3KS6A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 1.80 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
GMTRIASHRGGTLEFGDSTPHGFTATAAMALEEVEFDLHPTADGAIVVHHDPTLDATTDMTGAIVDMTLAKVKTATIRYGAGSHPMTLEELCALYVDSHVNFRCEIKPGVDGLPYEGFVALVIAGLERHSMLERTTFSSFLLASMDELWKATTRPRLWLVSPSVLQQLGPGAVIETAIAHSIHEIGVHIDTADAGLMAQVQAAGLDFGCWAAHTPSQITKALDLGVKVFTTDRPTLAIALRTEHRMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (17743486) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.80 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Hydrolase
molecule keywords Glycerophosphoryl diester phosphodiesterase
total genus 85
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ks6A00
3V1HA 2FJUB 4I8YA 4I9JA 1DJHA 1QATA 4Q6XA 3RLHA 2OR2A 1XX1A 3NO3A 2OOGA 1DJXA 1PTGA 3L12A 3I10A 3KS5A 4F2TA 1AODA 2PTDA 5T9BG 4F2UA 1DJYA 1PTDA 4S3GA 2PZ0A 3EA2A 4R7OA 3EA1A 1YDYA 3RLGA 4OECA 4QJ4B 3OHMB 2OTDA 6PTDA 4I9MA 4F2BA 1DJWA 3H4XA 4QJ5B 5PTDA 3KS6A 1T6MA 4QJ3B 1DJZA 2ISDA 1VD6A 2ZKMX 1QASA 3MZ2A 3QR0A 4I90A 1ZCCA 4RW3A 3V18A 2P76A 1O1ZA 3EA3A 3PTDA 7PTDA 2PLCA 4I9TA 4PTDA 3QR1A 5T9CE 4RW5A 5T91A 1DJIA 3H4WA 3CH0A 4GNKB 4RV3A 3V16A 1V8EA 1GYMA 1T8QA 2F9RA 3QVQA 1DJGA 2O55A
chains in the Genus database with same CATH superfamily
2AOSA 2P50A 1AL8A 5CCZA 1UC4A 3JZUA 4FZIA 1JYWA 1S38A 3A3XA 2QCEA 3V75A 4GE8A 2PGFA 4QS6A 1EQPA 1HN1A 1V3IA 4LUJA 3QBUA 2VZOA 1F6YA 1XIBA 4L4LA 2FH6A 1G9HA 1ADDA 1OEPA 1W8GA 5JU6A 5REQA 3CM4A 1U1HA 4UZSA 3LRKA 3LG3A 1FXQA 4J9JA 4X2PA 4WRHA 4OGZA 5BRQA 3ONBA 3CL7A 3SGZA 1ZAHA 1UD4A 2VZTA 2OODA 1QPOA 4IPLA 3OBKA 4LC6A 2Q3OA 1K8ZA 3I10A 4OUIA 3LCFA 2VL4A 5I79A 2PC4A 3KTCA 4QQ3A 3B8WA 4CVWA 2PA6A 2F8QA 4W85A 3VGFA 3ES7A 2J25A 1JZ2A 3EPNA 3GO2A 3AXXA 1AMYA 1Q2RA 1GEHA 5CPTA 3IACA 4Q3MA 4BFAA 4AD2A 3CUXA 3N29A 1MEIA 4LALA 4EWND 2QCDA 3DIPA 4F79A 2WW5A 4XAPA 3V5FA 2FVMA 3WX7A 4BQ3A 3SY5A 4AMCA 4LPCA 2DT3A 5J5RA 2PUZA 5BW6A 4V27A 3B8VA 1L6YA 3JR2A 2P3ZA 3WLHA 1OY0A 4BEQA 4GYJA 1XW8A 4JIIX 5C2XA 4H9MA 5ABFB 1EFZA 3DHFA 3K46A 3PBUA 3H7RA 4JHOA 3G6LA 3SM0A 3MJMA 3DFSA 2GVGA 1SJDA 4UWMA 3WD3A 3WNLA 5HNRA 3BE7A 4UUIA 4LS0A 1JR1A 1Q63A 3GC5A 2IPJA 1WUEA 9RUBA 4GXPA 3IUDA 1QXLA 3UWZA 3IIPA 1PIGA 2J7GA 2PBGA 2B31A 4O1BA 4BKNA 1EIXA 8RUCA 2E25A 5F4SA 5HR7A 1W1IE 4PN2A 2G96A 1J0IA 4GH1A 5JBEA 3HG2A 4UCGA 2AL1A 2WHJA 3T0CA 1JZ5A 1SM9A 3O8AA 1G69A 4Z1CA 4DRSA 4OJYA 2PDMA 4WJ8A 4BI5A 3EDEA 1XLDA 1OSEA 3MT1A 4ZODA 3BC9A 3BDKA 3ZLHA 3NQCA 3H7UA 1ML1A 3ABRA 2JIEA 1HKIA 1KO0A 1VYPX 4URIA 3LA4A 4D72A 4N7QA 3K4WA 5GNZA 2IS7A 3UXAA 3GFXA 4GIAA 3IJ8A 3VIMA 2Z2BA 1PKLA 5AN7A 1B0IA 4IZGA 4HJFA 1Z89A 3O7UA 1TPEA 1JVNA 3U5YA 4JDBA 1RP8A 4IIBA 5HWNA 4U28A 4D8ZA 5D02A 2F2KA 4O4VA 2ACQA 4MWAD 1FUYA 3CK5A 3N25A 3M5YA 2QGYA 1X96A 1P5BA 1SJAA 2BVWA 4H7VA 3WLJA 1XQKA 4PCNA 4LEQA 2HNHA 1Q4WA 1FCVA 2QAPA 2QVNA 2GVLA 4R3UA 3RPTA 4WVXA 1LP6A 3L66A 2ZIDA 4M1RA 1QTWA 5FJOA 1QOQA 3CIWA 3T8QA 3IRSA 2DZPA 3O6YX 3W82A 2PTWA 4RV3A 1H09A 2OCZA 4HZ7A 1KCXA 2CLHA 3SADA 3WK1A 1RCQA 1MRQA 1GVOA 1C3FA 3U7VA 5IM51 4DZIA 3HOJA 3JU2A 5IHSA 4OVXA 3IGUA 4JFUA 1BRLA 1SW7A 4RK8A 3W7IA 3ITCA 3KE0A 5JIPA 1T6MA 1A47A 4MVAA 3LGGA 3UZ5A 1WDPA 1B30A 2R24A 2I5IA 5CPMA 4JTAA 2P8BA 5E5CA 4IMDA 1MI3A 4WCJA 4GKLA 1YQ2A 2OZ8A 2BLEA 3AS1A 2PFHA 3PR2A 4DJED 3BICA 4DZHA 1XYAA 3LLFA 1F6PA 4ERGA 2GGIA 3VTRA 4YU1A 1TV7A 1P43A 4AD3A 4Q8TA 1DE5A 1T5AA 2HXUA 3CMJA 4H3DA 4ZMGA 1XR2A 2BOFX 3SUUA 2D0FA 4AAJA 1N8FA 4GX9A 3DKLA 2V3DA 4LBUA 5D2VA 5JH2A 4P61A 2Z1BA 3AMKA 1F2JA 2PTYA 5HANA 2GOUA 4P7RA 2OSYA 1VBRA 3RNDA 2VNCA 2VX6A 4FXFA 2ZA1A 1EYEA 2DORA 3T08A 1CYGA 3S83A 2YA2A 4JTFA 4E4PA 3R58A 1HL9A 4UQAA 4TXEA 1M1BA 3O6CA 1UKPA 1V6YA 1ECEA 3GTFA 3WNPA 1GVIA 1KXVA 2G0WA 5G4WA 3VPLA 2VCBA 2YCIX 2WM0A 1LQ0A 3OLIA 4QR6A 3WQ8A 4AHPA 5C8BB 4QG9A 3BV4A 2FPYA 4MUZA 2HROA 4KRZA 1A3WA 2POZA 4J5NA 4LUTB 1JQVA 2Y8VA 3VMNA 3NEHA 3TP4A 2INFA 1YTKA 3LTPA 4XO6A 1J18A 3L5LA 1TCDA 5B80A 4ZL1A 1DIKA 1U5JA 2D3NA 2QW5A 1XINA 5XIAA 4GQRA 1EGMA 1IGWA 3ICJA 2WWCA 3FN9A 3GUWA 4Q33A 1DP0A 4B3ZA 4GY0A 1UH3A 2J9ZA 5BU9A 1VFFA 1VP5A 3DAQA 4E5TA 4NZJA 1TIMA 2A0NA 3D47A 1PX4A 3V5CA 3TW6A 1TJ0A 5KSWA 9XIMA 4NZFA 1HKWA 1XDMA 2WCAA 2VFDA 3II1A 3NL3A 1NFGA 1PKMA 1I45A 4QNEA 3O15A 1UD2A 3EMCA 4DNMA 5CSSA 2VKZG 2CU0A 3WMLA 4GYKA 1EC8A 3UWVA 4NSBA 1EOMA 1KB3A 3SQSA 1XYLA 2PS2A 2CPUA 3MP5A 3POHA 3TK7A 3R43A 2PWVA 4GCXA 2VDIA 1OF6A 1ALDA 5DXXA 3OVQA 1OFOA 3HQOA 1VLWA 4MKVA 2VEPA 4Z1DA 3VIIA 3PHAA 1O94A 3L4ZA 3C5QA 2NV9A 2GVJA 5LNUA 5I06A 4MFEA 3VKJA 1PL9A 3T44A 3DGBA 2DSWA 3CZ8A 4XZHA 4AY7A 1K02A 2R91A 4GBUA 2ZRVA 5K9XA 1KM2A 4LEFA 3VU2A 1W3KA 3PZTA 3TTSA 2WK2A 3IIXA 1B54A 3W70A 2PDPA 1FH8A 4NILA 4B4FA 3UWEA 1A3HA 3CL6A 1S2CA 1LJYA 1KGWA 1R46A 5MHBA 1FY6A 4ZQOA 4EANA 4A3RA 1GQKA 3DYOA 3ZJ7A 4M6PA 4HCHA 3CGTA 4RUBA 1ADSA 1KFCA 4OBSA 1CT5A 3WKZA 3T0TA 5CGQA 3ARPA 1TCMA 3RLUA 3HBLA 3L9CA 4UNIA 1J0YA 4JIQA 2ZUWA 2QVHA 2PDFA 1I1XA 4AQLA 2WNQA 1K4HA 4G7EB 3QMTA 4JIHA 2E28A 2Y8KA 4IJCA 1WA3A 4UB9A 3SCWA 1LUCB 3KRUA 1MVYA 3IUIA 3SUWA 2E5CA 2ZADA 3NJ3A 4BF7A 3VXGA 4GI9A 4A8NA 1WO2A 