYGA 3FHQA 5HR6A 2EF9A 3LTYA 3T08A 2YDSA 1I2PA 1EO5A 2W6RA 3EWXA 3LK6A 2ZRYA 1KB3A 2OU4A 4BI7A 1LBMA 1UKPA 4H2HA 4C6PA 2JE8A 3WLPA 2HRWA 1PDYA 2Y5SA 4J3WA 2GSJA 4CNPA 3WLIA 3F1QA 1EP3A 4TU1A 1B54A 3UWEA 4F48A 4TR9A 4LW7A 5MKGB 4IIGA 4OV4A 4FEZA 2QPXA 1UP3A 1KM6A 5BW6A 4LGXA 5CJNA 4KBXA 3GTXA 2Z29A 3G5EA 2D0GA 5F4WA 1DVJA 1DIEA 4Z2GA 2F84A 3FA4A 1BGGA 3OBEA 1AH4A 4YL2A 3W1RA 4DN1A 4V2XA 4I5RA 3W7EA 4RW3A 1VPQA 4GVHA 1CXEA 2X16A 3ABXA 1UUOA 4LAOA 1UIOA 5AECA 2H90A 3PTDA 3GUWA 1H60A 1MNZA 4HOXA 1NP0A 4PMYA 4NAFB 5FSDC 1QK0A 4P8WA 1E9ZB 3ES8A 1WOBA 2WZEA 4QS5A 3ANUA 4JOMA 4KWUA 3MC5A 3N13A 1ZL1A 1VP5A 2R94A 1CLXA 1Q63A 3ITXA 3ZMRA 5E93A 2HBXA 2PMQA 1EYWA 1UWSA 2OVLA 3PBWA 1XC6A 5JBFA 4HPXA 4PCPA 3NO1A 3PSWA 3S5YA 4G56A 1KRBC 1KNWA 4L6OA 4TOQA 1QFEA 4NT0A 6CGTA 3C2YA 2NVCA 3O6DA 2HTMA 2C15A 1GQNA 2PSNA 4QG9A 4M81A 1IXPA 2IPWA 3RO8A 4DLFA 4AVOA 2NQLA 2DZAA 1J5TA 3U4FA 1SW3A 1XH0A 3K46A 2EPMX 4LUSB 1QNOA 7CGTA 4ADSA 4F66A 3HQNA 5A6MA 2HVNA 1VFUA 5GJMA 3E0VA 3EGJA 3GXNA 4GWEA 3RMJA 1UMLA 4IQJA 4ZQOA 5CAHA 3DGBA 2J9ZA 1XF0A 1VPYA 3NXFA 3UJFA 3KS5A 2ODOA 5EBAA 1R6WA 3V5FA 4JHZA 3NM1A 2PRMA 1A5LC 3C2EA 4UMBA 2P8BA 4JTQA 5E9AA 3SB0A 2Y5JA 1H0IA 1QW8A 2PGEA 1D3CA 4YXGA 1T41A 3WUBA 1W1ZA 2YYUA 4JHMA 4NKCA 1ME8A 3GHSA 4DO7A 3DKLA 4HSHA 1W32A 5EFDA 1T8XA 1F05A 3SQLA 2VUYA 3WD1A 1BXCA 2VWTA 3R13A 1MQRA 3KP1A 3RCNA 3VC5A 4OIFA 1V79A 4C1LA 4PTMA 4C5ZA 5I3KA 1X6UA 4GXPA 2FYMA 4QEEA 5K4XA 3LHZA 1RP8A 2L5HA 1FWIC 2VRQA 3WFZA 1J18A 2GUUA 5KZDA 3AISA 4A2SA 1VRDA 1JGMA 4JQ2A 5AHLA 3G18A 1QT1A 3BMWA 3TFXA 1G01A 1ZPTA 2EG7A 1AVAA 2O7QA 3MUXA 3HQPA 2C14A 2V2HA 1OX5A 3KP0A 5EKYA 1JZ6A 4ENLA 4LAMA 1VZWA 2FKPA 1PTDA 1YE6A 3HGOA 5DMLA 5T9CE 2VD9A 2YIHA 1US0A 1OD8A 1M6JA 3W02A 1HP4A 3TONA 3UT0A 1OCJA 2NV9A 2BLEA 1IEIA 1KTBA 3NZRA 4LBRA 3HFYA 5I3GA 3SJNA 3THQA 3DFYA 4W4QA 2QDHA 3AQUA 3MU7A 5LIUX 4PGLA 3KOFA 1Q6FA 4GMEA 1CB2A 2WJZA 3QY8A 2J77A 1VJZA 1EJUC 2CXEA 1XG4A 3MA8A 1EEPA 3RX4A 5G1TA 5LIYX 4N6FA 1N8IA 3GTFA 5F2GA 4IPIA 3PB0A 3T81A 1S5MA 4C6DA 2QVHA 2YL5A 1WP6A 1PDZA 3PJXA 4ZR8A 4CN6A 2PD5A 4MWAC 3TC6A 2OGYA 2XSXA 3MI6A 1B9ZA 3GDMA 4GG9A 1REQA 1XCFA 3NQ6A 2X2YA 1UOZA 4D1IA 5G2IA 2VX5A 4AHQA 1M7XA 4R27A 1YTKA 2VX7A 3DHDA 1M01A 3QGAC 3EB2A 4ROQA 3CO8A 5EMYA 1YLVA 1JFHA 1NOUA 2BASA 2V3EA 3BE7A 1OG6A 2VFFA 5BZAA 2CWNA 1FOBA 4OE7A 3W1LA 1V6WA 1D3GA 1FY6A 3CPGA 2OODA 3F2BA 1W5PA 3GR8A 4DEFA 4I9MA 1VEPA 3BQ6A 3REQB 5BWAA 3MUZ1 4JTJA 2VX6A 4XZLX 3W75A 1OGSA 2WLZA 5CXPA 4LYRA 3U7VA 4TVCA 3WZ0E 3VGGA 1KRCC 1LT8A 1FWHC 4JFSA 1DIOA 1QTWA 4U2YA 4WR3A 3PWGA 1DJGA 1QPQA 3L65A 4UMCA 3L4YA 2EKGA 2J7EA 1A5BA 3T7VA 1OGGA 5FEPA 4QRNA 4F0RA 2BY0A 3Q65A 1R2SA 5C71A 3SCOA 2NX9A 4XSLA 3Q45A 3CHFA 1P1MA 5M3WA 1S5VA 2VOTA 4U5IA 2CLOA 4O14A 1H51A 2IXUA 1JYXA 4MSSA 2FVMA 3FEMA 5RUBA 4CKQA 5TD4A 3DERA 3V7PA 4DF2A 4JGDA 4BY3A 2C8NA 4ZQCA 4QSHA 2VI0A 1I9CB 1S2WA 2O92A 2OSXA 4IXXA 2CZVA 1V3HA 1SO3A 4PBFA 1FVPA 3O07A 2DSKA 4D1JA 3HU7A 1LWIA 3IJIA 2PP1A 3H21A 4HNOA 1LTDA 1E0XA 5F7UA 1GYNA 4DWSB 2GSEA 1UQYA 5FJPA 1VGAA 3GWQA 2Z24A 3HG3A 1CZ1A 4Q4MA 4ZO8A 3T07A 2J47A 3TV8A 4A3RA 3AIEA 4NRSA 2YYTA 1B90A 2YXOA 1W3JA 2PWEA 1CYGA 3CPRA 3UXKA 3ZR6A 4C6KA 2VURA 4H6RA 3L2IA 2E0PA 2V5JA 5H1WA 1FCVA 2ZRXA 1OGBA 3MZNA 2GGEA 1EH9A 5KZ6A 3HFTA 4ZA0A 2VGFA 3MMUA 3UESA 4HCDA 1B0IA 1LCOA 1KBBA 4Q6XA 3UGVA 4N4PA 1F74A 3N29A 3W27A 4O13A 3LBMA 2Z0IA 5F2LA 3VABA 1E43A 3IVSA 1QI5A 3M47A 1K8XA 4YVVA 5REQA 4TTGA 1ONEA 3ITYA 2NXGA 4D8AA 3S1GA 5AC7A 4DBWA 1GCYA 1KTNA 1ZBVA 2ZTKA 2VZTA 3CIVA 1Q85A 2PBGA 3P62A 4NI3A 2F61A 2HDJA 3TYAA 3BSMA 1RVKA 2W67A 2VZUA 4BF5A 3QMTA 4K7VA 3CH9A 2ZICA 4BI5A 3MSGA 3N2OA 7PTDA 4I9JA 4IZGA 2FTWA 3R6IA 3WDPP 3S83A 2HSAA 3Q58A 4JD4A 4H9ZA 2GQ9A 3HV8A 4UIOA 3AS2A 3MI3A 3K13A 5D9NA 4A29A 4RDVA 3ZSTA 2PTXA 3H7RA 3DFQA 3PTMA 3QC3A 4GQBA 4Y9PA 3RU6A 3HIJA 3SN4A 3V1PA 1TMLA 4S3FA 3B0YA 1RA0A 3WD2A 1HJQA 4XD3A 3UP8A 3V18A 1WV2A 2W5FA 4X60A 2YL8A 1U5VA 1O1HA 1XV8A 5EMMA 1SFLA 5E0KA 5EA9A 4GKLA 3GS6A 3IJDA 1NDYA 2PTZA 1NTHA 4TMBA 3GHRA 4K8EA 3UXAA 1M5WA 3DESA 3WJWA 1HJWA 4GJJA 5D30A 2X09A 3S4TA 1RD5A 2DH3A 5A8OA 4D72A 3BZGA 4OJYA 2OKTA 2OX1A 4PUWA 1FWDC 1GZ1A 1C8VA 3N6QA 1QHZA 4RDWA 1AL7A 1DTNA 2Y7FA 2YSWA 1E5JA 3TYDA 3FXGA 3MWCA 4WIWA 3CL6A 3NGJA 1E3ZA 4IJCA 3E49A 4Q4RA 2A3EA 3OZOA 4Z17A 1OIFA 4YMZA 4FMVA 4H19A 1WDDA 1NQKA 4QG6A 6TIMA 1EQPA 2OLHA 2CCRA 3OG3A 3OA3A 3ANVA 3NYZA 1SZFA 5LA2A 3FHAA 4MLRA 4GX8A 1TCMA 1FKWA 4O53A 2Z1BA 2ALRA 1EOMA 4AB4A 3AHZA 3D5HA 2VX4A 3ZVHB 3PPHA 2PLJA 1M9HA 4M19A 2C91A 4D2JA 4Z0SA 5FAGA 2QHAA 3MSRA 4QNWA 4K3ZA 4HMCA 4AMCA 4C7FA 5TIMA 1ADSA 5EYWA 3RLVA 3SCQA 1P48A 3THUA 1L8PA 3DEQA 2PF8A 4C6FA 1WXZA 4S2CA 1RK5A 2I16A 4QTGA 1WKDA 3ITOA 1SO5A 3ZM8A 2VC6A 4WDWA 4DIAA 3R0KA 4QHRA 1HKJA 1R3SA 5BYWA 4N7QA 3VZZA 5FD0A 5KINA 4J3VA 4GD0A 1KV8A 4LQ1A 5CC6A 3G1AA 4Q8PA 5HJXA 1NWUA 2NXHA 1EWDA 2Y0FA 3T55A 2A1YA 4QM1A 1JYWA 1TTJA 3CAVA 3QV7A 3S1WA 