3KS6A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 1.80 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
250
Chain Sequence
GMTRIASHRGGTLEFGDSTPHGFTATAAMALEEVEFDLHPTADGAIVVHHDPTLDATTDMTGAIVDMTLAKVKTATIRYGAGSHPMTLEELCALYVDSHVNFRCEIKPGVDGLPYEGFVALVIAGLERHSMLERTTFSSFLLASMDELWKATTRPRLWLVSPSVLQQLGPGAVIETAIAHSIHEIGVHIDTADAGLMAQVQAAGLDFGCWAAHTPSQITKALDLGVKVFTTDRPTLAIALRTEHRMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (17743486) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.80 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Hydrolase
total genus 85
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3ks6A00
1DJGA 1DJWA 4S3GA 1O1ZA 1T8QA 2OTDA 5T9CE 2ISDA 1ZCCA 1PTGA 3H4XA 4I9TA 4QJ5B 3KS5A 4OECA 3OHMB 5T9BG 6PTDA 1DJHA 1GYMA 3QR1A 3NO3A 4I9MA 3H4WA 4RW3A 2P76A 4F2BA 2ZKMX 3V1HA 1DJXA 3KS6A 4QJ3B 3CH0A 1VD6A 1V8EA 5PTDA 4GNKB 1DJYA 4I9JA 4I8YA 1T6MA 3L12A 2OOGA 3PTDA 2PLCA 4F2TA 4I90A 4QJ4B 7PTDA 4RW5A 2F9RA 3QVQA 4PTDA 2O55A 1DJIA 1XX1A 2PTDA 4R7OA 3RLGA 3I10A 3MZ2A 3QR0A 1QASA 1AODA 2FJUB 4F2UA 5T91A 1DJZA 4Q6XA 3RLHA 3V18A 3EA3A 1YDYA 4RV3A 2OR2A 2PZ0A 1PTDA 3EA2A 3V16A 3EA1A 1QATA
chains in the Genus database with same CATH superfamily
1TZ7A 1D9EA 4WHBA 1RA5A 2BS9A 3MWAA 3OLGA 1V93A 2FFIA 1BTCA 3F2BA 4E3TA 1EYWA 5A8MA 3U9IA 4KEVA 3ZLGA 4R33A 2I5QA 1HL9A 1NU5A 4JICA 4JTHA 4WR3A 1GJUA 2BY0A 1XLDA 4F2BA 5EMKA 3TFCA 3GXIA 3HQNA 3ZLFA 2GGHA 3UESA 3GU9A 1O94A 4DBDA 1TPWA 2XUCA 1E72M 4AY7A 1YTEA 3QPEA 4X2PA 1FCVA 1XIJA 2BMBA 1UKQA 3A24A 3F5LA 3KWXA 1YNPA 1SSGA 1DXEA 2Z6JA 4LYKA 3S47A 1ZP4A 3VGBA 3VD5A 2XFYA 1EOMA 1Z42A 4HU4A 1CGWA 3UGRA 4IMAA 4PMYA 1A5SA 4S2BA 3ZWTA 1XM3A 5DANA 1G4SA 5D9OA 3L5LA 4B91A 1XLEA 3UZ5A 4GXMA 3GXTA 3P6LA 4ACYA 4JN8A 3GVRA 4QP0A 5LNSA 2RDUA 4AZIA 3H54A 4R7JA 3AU2A 5LSMA 1IWBA 4LV9A 4NZ5A 4GYKA 4H8UA 2WV8A 2Q8ZA 4B3KA 3B03A 3E02A 2VX5A 5E93A 3M6DA 3OBAA 4LGXA 4GKTA 3Q67A 3LGDA 4LCQA 4AF0B 1CXIA 1KO0A 3L2LA 4H2HA 3SJ3A 2BDQA 3Q4DA 3PM6A 1JZ6A 3GUWA 2D24A 3W1QA 3DI0A 2VM8A 3NEVA 3TYDA 4NASA 1YX1A 3H4GA 5HXMA 3BPWA 4NP7A 1SW7A 7REQB 4IUOA 