3P60A 1GPWA 3TQ0A 1OX4A 3W7PA 3S8HA 1VC4A 1KNWA 4QE5A 2QCLA 1MQPA 3B9NA 3IWPA 2QDHA 4L64A 5G4HC 1YW1A 2V5BA 4DF2A 2OX4A 2VD8A 4XVEA 2E6AA 2QF8A 1R8LA 3LB0A 4CD4A 3KOWA 2C0HA 1E1CA 2XIJA 4DO4A 1UWRA 2BY2A 2CESA 1DHPA 3T05A 4B9YA 2ADAA 4GD0A 1Q7ZA 4DYJA 3WBXA 3V35A 3F1QA 3GH7A 3FSUA 2CITA 1PVNA 5EMMA 3WF1A 2WMIA 2JEQA 4ROPA 5G5IA 4AYGA 3GXNA 3PC0A 2PDUA 2PCQA 4X0VA 3SR7A 2J27A 1P48A 4AHOA 2WJDA 1CPUA 1XCWA 4M82A 2XINA 2REQB 1ESWA 3EDDA 4R9OA 4N9CA 2Z2AA 3DESA 1D8CA 1PCWA 3VKAA 5KZMA 1W0MA 3S0CA 3G3DA 5FJJA 3KHJA 1JGIA 1JI2A 1FH9A 3EXRA 3K1DA 1O60A 3M46A 2Z00A 3HQ1A 1N7KA 3GYEA 4YS1A 5LNSA 1QNPA 3MSDA 3HZ3A 4IIEA 4J3TA 1TJ1A 3ATZA 3BGGA 1QU4A 1KCKA 4C6EA 4DELA 2G3NA 1E6RA 3EAUA 2BB0A 2HRWA 4JTDA 3ABOA 3QMSA 7CGTA 2ZUTA 4Q8PA 3N2BA 2BVTA 3BW3A 3VD4A 3GKFA 1B90A 1QFEA 1JPDX 5HMSA 3QKEA 3SW6A 1EA0A 3MI6A 1H5YA 1DJGA 1L8PA 3IAQA 3P8JA 2FB3A 3WFAA 1S3TC 4JICA 1U30A 1XYCA 3TUUA 1FHVA 2F6UA 2XHYA 4CU8A 1OFDA 1WNOA 1ICPA 3EWZA 4ZSTA 3QLLA 2NWRA 3RM8A 1EZ2A 3A22A 4H2HA 3C0QA 3ZVIA 4Z42C 3FJNA 3S1GA 3EX1A 1MNZA 3TQVA 2IKIA 4PEKA 4NI3A 4B5TA 4MLJA 4OT7A 2ZX9A 3O63A 5MKGB 2VFIA 1ONWA 3UVIA 4IMEA 3QPYA 3N3MA 1YX1A 1AQMA 5CC7A 1B9ZA 2QLYA 3DXIA 3UYCA 4XX6A 3RK8A 2CXGA 1E1EA 1MFVA 1UD8A 1EKOA 5G1TA 4D6HA 3B0UX 1DJYA 1ICSA 1PKNA 1RQBA 4JQ2A 2DJXA 1NARA 1ZBCA 4LVDA 3OO2A 3N18A 3WUGA 4LOCA 5F1VA 1S5WA 4A21A 1BPLB 2JKAA 2W4XA 2Y0FA 2CKSA 4Q4QA 2V3FA 5CAHA 3TVAA 4YXGA 2P10A 3LHTA 4I9MA 2GJXB 2Z1KA 5IDZA 2XIIA 1W9VA 4LUSB 4EKJA 3KOXA 3MHGA 3KOYA 4L1WA 3V36A 4AWTA 4JTRA 3W28A 1LF1A 4UTIA 5LIKX 4HHMA 3VIJA 1P4CA 4QROA 1XBZA 2DJLA 1UUOA 4KCTA 1XJBA 3M16A 4UZUA 3V0UA 2CZVA 2GLKA 3UXDA 1M41A 2J8FA 3JUGA 2QCGA 2CKRA 3MZ2A 3O6DA 1E5JA 5GJMA 1QUMA 2R9RA 3H23A 2YZ5A 3VILA 4H8HA 3M0IA 1RPKA 3CZLA 2B7OA 3TA9A 5CPLA 1E5NA 1US3A 2XJ7A 1W5NA 3SB0A 5FF3A 1XIIA 2G3FA 2YFOA 1MNSA 4O19A 3WLKX 5TD4A 7ODCA 1E6SM 5CZSA 4PBEA 3QY6A 3MPGA 2A2IA 3MWCA 3GYCA 5F4WA 1RY0A 1Q2SA 3NDYA 1UJQA 1XLJA 4YTUA 1RSCA 1G7VA 3W24A 1Q85A 2ZRUA 4DI9A 4HA0A 3WJYA 3NVTA 3TN4A 3SY1A 4D6CA 4QE1A 4BQ4A 4GH3A 4ERAA 2JGQA 3H2FA 5I3DA 2YL6A 1U33A 4F48A 4IG2A 3NOYA 1MEHA 5BYWA 3NL6A 2EHHA 3UQNA 2GDVA 1XYZA 1F7BA 3ABQA 1QVBA 1PB0A 1S46A 2VUNA 3GDTA 2QCMA 4XVDA 3SQLA 3CPRA 1AA1B 1GHSA 1UBSA 3NA8A 1EA9C 4CD6A 3TR9A 4N6EA 2V5JA 2CCRA 3DI1A 2D2GA 5G4EA 4AD1A 1LROA 4NZ5A 1PV8A 4KFPA 4DJDA 2Y88A 4K37A 5CH9A 1W9PA 1QHOA 1KGXA 2G3JA 2PWFA 1H7RA 2D0GA 4ML4A 3GLCA 4HN4A 2QMJA 4CNTA 4IQJA 1M7JA 1YBQB 2JKPA 2DY3A 4S3KA 3WJXA 2B0MA 3P0XA 5FJIA 1DTUA 3M0ZA 4LS1A 2X0HA 4CNSA 4L4MA 4J3UA 2BNJA 2ZCGA 4S3GA 1OX6A 4U2YA 2PU1A 1PWLA 1PE1A 4X9YA 3S3GA 5HWJA 3ZJ6A 3G1DA 3W75A 3H4GA 1RLDA 3UFYA 3IK4A 4GYFA 3WQWA 3LBOA 3OOQA 3MBDA 2GJNA 2YCLB 3TNOA 1XDLA 3N17A 1H11A 3W7LA 4I7VA 5D2WA 1M04A 3ITYA 3TTEA 4MB5A 4O12A 2YB4A 3KL0A 5KITA 4GIYA 4NP7A 2RGMA 4PMVA 3U57A 1I2QA 1GVYA 1M7PA 3LMYA 3PN8A 1AD1A 4OU1A 1FWTA 1YADA 2FFIA 1WKDA 1VFMA 3CEUA 2VVSA 3VUSA 2Q3RA 3V16A 1GG1A 1EC9A 3B0PA 2QNEA 1QOPA 4PCSA 2QAFA 4GUIA 4MDPA 2YXGA 2OZ0A 3GR8A 4IG2B 4F9JA 4UMBA 3NL5A 4ZE5A 1QI0A 1XLHA 3WLNA 4C6CA 3S46A 4DYEA 1KBLA 1TRDA 3LXCA 4J35A 1I2NA 2R14A 1J2BA 4FOJA 4P7NA 1AQHA 1K70A 3ABZA 1I4NA 3UXIA 1R38A 1WAUA 3SEPA 3W6LA 5C5YA 2OLAA 1K03A 2POTA 2J8TA 3T6CA 4I3GA 1QK2A 1Y0EA 4GZIA 4NX5A 1HJXA 7REQB 4NRRA 1YPFA 3QZEA 3RO6A 3DKJA 2XVPA 2A6LA 4YTTA 1TFVA 3THAA 1R7AA 3P7YA 4YWSA 4L7ZA 2C1GA 3R79A 5C54A 1L2UA 5EMKA 3C6CA 4O1DA 4MZ1A 4CN4A 3WDJA 1J0ZA 1XGEA 4HPHA 2OVLA 4AXNA 4JL1A 1M9HA 3QFEA 3NQEA 3CLWA 3WN6A 5H6HA 2HWGA 2QJJA 3F4VA 2PDGA 6TAAA 1WXZA 5DQPA 3G1HA 4GIRA 3A64A 3UGRA 1XI3A 2GUUA 4WDWA 4F0KA 1DWGM 3KEHA 3M6YA 3UCQA 3NWRA 1I1WA 4MNKA 2WVTA 2VC7A 4B2DA 5I3JA 3G0SA 2GGEA 4G56A 3B03A 1UA7A 4H9UA 1TX0A 2EPHA 2FH8A 2XPKA 3DYPA 3PFMA 4IP4A 3MCMA 1TTQA 4Q22A 1YTDA 1QO5A 3PTQA 3SCNA 5FACA 3C2EA 4K8EA 1EO5A 4RNJA 4X61A 4E4UA 8XIMA 4OECA 2JQXA 3EZ4A 1PUDA 2PWHA 5A69A 1CNVA 3WLIA 3TYCA 1JD9A 3NIYA 1SR0A 1A5AA 4QISA 4HNVA 4JPGA 3U48A 3LRMA 3GX9A 3N9RA 1O4UA 1DEDA 4F66A 4RZBA 1RD6A 4Z08A 3VNDA 2NVDA 3GAKA 4AZGA 2GPTA 5BWFA 3B06A 3SN1A 4LY4A 3VIGA 2P5NA 1B4KA 3WDPP 4C6IA 1R3YA 3W1AA 1TRIA 4OOUA 3BZGA 1K77A 1UROA 3OW1A 3ANVA 1OWQA 4XTDA 3RLHA 3W76A 1XUZA 3CB8A 4D8LA 3BOXA 4GACA 1FWEC 3ZR5A 2A7RA 3VKDA 1PS9A 3L4YA 4Y9OA 4L6DA 2EXOA 3GS6A 1TWDA 2GSEA 2C71A 2A3HA 2V2HA 1F73A 3AIUA 3EGJA 4IXHA 5CZJA 3ZS4A 3LEPA 4ZFCA 1YYAA 3GDBA 1Q6GA 2Z2UA 2HS6A 3HFTA 1DQXA 4GINA 3RJXA 5HA7A 3VDGA 2XDFA 3O3RA 2WJEA 2EPKX 4FXRA 3WH8A 3SRDA 3EA2A 3C61A 5IBXA 4EP8C 2VC9A 5F2LA 2KAUC 2D22A 4A22A 1UH4A 2GK1A 3AUOA 4KMQA 3INPA 3O0KA 1G6CA 3OODA 4I5RA 1E3XA 2X7WA 3B4YA 3SBFA 2R6OA 1J8VA 3QYQA 1J9YA 2B81A 3PTKA 3GG8A 1A49A 3GTNA 4Q8UA 2XVNA 4RE0A 3WJWA 1CBGA 3TSDA 4AUBA 2ZFAA 3OVPA 1J4EA 3QPZA 1GUVA 4GVHA 3HTWA 2FZBA 2H3DA 2BGNE 4B4HA 3KBJA 4ATDA 3K1GA 2IQ0A 1LWIA 1G1YA 3QZAA 5BU6A 1R9YA 2GGJA 3EWCA 4H6KA 3TE9A 5K9DA 2O9PA 5FI8A 1AH4A 1VF8A 4NG3A 4RW3A 1CIUA 3QYSA 1SFSA 3PUOA 5C9XA 4ZSUA 4GQQA 4QHRA 3E2RA 3W84A 2YBTA 3AYVA 1LLZA 2DH3A 3N4FA 4PCPA 3N2CA 3QSTA 2OWXA 1C92A 1W8SA 1HKMA 4QE4A 3OYZA 4LCQA 