3N6JA 4UFHA 3VDGA 3HGRA 2HK0A 2DT2A 3CT7A 4JTDA 3SRHA 4GI4A 1K7FA 3O8AA 3OLGA 4I8YA 2IW0A 4GI9A 4D6IA 3CMGA 3GZAA 3W22A 1NWRA 3TW9A 4G1NA 1UCWA 3FVDA 1NOWA 3DN5A 3IUDA 3MSDA 4GUJA 1JZ4A 3R2GA 4WXZA 5D2XA 5H8UA 1KCLA 4TVUA 5CJMA 3UCCA 2BY2A 1J6OA 1PS9A 1XLGA 5D37A 2WLYA 4O1EA 4AWTA 1TUFA 5DBTA 3LD5A 2R24A 5DX7A 4L9ZA 1WB0A 3ES7A 1J12A 1VCVA 1S2CA 4XO6A 3BCDA 1XLMA 2FB3A 5K9CA 2XGZA 3PPGA 3UWWA 3AMCA 2AAAA 2CC0A 3WD3A 2ISVA 2C16A 2BOEX 3SI9A 3H7VA 4C6OA 1OYBA 2O9PA 3QKZA 1PCKA 4Y9MA 4JTKA 4ASTA 3VOCA 3H6OA 2HPIA 4IJRA 4C6BA 2PWGA 3ENLA 4ATDA 3N6HA 4BEQA 4KS0A 1K1DA 3UZ5A 3AXIA 1RXOB 1TELA 5A1AA 5T26A 1YDNA 4MWAA 5FAJA 1ZNNA 5L6UA 5I2UA 3CGTA 1I2QA 3KBJA 3C3NA 2J8GA 5DMNA 3SW6A 1MYRA 1L6YA 3G6LA 2AKZA 4M7SA 4WDTA 3P5ZA 5LNWA 1WDPA 2F9RA 4TTUA 4JQ3A 3AZTA 3TLQA 3H2FA 4S3EA 1LLOA 3IJ8A 4LS2A 4OKDA 1PIIA 3PY2A 3QPEA 4J7RA 3EPMA 4UMAA 5TNVA 3KVLA 1DJIA 1TCDA 1Q3NA 1VBGA 2G4FA 4NIRA 1QOXA 3GNOA 1PKMA 2XYLA 1B4EA 3DU0A 5KETA 3T2QA 4UBPC 1BXNA 3V5CA 2KZHA 3HPAA 2XVGA 3F4VA 1OK4A 2BVDA 3IIXA 2POTA 3LZ5A 4PODA 2CERA 4H6EA 3W23A 3JVAA 1UMYA 1AH0A 5F1UA 3E2SA 4B4HA 4EPDC 1RPKA 3WH5A 1GT8A 3LNPA 1Q6QA 2X7VA 4N9BA 1QWKA 4LFYA 1HJVA 3EMZA 2PDFA 4IGHA 3SZ8A 3HGJA 4A22A 3M0VA 5U4NA 3WQPA 4F3HA 1KM0A 3TP4A 4CGTA 1S5WA 4X0NA 1PEZA 3II1A 4BR1A 2ZKMX 3CUIA 4IPLA 3BMXA 4PTXA 1V08A 4QEHA 2QDDA 2XU2A 1DWJM 2CHOA 4JIIX 2E1DA 4IT1A 4OU1A 3AIBA 1Q7ZA 3RRAA 4O52A 3E5BA 1JUKA 1DJHA 3O0FA 3O1NA 3AZRA 3B97A 4I8DA 3W0KA 3VOFA 1R38A 3WF4A 3DFSA 1TZ7A 3AICA 3IIOA 3R8HA 4B5WA 4NQ1A 5A8GA 2TSYA 1R30A 1PZ2A 1SUXA 2QCMA 3KBMA 1QW7A 4QCEA 2QGYA 2E5CA 1BWLA 4NP7A 3DG7A 1A0EA 4JNMA 1GKRA 1EYEA 1REQB 2CLEA 4HMNA 1XIFA 1O6IA 2C13A 1N55A 3TK7A 2YCLA 3WYZA 4GIEA 3RPMA 1NQ6A 3W2NA 1LZOA 4E2OA 1KBKA 1W9DM 3A5FA 4DZHA 5GNYA 3RCMA 1MUWA 3LXCA 4EANA 3WFAA 4IFOA 4R7WA 1JUBA 4A2RA 3O06A 1MXDA 3EMCA 3GDKA 4LS0A 1JZ5A 3LMZA 2Z2BA 3E0FA 4HZ8A 2DVTA 3VIPA 3B8SA 4QQ3A 4ERAA 1AFSA 1JCJA 3KWSA 4WKAA 2DIKA 4L9YA 5T8GA 1PTAA 2R9RA 3AROA 2VCAA 2EPNA 4N4QA 1FUYA 7XIMA 3VCCA 3QVQA 3CWOX 1NSJA 1WQ5A 2QGHA 5A3HA 1GG1A 5D09A 4Z08A 4YCOA 2OEKA 4EK7A 3W70A 2E5BA 3CNYA 4ECLA 4GZJA 1JCTA 5I5RA 4WDXA 3BH4A 1WDRA 2DT3A 3B8UA 4GO8A 2JEPA 1VB9A 1VF8A 2ZDRA 1L2QA 4K8HA 3LERA 3GDRA 3S3GA 1G4TA 2A6LA 4NI8A 4FNTA 1GTEA 4QLLA 1A47A 1FWTA 1BVZA 1SJAA 2DSUA 2PRHA 5LIKX 3NQ2A 1CECA 1EJ7L 3W28A 2CWXA 2R14A 1OCNA 1ZSXA 5ABHA 5CPTA 4JEJA 4CVUA 2ASHA 4LSBA 3B0VC 5FJOA 1M3UA 3TYUA 3TR2A 3N9RA 3IJQA 1XRVA 3RXZA 4C90A 2W91A 4MDPA 2Y8KA 5BXPA 1Z44A 3G3DA 1F61A 3H70A 4S3GA 3F5JA 3OHIA 3W83A 2HPMA 3QZAA 4CEXC 2A0NA 1GKQA 3SAZA 2QCCA 1C9WA 5D9OA 5AHEA 3LRMA 2YCEA 6TAAA 4LVGA 5FACA 4WSHA 3NAVA 4YHGA 3A9BA 2RGLA 4QCFA 5I09A 1A5SA 1E0UA 1IR2A 2D73A 2J6VA 2WSPA 2V81A 3MKKA 4Z2HA 2VR2A 3BUVA 2HCVA 2I17A 3M1ZA 4NAEA 1OFRA 1AG1O 1CCWB 1XFBA 1KKOA 4E8DA 1Q6CA 1XFCA 4AIUA 2Z2AA 3DENA 4GBUA 1U5JA 3MUCA 4JTAA 1AK5A 4IMGA 3MZ2A 3H53A 4O1CA 1SSGA 2CZDA 2ZVRA 3DXIA 4W9TA 4M1BA 1L0PA 3PG9A 5REQB 2WMIA 3ZLFA 1V7YA 4XSMA 3WQEA 1G7UA 3EA2A 3UZWA 2VEFA 2YZ5A 4MAZA 3QQ1A 2XSBA 4LV4A 4RXGA 2J7CA 1VEMA 2CFFA 1J0IA 4NX0A 3IWPA 4IUOA 2D20A 2ZX6A 3WQ5A 3W2JA 3TCSA 1OHLA 1NY1A 4UTWC 4I9TA 3WQ8A 4C5YA 4QJ4B 2W61A 4MGGA 2NUXA 2Z1WA 3Q4DA 1JZ8A 4CNNA 3WNMA 3T78A 4EPEC 1MDLA 3FAWA 4AEEA 4LC8A 3TWBA 2WHKA 5I0DA 1U1UA 3O0KA 4HYRA 1XHGA 2BHUA 2BY1A 2D2GA 5JIWA 1U30A 4S38A 3NO3A 1ISVA 3MANA 3SEPA 1WYIA 5AYIA 5EMUA 2QR6A 2Z6JA 5CPOA 3TDFA 3GDTA 4KRTA 4FNRA 4A4AA 4JTCA 4HNTA 4A8NA 5KZMA 2C1IA 3OODA 3SCSA 4GGBA 2H3BA 3E12A 4KQNA 4WEVX 5DT5A 1SJBA 3VA8A 3MJMA 4RCXA 1X1NA 4PULA 2C0AA 3L4ZA 3Q94A 4B5TA 3W7RA 5GJPA 1FHVA 1VFLA 2YZRA 3GXIA 2XZ9A 2E28A 3ERPA 3O63A 1WZLA 3KOZA 5CBIA 4M5PA 2UY3A 1ITQA 2AAMA 3S6TA 4A3HA 3PZNA 5JBDA 2OYLA 1VFOA 1Q45A 3JU2A 1OX6A 1GYMA 4NASA 4K1GA 5C5YA 1OJXA 3TTSA 2WBKA 3QPZA 3UF9A 3UR7A 1UZ1A 5HQMA 3MVIA 4PZVA 5BRBA 2CLFA 3LBOA 1S1RA 2GVGA 3RO6A 3M5XA 3KTXA 4EPKA 3ITGA 3GTIA 4KCVA 5CEWA 3MCNA 1FWRA 5KZEA 5JQ9A 2ACRA 3MI2A 3GDLA 3EWBX 3LV5A 4DO4A 1LOLA 4IFKA 4J3TA 1UR3M 3LMYA 3L5LA 2EQDA 3VM7A 1Q6LA 1OVDA 1HGYA 4HHMA 4FB7A 2J88A 2J62A 1VRXA 3VGDA 1EPXA 1IT8A 2BGSA 4BWLA 4BCEA 1WPCA 2J8TA 2G50A 5CBJA 1EHNA 4I9AA 3B9DA 1AQHA 3DI1A 5F1VA 1IXOA 4JKMA 4NZFA 2OFJA 3ARSA 4QAIA 1EBGA 3RR4A 3UCDA 2BBFA 5M17A 3L4TA 1P6WA 1DWGM 3WLKX 1R0MA 4CNUA 5A69A 4XZ9A 1HFBA 5DF0A 4A3UA 2Q3RA 1EX1A 3D46A 1KFWA 2DW7A 5IBXC 2BB0A 4GY1A 3OVPA 2I1OA 3SRDA 3SUWA 3G1HA 1EFZA 4ADTA 3W6MA 1IWAA 1A3HA 3M6YA 2C6QA 4F0LA 4GE8A 1XGZA 1O12A 5ABFA 5ABEA 3P0XA 1E4LA 3IS4A 5K9DA 2Q8LA 2D1ZA 2FIQA 2Z27A 4JTUA 4D71A 2EPKX 1JCXA 2QUUA 6PTDA 4M6UA 1V51A 3G3MA 3N17A 2B31A 1PUDA 3AIVA 3EX6A 3G0UA 4GOAA 2Y7EA 4M24A 2Q09A 3CH0A 1FWAC 5GQBA 1PSCA 1RQBA 1E70M 5C9RA 3VMNA 2V2CA 4ATWA 3QR1A 4W8LA 3GFYA 1K8CA 3H2OA 4E2BA 6ALDA 3WQWA 1E4NA 3Q2DA 3QKEA 1GEHA 1TIMA 4IP4A 4AIBA 3AALA 2FZ8A 4WOQA 5CC7A 4LVFA 3LTSA 3OBAA 4H8HA 4W7WA 3N2CA 4G7FA 2YCKX 4KIRA 