2J78A 3NYZA 3SCWA 1DJYA 4IG2B 4WJ8A 3W2LA 3ZR4A 3NM1A 5LXEA 1XH0A 4W5UA 3WH7A 1TVLA 4BJHA 4V2XA 1L6GA 1YTDA 1A5OC 3LYEA 3U7BA 4AC1X 3MQTA 4DY1A 1C3FA 4OE7A 2NXIA 3WQVA 4XUGA 3P3BA 3W2JA 2YW4A 1EF3A 3S5SA 3AS0A 1F4AA 1TPB1 1SZGA 3A47A 3JS3A 1JYNA 4O14A 4GVFA 1CYGA 4BKNA 2PWFA 4V1YA 2GYIA 3WJYA 1JD9A 4N02A 2X7VA 2VX7A 3G5EA 4HOWA 5TF0A 2XM2A 4DPPA 4XD4A 3W7LA 2PDPA 4B4FA 1WCGA 1W91A 3F4WA 3GVVA 4KT2A 1IR2A 1RQBA 1QJWA 1QBBA 3B8DA 4WZHA 4NT0A 1PX4A 2AOSA 5D2YA 2DZXA 2ISWA 3TMQA 2C71A 4BF7A 2WJEA 3TAKA 3VIIA 3LGEA 4RDWA 5I6SA 2J66A 3I7SA 2D0FA 2CERA 4O1FA 3D5HA 3M1ZA 1G4EA 4HK5A 1TZZA 1SSDA 5DY3A 3IK4A 2J7CA 3MYPA 5LNRA 1IZCA 2XGZA 5DMLA 2ZKMX 5AKQA 5E0FA 3FHQA 3CH0A 4ROQA 4IIBA 5I78A 4AD1A 3RU8X 3M0XA 4DWSB 3V7PA 5HJYA 2GQ8A 4X61A 3VDAA 4F0SA 3I6EA 3CBWA 2HZGA 3E74A 1Q6CA 1OZMA 1MFUA 5DF0A 3EWBX 4PMJA 1K03A 4KCVA 1WA3A 1TMHA 1OY0A 1SU5A 4NJGA 5CBJA 3U0HA 2PWEA 2V69A 4GVHA 1TWIA 3W1XA 1OIFA 4QNWA 5AB3A 4LUTB 1AMKA 1F6YA 4UTTC 2E1WA 2XFWA 1EEXA 4H7ZA 4UOJA 1KGWA 3QZEA 1C8YA 3MUAA 3LPPA 1UKPA 1QCWA 1KKRA 1N82A 3VDGA 2GQ9A 3NSMA 4TMBA 4HHHA 1GYNA 1XIMA 1YNQA 3Q65A 2ISFA 3MV11 1C7SA 1JCXA 4GWEA 3M0JA 3LSCA 1A50A 3KHDA 4PBEA 3ABQA 4NY2A 1M7XA 4N4QA 1E0XA 4AZGA 4KERA 3W37A 4D8ZA 3KZSA 4DO7A 2H3DA 5KEZA 3IV8A 2PU1A 3MMDA 2XIQA 1C8XA 1EX5A 3IIOA 4GQGA 2Y5SA 1FCBA 3BLKA 3L66A 5AC8A 2Y1HA 1X6LA 4Q3MA 2CWNA 2Q3OA 5I23A 1T5AA 4M1RA 3LERA 2MANA 3L12A 3R6IA 1Q7QA 1ZAJA 1DPMA 1GJWA 1F3XA 1V6VA 4JTRA 3CT7A 3O7UA 3IUDA 3BANA 4PUEA 4X9YA 3GNDA 1GUVA 2V2CA 3N2CA 5KZMA 3SCVA 3P74A 2HVOA 5C9WA 2I5IA 2E9BA 1VBGA 4FNUA 2WVVA 4BI6A 2VO5A 1W17A 5BXTA 2WK2A 3PG9A 2J8GA 4UR9A 1F61A 1MRQA 1AVAA 3QKEA 4HK6A 1FWHC 1F4HA 4P7NA 4GJ1A 3T0BA 1RCQA 2J9ZA 2Q02A 2VD9A 4MWAE 2FGBA 4JIHA 1GW9A 4C6DA 1TTPA 3MMTA 4U31A 3KW3A 3TROA 2OT1A 4J4KA 4IGMA 2FIQA 3B40A 3INPA 4NUWA 1YE6A 4ATWA 1A5KC 5HBFA 4RNIA 1ONXA 3ZSSA 4KBXA 3WQPA 5CCZA 1IT7A 4OV4A 3NL3A 3LCXA 4XZBA 1FWIC 1RBAA 3OA3A 4WJEA 4GZJA 4UNLA 3UVAA 2CKSA 3MSYA 1H50A 1KW1A 4HVXA 2VP8A 2F2KA 3OBEA 1XIGA 3T4WA 2IKIA 3W85A 5C71A 4Y9PA 4YVPA 2ZX8A 1VFTA 4S38A 4XZIA 1M41A 2J8FA 4XZHA 