5E9AA 1PZ2A 3H70A 2ZBTA 4NJJA 4GC3A 1JFHA 4WHBA 4JXCA 1H2JA 3EDJA 1GVQA 2DVTA 3QTGA 2QDGA 1W5PA 4CKQA 3DBPA 3F2BA 3IV3A 1D8WA 4JZ5A 1HJWA 3ZR4A 3LGEA 5DO8A 2A3LA 3FFSA 2VT0A 1HVQA 1A50A 2PLMA 2OFJA 2VZSA 1KA9F 3M0LA 2WMIB 3D0CA 4GY1A 3WEZA 2Z1VA 1XXXA 4B5UA 1TG7A 3SN0A 1TWZA 4U5KA 2ON3A 3AIEA 1HQTA 4JEQA 1Y5VA 1ZJBA 2C18A 2OEKA 4BF9A 2AL2B 4KFOA 4HYVA 1HG3A 1YXYA 3TYUA 3G18A 3WUFA 3AS2A 4BJHA 3ARVA 2YXOA 2BGQA 1KXQA 3C0JA 5GNYA 1OGGA 5M5DA 4QAWA 3HB9A 4PEEA 5I7GA 1GVSA 4QS5A 1GT8A 3P62A 1F61A 5I78A 2E6YA 4MB3A 4X3ZA 4AD4A 4AHQA 2ZZ1A 3KHDA 4ICMA 2AAMA 2CLPA 4XO7A 3E02A 4F3HA 1TO3A 2YLAA 5HAOA 5AZ0A 4J3ZA 3KTXA 1ISZA 1UKOA 1O5XA 2PD9A 3F2CA 7ENLA 3P61A 4W7UA 4OUEA 4AZ7A 1MUWA 4U2ZA 4YCOA 3JVAA 3GNPA 4HOXA 4KCVA 4GZEA 3MY9A 1QPKA 4Q7IA 4TTGA 5MF5A 2QQ6A 3W2LA 2PTXA 4ZQCA 2YR1A 3BAJA 1XSIA 3SCOA 1V51A 3H22A 1IEXA 3HQNA 1QATA 2W62A 1IV8A 2FKPA 5GJNA 1UWAA 2WMJA 4IP7A 3W9ZA 4PTVA 4HOWA 4QRNA 1ODZA 2C91A 1VFOA 4C1LA 2EGZA 3U8GA 3M41A 3WNOA 3TMQA 1KRMA 1TR1A 3OP2A 1Q6EA 1XIHA 2ATSA 2VGIA 5CKSA 4AW7A 3VOCA 1X1NA 3BLIA 4XK2A 5GQBA 1XPYA 1OC5A 1W1ZA 4HYRA 5C9RA 1DTNA 3GNRA 3E1F1 1OADA 3O05A 3E0VA 4WQ6A 1TMLA 3SRFA 1FRBA 2XWEA 4AIUA 4D71A 5KZ6A 5LNVA 1V6XA 3ELFA 3TYEA 1VJSA 3M6DA 1DJHA 2ESCA 4AX6A 1FHDA 1OABA 3GR4A 1U5HA 3BCDA 4GI6A 4JKMA 2XN1A 4CQDA 4MGGA 3TR2A 2DZAA 4ZBCA 3EKZA 1KFLA 4YMZA 4I8YA 1W91A 3I4KA 5IBXC 3L5MA 1I8JA 1H7NA 5HQEA 4LAOA 3I7SA 5D8WA 1GZGA 1S39A 1JNEA 3SCRA 3ZVHB 2WNZA 3NZQA 3VDAA 2HNEA 5A2CA 4MKSA 4IPNB 2DIKA 2Y5JA 4PULA 1J2WA 2ZC1A 2WMGA 3WY1A 1VPYA 2PB1A 1RQHA 3FA3A 1QI5A 5CC5A 1D2KA 1W3NA 4R7WA 2EKCA 4NZ1A 1J5SA 3FXYA 3EBVA 2VYOA 1FTXA 1SZGA 1KD0A 2PF8A 3DOPA 4WK9A 1B3XA 1HP4A 1DJIA 3W0KA 1E0XA 1TV3A 3S5SA 3L4TA 4ZQPA 1JYXA 4N4QA 3THDA 1JZ4A 3QOMA 1SZNA 2NW0A 3VIKA 4POCA 1TELA 4CD8A 4NJKA 1KXHA 3W1XA 1R3RA 3GSMA 2O56A 1NM9A 4W8BA 2DDXA 3IGHX 3UNDA 3QM3A 4HCLA 1QCWA 3PBVA 2Z7KA 4F40A 3WQFA 4KKXA 4N9DA 2V68A 3PPGA 3HG5A 3ZR6A 2F6XA 2JE8A 3QLDA 2VEKA 1TVPA 2UY4A 3ONCA 1T99A 4B15A 3W2KA 1QHPA 1LYXA 3W7KA 1QNVA 1I60A 3ITTA 5LYRA 1Z8AA 1IT8A 2WPBA 2QCCA 3MTWA 4FX7A 1QI2A 4ADUA 1AH3A 2RJGA 4ZCWA 1RALA 3LPGA 4HK7A 1EXBA 1XX1A 1OYBA 4GABA 4CCEA 1MWOA 4BF5A 2DEPA 4DAIA 4QDMA 3LV6A 4MKNA 3V18A 5HINA 1TA3B 1ZAJA 1UB3A 4KRUA 1NFPA 4FS9A 4GNKB 1UCWA 2EO7A 1KRAC 5KTLA 3BWWA 2H8XA 1NOFA 3CPUA 3PK7A 2WV8A 3OJGA 4A3HA 4JTKA 3TJLA 4HA4A 5A2BA 2QCHA 1W3JA 4NXSA 4DBDA 3BMWA 3ARWA 4HA3A 1MW2A 4HU4A 2WQDA 1ZP3A 4XZMX 2I7GA 4O1EA 2IPFA 1P0BA 4YJ5A 5D2XA 3UZXA 4BCEA 3W71A 3U3HA 1KCZA 1OINA 3WK2A 5DRCA 2F7FA 4KEVA 4US5D 1C91A 4H9TA 3VGBA 2RDTA 1H51A 4I7WA 4H6EA 1EJSC 1GTHA 5CC6A 4UFLA 3T81A 4C1NB 2VC6A 4XIMA 2XIBA 4PC8A 1W5QA 4PTDA 2FQIA 3AIQA 1F05A 4LUSA 9CGTA 1V5XA 1TB3A 4JTEA 3N2MA 5TF0A 2NUXA 1X7FA 4AZCA 5J5DA 5F4XA 5CPQA 1MXGA 3BLEA 5AZ1A 1OC6A 3TC7A 2FVKA 2YL5A 5ABEA 4H7ZA 1NTHA 4N0RA 4Q6XA 4Y9NA 3N73A 1IWPA 1TA3A 3B40A 3KS5A 2E6FA 3W1UA 4Q4SA 1AVAA 1UKQA 1J0HA 3DDMA 4NASA 5EBUA 3RLVA 3S47A 2CW6A 3WBWA 2Q8LA 1KFEA 2O0TA 1BF2A 4NI8A 3KCOA 4N9EA 3HURA 3QSRA 5E70A 2YYTA 2QUNA 1XPGA 4NJHA 2WQPA 3N4AA 4MNMA 1ME8A 1W32A 3EOOA 3OEXA 1S5VA 1XCFA 3BSMA 3ZZ1A 1XC4A 3B4UA 1NQKA 3UR8A 3OIXA 3WF4A 3CWNA 3TMLA 1WOBA 3SRHA 1RR2A 2GYIA 1GKPA 3SRKA 1KQYA 5A6MA 2E67A 4YYCA 2HVMA 1QWKA 3A3HA 5E1QA 5FEWA 2ZE3A 4YTSA 4IX0A 3DFNA 4ZOCA 4DBEA 2QJHA 2GQ9A 4IIDA 1PX8A 1K9TA 2VWTA 4WGXA 3MA8A 3SCVA 4JY9A 4RE2A 1H0GA 3RR4A 4MB1A 3TLQA 3VFLA 4E2VA 2WNWA 3P80A 3CWOX 1XGZA 4REQB 1UQZA 2Q01A 2BWGA 2OMAA 3AHYA 2GZXA 3W1NA 3RU6A 1EUNA 4GJJA 1R7OA 3RCYA 3B0XA 3WSUA 2I57A 4IH3A 1U5VA 4UR7A 5LGXA 1GJWA 2Y5SA 2HXTA 4LVAA 2VXNA 3CB3A 5C2GA 3AMCA 2QF7A 4EOUA 3MO7A 1UUMA 2VVNA 1W1TA 1JQXA 3W7HA 1VAHA 3CH9A 2NQ5A 3PP7A 1A5LC 4A8RA 3RG6A 4JTGA 4K68A 1SGJA 5I6SA 3S9ZA 4GVFA 1W17A 2PD5A 2I5QA 3WLLA 3LNPA 2QUTA 3L4WA 4O0QA 2CLKA 2CLFA 3LTSA 4B5VA 3WZ0E 3SIZA 2CWXA 4FSAA 1E70M 3BURA 1VLIA 2J7HA 3VDCA 1GQNA 4GXWA 3ZVHA 4B3KA 3VMPA 3DN5A 2HBXA 3M0KA 1W1VA 1I75A 3G22A 1KBBA 4YVVA 3DEQA 4XIAA 3CV7A 2Y61A 3AXMA 1O5QA 2OB3A 3GWQA 4FB7A 4US6A 2ABBA 4LJ3A 3IAPA 2ZC8A 1SFTA 4EIVA 5D09A 2ZRYA 4AY1A 2Y89A 4DWSC 4E2BA 4TV5A 3VZYA 3S2NA 1EQCA 4W88A 5AB3A 3Q4DA 3H2EA 3C56A 3DU0A 3F4DA 2FHCA 3WUEA 4J28A 2P8CA 4GIEA 5G2WA 1OX4B 4PTMA 4H04A 2D2JA 2ZXDA 1UD5A 3CUIA 4JTCA 5BXRA 1VBJA 1HF6A 5I77A 4EX4A 1E9YB 1R30A 5H2ZA 3BCJA 1UASA 3AIWA 4JNMA 3HGOA 4CN1A 5A3HA 2EG8A 3F4WA 3OQ8A 3MB9A 1JZ8A 5I09A 1EEPA 5EU9A 1UWIA 3NQ8A 2WLZA 3CBWA 1BG9A 2OELA 5D9MA 3GU9A 3WLTA 4XZBA 3MP3A 4RPPA 4DAFA 1EP3A 1AW2A 5J8LA 1JDFA 3W4RA 4NAFB 1ZLPA 4C6FA 2ZRZA 1JJKA 4JR5A 1R86A 4KBXA 2CC0A 2PI6A 4UTWA 3W29A 1V3JA 4AZBA 2ISSA 1SFJA 4K6AA 4DJDC 3RCMA 1W5MA 1V0LA 3VOFA 1YDVA 3S5NA 2VC5A 3PAJA 1PZ0A 1KRBC 2DUZA 2YYUA 2H6RA 2D23A 4O18A 1R3WA 4ONVA 5A6JA 3TH6A 1IXNA 4J3SA 1E6XM 4WY0A 4O17A 5DXYA 2C7FA 3UBPC 3STFA 1BWKA 3NTYA 2ACUA 3KBVA 4M51A 4K39A 3W73A 1Q13A 1AH0A 1TWIA 4H83A 1OZMA 1KFJA 2HSAA 3QVQA 4O53A 3N19B 3TN6A 4DBSA 1YDNA 3P93A 4XZLX 4J3WA 4MNJA 3LUTA 3F4CA 5FF4A 3U2EA 1JCTA 1R6WA 3LS9A 3UR2A 4M29A 1UPPA 2WM1A 1FDJA 1C8XA 4AU0A 2HS8A 