3KS6A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 1.80 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
b'GMTRIASHRGGTLEFGDSTPHGFTATAAMALEEVEFDLHPTADGAIVVHHDPTLDATTDMTGAIVDMTLAKVKTATIRYGAGSHPMTLEELCALYVDSHVNFRCEIKPGVDGLPYEGFVALVIAGLERHSMLERTTFSSFLLASMDELWKATTRPRLWLVSPSVLQQLGPGAVIETAIAHSIHEIGVHIDTADAGLMAQVQAAGLDFGCWAAHTPSQITKALDLGVKVFTTDRPTLAIALRTEHRMEASV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (17743486) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.80 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Hydrolase
total genus 85
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ks6A00
1DJGA 2PZ0A 3QVQA 3V18A 2ZKMX 2PLCA 1DJHA 4QJ5B 3I10A 3RLHA 3H4XA 2PTDA 3H4WA 3OHMB 4I9MA 4GNKB 1XX1A 4RW5A 1T8QA 3EA1A 3V1HA 1DJZA 4Q6XA 4OECA 3PTDA 3V16A 1ZCCA 2O55A 4I90A 1PTGA 3QR0A 3EA2A 3MZ2A 1PTDA 1VD6A 5T91A 7PTDA 2OOGA 4F2TA 2P76A 1DJXA 1QATA 1DJYA 3L12A 5PTDA 1QASA 2ISDA 3QR1A 4PTDA 1V8EA 3RLGA 3NO3A 1DJIA 4F2UA 2OTDA 4F2BA 1O1ZA 1AODA 1GYMA 4I9TA 3KS5A 5T9BG 4I8YA 4S3GA 2FJUB 4R7OA 1YDYA 2F9RA 3EA3A 1T6MA 3KS6A 4QJ4B 4RW3A 6PTDA 3CH0A 4RV3A 1DJWA 2OR2A 5T9CE 4I9JA 4QJ3B
chains in the Genus database with same CATH superfamily
1DJGA 3LMYA 2Y61A 1SMDA 3PZUA 4MG4A 3SECA 1VFLA 1C93A 1QI0A 1BRLA 1R7OA 1JCLA 1SSGA 2VGGA 1FUYA 1PKNA 1CLKA 1XFBA 1DOSA 1QT1A 4P7NA 4KEMA 1PDZA 2V63A 1YW1A 1XQLA 4L64A 4RE2A 3IJLA 4O28A 3E74A 4Z2HA 3VNIA 1K7FA 3H2FA 3QV6A 3O8AA 1K1DA 2P8CA 3WDJA 3EPNA 3UERA 3D6NA 4OVXA 1A5LC 4DM2A 1UD2A 1GVIA 2ABAA 3ITLA 1YXYA 3QQWA 2XTKA 5IBXA 3VZYA 3RYSA 3LNMA 1VFTA 1Q4WA 1GK8A 3I4EA 4DJFD 3B8WA 3QZAA 3VGFA 4DXKA 4BFAA 1XH2A 1SJBA 3HQPA 4K6AA 1QOPA 1WAWA 3I3EA 3T6CA 5F2MA 4CU7A 1RPKA 5HQLA 2FMOA 1J6OA 4TMBA 1O4UA 3U0HA 4IMEA 3AMDA 1KXVA 4MAVA 3RILA 1WXYA 1W3HA 4IP4A 1ZBWA 4KEUA 1FWDC 2A21A 3WFZA 2VFDA 5I2UA 3SADA 3LD5A 4NSBA 4QG9A 2E5CA 3R2GA 4HU0A 5AHFA 4F0RA 3AHXA 5E9XA 4PMOA 1UWQA 1ZFJA 3RU6A 1W3JA 1GQIA 1PAMA 2WHJA 2G41A 2ISSA 2WMIA 2CHRA 4GNVA 1VH7A 4Y7EA 4BHYA 1IEQA 3VNLA 2OSWA 3VIPA 1ZP3A 3B9AA 1EL3A 9RUBA 2CLOA 2HNEA 3W7EA 5FF0A 1UWIA 4GC4A 3LBMA 4BJHA 3ITTA 4GUFA 2GUYA 1S2AA 4V1XA 3U7BA 3EB4A 1XYFA 4ICMA 5CLWA 3EOSA 4RDYA 2ZXDA 1JDDA 2W91A 1JCJA 4FNRA 3SB0A 3USBA 1LRTA 1DWFM 1W0MA 3LPPA 3W2JA 4JIEA 4PMDA 2ZZ3A 1GVYA 3HV8A 3WLTA 3GG0A 4XD4A 4HCLA 3RX2A 1HX0A 5F4WA 2WSRA 4NJHA 3SCSA 4UFHA 5EMLA 1CTNA 2ACSA 3OZYA 1BXNA 1PX8A 1VF8A 3IPWA 2ZIDA 4UMCA 4KWSA 4AXNA 1UR3M 4HNTA 3H4WA 4GD0A 4MY9A 1S2VA 1E9ZB 3S1VA 1TJRA 5B80A 3UJEA 3WDHA 3NL2A 3KDNA 4M6UA 4IM4A 3CUHA 4ZB5A 2Z1VA 3L0GA 1NOUA 1JUBA 1WPCA 3NOEA 3TXVA 4Y6GA 1LWJA 4ZCWA 2WCAA 4GI4A 2EKCA 1E56A 4MJ4A 5CLTA 3ZR5A 3A9IA 2VFHA 4RDVA 1WZAA 3WJZA 2XG9A 1NTHA 2YDRA 2HK1A 1FFQA 4NL1A 3S0CA 2EQDA 3PZTA 2A2IA 2PWHA 5A6SA 3HPZA 2C1GA 2Q8XA 3ZLHA 2WJZA 2YB4A 4HPXA 3U48A 1IEVA 2E3ZA 3A3WA 3S47A 1XLMA 1LOLA 3C3UA 5G5IA 1P5BA 3M44A 4PTVA 4W84A 1J12A 2QJNA 3VFCA 3ARTA 1NWSA 4QE5A 3W7PA 3KDOA 1U83A 1JCMP 3VU2A 4PMVA 4LVAA 4H3DA 4JY9A 2YFOA 1QW7A 1P43A 3W74A 4OUEA 3WQ5A 1Q7MA 3HN3A 3NWRA 4HNNA 2DGAA 2OCZA 1HO1A 2D20A 4IICA 1UWAA 2ZUWA 1PE1A 3QVQA 3BAWA 2PLCA 1W56A 2QT3A 3W81A 3ZWTA 2JGQA 3ENLA 3T81A 4OBSA 4XAFA 3UWWA 4C1NA 4LC6A 1GKPA 2QDEA 4GX8A 3WCZA 5TF0A 1CXFA 4M1RA 3C0SA 3C61A 3GAYA 4YL2A 3R8HA 3R0KA 3WMSA 3TTQA 3KBJA 2FTWA 4A3UA 4ZO8A 5HA7A 1XINA 1E3ZA 3LI1A 2WPGA 3CUXA 2O7QA 3VCRA 3CXOA 1EGVA 5EYWA 4FLQA 3N18A 3U4AA 2Q01A 4F2TA 1OQFA 5FJOA 3TNOA 1IXQA 5A6TC 3T08A 5AYYA 2YDAA 5HUOA 3WL1A 2DJXA 3ITCA 2POZA 1GYLA 5F4XA 1TX2A 5HOSA 3FLUA 1AH3A 3HPAA 2CKRA 4Q4MA 2WLYA 3W7KA 4XBJA 2FFIA 1WB0A 2BDQA 2NUYA 2QJJA 4D6EA 2Y63A 2W3ZA 4IFRA 5DX7A 1L2QA 4PB4A 3QM3A 3WF1A 2P10A 1JPDX 5H8MA 5LIYX 1DIOA 2PF0A 3PS7A 1KFLA 2GWGA 4AC7C 2D0FA 2R1PA 1A0EA 5JUVA 4WDWA 2PE4A 2ZRXA 1KFKA 4GH1A 1VHNA 3C56A 1OFBA 3B0XA 3TLLA 3R8GA 3WBAA 2IUZA 2W92A 3C86A 2GUUA 4CGTA 1XS2A 2FPVA 2VEMA 4LGXA 4RPQA 4IIEA 4WX2A 3GTFA 3EWDA 2FZMA 4OHQA 2ZUMA 1R46A 3RLUA 3FSUA 2WHKA 1AJ2A 1VEOA 4NJGA 1G4TA 3KCJA 3Q67A 4UCFA 2GVLA 3ZMRA 1PCWA 1P0BA 4ADSA 1JNEA 1WBHA 2BHUA 2VCBA 2Y88A 4U2ZA 1OX6A 4NNAA 4D71A 3L4YA 4QFUA 4DWSB 4NUWA 4ATWA 1GJUA 4DJFC 3RFAA 3MKKA 3LA4A 4DXXA 4BR1A 1XBZA 4NXSA 4OV9A 2YB1A 3NUKA 3POCA 4G2DA 4UR8A 2XHYA 3AIUA 4GHRA 3AMLA 2GJLA 4ROPA 1LOSA 1TZZA 1YNYA 3O0FA 2V5DA 5DY3A 1I1XA 4GNJA 2BXZA 1TMLA 3EPMA 3JRKA 1XIJA 3KEHA 3N11A 2VTFA 2C13A 4I8YA 3ZVHA 4C6KA 1TTJA 2A7NA 1VENA 1KXTA 3H8AA 4TV6A 1DJQA 3GDBA 4NZ5A 3MCMA 1VBUA 1EIXA 2PU1A 1XLKA 3OLIA 3DECA 2Y24A 4UFMA 3I65A 2PI6A 1FQ0A 1Q6RA 4V28A 1ZY9A 1DJHA 1W5NA 3IV3A 1L6FA 3J7HA 2YDQA 1NARA 1I9CB 2BLEA 3BLEA 2R9RA 4L6HA 1B30A 4WRHA 1VPQA 3RJYA 2OT0A 1LLOA 1VBJA 2V38A 2UY4A 3GDTA 1GOKA 4IWWA 3KCOA 4OTKA 4O13A 3VKKA 4AIOA 4GC3A 5CG7A 4J40A 3VE7A 4HP5A 3N29A 1ADSA 1TJPA 1H51A 4EVZA 1H50A 3JR2A 1PTDA 4GE8A 3MS8A 2TAAA 2XWDA 4ACZB 4BI7A 2OOGA 1A5BA 3EEZA 2P0OA 2E7FA 2FB3A 3SRHA 5FF7A 4RK8A 4Q7NA 5D8WA 1W1YA 4JTQA 3U7VA 3SI9A 3LGEA 1TPDA 1PZ1A 3UZYA 1O5QA 1ZCOA 3M7SA 2GLKA 3E5PA 1V3LA 3GTIA 3H7VA 4R88A 3GHUA 3UXDA 2WMJA 4JQ4A 4RZBA 4QM1A 4AHPA 