3AHYA 1FXPA 1NOUA 4HPNA 3WD2A 3PUDA 3NIYA 1H63A 2O9PA 7XIMA 3VILA 3BC9A 2Y70A 1J0KA 3H23A 3E2VA 2EG8A 2VFHA 1XR2A 1XD1A 1B3WA 3Q58A 2ZRVA 4GCXA 3QYQA 3VPLA 3WQEA 3QTGA 4HSHA 1KV8A 4C90A 3HTWA 1MMFA 4MADA 5FD0A 1JAEA 1FY6A 3E2QA 4DIAA 5FOOA 2OU4A 4A29A 4PULA 3U4AA 4M7TA 4NRSA 5DXYA 2E09A 2ZADA 3CV2A 5I03A 2YBVA 1W8SA 1EGMA 3S5OA 2Z29A 1P1MA 3HG5A 3ZQ9A 1VLIA 3DOPA 3N34A 4GVIA 2PFHA 3CMJA 5FSEC 3LS9A 1OK4A 2HPMA 2V81A 3NOYA 4WCJA 2EXOA 4FF5A 4ZQMA 1VEPA 4GGBA 3TR9A 3WNPA 1E70M 2BLEA 5LNVA 4MNJA 2W62A 5TIMA 3E38A 3WL0A 3CC1A 4TVUA 1CXFA 2HWGA 2Z26A 3LU2A 1H7PA 3QN3A 3SCNA 4H9XA 4R34A 3LMZA 3AHZA 3W71A 1E4IA 4L6HA 3KBMA 3VGDA 4YTQA 4UQ9A 1UQZA 5D8WA 1GQJA 3N4EA 3FJLA 2PP0A 3QGKC 3BAYA 4JFWA 1H7WA 4GIEA 2CNCA 1FKWA 3CTTA 2ZUUA 4O4WA 4LV4A 1BKSA 2YL6A 3WLTA 1KTNA 4XAPA 5F1VA 1RXOB 1GNXA 1KC7A 1UCWA 4UCGA 1ECQA 3R4IA 1QK2A 3ARTA 2HRWA 2EF9A 2FGLA 2ZZ6A 2ZVIA 3SY1A 4CNSA 5EBAA 3UFYA 3WEOA 3QMSA 3GIPA 1OCQA 4TMCA 2EPMX 1E0VA 4QTGA 3PZMA 2OT0A 1KLYA 2E5DA 3BAXA 1KFLA 1WAUA 4QEEA 3P0XA 3LHVA 1VBUA 3ECQA 1E0WA 4PFHA 4PL1A 1R2RA 3K1DA 1O4UA 1F76A 3ARXA 3W84A 4JTGA 3TN4A 2FTWA 4NZ4A 2ZRZA 4HJFA 5IFPA 3IJ6A 2E5BA 4XTIA 1JJKA 1QPKA 1XYBA 1ZAHA 3FJ4A 2KAUC 4ERGA 2WQPA 1TPUA 3KRUA 4RXGA 3BOFA 1KRCC 2VI0A 4D6JA 2BZNA 1VFMA 4OOZA 3W1UA 4QJ1A 4LBRA 4CN4A 2PDYA 2JGQA 1BSLA 3KOZA 1E1FA 1BF2A 2IUZA 3TIMA 3XIMA 5D33A 4EF9A 2XVPA 3W1LA 3GFYA 1H1ZA 1UROA 3HB9A 3PWIA 3APTA 4PTVA 3S46A 1X6NA 3CXOA 1CENA 1Q4WA 3VCNA 3QM3A 3FOKA 3TJIA 4GGHA 3TTOA 1QBAA 2PDXA 4GFIA 1JI2A 3LB0A 1KD0A 2Z28A 4GLEA 3WMCA 1L6YA 3P60A 1XLHA 2I7GA 1PIIA 4PL2A 3L0KA 1E6RA 2YL8A 2G4JA 5CJ5A 4GUJA 3MVTA 4GIAA 3PPGA 2ZWZA 3WEMA 2D3LA 2X8RA 3PJTA 1US2A 2QHAA 4A8NA 4O16A 3S1XA 3EKLA 1FOBA 1QHZA 2Y24A 3M5YA 1DTUA 1SFLA 3BOXA 2YXGA 5A8QA 1G1YA 1QPRA 3BLFA 3W2NA 1UH4A 4OECA 1LTDA 3TQ0A 4V28A 4NIRA 1GZ1A 3KL0A 2JIEA 3NQAA 1E0TA 3SB0A 2D3NA 2G3FA 4XISA 1AJ2A 5TQLA 3TYZA 4UR7A 1UUQA 4HNTA 3ISIX 2XN0A 4IJCA 3M9YA 3KBJA 4JKMA 3AALA 1E6XM 2HNEA 5HK4A 1UC5A 3C4UA 3KEHA 1PZ3A 3ITVA 2XIJA 3HO8A 4UTWA 4AG0A 4RL3A 4RKAA 3IGXA 3MP4A 2OYMA 4ZCWA 3N18A 4X2RA 