1X97A 5HQLA 1M7XA 2J6XA 4MZ8A 4GVGA 2PC8A 3T0DA 2OLHA 1UMYA 3TYAA 3H2AA 4H9YA 3A5VA 5T9BG 4O10A 4HNTA 4Y2WA 2VENA 3UT0A 3MS8A 1JZ7A 3C52A 1IYXA 2GQ3A 1LOQA 3GHSA 3OZMA 2PDQA 3PULA 1H7WA 3RJYA 2E0PA 1UBPC 4Q8WA 1JF5A 1B3WA 3OVGA 1D7KA 3OYXA 4IL0A 4YIWA 4JGDA 1ZCCA 3PG8A 1C9WA 3EKLA 4I5UA 3QOKA 1O5KA 2I1OA 3S42A 3R11A 1JGMA 3AJXA 4ZOAA 3PANA 1IZKA 2DH2A 5K4ZA 3QHOA 4LU0A 2INZA 5CJMA 1A80A 1MYRA 4PTNA 1GQIA 3A9BA 3ARTA 1EXPA 2QJMA 4ATWA 3B9AA 5EMLA 1GOQA 1CXHA 2EPLX 2OQYA 3BJTA 1CLXA 1Q8AA 3NCOA 5A6SA 3HPZA 5DCDA 3GDRA 1W3IA 3UJSA 5DMNA 2ZUMA 1EPXA 2CZDA 4O15A 5LXEA 2WHKA 3TSBA 3N2OA 2FHFA 4DO7A 3O16A 4J7RA 4HA1A 4MY1A 1UR2A 2X1RA 5LA1A 4YVPA 3PM6A 3MDWA 2FDMA 5HK4A 3W86A 1VPXA 1SW3A 4W5ZA 2OEJA 4H6RA 4AC7C 1NWRA 4Z1YA 3OGVA 4M6QA 4ZVJA 3UPMA 4XD5A 4BI7A 4PL2A 5HUOA 1FQ0A 2DGAA 3IS4A 4UBPC 1JNDA 4EXAA 3OIHA 5DBTA 3BG3A 2E09A 5BOFA 5HMEA 1R87A 3PZMA 1V02A 3KVJA 5CEWA 3JRKA 1LBFA 2OO6A 3O6AA 1F4AA 2YDQA 1XD0A 4PCFA 3RILA 4I5XA 2ZXBA 4IWWA 4RKAA 1XD1A 1JEZA 5C7VA 4CNUA 5BOOA 3AHTA 4XD6A 1ZBVA 2HPMA 3S5YA 3GG7A 4AVOA 2WMHA 1NP0A 4QCFA 5G2IA 4DZ5A 1EB3A 3AHVA 2PEVA 3A47A 2NX1A 4QFUA 4ZTXA 2PURA 3CH0A 1PAMA 3PG9A 2NLYA 2BVDA 4DZAA 1OGSA 1GYNA 1FWRA 4MFDA 4RNIA 5HOSA 3FGCA 3PPFA 4IGNA 4P8WA 5DRIA 4UTFA 2DV0A 1FKXA 4AD0A 1W9XA 6REQA 1Q66A 3GE7A 4KESA 1R3VA 3MDUA 3B0VC 3S1WA 3WH9A 3L4VA 3HPSA 4PH6A 1E73M 1DQUA 4HPXA 3UYIA 4GI8A 1BTMA 3WLPA 4W8AA 5CSRA 2PDHA 3RPDA 2NWSA 3D3FA 1PX3A 3B9DA 2VGGA 3PFRA 4NJGA 2DUAA 5HJYA 4TV6A 6XIAA 3LCWA 1G4EA 4K7VA 5AHFA 5JBDA 1ITUA 5JIWA 1K9EA 5IRPA 3WK0A 3DC0A 1EIBA 1BLIA 7REQA 4C6KA 2J74A 3FV9A 3TJIA 4E38A 2WVVA 1LRTA 1GOOA 2W92A 1EJXC 1FVPA 3W88A 4M8UA 4C6OA 5LKYA 2J9XA 3PZNA 3ORWA 3W1PA 4M1BA 2O9OA 4FNSA 3UA4A 3ZQ9A 4YTRA 5EYWA 4PMNA 5ECVA 1A0CA 2ZX8A 1OJXA 1NP2A 4MF4A 3SCPA 3FNDA 2Z1XA 3L0NA 1JCJA 3LK6A 4AIEA 4F0SA 3GQYA 3PUGA 1T8XA 4ORMA 4NHVA 1QW9A 4PYSA 3CZKA 1ITQA 4H8NA 4MB4A 2WCGA 1XKYA 4XBKA 3WQPA 4IXXA 3WJZA 1FWFC 3S2MA 3WQ4A 3VM5A 1JRBA 3QW3A 2VUYA 3TTOA 3TXZA 3CWHA 2VR2A 2YL8A 2FHBA 1E72M 4XKMA 1CGYA 1KWGA 1O12A 1BXNA 1DJWA 3M7WA 2QPUA 1RZMA 1XIEA 4B90A 3NQVA 1E6PA 1Y5XA 4N4PA 3IVSA 4DYKA 1MZHA 1GOIA 3ARRA 3CUZA 4PUKA 1ZPTA 1KR1A 1XM3A 3ITLA 5L6UA 3V0TA 4C91A 2VI0A 1WYIA 2WVVB 4WIWA 3MMUA 3EEGA 2NT1A 3AYTA 1SO4A 2QUMA 4C7GA 4AVNA 3NZPA 2CZFA 2J8GA 2O55A 2J77A 2QCFA 3AXIA 4LF2A 3ZOAA 3LLXA 3IGXA 3F4NA 3W7JA 2Y7GA 5D9PA 5E93A 2ZXQA 2UBPC 4FR1A 4CNPA 3GHUA 4GWEA 4TX8A 4UFMA 3CHDA 4FALA 3ITVA 2V5DA 3TKFA 3OLEA 4GG9A 1VYSX 2A7PA 1EWEA 3CYJA 3B9EA 2Q02A 3UU0A 2I5GA 3M43A 3WH6A 4DO5A 2UY5A 4RE3A 3SO7A 4QEEA 2PSNA 4H9VA 1US2A 1W3LA 2VEGA 3CYVA 3OLGA 2F6KA 3DGRA 2RUSA 4JN8A 1OD8A 2HK0A 4Q6JA 3SY8A 4EF8A 4BY3A 3B3DA 1UWUA 3FJ6A 3E2QA 4H19A 2F2HA 3NGJA 3TA6A 1BRLB 4HMEA 4FXJA 4KWOA 4GZJA 2D24A 3S6TA 2GSJA 1TV2A 3H4WA 3S5OA 4C6PA 3QGAC 4U3CA 5EKYA 3L2IA 3GFZA 4JHMA 1KC7A 2EKGA 1AODA 1X6NA 3IEBA 1RBLA 4TUFA 2ZTKA 1E40A 4QDWA 3IIZA 5A6AA 3KBWA 4OTKA 3DHDA 3VGDA 4NYYA 1NJJA 3O07A 4HP5A 1FWCC 1SSGA 2VDGA 4HBKA 1BYAA 4UTMA 1W1PA 4KQNA 3TFCA 2NQZA 4RNHA 2OX1A 4LAUA 4CNNA 1RJQA 2J66A 4UTWC 1UR9A 3BW4A 1UMLA 1S5TA 3BLKA 3C2OA 1LG1A 4FF7A 1SFLA 1XDJA 1A5CA 1XIMA 3TN3A 3BL3A 2OZTA 3SGGA 4NVTA 3RN6A 2R1NA 3LBMA 4CUCA 3L4XA 2WSKA 3KBMA 3G1SA 1KM0A 3KL3A 2ATMA 3EMQA 3AS3A 4TMCA 4UC5A 4RW5A 3SFWA 4AYSA 4AF0A 2ZOXA 3HN3A 4LVGA 3UG4A 3CQKA 3NPVA 4S23A 2JBMA 3MVTA 3HJEA 1U1UA 1V4YA 5CZKA 3U5UA 2BXZA 1OIMA 4DN1A 1TJRA 2YDSA 2UV8G 3KWSA 4DWSB 4PUDA 1VRDA 4WEVX 3CNYA 2PU0A 1Q6CA 4GO9A 2FTPA 1AZ1A 1IE7C 4DUXA 3R4IA 1V02E 3WLRA 1EP1A 1XBVA 3PSVA 2PDKA 1W1YA 3TDFA 3TTYA 2G50A 1NELA 4LGXA 1P1MA 3NO3A 3QY8A 5FEPA 2E9MA 3DYMA 2DT1A 4UOQA 1FHLA 3H8AA 3EA3A 1JUEA 3DG3A 4GC4A 3CMFA 1OZQA 5AC7A 7A3HA 3OZYA 3L65A 5L9FA 4HZMA 3CJPA 1M7OA 3O06A 2VFHA 4DI8A 4OQVA 4HB7A 1ONXA 1E4NA 2Z28A 3TC3A 4DF0A 2NZLA 4AF0B 2A6NA 3LM7A 3MU7A 3LCLA 4DLFA 4BR1A 1ZU8A 3E5BA 4ACYA 5E9XA 3T7VA 4PA8A 1BYBA 1EJTC 2Z6JA 3L23A 4JYEA 5FL0A 3S2LA 3WQDA 4ZQNA 3DHUA 3ANYA 4N02A 4Q8NA 3VMOA 3ZYZA 1SU5A 2WO5A 3LCIA 4V1YA 4AG0A 3IJ9A 5A1AA 2Y4SA 4Z2KA 4QDPA 4UQDA 4K38A 3HG4A 3O1NA 2VGFA 2JIWA 2WYSA 1DVJA 4RZ6A 3R12A 2PWGA 4GFIA 2W79A 3U4FA 3LI0A 3YPIA 3NM1A 1PZ3A 3T07A 4B5XA 2Q6ZA 3GNXA 4LBSA 4I9AA 5C71A 1XH1A 2J7DA 2P0IA 3NL2A 1X1ZA 1F3WA 5FCZA 1QWGA 2FTYA 1RPXA 4X9SA 4QG6A 1FWDC 4EAMA 3LPFA 2CBVA 3OZOA 5U7SA 5D9NA 4F0MA 5E0KA 3TAKA 3M0HA 1MW0A 2HK1A 1QOXA 5U4NA 1HL2A 3DERA 3RX4A 1K4GA 1GOWA 1A5OC 3S1VA 2Q71A 3E0LA 4H2CA 1HJVA 3VD7A 4UTHA 3KOFA 4Z2GA 4N2YA 1XFBA 5M03A 3CQHA 1G4PA 1M03A 1B4EA 3VNKA 1BXCA 2PDJA 4F9DA 3FHAA 4JTJA 1M5WA 1BVWA 1V3MA 2CFFA 1RUSA 2TAAA 1UC5A 3UWWA 1JCYA 2ISVA 2HVOA 3BAIA 1XC6A 3M9YA 4ORIA 1OB0A 1BKSA 3SECA 1QNQA 3C2VA 1VEMA 3LCHA 4L5ZA 4C6JA 3NNTA 2OYLA 2YCEA 1CTNA 2C0AA 3LD5A 4PSPA 3M1ZA 5EB8A 2PGWA 1DWIM 2PAJA 2UWFA 3T42A 4ZGYA 2CBUA 4F0LA 4MG4A 4NNAA 3GC4A 2PDNA 2RHGA 1Q7QA 1EEXA 4Q4OA 4AEOA 4A2SA 1SYTA 4FOUA 1OX5A 2BZNA 4Y9MA 1P0EA 4FLQA 4CCDA 2A85A 1FA2A 4B91A 4IJBA 6PTDA 2Y2WA 1H3GA 5JBFA 4HD5A 4WDTA 4GJIA 3LGDA 1MQRA 3WMCA 3IRDA 4C5ZA 4AXKA 3KRZA 1G94A 