3DG3A 2VC7A 1B2YA 2QCDB 1BLIA 3UPWA 1PDYA 2XVKA 2DFAA 4DBEA 1CYGA 3P82A 1XRTA 3SW6A 2XJ7A 2EPLX 3QSRA 3W7MA 3URQA 3W7NA 1R30A 3OIXA 1YQ2A 3O1NA 4WJ8A 1UWSA 4CD4A 5A6KA 4ZOBA 3V5FA 4QAWA 4R9OA 2HE8A 2VD9A 1TRDA 4A3YA 5CPOA 2MUCA 4NILA 2W9MA 3G8RA 4GQ0A 3PPFA 1K02A 3ABOA 1FHUA 3OG2A 1ME7A 3B8SA 3MUAA 1FBAA 2F6UA 5CG0A 1V0LA 2XH0A 2O9PA 3UWUA 3MMTA 1EUAA 4JL2A 3LOTA 2XFRA 2DDXA 1LRNA 4W85A 4W8AA 3PTDA 1XPGA 2TPSA 3PWAA 3DUGA 3OVGA 5I3IA 2Y0FA 3LI0A 1GOOA 1Y5WA 5IFPA 3PB2A 4QG6A 3WN6A 2QGHA 2HJPA 1V3HA 4I8DA 1J5TA 1F61A 3WBWA 4DJDD 2DSVA 5LA2A 3TJIA 5CZKA 2E1DA 3F1QA 3UXKA 3M9YA 1NU5A 2F61A 3HGOA 1EXBA 1M7PA 2J75A 4DWSD 7REQB 2GSEA 4JTUA 1VFHA 4HA1A 1DHPA 2GOUA 4S1FA 2R94A 1RVKA 5A8NA 6ENLA 2QGYA 3NAVA 1DBTA 3NYZA 4CQ9A 3PM6A 2OFJA 3G1HA 3A47A 4Q8VA 4H6KA 1S1PA 2H9AA 1H49A 4RL3A 3SM0A 3PZNA 8TIMA 4Z1CA 2DW7A 1WDWA 3W71A 4PB5A 1W9XA 3MVIA 2QXWA 1NIUA 3MY9A 4AWEA 3B03A 4EPEC 2O9TA 4A3QA 5C5YA 4FNPA 5CC3A 4W89A 1T0OA 4REQB 4NZJA 3FW6A 2IQTA 3M5ZA 3EA1A 4EANA 1R2SA 5G2IA 4CNPA 1QUMA 3W9ZA 1GZJA 1ISXA 3FDGA 2O9RA 3TW6A 4FF7A 3JUGA 2CLKA 3I3BA 3MJMA 1YKWA 3VMOA 1OYAA 4ML9A 2CHOA 2ZXBA 5GJPA 1FCBA 1TV8A 2I5GA 3LPFA 1ZJIA 1LL6A 3U5YA 3BZGA 1JZ5A 4MKSA 3FAWA 3CO4A 1PIFA 4GQRA 3H23A 3MSRA 4IXHA 5C6MA 1XUZA 4DUOA 1NP0A 4MJMA 3LG3A 5H1WA 4IMDA 4B9ZA 1Q6DA 4H19A 2GJXB 3CYVA 1Z41A 4J3UA 3AO0A 3FYOA 1W17A 3T2OA 2OKOA 2ZTKA 4NAFB 3BAJA 4DUXA 3CPGA 4XZWA 4S3GA 4R85A 3WF2A 3EWBX 3SJ3A 1OG6A 1FOBA 1YNQA 4D6GA 5FF4A 4DX3A 2TSYA 1YDVA 5CSUA 1JRCA 4DYKA 2TODA 3GXMA 2QUVA 1JPKA 2ZRVA 3BICA 1KM5A 1SW3A 3VAVA 3B8VA 1WO2A 3SN0A 4G56A 3SY5A 3QQ0A 3G22A 2QPSA 1EJVC 3L4ZA 3PBYA 1DIKA 3MTWA 4NJIA 4UUIA 1KGUA 1VCGA 1GVFA 4KERA 2CNCA 2FZNA 3HGSA 3I6RA 2YXGA 2JQXA 2UY5A 3R58A 4INFA 1JYVA 3LEPA 3P14A 2OEJA 1WX0A 3EAUA 1QCWA 2YFNA 1UH2A 1H0GA 1REQA 3OO2A 4UMAA 3MV11 4ZENA 1RP9A 3SGUA 2DT3A 1VHCA 1VCVA 4DYEA 2CYGA 1LUCA 3WQCA 3E0VA 2DZVA 4PUMA 3URBA 3WX7A 3CAWA 3BUVA 3VO0A 3VOCA 5JVLA 4R7JA 3EDDA 3TW9A 3N12A 4PTDA 3S5SA 3HFYA 3WLMA 4LVGA 4FHAA 3PJXA 3RM9A 2PDFA 4J2PA 1KRBC 4HKPA 1DHKA 1V6TA 3OZOA 1AG1O 3PZOA 3A4JA 3SGGA 2C18A 2EG8A 2WVVB 4AX6A 2PRMA 1YDYA 1OCJA 4LB4A 5A6JA 1EJRC 4LAZA 1SJCA 2PDWA 1HQTA 6PTDA 3LPOA 3W2KA 1C7TA 3ANYA 4Q8MA 4DBDA 3QPEA 4CQ8A 1UR4A 1SZFA 4ASTA 3D5HA 1OCBA 3CIXA 2QVHA 4LWWA 3H7UA 3CK5A 3Q45A 3FHAA 4X2RA 3S5NA 2QCHA 4ECLA 4KCTA 3WFLA 4N9DA 1S3HA 1A5NC 1OFAA 3VIGA 4ZO9A 4AUBA 4IIGA 1W1A1 3MSYA 1U5JA 3WQWA 4NJKA 1JYNA 1PEZA 3BAYA 1FWRA 2VP8A 3BLDA 4XX6A 4CQBA 3UR2A 1KD0A 4WJEA 4AX7A 2XZ9A 4L9ZA 3M5YA 4Q3MA 3H2MA 4DLMA 1EJSC 3GUGA 1JNDA 2IXUA 1UW9A 1KBJA 1OCQA 1KCLA 1OFDA 4L1XA 3RJXA 3CQHA 1GOXA 3CLWA 1FY6A 3KP0A 4QNEA 1I6NA 6XIMA 3AHYA 3FA5A 3WUFA 4RV8A 3OIHA 3UZJA 4JTJA 2Z7KA 1Q3NA 2GQAA 2P53A 4Y2WA 3KS6A 2YBTA 1EFZA 2ZX8A 4QSFA 3AXMA 3ZJ8A 1UC5A 3CUZA 1KXHA 3LRMA 4C5YA 3ZXWA 4NRRA 4UMBA 3L5MA 2CLLA 2PDXA 1E4NA 4FR6A 3NDZA 3WNOA 1TWIA 5F1VA 3IJ9A 3QGVA 4MLJA 3GTHA 2WSQA 2VEFA 3VKBA 1RP8A 3EWZA 5K4ZA 2V2CA 3UVAA 4DJDC 5CSSA 2V67A 2J7EA 4KWOA 5GJNA 1XC4A 1P1MA 2Y8KA 3IJ6A 4O12A 4KF1A 5I3KA 4HA0A 2GPTA 3SN4A 2Q6ZA 2Z2AA 5KMYA 4MGGA 3TQPA 3WD3A 2VR4A 2XSBA 2D0GA 3WH9A 1N7KA 4ATDA 4YS1A 3WK2A 2G4FA 3TJXA 1XLFA 1JI1A 1H1YA 3U2CA 5D32A 3LV6A 1EKOA 3QOMA 1ZENA 3GZ3A 4UTWC 3QEZA 2RFGA 5E70A 1AD4A 1FWGC 1ME8A 4O1EA 4YWIA 2YL8A 3NZPA 4XVDA 4GIEA 4CN6A 3OBKA 5M17A 2ZQ0A 1XLJA 2A3LA 2AGTA 3VCNA 4HNUA 2Y62A 1NFPA 2NZLA 2Z7GA 3LENA 4WXYA 1N8WA 4QQUA 5I02A 3W1AA 2QCGA 3CZKA 4WLCA 1A3WA 2HK0A 3GY1A 3KW3A 4OBTA 3RX3A 4CVWA 4O57A 3BQ5A 3UETA 2XZ7A 1S5MA 5DLCA 4Z1BA 1EGZA 3NOYA 4MWAD 1PS9A 3WLHA 2GYIA 1PKMA 2E40A 3HPXA 3W7HA 2WCSA 1L8NA 4A21A 3KX6A 1CI1A 2ZZ6A 3FN9A 3PUGA 4IQJA 3O0KA 1E0WA 1W5PA 3OGVA 5T8GA 4M6QA 4LEFA 5F7UA 3HA1A 3FFSA 3OLDA 4R3UA 4DBUA 5ECVA 5MHBA 2J7HA 3AOFA 4EPDC 1F8MA 1V03A 3CAKA 4IMCA 4N0RA 4NNBA 4PEKA 5D9OA 3W2MA 3F5LA 1H5VA 3D0CA 1S5VA 3CPRA 3GC2A 5FJIA 1FHVA 5CSYA 4BZYA 4OQVA 4GINA 1XL9A 4I6VA 3UU0A 2Z1KA 1Q45A 3W00A 1EEPA 2B7NA 1TPFA 2OX1A 3PPHA 4GYKA 5AB3A 3DAQA 1LYXA 3EOEA 5A8MA 2WZTA 4ZSTA 4G1KA 3TLQA 2EPKX 2P5NA 1CENA 3V4BA 3QGKC 4AEFA 3VUPA 3FXYA 1EBGA 4KEZA 1CX9A 3W2NA 5ABGA 2J7BA 1GJPA 1D2KA 4Y9AA 4D9PA 1H7NA 1W3TA 4E6MA 3IIVA 4XZ9A 1W1B1 6ALDA 1DXEA 1YHTA 1TR1A 4Y96A 2C0HA 4NASA 3M0JA 2OR2A 4CNUA 4M1BA 1DXFA 2PZ0A 3NZRA 3NQEA 3S2MA 8CGTA 2F6KA 2CESA 3JVAA 3BG9A 2Z1BA 3SUUA 2WAGA 3RGTA 4XBKA 2X1RA 3W7OA 3BLPX 1K7XA 3GR4A 5J5RA 3T4CA 2QIIA 1GKRA 1VYPX 4K8HA 3U6WA 5K9DA 3LZ5A 4CCZA 4PMZA 3K1DA 4ZE5A 2D22A 2OEMA 4WDTA 4AD1A 4J3VA 4KKXA 3V5CA 2WJEA 1UOZA 2J8FA 4PBGA 4M6VA 1E1CB 2GDQA 4N42A 3LRLA 4B5TA 3A24A 5AC8A 1RHCA 3UCDA 2XGIA 4P8WA 3OJGA 4J5NA 4O11A 4PMQA 1EP2A 3VDGA 4ZVJA 2FLIA 2CZEA 1RLCL 1KGXA 2V81A 4Y9PA 1BVNP 2QV5A 2JEQA 5C70A 4EACA 4XWUA 1W3LA 3H26A 1K9EA 3WMLA 1AODA 1TG7A 4JPGA 2P3EA 1QPRA 1GZGA 4RE4A 1MDLA 1KRMA 3NL6A 4DJEC 4JTGA 4A35A 1H61A 1E1FA 1HZYA 1TFVA 3E38A 2R1KA 1X7IA 1XH0A 3ME3A 1BWLA 1JZ7A 9XIAA 4GX9A 1Q2SA 2IQ0A 1JCTA 2JBMA 1S5NA 3NDOA 3M0KA 1ONWA 4A3HA 2BY0A 1S2WA 4NI8A 3L4UA 2VCAA 3HV9A 4RZ6A 3DH7A 3LU2A 2JKAA 4HSNA 