6XIAA 5FEXA 3II1A 4US6A 4LBUA 1SQ7A 1DKWA 4K38A 5AVNA 3RHGA 1UIOA 4F3HA 3HFYA 1VGAA 4IGHA 4ZXOA 1RH9A 2Y61A 5DRCA 3WBYA 4GMEA 4MKVA 5CPQA 1UR4A 1MQQA 2QZRA 4GE8A 3M41A 3WN6A 2B7PA 4EAYA 2YCLB 1IIGA 2C1GA 1H1NA 4I7VA 3UWEA 3QHNA 3DXIA 4PBFA 1XW8A 4D8AA 4CU8A 1EP3A 3OZPA 4LT9A 3KZPA 2GPTA 1W3KA 1V02A 3ZZ1A 3WDHA 5HMFA 4DUVA 6A3HA 4AWSA 3KTSA 4IMEA 4UZSA 1N8IA 1PUDA 3UT0A 3MO7A 1XGEA 4NKCA 1FP8A 1G5AA 3BCFA 5KINA 2JBMA 4F79A 3UWQA 4BA0A 3U2ZA 4WLCA 1QI2A 4QCFA 1SZFA 3PTMA 3ZVHA 1POJA 1R6WA 4MG4A 3RNDA 4DF1A 2IQTA 3WO8A 4BI7A 4I90A 1RBOB 5HWJA 1O66A 1NWUA 3OQ8A 4DXVA 3R0DA 3URBA 4TU1A 5IBXA 3IVTA 1DIOA 2NQZA 4XZMX 4C91A 2EKGA 3M0VA 4GX8A 3AXXA 4ZOBA 2IPJA 1F07A 3CNYA 2QCMA 3DIPA 1B90A 1RLCL 2I5GA 2TODA 4LALA 4HMEA 2WNZA 5KZDA 1EHAA 4WKAA 2BODX 1H7NA 1PKMA 4AY8A 1WNOA 2GVYA 4G8TA 1P6WA 2XM1A 1YYAA 2E1DA 4LVFA 2IW0A 4O1CA 1OWQA 1OC7A 1DWFM 2X05A 4I6VA 3BQ5A 3PFRA 5B7ZA 4XAYA 1PKLA 4KWSA 1PAMA 4XWUA 4JOMA 1P1XA 2HK1A 1JYXA 1LROA 4HJWA 1W5PA 2EEXA 2POTA 1UQYA 3BGGA 1S2CA 3I6RA 4DUXA 4IJBA 4Q8UA 4IP4A 1FCUA 4WJXA 4GOAA 3N4FA 4ZQPA 4IQDA 1UWAA 3ITTA 1EUNA 3A4XA 2VEPA 3QV9A 3EMQA 3NNTA 1L0PA 2GJXB 4NAFB 1P0BA 4C5YA 1W9PA 4BQ2A 2VGGA 4FXRA 1ITUA 2FDSA 4I9JA 2E67A 4F9JA 3SQLA 1WV2A 2Y85A 4QX4A 3ONBA 3FW6A 5BRPA 1JDEA 1FWJC 5F1UA 2VC7A 3DHUA 3CUFA 4WEVX 3AZSA 6REQA 3R11A 2JKAA 1BRLA 3P8IA 4ZQOA 2ZUSA 3CAWA 3BV4A 1B5TA 1DJIA 1A47A 3S42A 1H2JA 4I7UA 2D69A 2WLZA 4HQVA 5TAOA 1Q45A 4NQ1A 1W37A 2VRKA 2PDUA 1UBPC 2J62A 4J9JA 4C6QA 3GIYA 2OYLA 3MMUA 2OVLA 3CLMA 3PWGA 4CCZA 4MTVA 3UNTA 3NQFA 4J5NA 1I2OA 3BL3A 3TA6A 2PDWA 2QXWA 4MHBA 4TIMA 3KHJA 1ADSA 3W87A 3W07A 3MBDA 2ZX6A 1FDYA 2CXGA 1SR9A 2A7NA 3S0CA 4QM1A 1QFEA 2ZZ4A 3KBNA 3CIWA 1OABA 4C7GA 4HKPA 2WZEA 5C8BB 3MTWA 1SO4A 5EA9A 3LLFA 1KBKA 3MSDA 3AIBA 4YYCA 2Y8VA 4MUZA 1LJYA 2OZTA 3O6DA 5M03A 3VNYA 4GZ7A 3IJLA 3ZVIA 3PY2A 4JY9A 2D2JA 2FHCA 4UTUA 4NJJA 4JTTA 2VCAA 3QH2A 3W72A 4M1BA 3R12A 1W5MA 2PURA 4O13A 1GHSA 4Q4MA 3IGHX 2XIIA 5FF7A 4TX9A 4REQB 1BYDA 5EMMA 1KWGA 3EDKA 4L4PA 3U57A 2YXOA 5A69A 1UR0A 3TZNA 2WXDM 7ODCA 1G0CA 5F2IA 2EHHA 3R43A 3W7HA 1UWRA 3DH7A 