4IGHA 4KW2A 1IXQA 3QQ0A 3SURA 4UR9A 5XIMA 4WGHA 2E68A 3S9YA 4BI6A 3F5KA 2EBNA 3G24A 2YZRA 4IX2A 4MWAC 4EPKA 1UIPA 4EPBC 3NYDA 1E4MM 1UWQA 1DIOA 4KEUA 3GXMA 4H9ZA 3PZGA 1HTIA 4O54A 3HGSA 1N55A 1P6BA 3BLFA 2BX7A 2BHYA 3LX9A 3P84A 1K9FA 2XN2A 2DSZA 4I7UA 4UXDA 4JCLA 5E0CA 1ICQA 2BSLA 2Y8UA 1THFD 3CAVA 4M56A 1Z6KA 4H9XA 1DWFM 2GVEA 2HZGA 1O6IA 4FA3A 3C0LA 4JTUA 3ANUA 2NVCA 4KGJA 5KEZA 3A3WA 5AYYA 3NPXA 1DIDA 5CGMA 2RJHA 3EXTA 1EJVC 2PZ0A 4MY8A 5CG7A 4XZIA 2C16A 4WD0A 1XLLA 1Q65A 4OV4A 4GGBA 3N11A 1V03A 5JMUA 1LQ2A 5D04C 5D05A 2OEMA 3W3OA 2XH4A 3VIFA 2E77A 1HVXA 1BFNA 5AY7A 4FNPA 3BLPX 2ACSA 2QUUA 1W37A 1C8VA 3BUVA 3PBYA 1GEQA 2OSWA 1Q5MA 3E0IA 3WK3A 4QJ5B 1B31A 1ENUA 3L2MA 1KR0A 3UR7A 1GGOA 4M6UA 3GW0A 3QEZA 1E0VA 1HO1A 1TZZA 2QJNA 4HYWA 2VTFA 4NUWA 1CI1A 2Y70A 4ACZA 5D4YA 1KFBA 5HPOA 1KBJA 2P3EA 3EA1A 1V0NA 4MY9A 5LSMA 4LFYA 3R10A 4U31A 2WMKA 1XQLA 4HNLA 1BHGA 3FJLA 3WMBA 1VEPA 3RRAA 3WQ5A 1KM3A 3VGHA 3IIOA 4X63A 1H63A 3NDZA 1V7AA 2V82A 2NUWA 2D1ZA 2O4QA 1JPIA 4PUEA 2FDSA 2G37A 1XS2A 1WCGA 3GKAA 2VQTA 1TPFA 3GHRA 3M64A 2XIQA 4P8XA 3RFAA 2GJPA 3B04A 3NAVA 4PMZA 3CV1A 4Q4PA 4XG1A 1N82A 2V2DA 3FEQA 4HKPA 3WNKA 5ENLA 4QLJA 1X8CA 1N8WA 3GY1A 4WSKA 2H8ZA 3QFWA 1LL7A 1CB2A 1QK0A 3KUMA 1TUXA 1VFUA 3GR7A 4HVXA 3MUXA 5DT7A 2V30A 4MJ2A 4S2CA 4V1XA 3W83A 4MADA 3SSZA 3EDKA 4EWJA 3ARXA 2ISWA 1IXOA 1OQFA 2JK2A 2Z7GA 3CXOA 3RHGA 2PLCA 1H5VA 1GJUA 3VE9A 4WKFA 1RVKA 4ASTA 2DIJA 1XFCA 1Z44A 1IR2A 4D1IA 3NEVA 3W23A 1TE6A 2A3CA 3TC6A 2VGBA 2JEPA 1K8YA 2I56A 5D38A 4NZCA 1X6LA 2P53A 2QZRA 1R2SA 5M2FX 3RM9A 1BSIA 4MPKA 3CMGA 4DM2A 4XSMA 1Z7AA 3RIKA 4Q8MA 5LZLA 5CJNA 3TSMA 4U3AA 2WOQA 4CEUC 2X41A 2WXDM 4ERIA 1SUXA 5HNUA 1E1FA 3W6YA 3MZNA 4E8DA 1TX2A 4DUWA 2DW6A 4GOAA 4PBGA 2PDCA 1JUBA 3WH7A 3KCLA 1YXCA 1B3ZA 3LXBA 1OIFA 3QTPA 1EPVA 3A21A 4KWWA 3GH5A 1C93A 3NQMA 5LIXX 2DZBA 1S3HA 3A9IA 4H00A 1H1ZA 1NVMA 5EPDA 2YCKX 2NQ9A 4FI4A 4XSLA 2BFGA 1R47A 3QXBA 3N1AA 3CAQA 2WKGA 3S4TA 4IMAA 1TR9A 4AWEA 3AHXA 4BA0A 5D2TA 1QW7A 1RD5A 5T8GA 1FFRA 3P67A 1XG3A 5CG0A 4ADTA 2VCCA 1NH6A 2QPXA 3M44A 1IEWA 4L1GA 2W66A 3EMZA 1RBAA 4F0HA 4D6FA 3FCPA 1YHTA 5HATA 4B2DD 3IUHA 3BJSA 3B8SA 5A8MA 3AWNA 4FX6M 2MANA 1ZJAA 4JDYA 4JX6A 4OWGA 4J40A 4WXYA 1TPVA 2TODA 3AHZA 1GJPA 1GOMA 2Y85A 3HPAA 2RDUA 4ZO7A 3QN3A 2ZQ0A 1B57A 1RK6A 2EF9A 1EDGA 1JL8A 2IPGA 4DPPA 2BP1A 1J0JA 1GQLA 1QW8A 2GDUA 3PNZA 2NV2A 2XTKA 3BSHA 1R0MA 4NAFA 3P5YA 2V6AA 2W6RA 3EOEA 4JNYA 1QAPA 4TIMA 2QIIA 5D2YA 3TCSA 4GYPA 3M0XA 4GJ1A 1SJBA 4RLIA 1TPDA 2XIMA 3C4UA 4WX2A 2XN0A 3SZ8A 4OFCA 2OG9A 3H7VA 4L4PA 2ZVRA 2HISA 3NO1A 4ZXLA 3GHTA 1HUVA 4MAZA 2BXYA 4B5NA 4G2DA 4LUIA 4GFSA 3F03K 1HL8A 2G8ZA 3QV9A 1EX5A 3K8MA 4MOZA 2YKKA 3PWGA 3MQTA 3RX3A 5DCEA 4CQ9A 3LZ3A 2BY3A 4FLSA 1I0DA 3TWAA 4IGSA 2YSWA 1BGGA 4H8UA 3SI9A 3G1XA 3MCNA 4JNZA 1YDOA 3KCJA 5EFDA 3A4AA 3AQUA 3HGRA 2CEQA 2CERA 3AYSA 5FAGA 3L5AA 4UTTC 6CGTA 4L80A 1IGSA 1VPQA 1R3TA 1F3EA 3KDNA 4UMAA 2ZRWA 4S3BA 3SUTA 1HNYA 2L5HA 1EGVA 3B0YA 4MLRA 4XAGA 2VURA 4OHQA 5EL1A 5DELA 1GW9A 3PZQA 3RAOA 3SJNA 3N12A 4QP0A 2CZEA 1A53A 3BSGA 1JULA 2NVAA 1EBHA 4J2MA 3URQA 2CZ5A 3D5HA 2OXNA 1HJQA 4K3ZA 3N6QA 1X6UA 2GFTA 1X8FA 4M19A 5ABFA 1ISVA 2PP3A 4QITA 4Q8VA 3CS2A 3NZRA 2FMNA 4IL2A 1GQJA 3CHEA 3W1QA 1KM4A 3VGGA 1GK8A 3O0FA 1DBTA 2IQTA 3GM8A 4O8AA 2E9LA 1UOKA 3LSBA 4LQ1A 4EK7A 4ZO6A 3ZM8A 3UJFA 4BHYA 3LERA 2FGLA 1WE5A 3SJ3A 1RLCL 4L65A 1Z48A 1K8XA 1CGTA 3FS2A 1H4PA 2IMRA 3B97A 4MYAA 1FCQA 4DJEC 3WD0A 5CXPA 4W7WA 4A35A 3WCZA 3GB6A 3IJ7A 3WIJA 5H91A 3FA4A 2BODX 3G1YA 3N14A 1EX1A 3G2GA 4O16A 2MNRA 3B8TA 5BXPA 3TIMA 3W01A 1MUCA 1XISA 2Z1SA 1YIXA 8XIAA 3KVMA 1KFWA 4DVOA 4GPNA 1XYMA 4CQCA 1EF2A 3MMWA 2OOFA 4GO8A 4QJ3B 1W9DM 3UCCA 4UOZA 4TX6A 2HJPA 3I4EA 3QR1A 5CGTA 5LXXA 2X05A 1TZ7A 1ZTVA 2F9RA 1Q6QA 1P6WA 1LOLA 2PTZA 3K8KA 1V93A 1FWGC 4XB3A 3AXKA 4RZ4A 2O9RA 5AYIA 1VHNA 1WV2A 1O68A 3NPUA 5GNXA 4HHLA 5LIUX 1O1ZA 1Q4NX 1ZHAA 5CSYA 5CAKA 3S2CA 3LHWA 1TQXA 3VOGA 1KFKA 1X38A 1O5RA 3OU8A 3ARZA 5JH1A 5CZTA 1BD0A 4PTWA 2B7QA 2YB1A 4WDXA 4PE8A 3KS6A 4C7DA 4OE7A 2A21A 3CIXA 1F8MA 3UY8A 3IVTA 1M3UA 3UVAA 1GKRA 4HCDA 5LHFA 1RK5A 1XSJA 1WOAA 3C3NA 4ZTYA 4O1FA 2FB2A 3ZT5A 1R9ZA 1MMFA 2KX9A 3ZT7A 1W2VA 1E0TA 1VEOA 1FBAA 1IIHA 2DZVA 3AS0A 1H1YA 3BLDA 1TUFA 2Z1WA 4W7VA 3VA8A 1G01A 3R8HA 3R8GA 1FWIC 2BS9A 1FHUA 4A29A 3KP1A 1G5AA 1WPCA 1YNQA 3QGKC 5IDIA 4LAZA 1NOUA 3U2OA 3R2GA 3L21A 4GXMA 3D6NA 5G1MA 3I65A 2IW0A 5AVNA 4DX3A 1NWTA 5LHEA 1RY8A 2ZZ6A 3RGTA 5AC8A 1HJUA 3NXLA 3HM7A 1E0UA 4GLEA 1F8IA 2FTWA 4JIPA 1DJXA 1WDRA 2C13A 4Z0JA 3ID7A 2PDLA 1TWWA 2OZ3A 2ZWZA 3VFCA 3ITGA 2J7FA 4HT3A 5FL1A 1DXFA 1QMLA 1KXTA 2ISDA 1C7SA 4PB3A 2E1DA 3LXAA 3MKCA 3VE7A 1J93A 3MSGA 3UR5A 2J88A 5DANA 3GD6A 1LRNA 1W1A1 1QR7A 3G3MA 5FOOA 4BWLA 1WZLA 3UPWA 2D73A 1V3KA 4XZNX 1CLVA 3MSRA 4DUVA 1FH7A 3U7BA 5E6YA 1KM6A 1PPIA 1SQ7A 4LX4A 1EO7A 2X42A 1KKOA 2XM1A 4UTJA 2FVLA 4B3LA 3BJFA 5K4XA 4TMBA 2UZ9A 3WQOA 3FX4A 4MPQA 1EP2A 2ZUSA 3KWXA 1XUUA 4FEZA 2QXWA 5FF2A 4PFHA 3HF3A 1JUKA 1E71M 1ZRQA 2DZUA 2BVYA 4R27A 1LLWA 1XBYA 4MWAB 1VJZA 2WVUA 3GG0A 3ENLA 3BTNA 5C2CA 