1I8JA 3LCIA 3OOQA 3GB6A 1NOFA 1F3WA 3NFUA 3F4DA 1BWKA 1J79A 1FWWA 4AVNA 3MUAA 2CBVA 1E6SM 2NZLA 4AEOA 3L0NA 4JIQA 4KFNA 4WGXA 4JY8A 2PDNA 3B9EA 3WL0A 2VRJA 4KERA 1H41A 4RDZA 5IOBA 4IMDA 1ZCCA 3NZ1A 5BXSA 3ZT5A 4MWAD 3M0ZA 4XTDA 5KEZA 1F2JA 1EGMA 2PLMA 1C90A 2FMOA 1GQIA 1QVBA 3TFCA 4A3YA 3VDBA 1FCQA 1FWEC 1GPFA 3AYTA 1GOQA 4XISA 1P7TA 2VOMA 4O4VA 4R7OA 1TVNA 4WRHA 9XIMA 4CQ8A 3LX9A 4HU3A 1HL8A 1W91A 4LB3A 3WDIA 1VYSX 1W5MA 3OLEA 3W7JA 5HPOA 2D3LA 4UFMA 1YXYA 1HKVA 3WK2A 4WUIA 3EEGA 5A5WA 4UTIA 4RE3A 3A13A 2PGWA 2F2KA 4QJ3B 4EVZA 1GW1A 4ML4A 4FX6M 2IQTA 2WCAA 1EPVA 3EYPA 1OADA 4HN8A 6REQA 3PZQA 1IR1A 1E9YB 4H8UA 3PZUA 3LM7A 1XIJA 4PL2A 3VD5A 1IV8A 3GNXA 1QI3A 4D8LA 3AS3A 4XB3A 3FX4A 3QFEA 3N18A 5DELA 3ZXWA 1H3GA 4Y8EA 3U0HA 4X2RA 3MV01 4PUEA 3LRKA 4J2PA 4ZVJA 2B7NA 5LNVA 3PAJA 4OFCA 4PE8A 1CX9A 2Y1HA 1H61A 4YTSA 4QX4A 1M7OA 3KBWA 3UZJA 3VOHA 3W2MA 4C91A 1V7AA 2YBTA 5CPSA 3OGSA 4GACA 5AVHA 1LBFA 3VNLA 2Y24A 1J96A 3SGUA 4AYGA 1FWGC 4FXFA 3BANA 1G4PA 2NXIA 2QCDB 3OP2A 1P0EA 4QISA 3F2CA 3BG9A 5HWJA 4PYSA 1J0JA 2GGJA 3LPGA 1H1NA 3CZEA 4L64A 3HG5A 5D2TA 3RCYA 1MNSA 3NZPA 4PA8A 3QW4B 2Z7GA 1RY0A 3W1XA 1UR4A 2DDXA 3TU9A 1KM3A 3WLNA 3UR2A 3G0XA 5DY3A 4I7VA 4BF9A 1QXLA 1JYVA 4RE2A 2B7OA 4X9SA 1NAL1 4FNUA 2D69A 3LDVA 4B91A 4C1NA 2Z2UA 4L6DA 3D3FA 1G1YA 2JK2A 3A23A 3EPNA 5AY7A 4DBEA 1O5KA 4E3VA 1IEXA 3WNNA 2NX3A 3L68A 5CPQA 2ADAA 3OYZA 1PAMA 1G6CA 4QFUA 1N7KA 4XK2A 1RLDA 3O3RA 4QDWA 1E4IA 5H8MA 1SPQA 3MUIA 1TX2A 4MB4A 3LQLA 1IT7A 1LORA 4UFIA 1A5UA 2FJKA 3U8GA 4WGHA 1E4MM 5IRPA 1S2TA 3POCA 3NQ8A 5CSSA 3DHPA 3DFPA 4AXNA 1TPC1 4MKVA 2FHCA 3GR4A 1Q6RA 4V27A 2VFDA 2ZUNA 2V69A 3MUY1 1WA3A 5E0CA 1FFRA 1ONWA 1D8WA 3CL8A 3N4EA 9RUBA 3BO9A 1F3TA 2YGYA 4C6LA 5MF5A 4RE0A 3CPUA 4XZHA 1DKWA 1A5OC 2CLIA 3BC9A 3UQNA 4NRRA 2HZGA 4OBRA 4P8UA 4DPQA 4K1WA 3W25A 2QZRA 3OZMA 4L5ZA 2RAGA 2C1HA 1KBIA 4RXFA 1G4SA 3N04A 4DM1A 3VNZA 3GLCA 3KHDA 1K4GA 3H22A 1XYLA 4KH2A 1HKMA 2J24A 3APYA 5SWUA 3ITLA 1QO5A 1W8GA 2PLCA 2OELA 3PZMA 3WF2A 4JCMA 4I7UA 2FGBA 5IFTA 4HPHA 4YJ5A 1K6WA 1QNRA 3E9AA 4LS1A 1WOAA 3M41A 3NPXA 2DQWA 2J9XA 1T99A 4DJDD 3RUBL 3GDBA 1RY8A 4GABA 4Q8TA 2D2OA 4GY7A 1XI3A 1G94A 1UC4A 3KWXA 3M44A 3GKFA 1A4MA 4UTWA 2Z7KA 1YE4A 3LGEA 5HUPA 3CM4A 3TJ4A 3UY7A 1H7XA 1GVEA 2DT0A 4GX9A 1BQGA 1WBHA 4U31A 3P80A 4G9PA 1SJDA 4O50A 3W29A 1ICSA 2ISDA 4MUZA 4FO4A 5F2MA 3SCUA 5BWFA 2PGRA 5AYZA 4XD5A 2WSKA 4Y9NA 2D0FA 5BOOA 4GNVA 4MUPA 1BF6A 1NWTA 3GG1A 3U7BA 4QP0A 1ZJAA 4UTTC 1Q6OA 3W24A 1KQZA 4JCLA 3P5YA 4I6KA 3ATYA 1TO3A 1Z9AA 5I7GA 3H2CA 1E9IA 4PR4A 4TX9A 1MDRA 3W7OA 1X7FA 4HNCA 4LUIA 1EIXA 1GG0A 4Q4KA 4XUGA 3DECA 5TBOA 1HKWA 4JTEA 1O95A 3NNTA 4F9JA 4M7TA 2RDXA 3CYVA 1OC6A 3QR3A 4LF1A 4R34A 4ORIA 1M53A 2WCSA 4O15A 3ZJ7A 3TR9A 1DJZA 1V6XA 1GVOA 2BGQA 3A4WA 4H9XA 3ZR5A 2WHMA 3SGZA 1OF6A 8TIMA 1RLCL 3ZWTA 4J27A 3HO8A 3B40A 3DYMA 4GKTA 2DJXA 3KBSA 1DHPA 1V0NA 5I3HA 1PIGA 4NAEB 5AN7A 4JX6A 2YLAA 1B9BA 1QASA 2ZADA 1ISWA 2F6UA 1CIUA 1XCWA 4GPNA 5IHRA 4V28A 1LG2A 3DKJA 3CEPA 3QC0A 5AC5A 4FR6A 3FFSA 2HV5A 2CLKA 4FNSA 4B5VA 3J7HA 2WMIB 3CB8A 1T0OA 5D05A 3PTKA 2J7FA 1TJ0A 3PPFA 4LUYA 1R2RA 4B92A 2EEXA 5GNZA 4XVEA 4UC5A 3V1HA 2NT1A 3UU0A 3WEZA 4B3LA 1I2OA 3AHVA 1XBYA 3UVAA 1QATA 3WMSA 1UC5A 3V5OA 4GCXA 1KA9F 1V6YA 1E1FA 4XBKA 3UA3A 3VYLA 3WQOA 3VNKA 1OG0A 5JH1A 3M9YA 3A3WA 4XG1A 5IBXA 4DELA 5BXTA 3T9PA 4PCFA 3SQMA 2PURA 2NQ9A 2ZXBA 1HG3A 2VMFA 2GJPA 5A8MA 4WZHA 4AWUA 1QHPA 2R8WA 4DUOA 1W5NA 2PDMA 4HA0A 2O4MA 3L4WA 4UQBA 5CSYA 3GBDA 2CBIA 2V3FA 4WSJA 1A0DA 3U2EA 3CMJA 1ZJHA 2OQLA 2B7PA 3BJSA 5AOUA 2PS2A 1GQJA 4PC8A 4ONVA 1FWBC 4RKAA 5F4SA 4M6QA 4MFEA 1D9EA 1ELSA 3LSCA 2ZUTA 4ICCX 2E40A 2GJXA 3NGFA 4YVPA 3B9NA 3KX6A 3S47A 1W6TA 4U33A 3PK7A 3GHUA 1EUAA 2X0HA 3QGVA 5IXEA 2HVOA 1HX0A 1R3RA 1BRLA 1QNQA 3EX4A 4ES4A 1R9YA 4LEFA 3H2MA 3D0CA 1CLKA 5FIPA 3O6AA 2Y7GA 4HMDA 2CKRA 3HF3A 4H8NA 1B4KA 4HNNA 1OD0A 1LP6A 4IP5A 3UJEA 3QV9A 4HMEA 3QZ6A 2R82A 3T2PA 5DFAA 4AX6A 3RM9A 4RDYA 1R5YA 1UHVA 3CBWA 4Y96A 4ACZA 3RIKA 1RZMA 3QTPA 4MJMA 2WZIA 1IXQA 3EXRA 4Z1AA 2RFGA 4I6VA 5LIXX 3CAQA 4LT9A 3WF1A 4FX7A 1KFLA 3S5ZA 3NPWA 3I68A 3EXSA 4POCA 3GZ3A 1UZDA 3VO0A 1CGUA 3TTQA 3C2RA 4AMAA 3OPSA 3AIUA 4QNEA 2YXGA 3LHTA 1XW8A 1AW1A 3VTRA 3WK1A 3BG3A 1PKNA 3YPIA 4IG2B 4AIOA 2BVTA 2V30A 4S3KA 3W6LA 1UD5A 1KXTA 3CZKA 3SUVA 4WDUA 3OQEA 3O05A 1F3XA 4P8VA 3M7WA 3N4AA 2XSAA 1YPIA 4R9XA 2PDPA 3QSTA 4J2MA 3CTLA 4Q7IA 1E40A 3GXDA 3I7QA 4JNYA 4XBSA 5FJUA 1H7NA 1RQHA 3S8HA 2NVDA 5ABFB 3W7HA 5C2CA 1MQPA 1IXNA 1ZS2A 4ZOBA 5CC5A 2ON3A 1UPMB 4GLEA 5A6BA 2RHGA 1GOWA 3EDJA 1UP2A 1O5RA 4KEUA 2YDRA 5AC4A 3S2LA 1J8VA 1VIWA 3W7IA 4I90A 3WQFA 1WAWA 3W84A 1MXSA 2GDQA 4H7ZA 1O68A 3K1GA 4JQAA 3BGJA 1I75A 3RLGA 3ZVIA 1V3JA 4E2DA 3G1SA 3TEVA 4MHBA 3W3OA 5I3FA 1JXJA 3WJZA 1TQXA 1E1EA 4KIEA 2WM0A 3HG2A 1WKYA 4GVIA 2FPVA 3URNA 1KO0A 3K4WA 3CIWA 1EC8A 3D3AA 3G24A 3ZFHA 3VZXA 1RJQA 4UTJA 3PSVA 3BLPX 1JI1A 2TMDA 