4DLMA 2CESA 4IHCA 3FDGA 1MUCA 1X98A 1KCXA 2QKFA 4H83A 1G4TA 3CEPA 3TDFA 1BKHA 3BAJA 4M19A 4HYWA 2WZHA 3K4AA 3KE0A 3KLKA 4LYRA 1LLWA 3A23A 4ATLA 3LQGA 4RPPA 2X0YA 4DF2A 2A6LA 1P0EA 2C16A 3WEZA 3P84A 1WKEA 4DQWA 1K8XA 5JU6A 1TA3B 2HMCA 2Y8KA 1MVYA 3HMJG 3T09A 1RALA 4GI4A 2C13A 3IRSA 2XN1A 5EY5A 3TONA 1D7FA 5M5DA 3THDA 5I3FA 5FIPA 2FMNA 4CGTA 4F8XA 1RP8A 3ITCA 3EMZA 1WZMA 4FNQA 4PMZA 3NZQA 3OP2A 3TUUA 3QSRA 4RZ5A 4B3LA 3FA4A 3CZGA 1QW7A 2A7PA 4G9PA 3GTNA 5EB8A 1QI4A 4PBGA 3CUZA 3OVQA 4KCUA 4M0XA 1B9BA 3TW7A 2KZHA 3UY7A 3C3NA 1UZHA 2DT1A 2DW6A 4P8WA 3W6LA 1WQ5A 3QQ1A 4C6OA 4KWWA 3A5VA 3HGSA 3UA3A 3C2VA 5HR6A 4ZA0A 1FH9A 4P7QA 4BHYA 2EGZA 3WF2A 3STPA 1QR7A 3T0AA 3A3WA 3G1HA 2VUNA 3SY8A 1JUEA 2PSNA 1OZQA 3UA4A 4O0ZA 3RJXA 3OZOA 3ZR6A 2JF7A 4Q8QA 1H41A 1XYAA 5BRQA 3W7CA 2F61A 5H91A 3GC2A 1VRXA 4MWAA 4PZVA 4FNTA 4MWAC 4W86A 4WKFA 4FSAA 4H9UA 3MI6A 4I9AA 5I24A 4HPHA 8XIMA 3TV8A 4GI9A 1TX0A 5F4SA 1I8JA 5L6UA 2IKJA 3GDTA 2F6KA 1GVFA 3CV7A 4FEZA 4LU0A 1THFD 1TRIA 1TPDA 2A0NA 3IACA 2P88A 5CGMA 4KRUA 3RPMA 4QNEA 3CYVA 1FWRA 1J10A 3GTFA 1S2AA 3MUY1 4R53A 1SFSA 3B0XA 1QNPA 5BZAA 3TYAA 4AEOA 2QCDB 5BW6A 5FA5A 3WCZA 5J5RA 4HCLA 5T8GA 2OKTA 3H6OA 4AHOA 1BGGA 4QE4A 4P7LA 3VFLA 5E9AA 4AD4A 4JL1A 3QPZA 3K8KA 3PTQA 3M5VA 3DBNA 3QHOA 3MI2A 5BU6A 4WY0B 2VHLA 3DUGA 3V0UA 5J04A 1XSJA 4HMDA 2VR2A 1CX9A 3FDKA 5CZKA 2CC0A 3ZT6A 2O9OA 5IM51 3JW7A 3PK7A 1EC7A 2AL1A 3M64A 5CXPA 4AH7A 1BQCA 5A6TC 3DC0A 4H9YA 3VC6A 3HMCA 1CI1A 1WDSA 3H12A 1C9DA 5DCEA 2D22A 2Q8XA 3VMPA 1NSJA 2PCEA 3LCIA 3MWCA 2PRMA 2W61A 2PRLA 4IM4A 4DNMA 3WBWA 4PEKA 4BQ5A 1K9FA 1IQ8A 1ZUAX 1FWFC 4IIGA 3IK2A 3SCSA 1R9YA 1V4YA 4CD5A 1P0NA 2PWUA 2R94A 1F3WA 4GY0A 5G4WA 3AISA 1ZY9A 2ANUA 2BY3A 2R1PA 5LA0A 4UFKA 4JEJA 1ZP3A 4S3CA 4JQ4A 4PRTA 2QCCA 1ICQA 1XPYA 3F5KA 4JZ5A 5HOSA 5K3VA 3QVQA 3ANVA 3OA5A 3FYPA 4Q4SA 1I1XA 7A3HA 4W4QA 3CZEA 5H8PA 1S2TA 3N15A 3CUHA 5F2GA 2INEA 1D3CA 2E6AA 4XVDA 3MI3A 5FAJA 3DERA 2ZTKA 1R3QA 2CHRA 5FJIA 1XI3A 3R1ZA 4LUYA 4XBSA 3GQYA 1O5QA 1XGDA 1YXDA 3NZGA 2QLYA 2EG6A 5CZJA 1OCBA 4FX7A 3R7MA 4ADUA 4PMOA 4YTRA 1U1UA 3AHVA 3FNDA 3ZYZA 