4ZFMA 3B8IA 4H01A 4LANA 2XVGA 4I8DA 3GXTA 4QNWA 3RO8A 1ZFJA 3VCCA 5ECUA 1M68A 7XIMA 1A5KC 1K1DA 4ZOBA 4EPDC 5AOUA 5HWMA 5A6LA 3BCFA 4XD3A 4BEUA 3V1HA 5I02A 4Z0SA 3KRBA 5DY3A 3HV9A 3P5ZA 2C19A 5LIWX 3KDOA 4WJEA 2WLYA 4JFWA 1XLIA 5LA2A 4QGCA 1GW1A 3WQGA 4XUGA 4A05A 4L56A 5M3WA 2BASA 4ALDA 1E15A 3QQWA 4QLLA 1DL3A 4UIOA 3W72A 1BWVA 3NQGA 3KP0A 2RH9A 4B16A 4RJEA 3HPXA 3SUVA 4ZO9A 1HXJA 3A6OA 5DY2A 4CD5A 3OBEA 1EF3A 4LYQA 2PP1A 4D6IA 4Z17A 5AHEA 5CPOA 3W26A 2HBVA 2ASHA 2XVLA 4E2DA 1GNXA 3TNBA 3AZSA 1BWLA 1YDYA 2EEXA 2GQAA 1JDAA 4G5DA 1W2PA 4CQBA 1SO3A 4LY8A 2VDHA 1HGYA 1WBHA 4KIRA 4V15A 4LF1A 1FWWA 5DCBA 1S5NA 1K7EA 4HHHA 3OHMB 4XISA 4FLOA 1WDSA 2V69A 4EVZA 2ZUVA 2ALDA 4FLRA 3WLSA 4JY8A 4YWIA 2C8NA 2GGHA 1XRVA 2A1YA 3LNMA 2G41A 4TOQA 2FMOA 1AQFA 4LC8A 1ZY9A 1J11A 4RV8A 4UCFA 5DMLA 3BW2A 3ERPA 2BHZA 4P2VA 3BARA 4U4MA 3BAWA 3S5ZA 3SCSA 4HMCA 3MW7A 4D2JA 3AIVA 2BGSA 3APYA 1OYCA 4F2BA 3N13A 2FZNA 1N2VA 2PF0A 4MM1A 3KOZA 4NAEA 3CUFA 5EMYA 1OT1A 1XWYA 5I2UA 1KCLA 4XAFA 1B3VA 3V4BA 4A6GA 2D69A 3ARYA 5DF0A 5PTDA 3ITOA 1YPIA 5BROA 2P76A 3CQJA 3ZT6A 1RJRA 4IF2A 2X2GA 1NSJA 3EB2A 1P0KA 1ISXA 3G6MA 3DG6A 1D3CA 2CYGA 1QRQA 2YW4A 3E2SA 2PLKA 1UZ1A 1Q45A 3TLLA 3KLKA 1O1HA 1T0OA 1EHAA 3ARQA 1IHIA 3OA3A 1REQA 2WSRA 1FWBC 4JEJA 2XUCA 1KLYA 1YE6A 3D3AA 3R0DA 1QASA 4Z2IA 2X30A 1V6UA 1PBGA 2OT0A 2PDBA 3GBEA 3AZTA 1J01A 4WSJA 4XKYB 3T2PA 1YBQA 4JQ4A 1Y7VA 3AMLA 5EMJA 1GVRA 5FD0A 4O1AA 3A4XA 2R1PA 3UGVA 4QG8A 1SO5A 5AHLA 3QPEA 1XLMA 3WNNA 4IFOA 5IHRA 2QCNA 5DFAA 3SIMA 5TAOA 3QQ1A 2G97A 1HP5A 1ODUA 4GRSA 1FXPA 3S2JA 1H61A 3NQAA 2E7FA 4D6EA 4IMGA 5JXQA 1G0CA 2GJXA 1N8IA 5D9OA 2VMFA 2PWUA 4DXVA 1SVDA 3ZFHA 3A24A 5HMDA 3TJ4A 3FKKA 1BVZA 1CW2A 4HSNA 3R8RA 2GOKA 1QI3A 4GK8A 3AXHA 1HKJA 1HGWA 3C86A 4HQVA 4LV9A 1V6VA 3PTMA 1PJ9A 2E5BA 1CB7B 4ZE4A 2XH2A 1F6KA 4Y90A 1KQZA 3U9IA 3RU8X 4GQ0A 2PRHA 4JQ1A 5I3HA 4INFA 3REQB 3W7EA 1XICA 1UR3M 1BG4A 1P7TA 3BANA 5GPRA 3V0SA 3LM3A 4RDWA 3MUIA 1AZ2A 2NXHA 3GXIA 4MTVA 5TNVA 4IFKB 3UNTA 3NSNA 3PB0A 2BOEX 3FXGA 1FCBA 4R53A 4P8UA 3ALGA 4PUWA 3V3WA 4HPGA 3OB8A 4LRTA 4I9TA 3V7PA 3HA1A 3R6IA 2YCLA 4DJEA 3Q67A 3W22A 1PSCA 2ZYFA 3AIRA 3OZPA 4AISA 1QT1A 1YE4A 2QULA 2DSKA 3HU7A 3GTIA 4LWWA 1PO9A 1DJZA 4NX0A 3T8LA 3M47A 3KW3A 1CGUA 4EAYA 2MUCA 1TE1A 4DB7A 2QHAA 4WUIA 4ZEPA 2FZ9A 1VBUA 4O1CA 4TTUA 2GUBA 3DFQA 3GTHA 2J6VA 1AD4A 1O66A 3RM4A 4RE4A 1OFEA 1Z32X 2Z25A 1RCOB 1XH0A 3UW6A 1UUQA 2ZWYA 1K6WA 5H8PA 1F4HA 3UZWA 3BG9A 3NR0A 4RDVA 3VNIA 4C5YA 4ZA0A 4W5UA 4MIMA 5HJXA 4GI4A 1A5UA 3PZIA 4FPSA 5I23A 3RR1A 3GVWA 4HZ8A 4PRWA 3LHZA 4UFJA 3E74A 5BMXA 2Z27A 1PIFA 1HFBA 5HNNA 3NXFA 2DPEA 1PDYA 1VZWA 2VZUA 2ONEA 2JF6A 4PMJA 2OTDA 3SSJA 4H6QA 2PDXA 4AMAA 3VNMA 3WQEA 4W87A 3T09A 4ZENA 1G4SA 2TYSA 3EEZA 3R13A 4RZ5A 3OLDA 1GORA 1XLAA 3PSWA 3K5XA 3UWYA 1TTPA 4NAEB 1P7TB 4AZHA 4JFSA 3WEMA 2G3MA 2DSVA 5IFPA 3EX6A 2XVKA 2ZZ5A 3DI0A 4YCPA 1VCGA 3BAKA 3PUDA 1XSKA 4A3YA 3F7JA 3MV11 3TTQA 3E5PA 1T8QA 3WF3A 4F8XA 3TX9A 4IOTA 3W2NA 4ES4A 5AC4A 2PODA 3W87A 2XGIA 4UNLA 5H1WA 1OF8A 3GVVA 3WDRA 2SFPA 3CEPA 4G6CA 2X09A 3MMTA 1LWJA 4S3CA 1WKYA 3UETA 4JTSA 4LSBA 3JS3A 1IEVA 2PGEA 3MYPA 4D6JA 4O4WA 3VDBA 2AQWA 1MXDA 2KZHA 3K8LA 3VCRA 3W1LA 1Q8JA 3T2OA 1GHRA 2REQA 3EWBX 1TIWA 3NQ2A 5DX7A 2J4GA 1ZL1A 3NQ7A 1UPMB 2RFGA 1UR0A 1EBGA 1XF0A 4DXKA 1HO4A 3HQPA 1H7XA 2E40A 2CIPA 5T26A 5B7ZA 1V79A 4MZYA 3ZMRA 5HBFA 1ECQA 3GNNA 2VHLA 2OU4A 4BQ5A 1JPMA 4KWVA 2I17A 2GVYA 2ANUA 3PNUA 3ZLFA 2FFCA 5I00A 4ZB5A 3WF0A 3GU2A 4HPJA 4YL2A 1EWDA 2C14A 4ILSA 2OPJA 2NQLA 8TIMA 1XIFA 2EPMX 4C65A 2VEIA 1WUFA 1RJPA 4NIRA 1FWNA 2BDQA 3CHCA 3CU2A 4AZ6A 1B3YA 1DKWA 1NF7A 3MUAA 3GVRA 3QZ6A 3QH2A 4W86A 5BXTA 4OBTA 2GQ8A 4DNHA 3RLGA 3MVIA 1EDTA 1KV8A 2ZA3A 1YRRA 2YDRA 4S3FA 3UXKA 1OCJA 2BG5A 3L0GA 4FF5A 1FWJC 3NQFA 2VD9A 4AEEA 4LYKA 4RDYA 4ADSA 2NLIA 2XU2A 2VEMA 1CWYA 1TPB1 3SCTA 4FOKA 3FKRA 1UQYA 3RX2A 4X22A 1KWKA 3A4JA 2ZRXA 4PL1A 2DSUA 2DT2A 1DOSA 4HK6A 4NQ1A 4QQUA 1UZHA 1L6GA 1OG0A 5BMWA 3RF9A 2INEA 2W91A 2CLEA 1PKYA 1IEIA 3BOLA 3SQMA 3ES8A 4RXFA 3F5LA 3PY2A 2VEFA 2E6DA 2OWWA 4FNRA 4J3VA 1D9EA 1NQ6A 4Z2HA 4HMDA 2ZXAA 3NM3A 3PJUA 4FR6A 1ME7A 2G4JA 2C1HA 3ECQA 4IM4A 1UR1A 3STGA 4MDOA 4RNFA 2Z29A 5A6BA 1LWHA 1EYWA 1UKTA 4O0ZA 4C6NA 3UXLA 2PMQA 4N9BA 5JUVA 3VGEA 3XISA 3AU6A 5FJTA 3FVDA 1QO2A 5A8GA 2XGZA 2WNNA 2RDXA 4UTKA 3GK0A 4UOJA 1V3HA 2BOGX 3ABSA 3DFOA 4HNUA 1W9BM 2O7SA 4M0XA 4GUFA 3W07A 4Y9AA 3RCNA 3A13A 4LUYA 1OM0A 2NQJA 2O7QA 4PSRA 4OOZA 4EF9A 3GU1A 2J78A 3KAOA 1TYGA 3M0YA 4TO8A 4E3TA 4L1XA 1VCVA 1POJA 2P1FA 3GH4A 1EL3A 3LHVA 1GCYA 3S1UA 5AKQA 2NT0A 1OYAA 1KGUA 1NDVA 4JQ3A 1Y65A 4TQTA 4QIUA 1E9LA 1MXSA 1LLOA 3UF9A 4JCMA 2JGYA 1TQJA 4M7TA 1GYLA 1YXDA 2Q8XA 3LBCA 1RVGA 3CV2A 1HW6A 1IQ8A 4NNBA 2WC4A 3UG5A 4F2TA 4S3EA 2IQDA 1NOWA 3NYZA 1GWJA 4JX5A 5K7JA 2PP0A 4AWUA 3VAVA 4M3PA 4XV0A 3WNMA 4HSHA 4NL1A 3W2UA 3WYZA 2OJPA 1S2VA 2QV5A 4KIEA 4I9JA 5GVJA 3HGJA 1BVNP 3QMRA 3WG6A 5HDRA 4YN5A 3POCA 8CGTA 4HJWA 1F74A 3R0KA 3I3DA 3W27A 2Y63A 2J62A 1WBJA 1XP3A 2ZX7A 4DO6A 3UCDA 1KM1A 1JCXA 3PZ9A 3UZYA 3TYZA 3SGUA 4CU6A 3RUBL 2F84A 