1ZB5A 3KHDA 1U5HA 3BMWA 4HN4A 3VKAA 2J6XA 1JZ6A 2B31A 1RK6A 2NQHA 5DCEA 2JF6A 1TB3A 3HU7A 1XF0A 3K1GA 4BF9A 5LKYA 4LUJA 3N34A 4GYJA 4PN2A 2J6VA 3MHFA 1YXCA 2Z24A 3BMVA 2VQUA 4F0KA 2PRLA 5FEZA 5CGMA 3T2QA 1E4IA 4PL1A 3ORWA 1UCWA 1XYMA 3VKCA 1BG9A 3ARXA 1QJWA 1QO5A 2GGHA 4Z1AA 3OG3A 3MP3A 3TYAA 3KS5A 1A5SA 3QOKA 4BF5A 1EZ2A 3H2EA 4GUGA 2XPKA 1G1YA 3G5EA 5CZTA 1B57A 4GOAA 3M0LA 1UZHA 2W5FA 2J8GA 1S5TA 1FA2A 1V6WA 2ZOXA 4JFSA 2J78A 2VI0A 5CGQA 4LQ1A 5F4SA 1KKRA 1UJQA 2VZOA 2VFEA 1NOFA 4IGMA 5E1QA 1EWDA 5CBJA 1XLBA 1R38A 1HGWA 4LYQA 4EK7A 4C6JA 1AK5A 1RBOB 1F74A 3WD1A 1GG1A 1QWGA 5BXSA 1A3HA 1NH6A 2DUZA 4FB7A 3OW1A 3QKZA 4CCEA 1RQBA 4ZFMA 3G1XA 3WQOA 3CYJA 3DFHA 2BG5A 3V16A 2FKPA 1OFQA 3B8UA 4CQCA 1TE1A 1TA3A 1TWWA 3GU2A 2VZUA 5C9RA 2P1FA 1H7RA 3UR7A 1V02A 2CPUA 2FJKA 3UWYA 4JIQA 3OBAA 1FH9A 4KRZA 5F2GA 7ENLA 3B8DA 3VNKA 4UTTA 1ZBVA 4MWAC 4QS6A 4DPQA 3C0JA 1EC7A 5G4EA 4ZEPA 4S3DA 3GVQA 1OIFA 1UWUA 3RCMA 5M3WA 3W3OA 5A8PA 2QLYA 3N1AA 3SQLA 3GUWA 5AOUA 2F38A 2LLEA 5AFDA 3BXWA 3BLLA 2OJPA 1SFTA 4OGZA 4I7VA 3W6YA 1CXIA 3OVQA 4AD0A 1I2NA 2RAGA 2CZDA 4GZEA 5D03A 3IIZA 4PCFA 3W38A 2J7GA 1EJ7L 4DF0A 1MI3A 5G2WA 2NT0A 3ATYA 4MJ2A 3S8HA 3SUSA 4PA8A 5JBEA 1M7XA 2CWXA 3TQ0A 1UA7A 1S2TA 1WXJA 3DI0A 3LMZA 3OZPA 3AXXA 3AU6A 3U3HA 1UQYA 2I1OA 4GABA 3QC3A 3AIBA 2ACUA 2NVAA 3UZZA 4IHCA 1F4AA 5FF2A 1H1NA 5G4WA 1H11A 3GX9A 1BGGA 5CQ1A 2CLEA 3BMXA 4ZXLA 1AW2A 1JYXA 4QLJA 1W6TA 2V5KA 3H54A 1VAHA 4PUNA 4LNYA 4MNKA 1LLZA 3HF3A 2VRQA 3VM5A 1XJBA 1I8JA 5EA9A 3P93A 1I4NA 4UNLA 2HPMA 3W7GA 5TNVA 3ZJ7A 3E0FA 4D6FA 1LCOA 1W2VA 1V7AA 2OXNA 1HUVA 5BW6A 4O1DA 2D3NA 4O0QA 3DG6A 1HGYA 3CJPA 2A79A 3PWGA 2V30A 3W87A 4DYJA 1HVXA 4MYAA 4H83A 2ZUSA 1OT2A 3G24A 1WKYA 3C8FA 2ZRWA 3LTPA 4PRWA 3KP1A 2X1SA 4KIRA 4AD3A 5H6HA 1C7SA 1SFLA 5G1TA 4C91A 2VX4A 4JTSA 4RPPA 2ZRZA 2INEA 3T0AA 2PP3A 1J18A 3M6DA 1RR2A 2QULA 4D72A 4MTVA 2CLFA 2DUXA 5CPQA 3FA3A 3NQFA 3MP4A 4ERIA 4AAJA 2DSWA 1PBGA 3V5OA 1FFRA 4L9YA 2YLAA 1CLVA 3WMCA 3E6EA 3OGSA 1V08A 3RCYA 1OWQA 3OB8A 4O1CA 3SIMA 2ZZ7A 1CNVA 1XHGA 2WMKA 5KTLA 5LXEA 3S2CA 2D73A 3HBLA 5IRPA 1WZLA 3W1NA 2AKMA 5E6ZA 1D8CA 3TIMA 3EDEA 5KZMA 1W1TA 1QNRA 1D8WA 5D33A 1J0IA 4UTLA 5D04C 3EA3A 1GQKA 3GXNA 2GUBA 1S38A 3P6LA 4PBEA 1W3IA 5EMKA 3W84A 4RNFA 5XIAA 3HGJA 1K6AA 3N2CA 4QJ5B 1XD0A 3BCFA 2BFGA 4WF7A 3LB0A 3FVDA 1QHOA 4XZNX 2JFEX 3RR1A 5FKYA 3EKGA 3K30A 4WOZA 4PSPA 5CZJA 1PIIA 4NNCA 4ZE4A 2ODOA 4W87A 5SWUA 2V5LA 1IHIA 3T55A 3PAJA 5EBAA 3NL5A 4JOMA 2NQ9A 4D6IA 1KM2A 2Q8ZA 1M41A 1W54A 1PHWA 3UQNA 4EF8A 2ISFA 3K5XA 2ZDRA 4IH3A 3HPFA 3JU2A 2G50A 4KS0A 1OCNA 5AHNA 5XINA 2HQAA 1EOKA 2Y89A 3WL0A 2Y1HA 4Y9MA 1AUSL 2D2GA 3AXIA 3N73A 5CJNA 4GIRA 2EAWA 4P7OA 4GXMA 3L2MA 3WBEA 5IFTA 4GA8A 3NO3A 3ZZ1A 3EWCA 4PCSA 2YYTA 4S2BA 1XV8A 2FGZA 2J24A 3WYZA 4JNMA 4QEHA 5I79A 1NELA 3IGUA 3ZVHB 2ZE3A 1TO3A 1AMKA 3NQVA 1KKOA 3MBFA 3APYA 1M5WA 3ITOA 1MQPA 4S23A 3QHMA 3AIWA 1DWHM 2X0YA 3UT0A 5EGRA 2PTZA 1VGAA 4DQWA 1Z89A 3TCSA 2G3IA 1ML1A 4LS1A 2DU2A 4DXVA 1MSSA 3FEMA 3PBWA 3HURA 3W88A 1DKWA 1E6SM 2XFFA 3MB9A 4YTRA 1EPVA 5L9FA 4LX4A 3TONA 3R0UA 3WIJA 3EA2A 1EJUC 3NXFA 5E5CA 2Z25A 2J7FA 4KRUA 2WMGA 3W25A 4HNVA 2I14A 1J79A 1ZNNA 2GSHA 3LNPA 3EWUA 1UKOA 3BANA 5T26A 4YVVA 3RG6A 5EFDA 4M7SA 3SGZA 1MW0A 3DHPA 4NF7A 5K9XA 1E40A 1E71M 1UD5A 4JHZA 2VR2A 2AAAA 3F03K 2I16A 2RJHA 3T07A 3SFWA 1UC4A 3R5EA 5A6BA 5AVHA 1AD1A 1NF0A 4ORMA 4B5VA 2OQLA 1TUFA 4JTKA 1SR0A 2NSOA 2PWFA 4KCVA 2W27A 4TTGA 2QF8A 3KHJA 3SR7A 4OOUA 5BRBA 3UF9A 2UY3A 2EKGA 3LCLA 3S2LA 3HG3A 1XD1A 1CWYA 3A6OA 1KO0A 1Z32X 3G6MA 4B16A 5E09A 4GZ7A 3ZIZA 1LDCA 1TPC1 3G0UA 1WDPA 1EXPA 3PPCA 3A23A 3WLPA 1PX3A 1KCKA 4G6CA 3VMPA 2X2GA 4LCQA 4XSLA 3VDCA 3BAIA 4MKNA 1GT8A 4FX7A 4FXSA 3CUJA 4JDYA 1K7EA 3L4TA 1V7YA 4H9UA 3CUGA 4LPCA 3FJ4A 3TVAA 4BQ3A 1VLWA 2F2KA 1OFRA 5KZDA 4NZCA 4Q6XA 1R0MA 1A5MC 3INPA 4C6DA 2BBFA 5G1YA 2YXOA 2QCDA 2QMKA 4P5UA 3GAKA 3W6LA 3GDMA 3MZ2A 3SRKA 2WZHA 3EWWA 1QK2A 1ZAHA 4Q4OA 5IDZA 1KV5A 3S4TA 5DRCA 1NSJA 3M0VA 4B5XA 1ZBCA 1YDNA 1SYTA 3QSTA 3TSMA 2CC0A 4C90A 4FPSA 1X6LA 2ZUTA 3WLLA 3WZ0E 4H6QA 1OG0A 4OZOA 3SEPA 5IBXC 3ZT7A 4XKYA 4AF0A 2WC4A 1GWJA 2OKTA 4MJZA 3PTMA 3MUY1 1KM6A 5BYWA 1UROA 2B0MA 3V7PA 7A3HA 3VILA 4RLIA 2ALDA 2E67A 3NSMA 2REQB 1AJZA 5BCAA 1BTCA 1UR9A 2CBVA 2Z1XA 3WEOA 4IZGA 4HU3A 4GIYA 4FA3A 4I9AA 2IMRA 2JGYA 3FJ6A 2DT1A 3MKCA 2H9AB 4MF4A 4DWDA 5EPDA 4JCMA 2W63A 4WDXA 4YTQA 2BY1A 3NQ8A 3TP4A 1EQPA 3DG7A 4PH6A 3QC0A 2BOGX 3SCWA 2PCQA 2XU2A 5RUBA 2ZA2A 5FJJA 1LBMA 4UTFA 1W3NA 2V5CA 3GNRA 3M07A 3A5VA 1XP3A 4L6OA 4WSJA 2QPUA 3M0IA 1JPHA 7REQA 1EQCA 4GH3A 4M24A 1LBFA 4GVHA 2E5DA 3W7IA 4J1OA 2BVDA 4YU1A 3WLIA 4NYYA 4GYPC 4TU1A 2NT1A 3O2LA 4IPNB 1IIGA 4HPNA 3CUFA 4J9JA 3WBXA 2PBOA 3QR3A 1GJWA 3WNKA 4OOZA 2P3ZA 4QS5A 3SY8A 3AYVA 1VLIA 5BZAA 3SIZA 1T40A 1CGYA 5BWAA 3AALA 2R14A 4POCA 3NO1A 1VFUA 3AIEA 1A4MA 2PGRA 3RF9A 3TTSA 4E0CA 1UD3A 4REQA 4IQDA 1ZJBA 4Y9NA 2XIMA 4EP8C 5KSWA 3F5KA 5CC7A 1B90A 4AWTA 2PCEA 5BU9A 4D6JA 3S1WA 5I3GA 4KCUA 3STEA 2A7RA 4Z2LA 3GQYA 4RNIA 1D3GA 3TR2A 1GHSA 3PN8A 1RBLA 5AZ0A 1GHRA 2QUTA 