3QV6A 3IIPA 3VILA 5CPLA 1DJWA 3RF9A 2UY4A 5CZJA 1JG9A 1QDSA 3TX9A 1YXCA 4Q32A 1VPXA 3RNDA 1M68A 1DXEA 2FLIA 4H9YA 9XIAA 3T0TA 5CAKA 3ARYA 3E2VA 3QYQA 2O9TA 5J04A 6XIMA 3U57A 2XH2A 3B4YA 1XLIA 4Q4QA 5H2ZA 3EDKA 3UWYA 1KRAC 4S23A 3W7NA 5HMDA 3WELA 2CIPA 3CV6A 3AXHA 2P0IA 2QS8A 3KCLA 3O7UA 3OVGA 1NEYA 4H8VA 1NELA 5C8BB 4FIQA 3W7DA 2XH7A 2YX0A 3CUXA 1KXHA 4HZ7A 1P7TB 2QV4A 1XJBA 3CJPA 4GUHA 2A85A 1OK6A 2O55A 2IS7A 1ONRA 3GNNA 3BLKA 4QLKA 1Y5WA 4IQEA 1OCBA 4PN2A 5DRIA 4ZXLA 4HTBA 4Z2JA 2TRSA 3TQ0A 3UZXA 2XDFA 1HNYA 1T6MA 3EWUA 3GQYA 4NHVA 4BQ4A 2DSVA 4G1KA 4Q33A 2V8ZA 4NF7A 3W00A 2DV0A 4DI9A 4LPCA 3CZGA 1KGXA 3T8QA 3F7JA 3AHTA 6REQB 4MB3A 1H63A 2KAUC 3VM5A 1E5NA 4HBKA 1E51A 4AZ6A 4PRWA 1G0CA 1WZAA 1AQFA 2Z1KA 1YPXA 3IV8A 4IUGA 3GIPA 3CWHA 4YWSA 1K77A 3BAJA 5G4HC 4H00A 1UBSA 2NX1A 1HT6A 2CLHA 1JNDA 1AD1A 2VDHA 4MZ1A 4WJXA 5D32A 2PWUA 1DEDA 4HSNA 1O60A 1KD0A 2XJ7A 4EF8A 3U9IA 1K8YA 1LL6A 2OQHA 3B8DA 2BVWA 3NXLA 1X98A 4PTNA 1JJKA 2CHNA 2QIWA 2X05A 2D0HA 2AQWA 4NX5A 5C7VA 1ITUA 4FHAA 2O7SA 3W1PA 3PZOA 4JX4A 1XPGA 4N9CA 3SN0A 1ZJBA 1JZ2A 1W1VA 2E67A 1XGEA 3NL6A 5C9WA 4QAWA 5DT7A 5EMLA 1P6BA 3A4XA 3VD4A 1MVYA 1H0GA 2XUCA 3QN3A 4RZ4A 1DYSA 3WBWA 2AMXA 3SM0A 5LHFA 2WNWA 1ONXA 3B04A 4JEQA 1E56A 2P0OA 2FJUB 3MT1A 4UTTA 2FH8A 2WVVA 4L6HA 1S3HA 4OWGA 2G95A 2H6RA 2HBVA 3VOIA 3TMQA 4L80A 2OZ3A 1SZNA 3ZQ9A 2VFGA 2YL9A 3CXOA 2WVSA 1Q65A 3T2OA 1ME9A 3STPA 3UWZA 3VINA 1FP8A 2E3ZA 3V0SA 2XG9A 7TIMA 4DUXA 2ZXDA 1LRQA 4XD6A 4WX2A 4HYVA 4U5KA 1X39A 4GHRA 2VGIA 5T9BG 4CQDA 1NDVA 1HW6A 3VGHA 2QJGA 1H09A 2PP0A 3WH7A 2PDQA 1JI2A 2XHYA 3FA5A 3I6TA 5HAOA 2A4AA 2G5WA 5K2ZA 3B8VA 1KC7A 2NUWA 2VDGA 4GQ0A 4O11A 1OIMA 1IT0A 3STEA 4MPKA 4KEZA 5B80A 1E0WA 2G3MA 3IJ9A 3ITVA 2E09A 2JKEA 4MTVA 3WLTA 3KFTA 3MV11 3MO7A 1V3IA 3QF0A 1XINA 3AXMA 3TA6A 1KR1A 1XYBA 2ZXQA 1H5YA 3T42A 1PWLA 2XGBA 4C6IA 3T0DA 3MCMA 4KRZA 2BMBA 4UQDA 2X7WA 3TJXA 3H12A 2PPGA 2VC5A 3K5XA 4NY2A 4RX0A 4UTHA 4V1XA 2C18A 3VFCA 4FF5A 2V0TA 1CENA 1O1ZA 3GC2A 1GJUA 1KTCA 3N3MA 1EEXA 3BK0A 1VCFA 1J9YA 1LJYA 3ITCA 2YBUA 4L4OA 4KMQA 7REQA 1JDCA 4DBSA 2P1FA 4GI8A 1PVNA 1ZLPA 3GW0A 3HV9A 2PZ0A 1YTDA 1JEZA 5AZ1A 2EGZA 5DMYA 1CXIA 1KBLA 4IL2A 1RBLA 3E0LA 3KRBA 1US2A 2OEMA 3LPPA 4HK6A 3QRHA 1UZHA 4NJHA 1WUEA 3O15A 2YCIX 2ACQA 3M5YA 2A79A 3B9AA 4P7NA 3WQGA 4MKSA 1AJZA 3OYXA 1EXBA 2DUZA 4Q8UA 3DH7A 1HZYA 2DZVA 5AZ0A 1I0DA 4ZSUA 4PCNA 4AZGA 1ISYA 2OO0A 3WH6A 4IGSA 2HEJA 3A3HA 4O19A 4Z2IA 3CUFA 4H3DA 3B4UA 3GW3A 4TO8A 3L2LA 1V0KA 1B3OA 2PI6A 2WCGA 2WMJA 4YTQA 3B3DA 3VDHA 4MY8A 4PEEA 4Y8FA 4BQ2A 1H5VA 3GIYA 1JPHA 3D6NA 3W82A 2DP3A 3NSMA 2OOFA 2VJXA 1LLZA 3HN3A 3QZEA 3SQSA 4KWOA 4C7GA 1BEUA 2IPGA 2FH6A 1TE1A 4RZ6A 3FYYA 3EKLA 2PDBA 3NDYA 4GYKA 3QBUA 1UW9A 3S6OA 4WOZA 1TPH1 2GOKA 4ROPA 1F3EA 4MJ2A 3WSUA 4Q8QA 3W73A 3IK2A 1IQ8A 4W89A 4DJED 1EJTC 3FV9A 3EBVA 4E8GA 2PDKA 3LCFA 3KM8A 4LALA 3GFXA 5DLCA 2FDMA 2ZA3A 2SFPA 3SFWA 5JU6A 2PTDA 2POZA 4YS1A 1A5CA 1ZB5A 3ATZA 3P60A 3RG6A 4J4KA 1EF3A 3BAIA 1L6WA 3BDKA 4JTTA 4NZJA 3QSRA 2IMRA 1CPUA 4JKLA 4NVTA 4MB1A 3ZSSA 2XVPA 3OJGA 2QUTA 3UWUA 4GYJA 1IYXA 3AMGA 4YPJA 3LCLA 3VNDA 1C29A 2FMNA 4MWAE 4RE4A 3BARA 4MADA 3PS7A 5HWNA 4LRSA 3EOLA 1LF1A 2QUMA 1EX5A 3T0BA 2WZTA 3AIWA 4QS6A 2VZOA 3VPLA 2C3ZA 1OBAA 4LU0A 2V6AA 4GC3A 3ZR4A 4KETA 1CGTA 5G2WA 3KBVA 3B0PA 4IHCA 1NWSA 5HNNA 4KRUA 3USBA 2DFAA 1WXJA 1DWFM 4QROA 4TXEA 1YQ2A 3FW6A 4MF4A 3WLJA 3G1FA 3R25A 3KL0A 1QR7A 5G1MA 3WLSA 4TIMA 2GJXB 4FAMA 4JN8A 1Q7MA 2EO7A 2NLYA 2X30A 2OZ8A 4INFA 3BJTA 1PZ1A 4FX8A 5IM51 3VVGA 5BOEA 3RILA 4D6CA 4DB7A 2R1KA 1XM3A 4O0ZA 1NDWA 1BHGA 4BQ3A 1Y5VA 4RNIA 4EOUA 5DO8A 3OQ8A 4LWWA 3S0CA 1X97A 1Q4NX 5BU9A 2ATSA 4EAYA 1TR1A 1A80A 5LNRA 4J5NA 8CGTA 1XS2A 3WDJA 4UQ9A 4CQAA 1W56A 4ACZB 3ELFA 3M46A 1BPLB 2GSHA 2OSYA 3QEZA 1QNSA 1E6ZA 3GD6A 4EP8C 4ICMA 2QAFA 3GVRA 3WLRA 4HPJA 4Q6JA 1QOPA 3M0MA 4Y6GA 1TTQA 4O17A 4E4PA 4UCFA 3DYPA 4O1BA 2PB1A 3GG8A 4IJBA 2PU1A 3FN9A 1W9VA 5CH9A 2BNJA 2R91A 3MHUA 3SCTA 1V02A 3UPMA 4GNJA 2REQA 5A6BD 3EB3A 3VNJA 4GINA 1SJCA 1L8NA 1ECQA 4GIYA 3IAQA 4UUIA 1FXPA 3D47A 4PCTA 1QI0A 4C65A 4IIEA 4D6JA 1MO0A 1R3WA 5AHIA 2OWCA 3I4EA 3LA4A 2WWCA 1THFD 1VHCA 4X9YA 2QF7A 1M1BA 1XLEA 2WJFA 1V6UA 3A9IA 1S1PA 3HG4A 3UETA 2WANA 2HNEA 3UJRA 5EGRA 3WLMA 4OBTA 3BGGA 3NTYA 5I02A 3QGKC 1K9EA 1XBXA 4UZSA 1W9BM 1R8LA 1Z6KA 4NNCA 3CEUA 1DJYA 1V0LA 1ZBCA 4CCDA 4CQBA 5C70A 3PFRA 3KDOA 3UVIA 1JZ3A 4S3CA 2ZVIA 2WVTA 4X0VA 4M1RA 4AFYA 3PBGA 3FK4A 4CD5A 2WMHA 4GH1A 3GVVA 3E2QA 3OVRA 1OFQA 5HMFA 1AL8A 1YNPA 3VXGA 4EACA 3W88A 1TRIA 1IIHA 2VEGA 3TROA 1OFDA 4W84A 1CI1A 3IARA 4YU1A 1Z3NA 2GK1A 1L9WA 1NFGA 2AL2A 2XVKA 4YIWA 3WMBA 4N6EA 3KL5A 2EBNA 3VX1A 4CN4A 1WKFA 3JZEA 3BURA 3WUGA 1ZENA 4JN7A 1P0KA 4HK7A 2HJPA 3TH6A 1LROA 1FKXA 4HTYA 3P2VA 2Z00A 4JPGA 3VGFA 3CU2A 2GYIA 4JIHA 3HMJG 3E2RA 2GGGA 3I3BA 4UNLA 2ZWZA 4NXKA 4G7EA 3G6MA 1K8ZA 2VC9A 4GFIA 2ZBTA 4JICA 5HULA 1UKSA 1XQLA 1M04A 4UTMA 