2V0TA 1OHLA 4J3VA 5BROA 2YZ5A 3EGJA 2INZA 4H7VA 3WBAA 3S5YA 1DQXA 1ECEA 5FSDC 4S3GA 3KP0A 4DYEA 4NNAA 4A6GA 3SRDA 2BY1A 1FWNA 1XLLA 1UR2A 3MB9A 4HU3A 1NAL1 3TSBA 2XIOA 4JIQA 3KXQA 3LX9A 1TV8A 4NZCA 1TPH1 2PGFA 1S39A 2BHZA 1A49A 2P76A 2ZUWA 4NRRA 1UOZA 1V6TA 3S5ZA 1JCNA 2OSXA 3W6YA 3SIZA 3GTXA 2PDKA 4L65A 5I5RA 5HUOA 1E4MM 3R13A 2E0PA 7PTDA 1X8CA 3PBVA 2QF7A 3E0IA 1ENUA 4XKMA 5FKYA 5JVLA 4RDZA 4KRTA 3ARVA 4EXBA 1VHNA 2NQ5A 4G7EA 3O06A 1LQ0A 3TJ4A 3O0FA 2DFAA 1CNVA 4O0QA 1N2VA 3VCCA 1SW3A 1IIHA 3S2LA 1NF7A 1W1A1 4EPBC 1F5ZA 3ARWA 3MHUA 4IPNB 3S1GA 1OG0A 1OG6A 1GKQA 1TPFA 4U2ZA 1A3WA 3WELA 3TYUA 3E2SA 3HPSA 3PJXA 1TJRA 3VD3A 1ZLPA 2V2HA 3DC8A 5E0KA 4MB3A 4TTGA 1Y65A 2ACRA 5LIUX 5HINA 4EXAA 1MZRA 1OYAA 1OFQA 3UPBA 5DX7A 2HVMA 1LCOA 2G97A 4PUKA 4XKYB 2VC9A 3VKJA 1TR1A 2PBOA 1C8QA 2G4FA 3GR8A 1B3YA 3FY1A 4U33A 3WQ6A 2DW7A 1F9CA 2WC3A 2GJNA 1BXBA 1Q8AA 3W28A 4E8GA 3H7VA 5HPCA 3NA8A 4J27A 3SCRA 3VNDA 4UWMA 1EGZA 1ZTVA 3RDKA 3TSMA 4GUHA 1VCFA 3PNUA 3PHAA 1UZ1A 2FQIA 3HPXA 2OOGA 2VEKA 1IEIA 5BOEA 4I8DA 3CPGA 2FDMA 3OLEA 1HUVA 3RU6A 4Y8FA 1TFVA 1Q6QA 4Z1BA 1SR0A 4FP1A 1YQ2A 3OLIA 1VBJA 3QJAA 4Z1YA 2G3IA 2QDHA 3UJRA 4U4MA 1MW1A 5J8LA 4ZOAA 3NL5A 1Q66A 4HIBA 3AS1A 4KWVA 3VDCA 1ZALA 3M16A 1FFRA 3NUKA 3CUJA 3AYSA 1TRDA 5KETA 3O6YX 4KRZA 2CXEA 4F2UA 3VZZA 4C65A 3HOJA 1M6JA 5FESA 4DJFC 2NV2A 8RUCA 3VNJA 1RK6A 3WQCA 4IIFA 4AISA 5CSRA 1EPXA 5CGQA 4QS6A 4PMNA 4OBSA 3FFSA 2ZX7A 3I65A 1MWOA 1NFBA 1QTWA 3OG3A 4GQQA 3LM7A 4TXEA 3GC4A 3PC0A 3LHWA 1L6WA 1YPXA 1EXBA 3BZJA 2V5BA 4IIHA 3NXFA 1GYLA 4UUIA 4X63A 1E6ZA 3OEXA 1HGWA 5LA2A 2VT0A 2CZEA 1S3HA 4BK9A 2OELA 4F0LA 2AKZA 3TC7A 4UNIA 4J3UA 4QR6A 1DWAM 1JFHA 4K8HA 2C8NA 3KAOA 1WE5A 5HAOA 4F0RA 1XYMA 1RQHA 5IXEA 4HZ7A 4D1JA 3E0FA 3BAWA 1OB0A 1R38A 3MVIA 2QUTA 3AWOA 4AWTA 3W82A 4RE4A 1VQTA 1EJ7L 2WO5A 4TUFA 1ZJBA 4DAFA 1Z32X 3QZ6A 1A5NC 1SZRA 4RCXA 2OFJA 3E5PA 4ZB2A 4MYXA 3QQWA 2RHGA 1UR9A 2Y7EA 1AL8A 3W4RA 4IFRA 3DEQA 3VKKA 5F2LA 2WMKA 4B5WA 3WK1A 1Q6RA 1JI1A 2P1FA 4Q4PA 4XZWA 4HGXA 5AZ1A 3T8QA 3BSHA 1Q4NX 4US5A 3BICA 3QF0A 1J0IA 5BMWA 1XBYA 3ARPA 3EXTA 1XINA 