3O07A 2ZX9A 3TCEA 2QJHA 4GZJA 1IR2A 1XCXA 1X7FA 5C9XA 1R85A 4MY8A 1X38A 3ZLFA 5D09A 1P1XA 5DFAA 1E5JA 3P62A 2PLMA 4X3ZA 3K4DA 1UP2A 1YTKA 1FHDA 2RJGA 2PEVA 3OU8A 5CPTA 2GJXA 3BURA 4C6BA 4IMAA 5DMLA 1CXKA 3L2LA 3NVDA 2OZ0A 4NAFA 2NUXA 1R2TA 5EBUA 3HQNA 4F9DA 1VRXA 1UR8A 1IT0A 1REQB 4LUTA 4LY8A 4C6NA 2BSLA 1LUCB 3DFYA 5DBTA 4IFOA 4WY0F 3GDLA 3W37A 3TOYA 4PZVA 1W9VA 4LCRA 2QCNA 4JR5A 3RO8A 1PJ9A 3NSXA 2PLJA 5KINA 1DWJM 3W1UA 3CT2A 2EPHA 1MFUA 1MUMA 3N2TA 4GLEA 3CWHA 1J0KA 4Q8PA 4E2DA 1OX4A 1SO4A 3W24A 2QQ6A 1XWYA 3S3GA 1C9DA 3UYIA 3I10A 4AD5A 3WK1A 3C5QA 4JHMA 1SM9A 4U3AA 1CB7B 4PUKA 3WJXA 4NZ4A 4O50A 4GI9A 2PA6A 3I7RA 3H24A 2XDFA 2WQPA 5EFFA 1HJSA 3HB9A 4H01A 5K2ZA 3EX2A 4UOZA 4P8UA 4QEEA 5CZ0A 1XBXA 3NQBA 1YXDA 4K8EA 4LNCA 3ABZA 3S9IA 3XINA 1UUOA 6CGTA 3QMTA 1BYDA 3N4EA 4LTSA 4F40A 4UFKA 2GJNA 3CHEA 4B5NA 1J0JA 2FTPA 4ZOAA 4X0NA 4URIA 4S3EA 1XSIA 5B7ZA 3AHZA 3VKJA 1B4KA 1QU4A 1QAPA 2Q71A 2DSZA 1OYBA 5HUPA 2NVCA 3L12A 1J0ZA 5EL1A 2I57A 1UZDA 3WDQA 3SURA 3ARPA 3O6YX 4JKMA 2CITA 3W01A 2VEIA 2WANA 2DZTA 3QTPA 2OU4A 1E55A 3GH4A 2PDMA 5LYRA 5FIPA 2GSJA 1CGWA 1FXPA 3PNZA 3L68A 4NX5A 3PZGA 4FO4A 2OWCA 1DE6A 4IJRA 3B40A 1NWRA 4H4IA 1TR9A 3G2GA 1E9IA 2VFFA 4BEUA 3AJ7A 3CH0A 1KFJA 3QKEA 1D3CA 4YCPA 4TOQA 2OVLA 3EB3A 4PL2A 3RPMA 3ZR4A 2E6AA 5J8LA 2XINA 3PBMA 1GNXA 3GU9A 4DNMA 3GZAA 4WZHA 3E2RA 2I9UA 3VIIA 1VJZA 2X1IA 2R6OA 4C6FA 5LA1A 3P84A 3QRHA 2G8ZA 4PB3A 5G1MA 3R13A 1P0EA 4HNOA 2XH2A 4LVBA 4NI3A 2B4GA 3GE7A 1XC6A 2YL9A 5AYBA 3MANA 5FOOA 2ACRA 4L80A 1XFCA 4N4PA 4P8VA 1XLCA 4JTEA 1AL8A 1OEPA 1PL9A 4X2PA 3NQ2A 1K8CA 2FZDA 2VHLA 3CEPA 4O19A 4US5A 3TSDA 2DUAA 4LUYA 1YPFA 3DKLA 2X0HA 5LGXA 3SQSA 4L1GA 3D3AA 4QDWA 1KBKA 5F1UA 3M6YA 4QE4A 1HP5A 1FCVA 3UZ5A 4AY8A 3D46A 5U7SA 1SQ7A 3BGJA 1XCFA 2QS8A 2ZXAA 3VFLA 4HT3A 5DO8A 1DJIA 3NZGA 3S5ZA 4NT0A 5C9UA 4EXBA 4F48A 4QR6A 3VXGA 4I9TA 3UESA 3HG4A 4OKDA 4M8UA 3R6IA 1DYSA 3CV7A 1W31A 3LERA 1JCYA 3K4WA 5I24A 1FH8A 1NFGA 1LQ0A 3LDVA 1X8CA 2WZIA 4DM1A 1SMAA 3ZWSA 3PUOA 1LWHA 2DZXA 1XLLA 1K4HA 5LHEA 3BL3A 3VD5A 3CAQA 4QIUA 4H7VA 2R82A 4PFHA 1I0BA 1IEXA 1UQZA 1A50A 3VKDA 1LJYA 2Y8VA 1Q6OA 1GKQA 1K4GA 4GY0A 1XKJA 2VC9A 4XK2A 5J5DA 4WXZA 3GU1A 2OLHA 4L65A 3HMJG 4BA0A 3NPVA 2F84A 4LCSA 4ADUA 3HFTA 3ABRA 4M19A 1RH9A 3SCNA 1B31A 3GBDA 2HISA 2A3CA 4QGCA 2G97A 4W8LA 4GBDA 2YGYA 4A05A 1G4EA 3UXIA 4IPPA 1DJNA 2G37A 3FS2A 3BTNA 1BEUA 1CXEA 3PAOA 3GB6A 2Z29A 1ZSXA 1TPH1 4YJ5A 1GOMA 4GGHA 2XVLA 3S2JA 1LM1A 4PMNA 1IT8A 2OT1A 5DCDA 3VD3A 2GDVA 4PRRA 4KMQA 1BWVA 1V6YA 1EHAA 3GBEA 5GPRA 1VFSA 3DFQA 3E49A 4XVEA 1ZP4A 3WENA 5ECUA 5A8QA 5CAHA 3S1XA 3KOFA 3H2NA 2VT0A 2XGBA 2WJDA 1WKFA 4PMXA 4JTIA 2VURA 2V68A 3VGEA 8XIMA 2DVTA 2OQYA 3TEVA 4AZHA 1UMYA 3PG9A 3V0SA 1IXPA 4KIEA 2H3DA 1BYBA 1SZRA 4P2VA 3WFAA 3S1UA 3VOGA 4XTIA 4W7WA 3SY1A 2V3DA 1TVLA 1S1RA 4XZMX 3GO2A 1PPIA 4Q4KA 4KT2A 1DORA 3CHFA 3EBVA 4OBRA 4KRTA 3WDIA 1IQ8A 2XN2A 1E5NA 1KBBA 3BW4A 5HDRA 2GGJA 3PZVA 4Y8FA 3R12A 2ZX5A 3LCHA 5KETA 3EMZA 1UB3A 3MA8A 1MQRA 2OODA 2Y85A 1JUKA 5HMDA 4W86A 4UNIA 4HMDA 3L66A 1HJWA 3LXAA 3COTA 2XM1A 1MO0A 3LSCA 3WH6A 4DAIA 1E6RA 4MYXA 3MMUA 4ZOCA 3TWAA 4K37A 3KBSA 3RRXA 1R5YA 1NVMA 1RALA 4Q4RA 3BQ6A 3ANUA 3W86A 1X6NA 4IL2A 3IJIA 3L65A 1FWSA 3OLEA 3VGGA 2WSKA 2YL5A 3OBEA 4EX4A 1TIMA 3V18A 2PDLA 4HA3A 1XBYA 4FZIA 2E09A 4FNQA 2GQ8A 2OELA 4US6A 1IR1A 2AMXA 1WUEA 4JAWA 1ZALA 1PX4A 1WOAA 3LX9A 3CIVA 1EJTC 3ARVA 3I6EA 2CU0A 3W27A 3UG4A 2B7PA 3NQGA 1DWAM 4Z1DA 1FH7A 2Y7EA 4N9EA 5DELA 3L0KA 4HQVA 1Q6CA 1F05A 4O0ZA 4MB1A 1Z9AA 1SO5A 1RJPA 1ZUAX 3W7LA 4TO8A 5HJLA 2CHNA 1BF6A 4B4FA 2VDIA 2ZC8A 1Q4NX 3E0LA 4GACA 1WAUA 2V82A 4FALA 4QCFA 5JXQA 4EIVA 2Y8UA 3BGAA 3W82A 1QI2A 2WMFA 3BK0A 1O68A 1JXKA 5HJXA 1BXCA 4J27A 5GJMA 1C91A 2E68A 2OWWA 3ZFHA 1ZU8A 5C8BB 1T99A 4GQQA 1ZAJA 3STGA 3VCCA 4HCDA 2Y5SA 3EZ4A 3TMLA 2WB5A 2WNWA 3BLOA 1Z69A 4JX5A 2FDMA 4I7UA 4NQ1A 1MUWA 1B3VA 4KETA 3WD0A 4RR4A 2D24A 1U1JA 3SBFA 3DHDA 6REQB 3GG1A 4RJEA 5K9CA 4PR4A 4HMEA 4I7WA 3SUWA 3ICJA 3N9KA 4I6KA 1P0DA 2PBGA 1F76A 3RAOA 1M01A 3B0PA 2BOFX 3T09A 2C8NA 1UJPA 2JALA 2WHMA 1ALDA 1A5OC 4MAZA 1RK5A 3TAOA 3B97A 5D2XA 3DN5A 1YYAA 2BMBA 3C0QA 4O53A 1F6YA 3F4VA 3VDHA 4V1YA 1SO3A 2HPIA 1OJXA 3IIOA 4E4UA 1TTIA 1BHGA 4DZIA 2RKXA 1TA3B 2A85A 2CLHA 4GO9A 5HAOA 3WJWA 3BCDA 3DC8A 4UFLA 1S39A 4HU8A 3E96A 2KZHA 3TKFA 3PBGA 4LBRA 4S3CA 2AGKA 4QSHA 4H41A 4HZ8A 3TXZA 4NVTA 4Q8UA 4L9XA 4C1LA 4LH8A 5FAJA 3UR8A 3LQLA 3FOKA 1VRDA 1A3XA 4AB4A 1B3XA 2FFCA 5TD4A 1BYCA 2HWGA 4V15A 1HN1A 1A5AA 3AU2A 1FP9A 2DVUA 2BXYA 5BWFA 5D05A 3BC9A 3NJ3A 3TQKA 4JBRA 2OZ8A 3U2OA 4WSKA 5LA0A 3GXTA 4B90A 3ZS4A 2OGYA 1R8LA 4L4PA 1BPLB 3CZ8A 3CEUA 3UA3A 2BNJA 3QLDA 3TR9A 1AFSA 3H2AA 1KM1A 2CWNA 4XD3A 4RW5A 2JIWA 4HYWA 3DX5A 1ESWA 3QY7A 2HV5A 2GJPA 2QCEA 5E93A 4LVFA 4W7UA 1NDZA 2VZTA 4E4PA 2R8WA 4ZQPA 2ZDSA 1RJRA 1XLHA 4LUSA 2FDSA 3BSGA 1E6ZA 2Y5EA 1K8YA 4BEQA 1V77A 4GUIA 1NY1A 3CT7A 5A5WA 5D2WA 4LSBA 5KEZA 1IYXA 2JKPA 3VYLA 1HJVA 3IACA 3UWQA 2QR6A 3U4FA 4AMAA 5XIMA 3MMDA 2DW6A 1A80A 2F7FA 5A2CA 3WF4A 1FP8A 3EPOA 4RE3A 4Q4SA 2JK2A 3W6MA 