3TYDA 2W61A 5I07A 1QPNA 5EBAA 2W27A 7PTDA 4KWUA 3ITXA 4JIEA 1T96A 3BAXA 2HE8A 3RPMA 4ATLA 2R82A 5IXEA 2ALRA 4MJMA 1TJ2A 3MMDA 4OBRA 4CNOA 1DXEA 3EKGA 3Q65A 1V6TA 3KVLA 1Q6RA 2DW7A 2Y7FA 3LI1A 5LA0A 4A3UA 3FGCB 1UR4A 2DZXA 4XAZA 4JBRA 4JN6A 4FAMA 3PZUA 1HIZA 4NRSA 3G1FA 3MKVA 4QXIA 3WD2A 1IZJA 3P81A 3VKCA 2OWCA 4JFVA 4QEHA 3LQLA 3DENA 4R34A 4AX7A 4PMRA 4LYPA 3CTTA 3W7DA 1K7XA 4JAWA 5FESA 3OBAA 4PUUA 3KBSA 1FX6A 1NDYA 1QNRA 1PHWA 1BYCA 1POKA 4IISA 3IJIA 4F2UA 1GTEA 2FPVA 1XIGA 1VIWA 3M4HA 4JTIA 6XIMA 3LPPA 3UESA 3ARUA 5K3VA 4NNCA 4H7CA 2X1IA 5TBOA 3HMJG 1B9BA 4ZB2A 3VKKA 2X8RA 3GXDA 3UEQA 2VR5A 3UG3A 4S39A 3BXWA 1DWAM 3UD6A 1US0A 3OGRA 4DLMA 3M5XA 3FLUA 4W8LA 3VX0A 3SDOA 3JZEA 2C1IA 3VD3A 1MDLA 3EWUA 4V2XA 3C3UA 5A8PA 2C6QA 3P74A 1CCWB 3M7SA 2BHUA 2O9TA 3OG3A 5CQ1A 3EX4A 5AECA 1W3HA 1HJSA 1H60A 3E6EA 3DFTA 1WXJA 3H53A 2E8YA 3NZGA 2G3IA 3UWQA 3ZWTA 5I5RA 4B5SA 1DPMA 1OCBA 4C90A 4K2SA 4LUTA 1NDWA 4BK9A 3VD5A 1E6NA 3W7NA 1Q6FA 1UP0A 1FWAC 2V0TA 3HG3A 1P6CA 3VI2A 3WDHA 1OFRA 4NJIA 2NV1A 3BK0A 1V6WA 4XBJA 4O11A 3W7CA 3AJ7A 4WKHA 3T1GA 2V9DA 4RR4A 2DQXA 2Z26A 2XFRA 1MRAA 4ZXOA 1KTNA 1YTEA 2PCEA 4M80A 1WXYA 3CASA 2XSXA 3BO9A 3K2GA 2E5DA 2X0YA 4FNQA 3DCPA 1H7PA 1A0EA 2Y7EA 3WBEA 3HMCA 3I68A 3H54A 4N42A 3E9AA 4H8VA 4C6BA 4JS3A 1S2WA 4M81A 1TJPA 3EWDA 2QT3A 3ZO9A 1W5OA 5T91A 1OK4A 4JFTA 2VOMA 2AMGA 3R94A 2UY3A 4MYXA 4IGMA 4JYFA 1U1JA 1BAGA 1KV5A 3PJTA 1IT7A 1U22A 4QCEA 3R0UA 2QV4A 3KZPA 4G8TA 3MHUA 1AJ2A 4WY0F 3GRIA 3GVGA 2RDWA 3ME3A 3FEMA 1M01A 5AC6A 4PODA 5FKYA 5E6ZA 1JI1A 3Q45A 4ICCX 3SN4A 1UP2A 3BLOA 3I3BA 1JXJA 2V5KA 2EQDA 1QI4A 1SO6A 4CEXC 2WC7A 4MUPA 1VQTA 1KRCC 4QTGA 5BRBA 3PUEA 3S6OA 2HV5A 3AI0A 4L9YA 3AAMA 3KM8A 3T78A 1VB9A 2HEJA 3FSTA 1F3XA 2ZUUA 1VJIA 3BPWA 3XIMA 3E12A 1PDZA 2YBVA 2D3LA 3BOFA 3PZOA 2V5LA 1BEUA 3FHQA 1V8EA 3C8NA 3BQ5A 2V67A 4WOZA 3FOKA 1H62A 5CBJA 1R3QA 1JAEA 1ZJHA 1R85A 3ISIX 2Y6ZA 1GZJA 1HKVA 3TZNA 6ALDA 4MHBA 4IQLA 1JCLA 1KM5A 1E6QM 4WJXA 1PIIA 3NSMA 4K1GA 1CDGA 1LUCA 3LHUA 5DBUA 3WQCA 3KVKA 4S38A 3UJEA 3TQPA 5REQB 3UJ2A 5KZDA 3APTA 1TVNA 3TONA 3GZ3A 1PTAA 2X1SA 2WZIA 3OGSA 3EOLA 1A0DA 1JFXA 4ZO8A 1L9WA 2X0SA 5RUBA 1NFBA 1XLCA 2YFNA 1XLFA 1U2YA 2EPNA 3LDVA 1YPXA 4J4KA 1UP3A 3FJ4A 2VELA 5B7YA 1CX9A 3WD1A 4ECLA 4JKKA 2GSHA 1UZ4A 2A7NA 3S1XA 4XAYA 4JX4A 1W1B1 4J2PA 2PTDA 3NZ1A 4FO4A 4TVDA 2PDYA 3I6TA 3QY7A 1J12A 4E2OA 3FAWA 3F2DA 3VC5A 5CPNA 3N2TA 3PZVA 1Z9AA 2NUYA 3AROA 1JG9A 1ZALA 9XIAA 3OA5A 1K7FA 4IP5A 1JYNA 2X1UA 1GVFA 3UG8A 4C6MA 3VINA 3M0VA 1RHCA 4CGTA 3PBGA 3LRLA 3UPBA 1PHQA 2PLJA 2Z0IA 1XLEA 3MV01 4LRSA 2TMDA 1J10A 1H0IA 4UFKA 5F2MA 5F2GA 2YA0A 4QSFA 3WDIA 1WDQA 4LXFA 1CGVA 3CO4A 3LN3A 3NQ6A 4DBWA 3QC3A 2J9YA 1IF2A 1GVEA 3M07A 4C7FA 3TV8A 2CLOA 1EH9A 2TSYA 4ACZB 3BGAA 4W9TA 1FFQA 1UA3A 2WKJA 3QGVA 5HMFA 1CECA 4FX8A 3W1TA 3MANA 5I24A 4K36A 2YW3A 4IIHA 1QPRA 1I2OA 4PZVA 4ML9A 1TZ9A 5HXMA 3H55A 1SSDA 2HVNA 1OCNA 1XLBA 4D9PA 3MKKA 1FCUA 2ZDRA 5C9UA 4HZ6A 1JRCA 1WDDA 3COTA 3O9NA 2ZZ4A 3VOIA 2ZZ7A 3G77A 1H1NA 4AZ5A 3TOPA 3GW3A 2QMKA 2VRQA 3GIPA 3GDKA 5DT5A 1V0MA 3PBWA 2CETA 3M0JA 3L12A 3IJQA 2DVUA 3E0FA 4PGLA 3GNOA 1UD3A 1S2UA 1ZAIA 2V3EA 5DMMA 4Y6GA 1BQGA 4CD7A 1PWMA 2VP8A 3LU2A 2G4FA 1OG6A 3TCEA 2OQHA 5DEZA 1C8QA 2EPOA 1I2RA 4MSSA 1ZS2A 4HGXA 2W9MA 3CAWA 1TV5A 2EAWA 4IQEA 4G1KA 4PR4A 4REQA 4YVXA 6A3HA 5AYBA 3RXZA 3ATYA 1XRSA 3NQDA 2VOTA 3BG5A 5CPSA 5CC3A 4GX8A 1TVLA 3QC0A 1BSLA 1K9DA 2CLLA 2VRKA 2VCAA 3GXPA 2I9UA 3CZJA 2R1MA 3ALFA 4AZCB 4D6DA 2G95A 1VHCA 2WZMA 3CAKA 2HMCA 3OHIA 1XYBA 2R1KA 3WD4A 3KZSA 2YPIA 1C90A 1LBMA 3CV6A 1ONRA 4Q4MA 1F76A 2PWDA 4LCRA 2FLIA 4V33A 4GZ7A 4MWAA 2V3GA 2WSQA 2YDAA 2A79A 5F1UA 4F4RA 1B3OA 1ZGDA 2DZSA 1WKFA 3CQ0A 3GDLA 3NUKA 4IICA 4Y8FA 2QJGA 5FJRA 1O95A 2QIWA 3H24A 4LCSA 3C8FA 1UJPA 2X1TA 3RYSA 5KZEA 2V81A 4AY8A 1DJQA 3W00A 4FNTA 1CEOA 3KRSA 2PPGA 5HULA 2ICSA 2XM2A 3SAZA 3VABA 3U2ZA 4KF1A 2DZWA 1F5ZA 3USBA 6REQB 5CLTA 1L6FA 3VUPA 4P5UA 1Q7MA 4W84A 4PRRA 1OFAA 2CHRA 3TW9A 1ZBWA 1UWSA 4Z1BA 3CO8A 2DU2A 1L0PA 4IQDA 4S3AA 3WFZA 1E6ZA 4C6QA 2J7EA 3S9IA 4L9ZA 1EGZA 2BY0A 4R33A 5T9CE 4TU1A 4ICNA 1TV8A 4HK5A 1FKWA 1CXEA 4MMWA 4MNLA 2O4MA 2OYMA 4JKLA 3G1RA 1NDZA 3PF3A 4J27A 1FOBA 3I6RA 4A2RA 3QV8A 1TTIA 3AYRA 4BWLC 5FEZA 3EOUA 5LNRA 3QHNA 3GNDA 3QHMA 1MZRA 4JOMA 1SZEA 2W3ZA 3DBNA 1PYMA 1JZ3A 4UFHA 2OR2A 4HU0A 1OK6A 1AJ0A 3ZSSA 1WZKA 1S2AA 4NXKA 4EPEC 3Q94A 2W67A 3W7RA 1OC7A 4ZQRA 3GZAA 4IFRA 4R5EA 4MAVA 3IV8A 2HE5A 5C9WA 1MW1A 4NKCA 3W37A 1CLKA 2ZZ2A 3E0WA 3VVGA 3CPGA 1AJZA 1GONA 1LRQA 4PTXA 2VX5A 3L7RA 4FNUA 2XISA 4YPJA 1TSIA 2D2OA 3AIBA 4WF7A 1RP9A 2H90A 5DN1A 2FYMA 1VENA 4GBDA 4RPQA 1ZBKA 1MDRA 2TPSA 1A5BA 2PZNA 4E0CA 3CIVA 3GDMA 4O57A 2J79A 1E0WA 5EMUA 5CLWA 1ITXA 3FYOA 1AK5A 3TEVA 3U2CA 4PMDA 1I6NA 1YEYA 3MYOA 3PB2A 3AWOA 3IGSA 2CBJA 5FF7A 3A4WA 2XH0A 3LY0A 5A95A 3T4WA 3NDOA 3UWUA 3VZZA 5D30A 2WBGA 4NZ3A 3DFPA 3W2MA 3ZLGA 3W02A 2QKFA 4M7SA 4Q8OA 3W25A 3MUY1 1V77A 2WZEA 3LTYA 1DJNA 3MCOA 5EFFA 5BRPA 3LSCA 1CENA 3FIGA 1WZAA 5A2AA 3VIHA 3N6HA 3T9PA 2X2YA 3PJWA 4JYDA 2V5CA 4DF1A 4XKYA 3CUJA 2VJXA 3E2VA 