2DT3A 3VD4A 5F2MA 1B4KA 2E77A 3M0MA 3DKJA 4Q8VA 5CSUA 6ALDA 2J7EA 1X38A 2XIMA 2V2DA 1LT7A 3BJSA 3RMEA 4PN2A 4AX7A 4TQTA 5GPRA 3U48A 3E2RA 1I1WA 1KXVA 4BQ4A 1H7OA 4GFSA 1H5YA 4MFEA 2G50A 3WNKA 1S5TA 2XFRA 2B7NA 2GJPA 2ZC1A 3CQJA 4AF0A 1QOQA 3O1NA 2OO0A 3T4CA 3NQ6A 3HQ1A 3KVKA 2E9LA 3GO2A 3O2LA 3H21A 1MEWA 5AHMA 3TTSA 1TX2A 3MKVA 1CXHA 3C0SA 4Z2HA 4R85A 4DEFA 4LQ1A 4HA4A 4OJYA 2CBUA 1XIFA 4N9DA 3W2KA 1TWSA 3PAJA 1KM1A 1ME8A 5CLWA 1ZENA 3PBGA 3KVLA 4PUNA 3OU8A 5DN1A 4DX3A 3EX6A 4DJDA 3WLNA 4LVGA 4Z2IA 3DU0A 1UPMB 2ZRYA 2W9MA 5C6MA 3WLKX 5JUVA 3HV9A 2R1KA 4AIOA 3K30A 1RY0A 1C92A 2DDXA 3PSWA 3BOLA 1C9WA 3P93A 4F9DA 6TAAA 1TVNA 1IHIA 4QIUA 3WDIA 4IQLA 1PE1A 3GD6A 1CWYA 5I0DA 3PULA 3FXGA 4I6KA 5D2VA 3CHEA 2CLLA 2IPWA 3N2XA 4AZ5A 1W1B1 4PUDA 3TYBA 3SEPA 2BFGA 4W93A 5KZEA 2WANA 3B9OA 4AVNA 1FH7A 1OD0A 3LA4A 2J13A 2XH0A 2OZ0A 4DPQA 4EPDC 2JQXA 1MNSA 3KBVA 1G67A 3A64A 1K9TA 4L80A 1JZ2A 3SN1A 5KMYA 1EJSC 4TTUA 1V6UA 1QK0A 2FZBA 1OYBA 3S1WA 3BVJA 3CL6A 4FIRA 3G6MA 3YPIA 2A3AA 1ZHAA 3IJ8A 1OX6A 2JKEA 1AD1A 3HIJA 1HVXA 5XIMA 5FF3A 1QT1A 3W7IA 2DZAA 3L7RA 4QRNA 2IMRA 1XYLA 1HJWA 4KS0A 1WUFA 2FPTA 3RR1A 1BG9A 3UERA 5LKYA 4AEFA 1X1ZA 5A6KA 2BOGX 3P62A 4HPGA 2ZUMA 3F03K 3BE7A 1RHCA 2WBKA 1IEWA 4LUTA 3CQ0A 4PMDA 1DVJA 5LIWX 1IT8A 2XPKA 4PEEA 2X42A 4B4HA 2PDGA 3R8HA 2XYLA 5CLTA 2DT0A 1QVBA 1F8MA 2EO7A 2ZXDA 5EFFA 1BVZA 5E9XA 1Y8BA 1VS1A 2OKOA 1WKFA 1TCDA 5A6BA 1Z69A 1GVSA 2A3CA 3VZXA 1QNSA 1SW0A 4PYSA 3K4WA 1MUMA 1OX4B 4V33A 1EKOA 1XV8A 4PMUA 3W3OA 3CAQA 5CZ0A 1KFEA 3UXAA 3SCQA 1AH4A 3QW4B 2VEFA 2GGIA 4NZJA 2REQB 2VTFA 1J9YA 2RJHA 3BG3A 2WOQA 3R10A 4JQ1A 1JL8A 3TLQA 3C86A 2V3EA 3F4VA 2VQUA 3C56A 3R94A 3NDZA 1LZOA 2YX0A 4HNVA 3VVGA 4R27A 4FIQA 4JQAA 1FDJA 3EX2A 3KVMA 5JH2A 3DAQA 2PMQA 2VL4A 1JUKA 1NARA 1EEPA 1US0A 3PBWA 2Y7GA 4WSHA 3GIQA 1DJGA 4ZL1A 1S1RA 2VEGA 4HYRA 4GPNA 4QS5A 1F7BA 4H1ZA 4W8AA 5FJRA 5ABTA 3DENA 5I3HA 3H2AA 3I6TA 3SDOA 4GY1A 1S5NA 1KQZA 4QAIA 4YTTA 4PUWA 1JEZA 2FH8A 4XO7A 1KBLA 1E9YB 2WM1A 4ROPA 3CQIA 4Y96A 1UHVA 3M0HA 3OHIA 3L65A 3V1PA 3G1AA 3WDRA 5XIAA 2QIWA 2A7RA 1JG9A 1PVNA 2PDLA 3HV8A 