3WY1A 1NP2A 3NCOA 2WMHA 4XZIA 4FEZA 4HPJA 4C7FA 1RPXA 1A5KC 4UTWA 2FJUB 2VNCA 3VNMA 3STCA 3WQDA 5AYXA 3TC6A 3O06A 2OZ3A 1US0A 3ABQA 3SUVA 4WQ6A 4E8GA 1XCWA 3LN3A 1LLWA 3R8RA 1IGSA 2NXGA 4C6IA 1HKKA 1FWWA 1QNSA 4H9ZA 1NDYA 3O6CA 5CAKA 3DHUA 2C1HA 3AFBA 2ZRYA 1K03A 4CUCA 3KOWA 3T0TA 2VELA 4O54A 1Q8JA 3LLFA 1E9YB 4A8RA 4E8DA 4I90A 1VS1A 3SFKA 1AH4A 3L5LA 1FHLA 2O92A 1EF2A 4IT1A 5A8OA 2AMGA 1RZMA 3O7UA 1GEQA 3C2RA 1CEOA 1TWSA 4IUGA 1DIDA 1I60A 1KBLA 1KGWA 1W9PA 2J9YA 2ICSA 2VZSA 1B1YA 3LZ3A 3GYEA 4K39A 3CQKA 1B3YA 3GDRA 3GHSA 3W70A 3KBNA 1XUUA 4Z2GA 3T4WA 4Z42C 1KQZA 3GHTA 5REQB 2OB3A 2ZZ1A 2ATSA 3WD2A 4PMYA 4QQ3A 2A7PA 2BY3A 4AIEA 4AU0A 1Z7AA 4CKQA 1R6WA 4HZ7A 3V75A 2XWEA 1U5VA 3T0BA 3AXHA 4LYRA 3S6TA 5C71A 4N9BA 3PB0A 3FJNA 2TMDA 3AUOA 1Y5VA 1ONXA 1YPIA 4JQAA 2YBUA 1O12A 1EDQA 4B5SA 4AIBA 4R5EA 1P7TB 3KRSA 1MFVA 3QV9A 3VK5A 3MV01 4RNHA 2XM2A 3ARSA 2AAMA 3MC5A 4PMUA 3N2OA 1MNZA 3T40A 1NF7A 1CGTA 1MVYA 1ONRA 4MMWA 1WV2A 1CXHA 3LTYA 3V0TA 1A5CA 1DQWA 2E28A 3FYYA 3M7WA 3G1RA 4NP7A 3KUMA 2HCVA 2X8RA 4X61A 2YL6A 1FCQA 3EXRA 4JYEA 3GVGA 5AHEA 1V3IA 1XYZA 3VX0A 1KFBA 1L9WA 2WSYA 3OPSA 5DQPA 4H7CA 2C91A 4R9XA 1MYRA 3B3DA 3M0YA 4HYRA 1LP6A 4XIAA 4D8ZA 3FAXA 4B3KA 2YCKX 5CC6A 1XLAA 3BWWA 5D2TA 4FLSA 4IUOA 3VOJA 3DENA 3UXLA 4S3FA 4X9SA 4GISA 1R3YA 4JFWA 4HSOA 4ZMGA 1WDSA 4PCPA 1VCFA 1SVDA 3NTYA 3WQEA 4JN6A 1B9BA 4MPKA 3SDOA 1BXBA 4MLRA 3GSMA 4A4AA 4WKAA 4BCEA 5HXMA 4A8IA 1H4PA 4F3HA 4DJEA 3WLNA 4BWLA 1W1PA 3BCJA 1ZLPA 4EXAA 1WQ5A 2KAUC 1OGSA 1KBIA 1TTPA 1W5QA 5HPCA 1I2PA 1XX1A 4OUIA 5EU9A 4DRSA 5AHIA 3PK7A 3M41A 4GBUA 2VX6A 1EX5A 3E02A 3P0XA 1K9TA 5I3HA 3EDKA 2P88A 4BI5A 5FJPA 4LV4A 3EGJA 3QYQA 1XYLA 4GG9A 1VD6A 1TYGA 3DGBA 3E2SA 2YIHA 1R9XA 4L4LA 1TJ2A 4M7TA 4HNCA 3ALFA 3QHNA 1DQXA 3DC0A 4EOUA 1L8PA 4L61A 2E5BA 1RY0A 4WKHA 3EXSA 1GCYA 3I7SA 2Y7FA 4FI4A 2DPEA 1AQMA 4B92A 3PJTA 4B3LA 3O05A 2XYLA 4NZ3A 1PKYA 3UJFA 2E8ZA 1F8IA 1HG3A 2VWTA 1EA0A 2IKGA 5HR6A 4XAZA 4J3SA 3VX1A 1GUVA 1OFPA 4PMJA 5JH1A 2G3MA 3VOIA 2XIJA 4TVUA 1H60A 3S5OA 3M0MA 3XISA 4WUIA 4M51A 1US2A 2NUWA 4TXEA 4X0VA 4YVPA 3NQMA 4YMZA 4H9TA 3NGFA 2ZYFA 2L5HA 1RXOB 2WNNA 3W1LA 3TC7A 1Z3NA 3W7QA 1BKHA 4FX6M 4GKLA 3M47A 3ZOAA 4C7GA 4B4HA 1H1ZA 1W2PA 2HNHA 3IV8A 1TV5A 3ONBA 5TIMA 1SZEA 2ZUVA 3V1HA 4X63A 3VIKA 3UG8A 4ZQRA 1K8XA 2FH8A 2PWVA 2PU0A 3LPGA 4QITA 4S2CA 4EXQA 2A6LA 1SZNA 3REQA 1UUMA 1WA3A 1V0NA 3L4WA 4NAEB 2ANUA 4AY1A 1XIMA 4AHOA 1UKPA 2PDIA 4JN7A 3BLIA 5KZ6A 4XO7A 3QY8A 3V1PA 2C3ZA 2DH2A 4CD7A 3KZSA 5KITA 3M1ZA 2DZWA 3A4AA 3MW7A 3BLFA 3LM3A 3Q94A 4JS3A 1H2JA 2PPGA 2V8ZA 5DMNA 1JQVA 4YWSA 4YYFA 1EC9A 3SUTA 4CD6A 5IDIA 3B06A 2X2YA 4XKYB 4AF0B 2ESCA 1QNPA 3BLKA 3DYPA 3WO8A 6TIMA 3ES8A 2VQTA 3FDKA 3AS2A 3B4UA 3A13A 4CEXC 2J62A 4AZ7A 5HNRA 3WLRA 5MKGB 1E0XA 1E9LA 2QIWA 3LRKA 3WQVA 1W1ZA 3WMBA 3PFMA 1GVQA 5AKQA 3ZJKA 4LC8A 4FNSA 1EYWA 3DFNA 2VFGA 3UWZA 4AFYA 2JE8A 3LQGA 4JTCA 5DF0A 1JGMA 3CZJA 1V93A 2RDUA 2CLPA 2J9XA 4L6DA 2CLMA 1UR2A 4JXCA 2FHFA 4JFVA 2C7FA 3M46A 2G96A 4FLOA 1NAL1 1SGJA 4E2VA 3IAPA 5BNKA 1UR0A 1NFBA 2B81A 2CXEA 1C8XA 1D7KA 4IF2A 3FV9A 1LOQA 2REQA 2WV8A 4DO7A 1PYMA 2E9BA 4K68A 5L6UA 4RZ4A 1V3JA 1HFBA 4AWSA 1XH1A 4AZ5A 2V5BA 4XB3A 3EKLA 5CBIA 1IE7C 2H90A 2WZMA 3C0LA 3UYCA 1R47A 5LNRA 2YJQA 1B3ZA 1SU5A 4XV0A 3T05A 4ZTXA 3LCXA 3HMCA 3RRAA 1BFNA 4UTTC 3GKAA 3DDMA 1C8QA 1GW9A 1LT7A 3HTWA 4JIIX 5C55A 1SZGA 2JIEA 1GQLA 1EPXA 4OV4A 4CNOA 3NPWA 2A3AA 3W07A 2DZSA 1I2RA 3E9AA 4FS9A 4HN8A 5TBOA 1RA0A 2WXDM 1FDJA 3F2BA 1CGXA 2RDWA 1AZ2A 5A6BD 2OPJA 3TUUA 4R7WA 1RQHA 5EMJA 2E77A 5LNWA 1DTUA 3QHOA 4GCAA 3IVUA 1BQCA 2QZRA 3ARZA 4I9MA 4YTUA 1ISZA 2G0WA 4CD5A 4R34A 2F2HA 1ITQA 4WD0A 3G1VA 3W85A 1T8XA 4IX0A 4B2DA 5C2XA 5AN7A 3PULA 4RXFA 4TIMA 2DVXA 1KRAC 2VR5A 3MMWA 5I3JA 4QDMA 1LBLA 5G4HC 3M5XA 3TNBA 2XFWA 3OLGA 3CASA 1FWTA 4P8XA 1RCOB 4HB7A 1X1OA 2Z2UA 3LM7A 1WP6A 4B91A 3M4HA 2EPNA 4AYGA 1O66A 4JNYA 2JF7A 4G7EB 2WO5A 2QCCA 1MEWA 4UWMA 1CW2A 4H9VA 3UBPC 2VM8A 3G0XA 3UJ2A 4WKFA 1G94A 4LUTB 3CMGA 1OF8A 3L7RA 4LJ3A 3GVRA 1AW1A 4UQCA 4D2JA 2Y5JA 3G3DA 4U4MA 2X7VA 4Q4QA 1WZKA 3PWIA 4KWVA 2RGMA 1ICPA 4UCGA 4LBUA 2Z2BA 5AC4A 2X05A 1CXLA 1KFWA 1LL7A 3PZIA 4S3KA 4TVDA 3ABSA 5HNUA 4JGDA 3VINA 2Z26A 1QPOA 3DYOA 2HEJA 2XGZA 3IK2A 3B05A 3IJ8A 2V9DA 1GG0A 4TX9A 4GVFA 3WQGA 3E1F1 1IWBA 3AZTA 1OX4B 3B0UX 4GI6A 4OU1A 3A5FA 4DVOA 1GOQA 1F3EA 5CSRA 3URNA 3EOUA 1Q66A 2GOKA 3EMQA 4IIBA 4FNUA 3TTOA 1E6PA 2X1UA 4G9PA 4F9JA 4W4QA 3YPIA 1U1UA 4FIRA 4AEOA 3P3BA 3W02A 4DB7A 1T96A 5DBUA 5AYZA 4GRSA 1OIMA 1QBBA 3VVGA 5A3HA 2WPBA 1LT8A 1AJ0A 4PUUA 4WJXA 4QLLA 5KZEA 1J11A 4JIRA 1POKA 4GFSA 4WIWA 2VYOA 3A9BA 4Q7BA 3KOZA 1WDRA 2YA1A 3E0IA 1PZ3A 2A4AA 2X16A 2DQWA 4IISA 3PANA 3LHWA 1O5KA 7CGTA 4IG2B 1XIGA 1W9BM 4HJWA 4NZ1A 1ZJHA 3KL5A 2X42A 1MXDA 1EC8A 3PBUA 4GCXA 4HA4A 5A1AA 1TUXA 3PVFA 3Q58A 2OWXA 2ZZ5A 1KLYA 5FEWA 3ARYA 1Q13A 5E6YA 2W62A 4EWJA 1XPYA 3IVSA 1E6XM 2PDBA 1OC5A 3HQOA 1SR9A 1C3FA 3NL3A 3WF3A 3TU9A 3NDYA 4N6EA 4BF7A 4O8RA 1Q7ZA 5IHSA 3W4RA 3M5VA 3QFWA 4JKLA 2BZNA 5TAOA 1DJZA 5HR7A 4C6EA 4XKMA 3L21A 4FOUA 2G5WA 1XIHA 