3QM3A 2DH2A 1UASA 2W66A 2OWWA 1CLVA 2QF8A 1I45A 2WMKA 3UEQA 4M29A 3PVFA 3G1RA 3UG4A 5CG0A 3S2NA 4LVBA 4X2PA 1XISA 5FJRA 5I07A 4LTSA 2QJMA 3NPUA 2OKOA 3GKAA 3V36A 1XIEA 3PBMA 1NIUA 3CT2A 1OFPA 3UCQA 3O9NA 3EWYA 1GOMA 1VD6A 2YL6A 1OFEA 3ME3A 4W7VA 3W4RA 1W17A 2HQAA 1UWAA 2V63A 3QY6A 2XZ7A 1AZ2A 4ZQNA 2P5NA 1W37A 3NQMA 1Q6EA 3THDA 5DN1A 4LUJA 4GI6A 3N2MA 4LAKA 2GL5A 1EGVA 2I5IA 3H8AA 2XN2A 2ATMA 4WLCA 4B15A 3HJEA 5BMXA 2G96A 2Y8VA 3O2LA 3UERA 1I1XA 4GVGA 3LPFA 2YA0A 1J0KA 3B8IA 2NT0A 3RPDA 3LCHA 2OSWA 4KEVA 1YTEA 1JQVA 3KLKA 7TAAA 4NL1A 1U1HA 4AAJA 1UD8A 2PDWA 3AAMA 4YLWA 4QQUA 3G77A 1GPWA 3DHUA 1ZAJA 3FYPA 3A4AA 1H1ZA 2BP1A 4H9VA 1SFSA 4IISA 4UTFA 1XSIA 1EDTA 2PZNA 3W87A 3RLHA 5HDRA 1K3UA 1XGDA 2YCJA 4J3SA 3LXAA 2PWFA 2XVNA 4NYYA 3BZJA 1E6QM 3TSDA 1R47A 1H2JA 3DIPA 2OMAA 2YDAA 2QUNA 3VE9A 4K68A 3DBNA 4ZB2A 1H50A 1CGVA 3NZQA 3MYOA 5LA0A 4F0SA 1QJWA 3OU8A 3M4HA 4I5XA 4AY7A 4B5UA 3CZLA 3DBPA 5D8WA 1E73M 1OT1A 3C6CA 4LOCA 4UOQA 4AZBA 1KFEA 1WCGA 2E6FA 1AJ0A 3NM3A 1DQUA 1XLDA 3AU2A 1W3IA 5C9UA 5A8PA 1G4EA 2PC4A 4B5XA 1F8MA 2RH9A 1R3YA 1DOSA 4MJZA 1GOIA 2FFCA 1CGYA 3EAUA 3TZFA 4FNPA 3OBKA 2BX7A 2EKCA 2A3BA 1XIIA 2XIMA 1A5NC 1I6NA 3FVMA 4U3AA 3FS2A 4A6GA 3ABQA 1ADDA 1HN1A 3NWRA 2J25A 3EOUA 4KKXA 2IUZA 3FJLA 4QIUA 4W93A 4FOUA 4Z2KA 3VOGA 3BLIA 4C6MA 2GQ8A 1B3XA 3ZZ1A 2XIJA 5EFFA 2F6KA 3KS6A 5EU9A 1UD3A 2BS9A 4RV3A 4AZCA 1A53A 1DBTA 4IX2A 1OEPA 3R4IA 5CGTA 4P7RA 1ZQ5A 3AXKA 4GY0A 3E6EA 2A5HA 1NF7A 1XLAA 3C0JA 4OQVA 1P0BA 2ACUA 4K6AA 4W86A 4AZ7A 1R86A 2P53A 4A05A 3TIMA 3OZPA 4P8XA 4ZOAA 2ZZ4A 4L7ZA 1GK8A 3CL7A 4Y7EA 3EDEA 5KTLA 1TE6A 4PFHA 3W1UA 3URAA 5BRQA 1ME7A 3KOWA 1PZ0A 3VAVA 1HJUA 2DZSA 1O4UA 3FJ6A 3VFLA 2A6NA 3G2GA 7REQB 4AIEA 2YJQA 1GQLA 1A3WA 4Q3MA 1EF2A 3UYCA 4E3TA 1DIKA 1I0BA 2OGJA 3QY7A 2WC3A 1R85A 2GQAA 3URQA 4AHPA 3LM3A 2HNHA 4RZBA 4AW7A 3BVJA 1UD2A 1HGWA 3W07A 2WHJA 3ANYA 2GJLA 4YHEA 3W81A 2PU0A 3GM8A 4XD4A 2QJIA 3GNRA 3NUKA 5HWMA 4AEFA 3AUOA 2GVEA 1A5MC 3IGXA 3PZTA 4LANA 5AHFA 3OW1A 3WG6A 4TVDA 3T1GA 4Z42C 3EOOA 1BG4A 2G3NA 4IIBA 2G41A 5EL1A 1RJRA 4DPPA 3RPTA 2OO6A 3FSTA 1JCYA 3QMRA 1DORA 3SCPA 4XWUA 5KITA 5C6MA 4IOTA 3T44A 5M1TA 1SR9A 3LG3A 3N1AA 2PGFA 1FH8A 5HNUA 4Q7NA 3IK4A 1ICPA 4CEUC 1JVNA 2WHLA 3BW3A 1DL3A 5GNXA 1J4EA 2P50A 3ARQA 3GUGA 1Z32X 3AXXA 3KXQA 3S9IA 3CV2A 3VIMA 3IJ7A 4HSOA 2DZXA 2OQYA 1S2AA 1PO9A 1S46A 3S42A 1UBPC 3SIMA 1L6GA 3E96A 4W7UA 4UZUA 4D6DA 1VFSA 3LUTA 1XUUA 1JFXA 1HQTA 3M07A 4DJDC 1Q2RA 3UXIA 2FZBA 5D2WA 2ZZ5A 3W7QA 4GCAA 3U5YA 2QUVA 1F4HA 1TG7A 3LPOA 3BV4A 3LHYA 3CAWA 4GK8A 2YFOA 3JRKA 3VX0A 4NJGA 1PTGA 4GZ7A 3VOJA 2DUAA 3SADA 2RDUA 3PNZA 2D24A 1GNXA 5FA5A 4YN5A 4RV8A 1EC7A 3TOPA 1IZCA 2G3JA 2H8ZA 2H3DA 4PCSA 4OHQA 3N34A 3F4WA 5I3IA 3W7CA 1UR2A 7ENLA 4L1GA 1WE5A 4HYWA 2C1GA 1TWDA 3BAKA 2YA1A 3NSXA 5D03A 1SMDA 2BVYA 3AUJA 2AGTA 4UNIA 2G3IA 3NSNA 3USZA 3TW7A 2W62A 1OZQA 3Q67A 2DZUA 2D23A 4S3AA 1JZ7A 1E6XM 2GZXA 2V67A 3AWNA 1XLBA 2FDSA 5FOOA 2BOFX 3GC5A 3ALFA 1LWJA 1O5QA 3H2NA 3L4UA 1K9TA 3VGBA 3R58A 1OT2A 4H1ZA 1JUEA 3NL5A 1D7KA 1JPKA 4GIAA 2WWDA 2WV8A 3TN4A 2ZUUA 2X1SA 5G4WA 3RFAA 5EB8A 3WBYA 2E9BA 3CLMA 5EMJA 5AB3A 2QDEA 2UZ9A 2YBVA 1SW0A 4F0MA 2XIIA 3UGRA 4V1YA 2CLMA 3EWZA 1POJA 1EUNA 4E0CA 3AYSA 4GZIA 3GYEA 4NZ3A 3IRDA 4CCZA 2A3HA 2BOGX 5K4ZA 2XM1A 4W8AA 1R3VA 3MKVA 2VM8A 5DRCA 2VWSA 2X1IA 4H9TA 4DY1A 4OUIA 2Q71A 4H7CA 3EKGA 3S6DA 4UQAA 1Z69A 2ZZ3A 4EXQA 1O5XA 4NZ5A 2KX9A 3M5ZA 3TW6A 1IWPA 1U22A 2G37A 3MMWA 3SY5A 5CC3A 2ZZ6A 3ABZA 2VELA 1XRSA 2R1LA 1J0YA 1VFHA 3LHWA 2GWGA 3L0GA 2A2IA 2DJLA 4DNMA 3PG8A 3CAKA 2XM2A 1OM0A 3B8WA 2AOSA 5BXRA 2X1RA 1HJXA 3UA4A 1X38A 3FGCA 1FWJC 3WJXA 5BRPA 1WZMA 2J78A 3PWIA 4DI8A 1VFTA 1A50A 4PMRA 3A47A 3CO4A 4PMUA 1CNVA 3L0KA 2AGKA 4GQGA 4LX4A 1B3VA 4RW5A 1FA2A 4YWIA 3SUUA 1WXYA 3S9ZA 3K4DA 2C71A 4KGJA 3P67A 4JFWA 3NQDA 3F4NA 2QEZA 3W85A 3UXLA 4BQ5A 1KKRA 1H11A 3URBA 2BXVA 4ILSA 3NOEA 4CLMA 2WSYA 4DZ5A 2BDQA 2PP3A 3ZLHA 3C2OA 3MB9A 1IGSA 1IE7C 1W31A 3HPSA 5B7ZA 4H2CA 3ITTA 1Z42A 1CW2A 1OZMA 3R12A 4WJEA 5DCBA 1TX0A 3NQCA 3RR1A 1KBJA 2NV1A 1MW2A 1DQWA 1TYGA 4K7YA 3TCEA 2E8ZA 1MRAA 5FEXA 1MMFA 2ZDSA 4PUUA 1X6LA 3LENA 3HZ3A 4BWLC 4L4PA 1XIGA 1QI2A 3W1MA 3LI1A 1E15A 4JR5A 1R87A 1P0NA 2O4QA 5C9XA 1SZRA 1E0VA 2BG5A 1DPMA 4DZIA 5FF3A 4JYDA 1GJPA 4ZQMA 1TPDA 4O54A 3LTPA 3SUSA 1JPDX 3WBAA 3CUGA 3IV3A 4Z1CA 2J7HA 4WK9A 1V6VA 2BTMA 3WN6A 4ZZ9A 3K4AA 2WJDA 4C1KA 1RALA 3L21A 3H2EA 2GK1B 4UCGA 5AHMA 2V68A 1GVSA 1XICA 2AL2B 3RLUA 1TJ1A 4RR4A 3DG6A 3EOSA 4L65A 3AMLA 2OR2A 4QDPA 1TWZA 1K03A 6A3HA 3FJ4A 3NR0A 3I3DA 1Q7QA 4HIBA 1XKJA 4PMQA 1EOKA 2GDUA 4AC1X 3HOJA 3TUUA 5CSRA 4BI6A 4E4UA 1MQQA 1GTHA 1YMYA 3WLOA 1RH9A 4MM1A 2Y63A 5I3JA 1BF2A 2X40A 1W9PA 4W87A 4G7EB 2EG8A 2QKFA 5KSWA 5E5CA 2XFYA 4ZCWA 4F2UA 1PX3A 3N12A 3QHMA 4GGHA 3BLFA 1YDOA 4EAMA 1QCWA 3H4XA 4K2SA 4O1FA 2X0SA 2V2DA 3GNDA 2VEKA 4YCPA 1DTUA 1XG3A 3OLIA 1D3HA 4LVAA 1X8FA 4ZODA 3W86A 1TMQA 