4LV4A 3T0AA 3WJSA 2WJFA 2A4AA 4UTUA 2CNCA 4LNCA 1JCNA 4HPNA 4KFNA 1VFHA 3LOTA 2FZMA 4A8LA 3R1ZA 4FIQA 2PRMA 5C0QA 3I3EA 3MO4A 1E56A 4HSOA 1WB0A 1Z42A 1B2YA 3LHYA 1L2QA 4CN6A 4HN8A 1NY1A 1EUAA 3CT2A 2TRSA 3W6MA 1ZENA 2E3ZA 3DFYA 4AEFA 1UYQA 4E8CA 4ZOEA 4MWAE 1UG6A 2V38A 2XGBA 5LGZA 3QRHA 1OHLA 1GKQA 3QF0A 4EACA 1BKHA 1ZJIA 2R94A 3KBNA 4L6HA 4RX0A 1VBGA 2DT0A 3ZSTA 4M6VA 3EDFA 3QKZA 3UY7A 3DZ1A 1EOKA 4AIOA 5HR6A 2FIQA 2PDWA 2DQWA 3WQVA 4M5PA 1TV4A 1LORA 2FJUB 4DQWA 4PUNA 1SW0A 4KCUA 2FZ8A 4KS0A 2LLEA 1KBKA 4LT9A 4QM1A 3BMVA 4R7OA 3BZJA 4YTQA 5M17A 2RAGA 2YJQA 4NYUA 3LZ5A 3E96A 1J6PA 3GC2A 2VFGA 3LPOA 4Q32A 3AO0A 3ZJ8A 2RKXA 1RCXB 3NO5A 4L6OA 2NSXA 1TPH1 2WBKA 1I2PA 2XZ7A 1QBAA 2Y62A 3I6EA 3G8EA 3C0SA 2J7BA 3EPOA 1KBIA 3P2VA 2FGBA 2QJIA 5TQLA 1HT6A 2BY1A 3APGA 5FIPA 3CHFA 3IK2A 1E55A 3WQ6A 3STEA 3QR3A 4QJ4B 2QYGA 4XQ6A 1GPFA 3NVDA 3L0KA 5C7HA 1G7UA 1DHKA 1W54A 2J47A 4X2RA 4PB4A 1OCQA 4XZWA 1Y8BA 1WX0A 3C2YA 3D46A 4JIRA 2XSBA 3O2LA 4EXQA 5JVLA 3LCXA 1OFQA 2A3BA 4AIBA 1REQB 1W56A 3K13A 1UD6A 1ZUAX 4R7JA 1P0NA 3CC1A 1V7YA 4U33A 4WOQA 5MKGA 4KETA 1RA0A 2WPGA 2Y24A 5TIMA 4GVIA 4HNOA 3I7RA 4DJFD 2OO0A 1AMKA 3DG7A 2VRJA 4US5A 2VZVA 4PMQA 4A3QA 1TPUA 1YMYA 1JDEA 1OFBA 4GYPC 2QDDA 3WL0A 3GXFA 3K4AA 1QBBA 1RH9A 4K8GA 4IJRA 1VFSA 4LH8A 1B5TA 4S3DA 3EB4A 1QNSA 1DYSA 5A5WA 4KEMA 4TX9A 2ZA2A 1VFTA 1VIZA 3MUZ1 3EWYA 3R25A 3W7QA 2VFEA 4LW7A 3RMJA 2WAGA 1HKKA 1LOSA 3Q2DA 3SFKA 4H41A 5HNTA 3AICA 4YYFA 2Y5EA 1L6WA 5BWAA 4PMYA 1XIJA 3LCGA 4DJFA 5F7UA 1AFSA 5E09A 3PPCA 4C1KA 3H2CA 4I90A 1J5TA 1C8YA 5FA5A 5BCAA 3SUSA 4Q7NA 5M1TA 2IXUA 5FAJA 3AZRA 4H4IA 3VDHA 2D0HA 3ZXWA 1TTJA 4IIGA 3MSYA 1TMQA 2GL5A 1J6OA 4IT1A 4Q4KA 3KTSA 1EJRC 3G0XA 4E8GA 3UP8A 1OFPA 3OG2A 3URNA 1U83A 1E4IA 2CBIA 1IXPA 1VKFA 1S1PA 3IIVA 2OGYA 4DJFC 3N15A 2V63A 5C6MA 1TKKA 3WL1A 4DUOA 1LG2A 2AMXA 1IIGA 1ZSXA 1Q6DA 1X39A 4WSHA 3T0BA 1EJ7L 2G5WA 3GUGA 4DXXA 1F07A 1T41A 1Q3NA 4E3VA 4HTBA 3VZXA 4LNYA 4C1NA 5LNWA 4HU8A 3N6JA 3W85A 3THCA 1NAL1 1DXIA 3CL8A 1PTDA 4X0NA 4GY7A 2GK1B 3UJRA 1VD6A 3B8UA 3EPMA 4O14A 2NXGA 3JW7A 3FK4A 1WZMA 1MUMA 2IPWA 4JTHA 2JF7A 4O0KA 3MI3A 1NWSA 3TW7A 5H8MA 3C2RA 1JCMP 4P7LA 4GMEA 3WF2A 3W7MA 2Z6IA 4CLMA 4P8VA 1LT8A 4GNJA 1AG1O 3GTXA 5FJPA 3UZJA 1TREA 2NX3A 2BXVA 3FY1A 1UOZA 3CZEA 4KEZA 3NOEA 5IFTA 3H26A 1QDSA 3G1AA 4L61A 2XWDA 3H2OA 4I6VA 4DEFA 1CGXA 2E9BA 2GUYA 1WQ5A 1A5MC 2PBOA 3QV7A 3Q37A 2CHNA 1T7LA 4G1NA 4EXBA 1Y5WA 3LENA 4DWDA 4C60A 1Q6LA 4CQ8A 3LV5A 4PUJA 3VO0A 4Q7BA 1LTDA 2HPIA 2OYKA 2Q8ZA 3AC0A 4HHPA 2W0UA 1A3XA 1OT2A 4HNNA 3VM7A 7TIMA 2QS8A 1DWJM 4JL2A 1MO0A 2CLIA 3BH4A 2J24A 2EJAA 2PDIA 2ZZ3A 3TXVA 5AC5A 1EDQA 4IPJA 3AOFA 1OVDA 4V28A 1P1XA 4O52A 4GCAA 3IVUA 5KMYA 1DE6A 2X7VA 1ITCA 1NEYA 3P8IA 1XLGA 1PCKA 2FGZA 4XTIA 3MJYA 1XLKA 4KPLA 1WDWA 5D32A 1X7IA 1NIUA 3H6OA 2WZTA 4MJ4A 4LVFA 4IMCA 2HCVA 4FXSA 1ME9A 1LDCA 5BZAA 1JDDA 3IJ6A 3MWAA 4Y7EA 2PE4A 3PJXA 3VX1A 4WZHA 4IIFA 2QDEA 1J96A 3E3HA 2FZDA 3IARA 4TVCA 1ZB5A 4FHAA 2CWNA 3N3TA 1XCXA 4CQAA 3DC8A 4UR8A 3GG1A 2IKJA 2BBFA 2B7PA 1QJWA 1Z3NA 1XL9A 2W5FA 3E38A 3PPHA 4CCZA 2B7NA 4JTQA 4NU7A 4ROQA 2F61A 5XINA 3G8RA 1ZQ5A 3KX6A 3P6LA 3W2JA 3IPWA 3P14A 4S2BA 2DIEA 5DLCA 3DUGA 4AD5A 2CHOA 3EX2A 3WUBA 2IKHA 2NXIA 1FWHC 5I03A 4E4FA 3WH5A 2WSYA 2QCDB 5HJLA 5A94A 3W1MA 3EYPA 3NQBA 2ZX6A 3R7MA 1R3SA 1WAWA 3CZGA 3TWBA 1XRFA 1A5NC 1P0DA 4G9PA 1MSSA 2YL9A 3CHVA 4P7QA 2BTMA 3OVRA 4GUGA 1BQCA 1ISYA 3B8DA 2J75A 5HQMA 2WHMA 3EX3A 3AALA 4NZ4A 1DIEA 1EHNA 1Z41A 4KCWA 4N6FA 2JKEA 4UTTA 3PWAA 4IHCA 3A5FA 2XZ9A 3G5EA 3AMGA 4DWSD 4B5WA 3CUHA 3EWWA 1H50A 1QPQA 1ONEA 4RCXA 4LB4A 3VYLA 4UQBA 5F2IA 5AYXA 4ZB0A 5AFDA 1JZ6A 2GWGA 1BGAA 5C9ZA 2OLSA 2VFFA 1S5MA 5A8OA 3FYPA 1D7FA 1DQWA 1SZFA 1L8NA 3KXQA 3ABXA 1I9CB 1UZDA 2ZUNA 4WY0B 3FVMA 2WMFA 5BNKA 1S1RA 4D1JA 4JTTA 2GJLA 3B05A 2R8WA 3VC6A 2C15A 3MBFA 2ZDSA 4J3XA 3WLQA 2C3ZA 6TIMA 3EOSA 1AW1A 1E1CB 4NT0A 1GOKA 1UR8A 5EY5A 3A23A 3CUGA 4DJDD 1VH7A 4HTYA 1JPHA 3VK5A 3RITA 1XYFA 4WDUA 1QNOA 3GBDA 1AQ0A 1RA5A 3TU9A 1EC7A 4GNVA 2XH7A 4Z2LA 2X16A 2WVSA 5FF0A 5A8NA 1XGDA 4HOZA 2PWEA 2DVXA 3RRXA 5LIYX 3L68A 4GGHA 3LLDA 2OKTA 3AFBA 1GOXA 2WZHA 4TVUA 3UA3A 5CSUA 3GFYA 4IFKA 1W3TA 4GQBA 1VBHA 4PMOA 2CXEA 4O8RA 4ZZ9A 3PAOA 2WB5A 3KL5A 3C2FA 1YNYA 4OZOA 4QJ1A 7TAAA 2WHLA 1ZZMA 2V8ZA 4NY2A 3GIQA 4C6DA 1E9IA 2ZVIA 1IEQA 2O92A 3BGJA 1LBLA 4GISA 1CGWA 1Q6OA 3HFYA 1IT0A 1RXOB 1UKSA 2GWNA 3TZFA 3G0UA 2QEZA 1SJCA 1LT7A 5DMYA 3OQEA 1KLZA 1XG4A 1HZYA 1LL4A 4OIFA 1UIOA 1XIDA 3EB3A 1XV8A 3N2XA 3H21A 3NPWA 1JIBA 3P3BA 1R9XA 2UY2A 2WWDA 4DY1A 2OT1A 3CQIA 3FDGA 5H8UA 4HIBA 3SCQA 4DM1A 4GUHA 3BAYA 4XWUA 2NSOA 2BV9A 5FSDC 1CXLA 2XIOA 4DWSA 1ZCOA 1RBOB 5CBIA 4DPQA 2YCJA 5BOEA 3TN5A 3P82A 1IWAA 3R89A 4W93A 3ZWSA 1NF0A 4A4AA 2EG7A 3ARSA 1SR9A 3KLLA 4ZQMA 3R5EA 3HO8A 5A8QA 4HMNA 4UTLA 1VYRA 2XYLA 4GA8A 1J79A 2J7CA 2R1LA 2B4GA 3EWXA 1K6AA 3H4XA 3VIOA 1TPC1 4RXGA 1RV8A 3BLLA 3VD9A 2IKGA 2C79A 1ZP4A 1FP9A 3GAYA 1BXBA 1WKEA 4F0RA 4QBXA 5A6TC 2P0OA 1T40A 4BQ2A 1AW5A 3RMEA 4AFYA 3GVQA 1ADOA 1MQQA 3NFUA 2HDJA 1HX0A 1TPWA 3MI2A 3PTDA 2IXVA 1V0KA