4Q8QA 4HD5A 3G1AA 1JZ4A 2WKJA 3PZQA 2FH6A 4IGNA 1KRCC 2PC8A 3RCNA 5BRPA 1PB0A 1AH0A 2W66A 4KCWA 4N02A 2Z1SA 2NVDA 1OK4A 4GUJA 4ZFCA 5IXEA 2ZX6A 2QMJA 3LSBA 2MANA 2XH7A 1KWKA 2ONEA 3BE7A 2DT0A 5DCBA 4PEEA 4ZOEA 3N04A 1J2BA 2BY2A 3C4UA 3TN3A 3TAKA 5HATA 5I7GA 1VFFA 4ZO7A 1PSCA 3BAXA 3VDAA 3H21A 4S38A 3SCTA 5ENLA 3TN4A 5CJ5A 3GIYA 3D3FA 4PGLA 1YDOA 5D02A 2VC5A 3APTA 3B0VC 2EGZA 1HTIA 4AXKA 1W9DM 2PDHA 4GKTA 4GJ1A 1PO9A 2PUZA 3MPGA 2YCLB 1A0DA 1C8VA 3SRDA 1QK0A 3NG3A 2FPYA 4RX0A 3U9IA 3IVTA 1ICQA 2J66A 4HTBA 3I7QA 1OF6A 3R7MA 2P0IA 4AWUA 4DWSC 1JD9A 3MJYA 1NEYA 4AZ6A 1ZPTA 4Q8TA 3POHA 4MIMA 3TN5A 3WBYA 3WQ4A 2F6XA 3CZEA 5AY7A 3ZM8A 1F73A 3R43A 3NZ1A 4EE9A 3LHUA 1VEPA 4UTIA 3MI6A 4YIWA 4Q8WA 1EYEA 3IS4A 1ICSA 4FF5A 4XAPA 5BXRA 1L2UA 5I3FA 2DZUA 3BO9A 4Q32A 4MHBA 3QQ1A 1QFEA 3GH5A 1AQHA 1Y0EA 3MDUA 2BP1A 5GQBA 1PZ0A 1QASA 3OEXA 1BQGA 4F8XA 1HIZA 3BG5A 4U10A 3DEQA 4RZ5A 5DT5A 1IIHA 1YIXA 3FK4A 4HK6A 2IKHA 4DBWA 1GOWA 4JFTA 3AIVA 3FX4A 2VOTA 3FJLA 3H53A 4QAIA 1GVOA 1OABA 3LBCA 4JIPA 1GYMA 3NA8A 4OIFA 1WUFA 2W61A 1UP3A 2ZTJA 3M43A 4XG1A 3TYEA 2A3HA 3QW3A 4IIFA 1OC7A 1BSLA 2IPWA 1DEDA 3GXFA 4J3ZA 1XI3A 1WBJA 3HZ3A 4PE8A 1EDTA 2ABBA 2AQVA 3NYDA 4BQ5A 4W7VA 4K2SA 1YNPA 4GK8A 4O1FA 4WCJA 2INZA 5M2FX 1BGAA 1K8ZA 1KM4A 1H7XA 3C8NA 1R3QA 3HJEA 1EA9C 4K7YA 3AISA 3G0SA 1V0MA 4LF2A 1V79A 5I07A 5HK4A 1BYAA 1QPQA 2X41A 3B8TA 2ZWZA 4AZCA 2V69A 4GVIA 1ISVA 3TH6A 3OVPA 2ZUNA 1VBRA 2X09A 4OE7A 2YXXA 5HANA 4MADA 2WVUA 4HPHA 1FTXA 4O4VA 2VD8A 1LF1A 2UZ9A 2PWUA 1QW9A 4J3XA 4FAMA 1J6PA 2DZPA 2YA2A 3ITYA 1B54A 3ZT6A 1CLXA 2XSAA 3VOHA 3N9SA 5I00A 4LAOA 1NQKA 1VKFA 3NQCA 4JX6A 3HJZA 1B9ZA 3MSDA 3TQVA 2F8QA 4GYPA 2PDJA 3WQ6A 1Q6GA 4UTKA 4Q8OA 1XW8A 4H9XA 3RHGA 1YRRA 4IQEA 1P0KA 4WR3A 5FI8A 3BSMA 4US5D 2AOSA 4M3PA 3GFYA 4E4FA 1JZ2A 1PCKA 2ZC1A 2GDUA 2GVYA 2HRWA 3QV8A 4GXPA 4GO8A 1VJIA 4YPJA 2R24A 4O0KA 2Z27A 3W76A 2GVEA 2IPFA 3F4WA 3VTRA 1UH4A 4MZ8A 3VC6A 4LVDA 1Q2RA 5HMEA 3FEQA 4EAMA 3G6LA 2QAPA 2OGJA 2QF7A 4K38A 1IZKA 5ABHA 4QP0A 2NQLA 2QUNA 2UV8G 5J04A 6XIAA 1KWGA 1J0YA 4LRSA 5LIXX 2O4MA 3W1XA 4ZO6A 5A6MA 1HVQA 4GYFA 1JDCA 1F6KA 1ADOA 4KESA 4JTFA 3FGCA 2IKJA 1X8FA 4IMGA 3KBMA 3EWYA 1G7UA 3OHIA 2PGFA 4D6CA 3TYDA 1YLVA 1L6SA 5H91A 2VRJA 3B9EA 4H8VA 1FWFC 1Y5XA 3F4DA 3MQTA 3MZNA 3UZXA 2GVGA 2WBGA 1OC6A 2XVPA 1JULA 2V2DA 1ZRQA 2Z00A 3P0WA 2OO6A 1UKSA 2EG6A 2X1TA 4KWUA 4W5UA 4PUWA 4UOQA 3SCVA 3TX9A 4PMRA 5I09A 3OP2A 2ZA1A 3EOOA 5AC6A 5LZLA 3OZMA 4XZHA 2PDYA 4JEQA 1W1IE 3ERPA 1YEYA 5A6LA 1CT5A 2C16A 3VC5A 3BOXA 3W7DA 4GY7A 1M1BA 2YDSA 5FAGA 4UQ9A 2ISVA 4G7FA 4K7VA 1C92A 1F07A 4IJBA 4UBPC 4DEFA 2WM1A 3LXBA 1DP0A 2PLKA 3FIGA 1TMQA 2EJAA 1OD0A 1TRIA 2Z0IA 3QV7A 4XD5A 2ZWYA 1O94A 1HP4A 3DZ1A 4QE1A 3MWCA 3WUBA 2GWNA 1ECEA 4P61A 4F0MA 3KVJA 9XIMA 3V35A 3N6QA 4JICA 1MW3A 4GVGA 3NZQA 3KRUA 2SFPA 5FEXA 1GTEA 2J25A 3F4NA 1W9UA 4C60A 4UFJA 1A47A 2I7GA 1G0CA 2XIQA 5FSEC 2ZADA 4MKVA 4O15A 5PTDA 3R11A 3JZEA 2PF8A 4HTYA 2WVSA 3MBDA 3VUSA 7TIMA 4NRSA 6REQA 3IAQA 1R3WA 3UA4A 5EMUA 3R1ZA 5E0KA 4O17A 2KX9A 2OSYA 3USZA 1XDJA 3LHTA 2WCGA 4QXIA 4X9YA 3RM8A 2YR1A 1JGIA 2O56A 1JUEA 1E73M 3PSVA 1XICA 3B9OA 3TW7A 4I9JA 2I9EA 1JQXA 3FXGA 5AC7A 1KM0A 1PWMA 2W6RA 5I5RA 4JHOA 5CEWA 3HIJA 1F4HA 1AZ1A 4ML4A 3KAOA 4QTGA 4C6LA 3B0YA 1ITCA 2YOCA 3VZZA 4XSMA 2BVTA 1I2OA 5DXYA 1KCZA 3IIXA 2DV0A 1Z42A 3QYSA 4GFIA 2YLLA 2DEPA 3EB2A 2GGIA 5CGTA 2OOFA 4D1JA 4O1AA 2VKZG 2PDNA 3VIJA 4J28A 1U33A 4UQAA 3GTXA 3KLKA 2FZ8A 5D9NA 3DU0A 1FWJC 2OG9A 4TR9A 3R79A 4LUSB 5EY5A 1R3VA 4FR1A 4DO5A 2GGGA 1BTMA 2DT2A 3QFEA 1KNWA 2YZRA 3BV4A 3MCOA 5C2CA 3IUIA 3G77A 1R87A 3MP5A 1U30A 1TJ0A 3HG2A 1XYCA 1RSCA 3AIQA 1ELSA 3LCWA 1J8VA 4G8TA 2BGQA 3G1YA 3KRBA 2PD5A 4MDOA 1ONEA 1T6MA 5C7HA 1G4PA 2V2HA 1OY0A 1E1EA 1KFEA 2BS9A 1MRAA 1YBQA 2PRHA 1CB2A 3BV7A 2BASA 3BPWA 2DJLA 3IRDA 3PJUA 1C90A 1M3UA 3GYCA 4LW7A 1KB3A 3AWNA 1C8YA 1KTBA 3NR0A 1G01A 4DUWA 1OGGA 3QGAC 3BW2A 2YPIA 1TPUA 3BDKA 2QAFA 4JYDA 3AC0A 1SFSA 1A53A 4B15A 4ADTA 2NX3A 1W32A 4QROA 4XZBA 3FY1A 3TYCA 3UW6A 1SW0A 4ACYA 5M03A 3AMKA 3IWPA 3IK4A 2FVKA 3MT1A 4LT9A 1WE5A 3GH7A 2X0SA 2DORA 4XQ6A 2C1IA 4HK7A 3AICA 2VGFA 6TAAA 4ERGA 3N13A 1V3KA 4GWEA 1HKIA 3GFZA 1JRBA 4JQ2A 4DY1A 1XRSA 3K4AA 5E0CA 2ZRUA 4S3JA 3EX1A 3ONCA 1T41A 4PULA 1H3GA 3CMJA 1JFXA 2RGLA 2WW5A 2WK2A 1TWDA 5G2HA 4LANA 2RUSA 3CBWA 1OGBA 1YTDA 3JW7A 4A2SA 1P6CA 3H70A 5D2YA 4RV3A 1UR1A 4BY3A 1F5ZA 5TQLA 4QG8A 1KA9F 3NIYA 3PPGA 3AWOA 3K13A 4UB9A 3AYSA 5D4YA 2ZICA 3KBWA 1RCXB 3ZYZA 1X1ZA 2Y6ZA 4HHMA 3TJLA 1EZWA 2NLYA 2IQDA 1KW1A 4AH7A 3NO5A 3TDFA 3N3TA 4AZIA 1RA5A 2QDGA 1Q8AA 1XXXA 3BOLA 3AMCA 1JPMA 3GW0A 5BMWA 4N9CA 3P81A 5REQA 3TMQA 5T91A 7PTDA 3BARA 3T44A 3I68A 4Q33A 1GVRA 3ABXA 3WNNA 1XLGA 1J2WA 1PUDA 2VRKA 3QBUA 4LS0A 3PNUA 1FDZA 1VQTA 3TE9A 1G69A 4HVXA 4K1GA 2PS2A 3LCIA 3EOLA 4IP7A 2PDCA 2RDTA 1EUNA 2CEQA 2ISWA 2IW0A 3JZUA 5DY2A 3II1A 1Z6KA 1CGVA 2B7QA 5EKYA 2OQHA 3I6TA 1P7TA 4PTXA 1QPNA 3QTGA 3GW3A 3UNTA 3WKZA 2GK1B 1D3HA 2CBJA 3LGDA 3GM8A 1XLIA 1OBAA 3AXKA 4QX4A 1R9ZA 1ZL1A 4IJCA 3DGRA 1V02E 1H5YA 1GW1A 2XH4A 3CNYA 4XUYA 