3P6LA 3EB4A 2VHLA 4M8UA 1RAKA 4MNLA 4B2DD 4ZGYA 1UPPA 3W1QA 3DUGA 2F38A 3WD0A 4WKFA 3N15A 5M03A 4AC7C 1HO1A 2VTFA 3VIFA 1U33A 3W2LA 2WQPA 3BLEA 1XR2A 4J1OA 1LQAA 5G5IA 4ZE5A 3JR2A 3G8RA 3AOFA 3EX2A 1XIMA 1ZHAA 5CZSA 4AY8A 3BPWA 3GE7A 4G8TA 2DZPA 3ARRA 3W7LA 2OYMA 2DVXA 2WNNA 2OB3A 5E9XA 2I14A 3N9KA 2QV5A 5XINA 4BFAA 3GVGA 4DUVA 1MW3A 4H83A 4L4MA 5JMUA 3ZYZA 3PJWA 4I7WA 3GHTA 4J35A 4MMWA 4UWMA 5LNSA 4LNYA 1TB3A 1E55A 2HXTA 3RU8X 4LYPA 2PDIA 4IPNB 3W9ZA 1F07A 4QBXA 4FK9A 3R5EA 2WO5A 2P8CA 4DAFA 5HOSA 1GOKA 1TV3A 5H6HA 5DANA 2J7BA 1JDDA 1V0MA 2V9DA 5ABGA 2EJAA 2UBPC 3N4FA 4LVDA 1FWFC 4QLJA 1P0DA 4WSKA 1W1B1 5LXEA 4FP1A 4PB4A 2PDGA 4LBUA 3M7SA 3OEXA 3T4WA 4PBGA 1UD4A 2ZC8A 4JL2A 1FHUA 1PBGA 3EPOA 3ARUA 1U2YA 3B8TA 1H62A 1QMLA 1RK6A 1RVGA 3M43A 3IJLA 1W2VA 5CZ0A 1UG6A 4PUNA 1KLYA 3UJSA 1IZJA 1X96A 4C6QA 1FP9A 3V0TA 5A2AA 5HK4A 5BU6A 4QXIA 4AYSA 3TN3A 3FLUA 3R0UA 1R3TA 4IX0A 1BG9A 1PKLA 1MW0A 3GH4A 3P8IA 3EDFA 3W2KA 1UWTA 2JALA 3L7RA 4LYKA 2HK1A 4OUEA 3C56A 3N2XA 1KLZA 3PR2A 2ICSA 2RJGA 4QITA 3Q37A 4WKHA 1L6SA 4EIVA 2OX4A 4DWDA 2YKKA 3NQBA 1ML1A 2E68A 1JCNA 3TQVA 4H9UA 3UNTA 4NJJA 3ONBA 4LCRA 1JDAA 1JRCA 2INFA 1CXLA 1ZCOA 4RUBA 3VCNA 3K8MA 4KF1A 2FZMA 3RRXA 4CU7A 2HS8A 1CWYA 1W8SA 2ZIDA 3B05A 4NNAA 4V33A 1EZWA 3L4VA 1UA7A 1CBGA 3QH2A 4DJDA 2VEPA 4AZCB 4Y90A 1HL2A 2AKMA 1RBAA 3AZSA 3E74A 4AU0A 3KZSA 2X0YA 3TKFA 1EO7A 3KRUA 3ARXA 1S5NA 4S2BA 5A6TC 3IVTA 3E3HA 1P4CA 4HNVA 2Y61A 4HU4A 1RV8A 2XWEA 2CLLA 3OG2A 1AQ0A 5CGMA 1RCXB 3GXTA 2V3GA 4IIFA 4UTLA 4HP5A 3ONCA 3TNBA 2QVNA 1WNOA 3MBDA 1YYAA 3AC0A 5FI8A 1EQCA 3PBYA 4MYXA 4IP7A 4CD8A 1FHDA 1GUVA 1XYCA 3GO2A 2EHHA 1F5ZA 1RHCA 2LLEA 4LXFA 3GXPA 5C2XA 4JYFA 1H49A 1KM1A 1B2YA 1TVLA 1NH6A 3DI0A 4C6CA 4HNLA 3W1NA 1ZAIA 2Z28A 1PPIA 4O12A 3BAYA 1UP0A 1TTIA 1ZP4A 3F5LA 4HNUA 1A0CA 3LNMA 3FJNA 3TN5A 4H04A 5AC8A 3C86A 3KAOA 4O4WA 3LB0A 4IM4A 4QR6A 4O0QA 3GY1A 1VQTA 2WMGA 2FTYA 2QDGA 2V38A 1TKKA 5LZLA 4DJFD 3WY1A 2QJJA 2WZHA 2CETA 3KUMA 3UG8A 1EJXC 2ZRVA 1E71M 1NFBA 3SCNA 5GJNA 2I57A 5ABTA 5LYRA 1YPFA 4NYUA 5LGXA 1J10A 3PJUA 5AYBA 1DP0A 3IRSA 3QMSA 5A6JA 1QU4A 2J7DA 2ABBA 3MHGA 1YIXA 1K9DA 1FXQA 3I4KA 4I3GA 2UY5A 4WY0F 4DM2A 2QPUA 2WPBA 1TPWA 3WX7A 4Q8VA 4HGXA 4Q8OA 4QJ5B 1E0TA 1I2NA 4FXSA 4YYCA 4R9OA 2DUXA 3AI0A 4Q4PA 3UJ2A 4J9JA 5TQLA 3DHFA 1YEYA 1B30A 3VIJA 1HVQA 3RGTA 4WQ6A 1Q6GA 4DBDA 3E02A 3NL3A 3KOYA 4TUFA 1DHKA 3B06A 4A21A 2YLLA 4LJ3A 4G5DA 3UYIA 1JCMP 2WVUA 1UKTA 1MXGA 3QQWA 2D2JA 4DXVA 3VKKA 1KFJA 3MWAA 4JKKA 4F79A 4LC6A 4DVOA 1I60A 1TIWA 4Z1YA 4EX4A 1I2RA 3R10A 1VFFA 3KW3A 4OBSA 5HJLA 4LUTA 2QAPA 3G8EA 3KL3A 4NJIA 1Q13A 2EG6A 3CQJA 2NSXA 2WW5A 1ECEA 3W7MA 2ZTJA 3OLDA 4WD0A 5DY2A 4D9PA 5H91A 4WJ8A 4DZAA 1FTXA 4OVXA 1S3TC 3ARZA 5C54A 3I10A 2VO5A 3CB3A 1LYXA 1UD6A 5HXMA 3AHXA 3C4UA 2INZA 4MZYA 3QPYA 4KFPA 3BOFA 5FL1A 1MEHA 2GUYA 3IUIA 3MKCA 3QHNA 1RR2A 2VR4A 3VMPA 4DYKA 3UBPC 5A6SA 5A6AA 1RSCA 1GZJA 1GVIA 3F4CA 2Q8XA 3LXBA 1QUMA 5I23A 2JGYA 4MKNA 4S39A 2FB2A 1GONA 4DYJA 1W9XA 2WC4A 3VC6A 1ICQA 5A8QA 3GU1A 4DAIA 3GBEA 4XKMA 1NM9A 4DJEC 1OYCA 2PODA 2ZC1A 2GGHA 1F9CA 3IVUA 3G1DA 2QXWA 4JIEA 4FXJA 4XO7A 4ZXOA 3A6OA 4MY9A 1MUMA 1A4LA 1EA9C 3IPWA 3TQPA 3RHGA 3RM4A 2RGMA 1GVYA 1EKOA 4F0HA 4S1FA 1YW1A 1B3WA 1C9DA 1JXKA 1ZBKA 1MUCA 1FWNA 5HQLA 3VDCA 2GOUA 5GVJA 1WDWA 3BW2A 4Z1DA 1VCGA 3WUEA 3SJ3A 3S5NA 1UUQA 4I5UA 1C8QA 1QO2A 2Q6ZA 2VCCA 5J8LA 4O8RA 2XINA 5FF2A 4XAGA 4GIRA 3L23A 4JL1A 1GVRA 4C6JA 1QBBA 3FGCB 1LT7A 4MOZA 3W71A 1J01A 1P6CA 2VFHA 2VNCA 3KRZA 2XTKA 3RM8A 4XZWA 4AY1A 3OTRA 2X2GA 1SW7A 1H7WA 3U5UA 1POKA 1TJRA 2CNCA 2OXNA 5AYXA 5I78A 3VKDA 1R9ZA 5AHNA 5HNTA 3VKCA 4IICA 4IGNA 4JDBA 3ABOA 4DWSD 4PRRA 2CXGA 2WNQA 2GQ3A 1YHTA 4G6CA 1W1TA 1V77A 2WB5A 4N0RA 3MQTA 4L1WA 2CZEA 1HIZA 3CHEA 3E0IA 2XN0A 1ALDA 1C8XA 3WLHA 4BK9A 1YX1A 1HJSA 3M6DA 4B4FA 4C60A 5M5DA 3NJ3A 1WDQA 1RJPA 3VDAA 3W7PA 1YRRA 3TN6A 1UWUA 5G1YA 3AIQA 4HJWA 2VZSA 4KEMA 1AODA 3EKZA 5LSMA 2Z1SA 3PM6A 3RJYA 1EWEA 1F73A 1KRMA 3UWVA 3M0XA 3PWAA 3NPVA 4F0KA 4CQ9A 4R85A 3TJLA 4AHOA 3AHYA 2DT1A 2ZUVA 3N3TA 1R46A 3ALGA 4PSRA 5A6LA 4GNKB 5FF0A 3H4WA 1ISXA 3RK8A 4MWAB 4JTSA 4B5SA 3ECQA 3I7SA 3PZVA 5FJTA 3W74A 1IZKA 4YYFA 1WBJA 3WQCA 1SM9A 3LEPA 3PB2A 1OX4A 4U2ZA 2XIQA 4B90A 2I9UA 2NWRA 4C7DA 3UPBA 1JDEA 4Y9OA 1PCWA 2ACSA 3FNDA 4BEUA 3ID7A 1WAUA 4B3KA 3KZPA 3L5AA 5HMSA 4IFRA 4LNCA 1R3QA 2YFNA 1M7JA 4PMOA 1UKQA 4LBSA 2PDJA 2VXNA 3TAOA 1IEVA 2QIIA 2JF6A 1MI3A 1NARA 1VLIA 3UWQA 3R1ZA 1XH1A 1UR9A 2VP8A 2FPYA 4Y9AA 1FRBA 2NQZA 2GJRA 5GPRA 3LBCA 3L9CA 5EPDA 1UJPA 2TPSA 3IIVA 2ZZ1A 4PTDA 5BNKA 3IIZA 3RITA 2TODA 2BY3A 4ZE4A 2NQ5A 3A21A 5HJYA 3NURA 4NZ4A 2VEMA 3C3UA 1EB3A 1EP2A 4DXKA 4K38A 2PDXA 2VZVA 1IEQA 3NL2A 5HMEA 1U83A 2FGLA 1TUXA 2HXUA 4AZHA 4X3ZA 3CIXA 1VKFA 4B9YA 4XZNX 4OGZA 5LXXA 3UFYA 3FXYA 2FTPA 1O7AA 1BD0A 4J28A 4DX3A 4MNJA 2DW6A 1XDJA 1GOXA 1YDVA 2PA6A 1HTIA 4XUYA 1GVFA 4ICNA 4GFSA 1E3XA 2G3FA 1JAKA 3GU2A 