2FTYA 4ERAA 2VL4A 3DBPA 2WQDA 4Q6JA 3UPBA 4EKJA 2BODX 1DJWA 4C6CA 3VZXA 1EF3A 4UFIA 2VVNA 4O16A 2Y4SA 3W29A 1JDFA 5EMMA 4MFEA 4YLWA 4JZ5A 2CERA 2O7SA 3GD6A 3TZNA 2EPOA 2WWCA 5A94A 4YN5A 4AZBA 4RKAA 4HK5A 3A21A 3OGRA 4K1WA 1MEHA 4R53A 4UXDA 2Z6JA 4S3AA 3DFOA 3FCPA 4MM1A 4JFUA 1JR1A 4ZXOA 1G67A 4LFYA 4DELA 3NNTA 3U2ZA 1PWLA 5GNXA 1B3WA 2ZFAA 1US3A 4MB5A 1A0CA 1CGUA 1P0NA 1FWNA 4O18A 1TVPA 2XUCA 5AHLA 4WHBA 3VA8A 2NV2A 3L9CA 2A5HA 2FQIA 5BXTA 4DPPA 2E6YA 4I5UA 4LF1A 2PZNA 3LUTA 3DBNA 4N4QA 5C9WA 3G1SA 1O5XA 3TJ4A 1XKYA 2VDGA 1FWCC 1IZJA 5BOFA 4F0LA 1F3XA 2HZGA 2X30A 2XFYA 3CLMA 4UTUA 2TYSA 3DYMA 1RD6A 4H2HA 3N19B 1E15A 4DZAA 3WNPA 4MOZA 2C0AA 2UBPC 1UUQA 2PDUA 2IS7A 3VOFA 4GJJA 4R7OA 4PUJA 2ZVRA 1V5XA 4Y9OA 1J96A 3LHYA 1LQ2A 3TTYA 1M03A 3KL0A 4PC8A 4GJIA 5CKSA 4TMCA 1XSJA 1M7OA 2EBNA 3F5JA 3IJ7A 1E43A 3DOPA 3KE0A 4LUIA 1Q6QA 2QV4A 3E2VA 2EF9A 1J93A 4L4MA 3G3MA 4WY0A 4FK9A 2V3FA 4L56A 4ATLA 9CGTA 2ALRA 4H6EA 1IF2A 3ALGA 5EB8A 2DH3A 4MZ1A 5GVJA 4DBSA 2CFFA 2B7OA 4ORIA 2CBIA 3DKJA 4LALA 1DPMA 3W83A 2QDDA 3TZFA 2VC6A 2BV9A 3TYBA 3ARQA 4ZB2A 4E3VA 5DXXA 1EDGA 4AMCA 1UD8A 3REQB 1QO2A 3W1QA 8A3HA 4E38A 2E25A 3AROA 5IHRA 1IXOA 5HNTA 4PUEA 3N6JA 3RPDA 2XN0A 2GFTA 3OVRA 3UXAA 1JFHA 4F4RA 2VXNA 3WF0A 2OTDA 2NXIA 1VFMA 1LG2A 3NM3A 3GLCA 1F3TA 2VGBA 3IUHA 2PFHA 3SAZA 4K8GA 4UZUA 3ES7A 1BVWA 2Z4GA 3TTEA 1PXGA 2A3BA 4TV5A 1PHQA 4CEUC 3CQIA 1W5MA 5LIUX 1RY8A 4ZGYA 3ELFA 4ZZ9A 2JKEA 2HBXA 4A29A 5HJYA 4MWAB 4CU6A 4JQ1A 4H8UA 2QVNA 3VD9A 1HT6A 4A8NA 4NZFA 3UZWA 4NAEA 3AUJA 4AC1X 1K77A 4F79A 3L23A 3CWNA 2GL5A 3QY6A 4IPIA 3P5YA 4AZGA 2GGEA 1HKWA 3VM7A 1JZ8A 3F7JA 5JU6A 4HOWA 1V6VA 2VWSA 3WD4A 4M6PA 3VIHA 2YKKA 4A6GA 2I5IA 3MI2A 5FCZA 2ASHA 1N55A 5LXXA 4E5TA 3CH9A 2HTMA 1WYIA 1D9EA 4IMFA 3NM1A 1GPFA 1LROA 3SCUA 1TV3A 2V3EA 4DJED 3SCRA 3P67A 4UTMA 2BTMA 3EX3A 1JEZA 1TTQA 5U4NA 3KVLA 1LRQA 4J35A 4KGLA 3STFA 1TQXA 5CZSA 2NX1A 2J47A 4W9TA 1JDEA 3VE9A 4YYCA 3P2VA 5MKGA 5CPNA 2MNRA 2YCIX 3UR5A 4I3GA 1FWHC 3RLGA 1JD7A 3WQ8A 2CLIA 4AD4A 5C54A 1N8IA 4D1IA 2PWGA 1LORA 5T9BG 2A0NA 3ZSTA 4G5DA 5A8GA 3N25A 4LV9A 4ZQNA 3W75A 1QBAA 1YMYA 4UQEA 3SSZA 3TK7A 3APGA 1UG6A 1I0DA 1OM0A 3VGHA 3C6CA 5M5DA 3QMSA 2AL2B 1JF5A 1O6IA 3GG7A 4DZ5A 3W22A 3SO7A 4TVCA 2J7DA 4HMCA 1KV8A 3KOYA 3TFXA 3S9ZA 2G95A 3AS0A 3L67A 3DFSA 5BRQA 2D69A 3EDFA 3A12A 2QDHA 2J27A 3ARUA 3GC5A 3BVJA 4A22A 1CIUA 3AIRA 1BF2A 1PIGA 5CC5A 4TTUA 3SCPA 4F66A 1K3UA 2QEZA 4QDPA 4H8HA 1E6NA 5D9MA 2WBKA 4XD6A 1Z8AA 4C6QA 4JEJA 1TV7A 4ILSA 1TJ1A 3CO8A 3DESA 2YZ5A 3NFUA 2D3LA 3GXPA 3AMGA 2VX5A 4IFKA 1O60A 3EWXA 3NEHA 3VABA 3CTTA 3THAA 1XDMA 3LBOA 3FNDA 3TYZA 5HMFA 1OINA 1QNQA 3K8KA 2EO7A 3M0XA 1W8SA 4H1ZA 4LEQA 3H6OA 1J5SA 4LY4A 4AIUA 3P8JA 3CTLA 3G8EA 4UOJA 3FKKA 4XAGA 3ZO9A 3KTCA 2E9MA 2E1WA 3G1FA 2XN1A 5JIPA 3UGRA 3QPYA 1Y7VA 4F0SA 3IGXA 3IUDA 5K3VA 5D9PA 2GQ9A 1UBSA 2VFIA 2VGIA 1MMFA 3CL7A 2QHAA 1Q6LA 5AHMA 3UWEA 1QI4A 4P7QA 4YNGA 3WQFA 1V51A 3T42A 2H6RA 1NDWA 2E8YA 4FLRA 1SPQA 3AZRA 3VNDA 1O7AA 4HOXA 4LU0A 4DF2A 2OEKA 4G7EA 1B4EA 3HOJA 5CPSA 1OX5A 2GQ3A 3KTXA 2CBUA 2HROA 1FVPA 4XZLX 4J7RA 1N2VA 1JAKA 1EJWC 1XSKA 1KCXA 4IIDA 1JDAA 3DXIA 1EEXA 3CV6A 5D30A 2D1ZA 2DIJA 1NWTA 2D23A 1AA1B 3K2GA 3BJFA 2WNZA 4P7LA 2ZCGA 2V5JA 2C79A 4GQGA 3WQPA 1V6UA 1VFOA 1TMHA 3B4YA 4Z2IA 4YHEA 4BQ4A 4YCOA 1UYQA 2VEKA 4EAYA 3O3RA 1ME9A 2FIQA 3C2VA 3KWXA 4EWND 4Q7IA 1UP0A 1ZGDA 5FD0A 2C71A 3H4GA 4B5WA 2NLIA 4RW3A 1FWEC 1E3XA 5FESA 1IWPA 2PTXA 2D2OA 4QJ3B 1F9CA 1TCMA 4UTHA 3N14A 3STPA 3W28A 2GVJA 3DCPA 3LTSA 3DI1A 5ABFB 1QHPA 4JX4A 3W7JA 5HULA 4Z0SA 5BMXA 4UQDA 5AC5A 1A5UA 4WEVX 4UNKA 1EB3A 1GONA 4IPJA 1ADDA 3GR8A 4Z17A 3OA5A 2WJFA 4NY2A 1TX0A 5CPLA 2VUYA 2WC7A 4IL0A 3AYRA 4M80A 3M0ZA 4WVXA 4PODA 5GNYA 3AZSA 1BVZA 4DJFA 3TA6A 1L6YA 4O4WA 2FYMA 1QTWA 4IG2A 1CCWB 2CKSA 2R91A 2H8XA 4D8LA 1UBPC 3SSJA 1I45A 4IGSA 4ZR8A 3UPMA 2C19A 3AQUA 1ZTVA 4B2DD 4KFOA 4LB3A 7TAAA 3SRFA 4FXRA 3VD4A 3TROA 4NXKA 2QW5A 2QCFA 3THQA 3HM7A 3RR4A 4CQAA 3LCGA 3QN3A 3VIFA 4H2CA 3S42A 3L4VA 3M0HA 3F4CA 3V0UA 3U57A 1TVNA 3WEMA 4E3TA 3BOFA 3CL6A 1E4LA 3F2CA 1FXQA 1E70M 1XIBA 1QNVA 3HQ1A 3CZLA 2A1YA 4QCEA 3GRIA 4KBXA 3MHUA 3IEBA 3OYXA 1ZS2A 1QXLA 1X1NA 3RLVA 3UP8A 3VPLA 4TQTA 2G3JA 2DSKA 2NW0A 3LGGA 1ITXA 4LYKA 1OD8A 3TFCA 3GNDA 4BWLC 3MU7A 3W2UA 5LIWX 2QKFA 3ZT5A 1G4SA 3ARRA 3VIOA 4S3BA 1V0KA 1QMLA 3H7RA 3UNDA 4JKKA 4PTWA 3ID7A 4YHGA 1P48A 2QYGA 1XIEA 5LSMA 2V6AA 4ICNA 1UASA 4NG3A 1BRLB 3WK3A 4A3RA 4JTAA 2IPJA 4R27A 3AJXA 2BB0A 3B9NA 3CIWA 4AQLA 3LV5A 2YCLA 1M68A 3ECQA 2QPXA 5IOBA 3G1DA 2CZVA 3IANA 1IXNA 5BOOA 2HE5A 5M1TA 3DIPA 4UIOA 3RX4A 5CJMA 1JAEA 2WVTA 4V27A 5AVNA 4HGXA 5FJUA 2DY3A 5HQEA 5JH2A 1PTAA 4FSAA 4KWWA 1IWAA 5LGZA 3QMRA 3HG5A 3PSWA 4FX8A 4ZL1A 1BD0A 1KQYA 4G1NA 4KFNA 2BGSA 3BAKA 4BS0A 2DQXA 3CMFA 4WOQA 1BKSA 2OLAA 1L6GA 4KQNA 5GNZA 3VGDA 5A6AA 1DWGM 1VBHA 1GQJA 4DIAA 3CB8A 2PTDA 3OHMB 2HBVA 4OWGA 1H62A 3PTQA 2WNQA 1IV8A 3NQAA 2BOEX 4N6FA 2PDGA 3LHZA 4AZCB 5A2BA 4OECA 1VC4A 2G3FA 4CN4A 1QI3A 2NXHA 4DN1A 3SZ8A 2YW4A 4H7ZA 3S6OA 1WNOA 4LAKA 3VNZA 4F0HA 3WEZA 4DHGA 4AY7A 