4Q8WA 5LHEA 1A3XA 1LLWA 3UXDA 4WVXA 3QLDA 1TRDA 3EWCA 5E70A 3N9SA 4HKPA 1W3LA 3HB9A 4ZO6A 1NDZA 1Q5MA 2YCLB 3BAWA 4PTWA 1EJSC 3H24A 4X22A 1TZZA 4DRSA 3WLLA 3C0LA 4IWWA 3BCJA 1HKKA 4JN6A 3LCXA 1TJ2A 5I00A 4FS9A 1Q66A 3ARTA 2NSOA 2ZX8A 1YKWA 3CZJA 1YADA 3LCGA 1C7SA 1V3LA 2Y6ZA 3M0KA 2BXYA 3CUJA 2Y85A 1KV5A 4M6PA 3S2JA 2VEIA 3TA9A 5D2VA 4OZOA 4JTFA 2CKSA 3HQOA 3TTOA 1X7IA 3AMKA 4PL1A 4AUBA 1H7OA 3VGEA 2XIOA 4JFTA 2Q3OA 1XP3A 3NOYA 3OIXA 3INPA 1KW1A 1A5AA 4UOJA 4JY9A 3PBUA 2YA2A 3IGHX 4IH3A 3WENA 3SIZA 2DQXA 2GLKA 5CG7A 2E6DA 2WM1A 3A5VA 1KQYA 1AW2A 2A7RA 2JIWA 3LV6A 1XCXA 3TC7A 3WQ6A 2CU0A 2PEVA 4QE1A 2ZE3A 3FDGA 3M64A 1JRBA 3XINA 1XX1A 2WKLA 4CN1A 3P74A 1H1YA 4PB5A 2UWFA 1KCXA 2PRLA 1R9XA 5CZKA 4A8IA 1SMAA 2DSZA 2H8XA 2CW6A 4RZ5A 1PX8A 2NVAA 3WEOA 1UKOA 4O16A 3G1VA 3BSHA 1R7OA 2Z25A 1J0ZA 3SO7A 1E6RA 1XXXA 2W63A 4BA0A 1GWJA 4ZO7A 4AG0A 2ZX7A 4CD7A 2QCEA 1W3HA 3TQKA 1MFUA 3S1VA 5I03A 3KE0A 5LA1A 3UW6A 2VL4A 4US5A 1OFAA 4DLMA 2OZ0A 1Y5XA 1V3KA 1O66A 1EHAA 1G7VA 1LL7A 1TREA 1E1CA 3STFA 1DXFA 2IQ0A 1LBLA 2I9EA 1SR0A 3S5OA 2PAJA 4GXMA 3NDZA 1V02E 3T4CA 4DQWA 3S2MA 5AC6A 1MFVA 4J3ZA 2ZWYA 4JFUA 3VMOA 1Z89A 4M6VA 4DBUA 4PB3A 2CZFA 2QJNA 3O16A 1W3KA 5HUOA 2J7GA 1XSJA 4UB9A 4E38A 4AD0A 2D22A 3DFHA 1LL4A 1XLJA 1C7TA 1SQ7A 1C91A 1BYBA 2RUSA 1BTCA 4XAZA 4UTKA 3DAQA 4QG8A 2J9YA 2DGAA 4OV9A 1XLLA 4QE5A 4N9DA 3MTWA 2G4JA 2QPSA 3VNIA 1XKYA 4NG3A 3P84A 1EXPA 2HWGA 3KHJA 4UR9A 1OWQA 4ZOCA 1RP9A 3PULA 2PC8A 3M5VA 4HPNA 2CZ5A 3GTNA 1XYMA 3I7RA 1XIHA 3AYVA 3H26A 2E1WA 1VBHA 4O0KA 5M2FX 4EE9A 4MY1A 5JVLA 2IKHA 1BSLA 3ISIX 2DPEA 3OHMB 2Q8ZA 3CLWA 3F5KA 4P61A 4DJEA 1PZ3A 3SCVA 2PWDA 4JBRA 1QPRA 2PFHA 1TWSA 3DYOA 5CGQA 3S46A 4GUGA 3BSGA 4MVAA 2GUBA 1VH7A 4KCUA 4XKYA 3C61A 1XPYA 2CPUA 4DO6A 3DFOA 1PYMA 4H7VA 4GQQA 3WIJA 2ZA1A 4IIHA 1VIZA 4XBJA 4BJHA 4RPPA 3AJ7A 3TC3A 1GHRA 3BMVA 1K7XA 2QCDA 1LM1A 1C93A 1UOKA 2DORA 1OCQA 4PMXA 3DOPA 3FSUA 3WNPA 4PUJA 2PD9A 1OF8A 4P7LA 2AQOA 4KCWA 5MHBA 1EJRC 4BKNA 4R33A 1CXKA 1JL8A 3IAPA 4EPBC 3CQKA 4KFOA 4QGCA 3KCOA 3BXWA 1LG1A 2PDCA 3A12A 1XIDA 3CQHA 1J11A 1T40A 3PAOA 3PZIA 3TSBA 1Q8AA 3VI2A 3LI0A 4U3CA 5FJIA 3A24A 3W53A 5D4YA 4HZ6A 1G9HA 1B1YA 5HA7A 1ZY9A 4LUTB 4IQDA 4CNSA 4HHPA 3IACA 1UWRA 4F2BA 1TR9A 3GG0A 5A8NA 3APTA 1FWCC 3BV7A 1T5AA 1SO4A 4GQRA 1LQ2A 6XIAA 3R0DA 3AO0A 3HPXA 1SZGA 4AVFA 2P76A 1QNVA 2P3ZA 2Z1VA 2GFTA 3MCOA 4XAYA 4IFKB 2ZX5A 4YTTA 1K6AA 2I5GA 1DE6A 3W01A 8A3HA 3OGVA 4PMZA 4NSBA 2D2HA 1QPOA 3W72A 4IIDA 3RJXA 3FCPA 1B5TA 2J27A 2O9RA 1DJQA 2J66A 4LRTA 5CCZA 3GSMA 5AKQA 1ENUA 1XLFA 4K36A 3QLLA 3WK3A 4HHLA 1F4AA 3E1F1 5HATA 2QULA 3LYEA 2VD8A 8XIAA 2Y89A 3QJAA 3KCJA 2V5BA 1MZHA 3B9OA 1HP5A 1UZ4A 1IWBA 3DX5A 4ZQRA 1SU5A 3ZO9A 4BZYA 4KESA 1J2WA 3OVQA 3BQ5A 2A7NA 4ZENA 1XDMA 4ZFMA 3AJXA 4CD6A 2V3DA 4MFDA 4ZFCA 1EDQA 3F2DA 4XTIA 1QK2A 4OOUA 3LGGA 1HKIA 4DXXA 1AMKA 4PMJA 3W1TA 4R7JA 5E6ZA 5CLTA 5C55A 4PRTA 4D6HA 2EPHA 3MBFA 4GO9A 2QW5A 3RDKA 4IF2A 4LCSA 1QPNA 3OZYA 3TZNA 2IPJA 1UWIA 1AA1B 2W4XA 3WH8A 4TX6A 3E0WA 4R3UA 1RQEA 3QQ0A 1TZ9A 4UNKA 1XDLA 3QV8A 4X61A 3L4XA 1XL9A 3ARVA 2BHYA 4MYAA 2WC7A 5TF0A 3OGRA 5JIPA 2XFFA 2PDLA 3WNKA 4ZMGA 3NDOA 2W3ZA 5HQEA 2WQDA 4LAZA 2DIJA 4HQVA 5E0FA 3N14A 4Q4SA 5HNRA 3T6CA 5HANA 2O9OA 1TV8A 1AQMA 3BLDA 2YPIA 3PUOA 2PWVA 4S3JA 1VLWA 1UH3A 2W79A 1TV7A 3DZ1A 2QLYA 1PV8A 3W37A 1MSSA 1TPUA 3EDDA 2E6AA 3C2FA 4F40A 2W92A 2E9LA 1QHOA 4TMCA 1UJQA 4D6FA 3VIIA 2BGNE 2R6OA 3WF3A 5DXXA 4PUMA 4HHHA 1V03A 3ZS4A 1NP2A 3SR7A 1P1XA 2X8RA 1ZZMA 2FZNA 3PZGA 3KTSA 2FHBA 1I1WA 4BHYA 1HVXA 3EA1A 4GJIA 1SYTA 4E2VA 2Y2WA 1KXVA 1OFBA 4CD4A 2GVYA 1GJWA 4DUWA 4XVDA 1OX4B 2ZRZA 1JCLA 1AJ2A 3L5MA 5CJ5A 5ECVA 2RJHA 3GIQA 3MMTA 3DFTA 1AUSL 3GXFA 2E9MA 1RCOB 3GK0A 4HK5A 3AWOA 4AD4A 3MPGA 1AD4A 2FZDA 4JAWA 1JULA 4RLIA 1W3TA 3LY0A 1JD7A 2CBUA 3TYBA 4FI4A 3NVTA 5CPMA 4GZEA 2VVSA 1ISZA 1W1PA 3XISA 2E6YA 3UY8A 3LSBA 3PP7A 1Y65A 1KFBA 1UYQA 3TJIA 4P7QA 1QI4A 3OB8A 1WKEA 1OC7A 3R8RA 3ZJ6A 3P8JA 3DFNA 1F76A 2VCBA 3WDHA 4JFVA 2WSRA 4W85A 4XIAA 3VKBA 3UG5A 1Z41A 3KDNA 4S3DA 1TVPA 3LLDA 5DCDA 3S5SA 1OINA 3HJZA 1PL9A 3T0AA 4QE4A 2WSQA 4ZTXA 2P10A 1PYFA 3BOXA 3TXVA 1XC4A 4Q4OA 3SUTA 1EGZA 1P43A 1R7AA 2JBMA 1KWKA 4C1NB 1UA3A 2Y62A 2OWXA 5I79A 2ZFAA 4PTVA 1Q6DA 3CQIA 5HPCA 5JH2A 3CS2A 4JHOA 3FAXA 4YNGA 3B0XA 2VFEA 4YTUA 1UH4A 4HCLA 4AWSA 3VIHA 1YNYA 1V5XA 2GWNA 1IF2A 5XIMA 4U4MA 4B3ZA 5FKYA 2YW4A 4G2DA 3S2CA 3MS8A 4GBDA 4PFMA 2OT1A 1S2UA 2WYSA 1GVQA 3NEHA 1C3FA 4TX8A 1QWGA 1QAPA 1DJXA 1Z48A 1UH2A 3PPCA 4Q8MA 3SRKA 2DU2A 3SY1A 3PNUA 5DEZA 3SECA 2RKXA 2OZTA 4REQA 3N11A 1N2VA 1TFVA 5JXQA 1HF6A 2FVLA 1BSIA 3ZT7A 2CHRA 2ISSA 1ZP3A 3C5QA 3R94A 2PTYA 2QCGA 2W27A 4LY4A 2DY3A 4AX7A 3W76A 3I6EA 4HVXA 3GAYA 3UZYA 1JF5A 2JKAA 5CKSA 1GHSA 2WOQA 3TE9A 4FR1A 3E38A 1H4PA 2XISA 1FWSA 2XPKA 4CNTA 5FEZA 4J40A 3N73A 1G69A 3L66A 1FH9A 1DXIA 4M0XA 1B31A 3NQEA 1S39A 3KOXA 3VNMA 1JNEA 3GRIA 5E6YA 5FEWA 3PFMA 3SURA 3PUGA 4JQ1A 3C52A 4O8AA 4ZTYA 3OIHA 4N2YA 4IG2A 1M41A 2ZUSA 5IDZA 3MYPA 4JNZA 3GU9A 4K8GA 4FOJA 1Q4WA 2Y7DA 3L2MA 1UUMA 3B0UX 5DXYA 3EZ4A 3WD4A 4R5EA 4EKJA 5G2HA 3VZYA 4EWJA 4L1XA 3V3WA 4HOZA 1KWGA 4KWWA 3PF3A 1SZEA 2ZA2A 1Z7AA 3WQDA 2C0HA 1VENA 3BWWA 1XLKA 3ZJ8A 1FH7A 7ODCA 3FYOA 1GZGA 5E09A 4AISA 1B3YA 3ARPA 1XYFA 4JDYA 5K7JA 3M16A 1ZRQA 5ENLA 3TVAA 5D9PA 4MNMA 4GYPC 4US5D 2X1TA 3HM7A 1MRQA 2YW3A 2NUYA 4LY8A 4U28A 1PE1A 3LLFA 3LN3A 3V4BA 3UD6A 4NZCA 5D04C 4RNFA 3GH7A 3CV7A 1MWOA 1WZKA 2NWSA 2CITA 3TWAA 1US3A 3UNDA 1X1ZA 5CPNA 1OSEA 2P88A 1V4YA 4LCQA 2JQXA 4FXRA 1XYZA 5A2BA 1UB3A 1BYCA 2JEQA 3BTNA 4WF7A 2VQUA 4PUKA 1J5SA 1GYLA 3LOTA 5HBFA 4CCCA 2AMGA 1XSKA 3EWWA 3EEZA 1E1CB 1K4HA 4B9ZA 1K9FA 1DIDA 3VUSA 1BVNP 5I3DA 1DV7A 1VHNA 3CV1A 4A8LA 5HR7A 4KGLA 3G1YA 3DC8A 2H9AA 3BW4A 4FOKA 1LWHA 2IKJA 4HPGA 2TAAA 4HU0A 4ZOEA 3CC1A 4URIA 4ZB0A 3T09A 5K3VA 2Q02A 1YBQA 1TPVA 2WAGA 3TYZA 2ZRUA 3THAA 3JS3A 1CGWA 3VD3A 1KFKA 4GJ1A 1ODZA 5DMMA 2WNZA 6ENLA 3LRLA 3PJTA 2FFIA 2YOCA 3WDRA 3QW3A 4AZ5A 1K7EA 1ZAHA 3MDUA 1RUSA 1G67A 1UROA 3WDQA 2NQHA 4HZMA 4WY0A 3DG3A 3BLOA 1BLIA 3QOMA 4KPLA 3DDMA 2OJPA 5A94A 3VE7A 3UG3A 2VQTA 5JBEA 3N19B 3SRFA 3NEVA 3VIKA 1MEWA 4E6MA 1EIBA 2P3EA 1YXDA 2HISA 4GC4A 3C0QA 1TWIA 4GH3A 3FEQA 5BROA 5D38A 5AFDA 2E5DA 2MNRA 2BV9A 3A22A 4NUWA 4Q8NA 1JQXA 1JAEA 1S5TA 1W54A 2Z4GA 2D3NA 2G8ZA 4E4FA 1OABA 1TTPA 3NA8A 4XKYB 3ZOAA 2OEJA 2B81A 4AD1A 1F7BA 3ZLGA 3TTYA 1XIBA 3BLLA 1UR1A 4XQ6A 5LKYA 3T0CA 1FQ0A 4GVFA 1VFMA 1DWIM 2VC7A 2OOGA 2XWDA 4NZ1A 1W5QA 2MANA 4W88A 1QNPA 1ZUAX 4H41A 2OYKA 1SVDA 1XQKA 1JPIA 2ZCGA 2ANUA 2J79A 4F2TA 2R1PA 3M0LA 3NVDA 4XAPA 1SFJA 1CXHA 3KVJA 3C8NA 1BRLB 1KXQA 3L12A 5U7SA 3ZIZA 3GR7A 4NILA 2IXVA 4DJFC 2R1NA 4H9MA 1BGAA 2OG9A 2B0MA 3AS0A 3FA3A 3WCZA 5CLWA 3AIRA 1IEWA 3C2VA 2C19A 4GXWA 3U4AA 3PUDA 1D2KA 5F2IA 3NQAA 2A3LA 4MJ4A 3P81A 2ZRWA 3WKZA 3QFWA 3H4GA 5BMWA 4NXSA 2OT0A 3GXMA 1M7PA 4OOZA 3MJYA 3O6YX 1EDGA 1LQ0A 3TXZA 5DBUA 1VC4A 3MP4A 2BODX 4HA4A 3WO8A 1WDSA 4FF7A 4CCEA 2PF0A 4O28A 2VUNA 2Y5EA 3STGA 1DJNA 2I5QA 1TA3A 4PMVA 3NO5A 3KVMA 3HTWA 2PCQA 1BTMA 3EWDA 3CYJA 4XV0A 1EJWC 3F03K 3LGDA 2XH0A 3NQGA 3NQ7A 3NQVA 4MLJA 2WKGA 3CUHA 4PBEA 2NW0A 4FIRA 2PTWA 1V3MA 1Z8AA 4ALDA 4UOZA 2ONEA 1SO6A 3GH5A 3CQ0A 1AW5A 2WMFA 5EY5A 3EX3A 3QR0A 2YDQA 2F8QA 1J0HA 3SCWA 3EMQA 4WXYA 3MP3A 4HT3A 4IPJA 4JYEA 5AYYA 1OYAA 2AQVA 4FLOA 4NJKA 3WNOA 4JZ5A 3AFBA 1BAGA 3LU2A 5F4XA 4IGMA 2CLPA 4MAVA 2J75A 3ZT6A 4QJ1A 4FLSA 3GAKA 4FZIA 1HL9A 1IIGA 2B4GA 2JF7A 4N02A 2E7FA 3T05A 4IXHA 4MDOA 2VRKA 4W5UA 3VU2A 4H4IA 1FDJA 1HUVA 3W1AA 2C7FA 1L6FA 5C2GA 3PHAA 2HE8A 4CQCA 2VKZG 5FL0A 4WHBA 2VYOA 3M0HA 3SSZA 1L2UA 1PB0A 4RNHA 5D33A 4H6QA 1RA5A 4DF1A 3JZUA 5A2CA 4KWVA 1OFOA 2ZUMA 4K37A 4GA8A 1CT5A 3MP5A 4JTIA 4CU6A 3VUPA 2Z26A 2B7QA 1R2TA 3HPFA 3I3EA 4MPQA 1TJPA 2RDTA 2Y70A 4DHGA 1TSIA 2JGQA 2QMKA 2ZQ0A 3FIGA 3WL1A 1WUFA 4CU8A 1ODUA 1UR8A 4PMDA 2DVUA 4IMAA 3P93A 3BOLA 2I56A 3C0SA 4MG4A 3CUZA 1Y8BA 3LZ3A 3NYDA 3MSYA 2A3CA 1FX6A 5I24A 3BGAA 2DZWA 4AF0A 2EJ1A 4HOWA 1KR0A 1XD1A 1C8YA 1GKPA 3W7KA 1XBVA 4IMFA 4C6EA 1NJJA 2EAWA 4FPSA 4M51A 3M0YA 2ESCA 2Z6IA 3WJSA 4JIRA 1N8FA 3ZWSA 4LH8A 4DWSC 1PWMA 1ZFJA 4B2DA 1A5KC 4KWSA 3GVWA 4AWEA 5IFPA 3P0WA 2A21A 1M03A 2GGIA 4H01A 3B03A 3RN6A 1WO2A 3PBVA 4Y2WA 4ZO9A 2J4GA 1BKHA 4IL0A 2ISWA 3TYEA 3TTEA 2XFWA 4R53A 2VR5A 3I65A 9CGTA 4EXBA 1JGIA 5A95A 1W1YA 3IJ6A 3MHFA 1KM4A 1F6KA 2ZXAA 3W38A 2A7PA 1F6YA 4AZIA 7A3HA 5CZTA 1EJVC 4XIMA 4QDMA 1FDZA 2VT0A 4MB5A 1FCUA 3ORWA 1VBRA 2WXDM 4L9XA 4Q7BA 2BXZA 3ABSA 3APGA 1H7PA 2FQIA 4ZQPA 2V5KA 3U2CA 4L4LA 2DSWA 2WJEA 3SDOA 4LAUA 1XUZA 5FCZA 4GUIA 5XIAA 1TQJA 4GYPA 1TMHA 2PWHA 2GVLA 5A6KA 3WFLA 4MIMA 2BZNA 3G22A 3DC0A 3LLXA 1LUCA 3RAOA 2WVVB 4LYQA 2V82A 4TQTA 5FESA 1PKYA 2YB4A 2CESA 3EX1A 1QW9A 2W9MA 1H7RA 1BYAA 1GEQA 2FPTA 4XZIA 3WLQA 1BYDA 3E5PA 3KBNA 1VS1A 2JIEA 3HGSA 2J6XA 3AYRA 4UR8A 1BVWA 4FNQA 4AXKA 4DF0A 3CMFA 4J3UA 2HROA 3GNPA 2QQ6A 1XWYA 1NVMA 4CUCA 4GISA 4A3QA 3TYCA 4H6KA 1FBAA 4W5ZA 5MKGA 4HA3A 1F6PA 5G4EA 2ZE0A 5LNUA 1YNQA 4HJFA 4REQB 4F9DA 2NV2A 4B5NA 1HO4A 3VCRA 4R88A 3IUHA 1N82A 3K2GA 1EA0A 3OA5A 1LDCA 2XFRA 3VIOA 2PCEA 4EF9A 3GC4A 2JFEX 3TNOA 2V5CA 3CTTA 4PEKA 1FHLA 3BCFA 3T40A 1LOSA 4FA3A 2WZMA 2ALDA 2PBOA 5IDIA 1SSDA 1M65A 4NAFA 1W0MA 4ZEPA 2PDYA 3U6WA 4ORMA 2PUZA 4B16A 1W1IE 2CEQA 1U5HA 1MEIA 1W2PA 4CVWA 1LOQA 3UPWA 3S1XA 3DCPA 1KGUA 1ZJIA 5ECUA 2ZZ2A 2Q01A 3WUFA 3MO4A 1V6TA 3PC0A 4ZSTA 4YVXA 1TV5A 4JTLA 5L9FA 3QYSA 4M80A 3K8KA 3UR5A 5D9MA 4DYEA 4HB7A 1Y7VA 3ZJKA 2XGIA 3NQFA 3KVKA 3PTQA 4UR7A 3RYSA 1AZ1A 4LV9A 2IKGA 4IMEA 1BQCA 1KCKA 2F7FA 4UXDA 3WQVA 1PHQA 1B57A 4LUSA 2A3AA 1D8CA 2JKPA 3SCRA 2WKJA 4JQ4A 3EA3A 4Z2LA 4O10A 4ML9A 2BWGA 3ARWA 1BFNA 4A8RA 1QBAA 1ESWA 3VKAA 1GGOA 4S3BA 1WX0A 2HE5A 1TPFA 4UFLA 3T8LA 5B7YA 3L67A 2X41A 5K9XA 8XIMA 1XRFA 2GJNA 4O1AA 5FSEC 1KM5A 2DEPA 4P7OA 1V8EA 3VK5A 1F8IA 3TAKA 1PHWA 3AMDA 4PUDA