3RUBL 1MZHA 5K4XA 1S3TC 3QZEA 2HXTA 5DMYA 1R3TA 3PFRA 2EXOA 3AS1A 4X22A 1TPEA 3AHVA 3OODA 1OHLA 2YCEA 2WMIB 1UD4A 1HL9A 1GTHA 3AAMA 3ZQ9A 3CHDA 3IJQA 3EX4A 3WUGA 3LCFA 1DE5A 1WKEA 1M53A 4ALDA 4EPBC 4DAFA 1O1ZA 3AHTA 3A22A 2YA0A 2POTA 3ITGA 4EF9A 1SSDA 2E6DA 1AQ0A 5LIKX 2I17A 3BG3A 4U5IA 2OLSA 4GUHA 1KFCA 2D2JA 4XAYA 1OVDA 2PWEA 1T7LA 2D2HA 1FKXA 3H2OA 4PTMA 1TQJA 3MYOA 3WG6A 3GKFA 1BSIA 1OZMA 1VIZA 3TN6A 4Z08A 1V3MA 2ADAA 4M82A 4D6DA 1JYWA 3CC1A 5JBDA 4A2RA 1RVGA 1S46A 3RO6A 2OX4A 5K7JA 1MUCA 3N15A 1FWAC 3GVWA 3EEGA 1UWTA 2PGWA 4AW7A 3PJWA 4L5ZA 3HPSA 2FGLA 3R25A 1ITUA 1U1HA 2BHYA 2VEGA 4BI6A 3C2YA 4NU7A 4DO4A 1P6BA 2Q09A 3FGCB 4LAMA 3UD6A 3O15A 5H8UA 4U33A 2VCCA 3V3WA 3UCQA 1F3WA 2PMQA 3U5UA 4KFPA 5HPOA 1MNSA 3KL3A 4QBXA 2VZVA 7ODCA 3GTNA 2ACQA 4A8LA 1ISYA 4U31A 4XUGA 1Q7QA 2WKGA 4GZIA 2JEPA 3W72A 2NQJA 1EGMA 2PTYA 4LYPA 1UIOA 1EBHA 4C6MA 1JG9A 1XLDA 2E9LA 1M04A 1WDQA 2PP0A 5FJRA 4QISA 5CPMA 3FYPA 3WJYA 4FXFA 4JTHA 5F2LA 1F2JA 1QR7A 1EH9A 3VNJA 4U5KA 3NPUA 1UHVA 3N6HA 3FSTA 5BOEA 2O4QA 3RN6A 3GR7A 2XIIA 5ABEA 1GEHA 4FOKA 1HKJA 2ZZ4A 3Q65A 4DF1A 4DZHA 3MO4A 5CXPA 4FP1A 3UFYA 5JMUA 4JQ3A 3N2XA 3C3NA 4AVOA 2NWRA 3RMJA 2WWDA 4BQ2A 2IXVA 1TPWA 2FVLA 4WGHA 4LAUA 5D2VA 1MW2A 4BKNA 3MWAA 3CM4A 4ZQMA 1Q6EA 1HNYA 4RUBA 3TWBA 3LY0A 4M56A 3EMCA 3P80A 1J0HA 1ZCCA 4RDWA 1MRQA 4H00A 1AW5A 4WK9A 4C7DA 1EO7A 1B0IA 1H0IA 3KVKA 1H09A 4NHVA 5E0FA 1TZ7A 1U22A 3NURA 4C1NB 4V2XA 3WSUA 3WH7A 1R86A 3ITXA 3MKVA 3BH4A 3MO7A 3R4IA 3PF3A 3IGSA 3OQEA 4XISA 1K9DA 3QR1A 1XR2A 1WDDA 3AS3A 4XBSA 1RQEA 1GZ1A 2EEXA 3N4AA 1CECA 1JCNA 1XGZA 4IGHA 2E6FA 1VEMA 4N2YA 1J4EA 3LK6A 2VOMA 3EYPA 1FRBA 5CCZA 4CNNA 3UY7A 3RK8A 4QJ4B 1K70A 4IXXA 3FA4A 5IM51 4NKCA 2YSWA 1XDLA 2NX9A 5FL1A 4LBSA 1ZHAA 3RIKA 4DI8A 3I4KA 1W3KA 4HHLA 2UWFA 3CAVA 4JD4A 1D7FA 4H9MA 1M9HA 4UTJA 1CPUA 2QUUA 4GNKB 2W67A 1V4YA 2CXGA 1HXJA 1HL8A 3RMEA 2WLZA 3NVTA 4CQDA 3MSGA 4RNJA 2NQ5A 5LHFA 2OO0A 1W37A 1VPYA 4P7RA 1R2RA 4XTDA 3A4WA 2WZEA 3KZPA 3UEQA 5I0DA 2QJGA 1V6XA 2RDXA 3GVVA 1UA3A 3ZR6A 2FVMA 1XQKA 1E6QM 2J79A 1QATA 3PG8A 1OT1A 3CGTA 1VR6A 3T9PA 2J88A 1PVNA 1EWEA 4ENLA 3C2FA 1HJQA 3GWQA 3QJAA 3WNMA 1L0PA 2PDPA 2YW3A 4PBFA 2XVNA 1UZ4A 1UMLA 3A3HA 2CETA 5C7VA 2GJRA 4H04A 5HNNA 4AVNA 3LYEA 4HCHA 3E0WA 4L1WA 1G6CA 4E2OA 4TX6A 3DHFA 2FZ9A 4QHRA 4JTDA 2G3NA 3PZMA 2X40A 3DFPA 5F2IA 3P61A 3W23A 4O10A 2Q3OA 5A95A 1YTEA 4JNZA 1HF6A 5FSDC 3CS2A 5D38A 3F2DA 3CZGA 3CU2A 1W1VA 1LL4A 4JN8A 4D8AA 3UJRA 4GPNA 1YBQB 5B7YA 2VX7A 3RM4A 2FPTA 1AQFA 1K6WA 1OB0A 3PTKA 2DZBA 4JTLA 4DJDA 1EO5A 4C6OA 4HOZA 4JL1A 2WYSA 1JIBA 1T8QA 3WLQA 2E4TA 1JI2A 1ODZA 5D37A 5HQMA 1E0TA 5DMMA 1HW6A 4IPLA 2AQOA 4ZODA 4DWSA 4UQBA 3MUCA 1UWRA 3A4XA 1RBAA 3E5BA 4R33A 4ZSUA 4CNSA 3P60A 4NJJA 1TZ9A 3RDKA 2CZFA 3KXQA 3CUIA 1DJYA 1GVSA 4B9YA 4YVXA 4GY1A 1OADA 2Z6IA 2I5QA 2J77A 1QOQA 4H9YA 4HPGA 2PDKA 4IP5A 2WM0A 3KOXA 4XO6A 2ZBTA 4JDBA 1JXJA 3WLOA 4MB4A 3W7CA 1XGDA 4IQLA 3GIQA 4FMVA 4ZTYA 4QRNA 3PR2A 1YADA 1PV8A 1R9YA 3SJNA 2Y7DA 2C6QA 1MQQA 4OT7A 2Q3RA 3SN1A 5H2ZA 1WOBA 1Q85A 2VJXA 5AYIA 4JTRA 1KR0A 4QLKA 2E0PA 4JY8A 1VP5A 4ONVA 1XLEA 1ODUA 4PCTA 4TX8A 1QRQA 1GGOA 1XYBA 3PP7A 4WSHA 2OZTA 1ZAIA 1B5TA 3K8LA 4PTNA 1L6WA 2VO5A 3O6DA 3RLHA 2BXVA 1GPWA 2PC4A 1FWIC 3S46A 3KFTA 3LLDA 3TSBA 1U2YA 3MCNA 4FOJA 1ISWA 1OSEA 5FF3A 2PODA 2ZX7A 4ACZA 3UG3A 1POJA 2YBVA 1TV4A 1TELA 3BGGA 4MPQA 3QLLA 3VD7A 3GDKA 3BZJA 4H6RA 3W2LA 2Q8LA 2J9ZA 1J9YA 3MI3A 1UZ1A 2VMFA 3W1TA 2VEPA 3GNOA 3MDWA 1X98A 1R3RA 4FXJA 4HSHA 4MDPA 1G9HA 3FKRA 6A3HA 1N8FA 3VGBA 1T5AA 3GFXA 2VDHA 4MNMA 3UY8A 1UD6A 4F2UA 2PD9A 4Z0JA 1VB9A 1EP3A 5DRIA 5DANA 3S83A 2PAJA 1FCUA 4JCLA 3ZLGA 1JZ3A 2A6NA 2PTWA 2ON3A 3GNNA 3M64A 4HNLA 5I23A 2EG7A 3N3MA 1XRFA 1JJKA 4IX2A 2HMCA 4BK9A 5E9AA 1QOXA 3H4XA 3IIPA 3KLLA 4EPKA 1W8GA 3OQ8A 2DSUA 1DQUA 5AECA 1S2CA 1W5OA 1DXIA 3WUEA 3QXBA 3KWSA 1LWIA 3GG8A 1XIDA 2ATMA 3ZVIA 1SJDA 1UIPA 3Q4DA 3HO8A 4KH2A 1BWKA 3VMNA 5CH9A 2GK1A 4JIHA 3RITA 3P7YA 5I3DA 3CL8A 3WLKX 1FWBC 1A49A 2WSPA 3Q2DA 3RXZA 4FNTA 4I5RA 1X97A 3WJSA 4GGBA 1J10A 1RD5A 4XIMA 1XGEA 3LS9A 2VUNA 1S2UA 2Y7GA 3G18A 3IJDA 3P74A 2CIPA 3O16A 3W26A 3BW3A 1OZQA 5JBFA 3L2IA 5HBFA 2GZXA 2PGEA 4UR9A 2HS8A 3CQ0A 3MHGA 3P8IA 4NX0A 3IARA 1S5WA 2QCLA 4HHHA 3SCOA 4S39A 1XRVA 3LLXA 2CW6A 2DZAA 1YE4A 4QNWA 4AYSA 2BVWA 4KEVA 1WZMA 3S2NA 4AHQA 1GYNA 3WDPP 3L4XA 2EJ1A 1UKQA 4ZBCA 4E8CA 2HVOA 2V3GA 5HWMA 3W7RA 1AVAA 4MSSA 1H63A 2H8ZA 3MVTA 4AISA 3W1MA 2EHHA 1DL3A 4H8NA 4HIBA 1EOMA 4TUFA 1VBGA 2W4XA 3WLJA 3NXLA 1DVJA 1G5AA 1RJQA 1Z48A 4RCXA 4GQBA 3IGHX 4PSRA 1FX6A 3NQ6A 1R7AA 2BWGA 2WOQA 1QPKA 3GXIA 1X96A 2HXUA 2XIOA 3CPUA 3B04A 4KPLA 3EXTA 5C0QA 2FMNA 8XIAA 2BGNE 4WY0B 2OYMA 1O5RA 3DERA 1YE6A 3EDJA 5DEZA 3K46A 2ZA3A 1LZOA 1PKLA 1VYSX 1CBGA 4IOTA 1KXQA 1HJUA 3KRZA 2VENA 1NM9A 1TIWA 1VZWA 3P5ZA 1VYRA 1AL7A 3C2EA 2P50A 2UY2A 1X39A 1YPXA 3R10A 3UGVA 1RAKA 4OFCA 4J2MA 1RCQA 1TPVA 2R1NA 2W0UA 4JTTA 3THUA 5LNSA 1ZBKA 1RV8A 1LG1A 4FIQA 4U3CA 1LQAA 4W88A 3CWOX 1H7PA 2P8BA 2Q02A 1H41A 2ZZ2A 1LTDA 4O8AA 4Q22A 1YX1A 1SJAA 1SO6A 4NIRA 1OYCA 4MZYA 2J74A