3W25A 1FWDC 1RBLA 1DWGM 1PYFA 3CHVA 1AJ0A 1HN1A 4PMVA 4HK7A 4XBKA 2QV4A 1Q5MA 1HP4A 1TPEA 1FKXA 3W7PA 1F2JA 5C2GA 3NTYA 1QXLA 3CWHA 4Y7EA 3VDBA 5GNZA 4JS3A 3VA8A 4FI4A 4RX0A 1XYCA 4YXGA 2QCNA 4HZ8A 4ZB0A 3GDMA 2PRHA 3B3DA 2VCBA 1TR9A 4C60A 4B3ZA 4Q6XA 3GDRA 3CZ8A 1NY1A 1JPDX 4GI6A 2O7SA 2HISA 1UKTA 3W00A 1X96A 5AZ0A 3TZFA 3WDJA 1KNWA 1D7KA 1J96A 2BGSA 2ZZ1A 3THAA 1V0MA 4JIIX 4AYGA 1T8QA 4CQ9A 4NZ3A 3G1FA 3R79A 1C8VA 4DZAA 1W1IE 3NDOA 3AUOA 4JFSA 2DIJA 3GXNA 3LI1A 1V3LA 4GJJA 3DBPA 3VD7A 4IIDA 2DEPA 3H2NA 1W1ZA 1OF6A 1VPXA 3T42A 2UY5A 1PKYA 2OZ3A 4LNCA 3T40A 3WLQA 3LZ3A 3W1AA 3DECA 4IISA 1JAKA 1LWHA 5FJTA 2FGZA 3FGCB 2WNNA 4PRRA 1AH3A 3GKFA 1W9XA 4FX8A 4KF1A 3MCNA 1Z6KA 3GAKA 4JNYA 3N04A 2CLPA 3RM8A 4X3ZA 2YZRA 3LSBA 4MWAD 1WYIA 3FA3A 2V5CA 2WMHA 3B8SA 4BWLA 1KGXA 3LEPA 4D9PA 1A0CA 3IPWA 4NG3A 1RPXA 1QHPA 3TAOA 3CZKA 4UOZA 4Y9MA 1BD0A 1EQPA 2FZNA 3GHSA 3W27A 2YBUA 4C6JA 1HIZA 1ZBCA 2BXVA 3UP8A 1XD0A 4QLKA 3FJ6A 5CZSA 3RLHA 4U28A 3FV9A 1S5VA 1DTNA 1CXKA 3V3WA 1HP5A 1XCXA 2H3BA 3HPAA 3WF3A 4L56A 4L9YA 1X97A 4L7ZA 3T0DA 5DCDA 3OZYA 4Z1DA 1OFEA 2A2IA 4HOXA 4H9ZA 4K36A 4RE0A 2PD5A 2JE8A 2J75A 4MB1A 1TO3A 2PE4A 2WCSA 4XTDA 1E55A 1RV8A 1W0MA 5HMDA 1KRMA 3PG8A 3AS2A 3QFWA 4CD6A 4NL1A 1AG1O 3OVPA 4OU1A 1HJQA 2O56A 2YYUA 1PCWA 2UY2A 4NJKA 2GJRA 4IP5A 4AD0A 1ADDA 1UP2A 3G3MA 5A2CA 4GH3A 4PTDA 1OIMA 5FACA 3S6OA 1SYTA 4DBSA 3DYMA 3JRKA 4U3CA 1Z3NA 3WLSA 3W7EA 1RCOB 4KQNA 4H19A 4ZQRA 3MP3A 3G2GA 1G7VA 4MKNA 2VZTA 3N73A 3FJNA 1UR3M 3CMGA 3IVUA 5HULA 3AXMA 2D73A 5AC4A 4KCTA 1Q6OA 4HP5A 5G2HA 1JCYA 2DJXA 4QCEA 4CQ8A 3PBYA 3COTA 3VKBA 5EFDA 1YDOA 1IEXA 4ORMA 5BOOA 5LZLA 7TIMA 1G7UA 1QI5A 1XRVA 3GDKA 4GBUA 4ILSA 1B1YA 1XUZA 3AAMA 1CEOA 1F3EA 3HGJA 2Z4GA 4CQAA 4PUUA 5GVJA 3CQHA 4GQRA 3S83A 3SIMA 4HNUA 4JNZA 3QW3A 3HJZA 3KOYA 3UY8A 3RXZA 3GXPA 4UOQA 2YFNA 3BMXA 2FZDA 1T0OA 2WC7A 3P5ZA 3VNKA 1KV5A 4UIOA 3AUJA 2WJDA 1JCTA 3KWSA 2XFFA 5GQBA 5BYWA 1BFNA 1V3JA 1FXQA 4FPSA 1JQXA 3T44A 4FR1A 3EOSA 1CGYA 1QO2A 3L0NA 2NVCA 3UPMA 4E8CA 4UFMA 3UG4A 3NSXA 3PZIA 2YLLA 4XAFA 1WUEA 2VZVA 4JFVA 5I02A 4R7OA 1IEQA 2EPKX 2B7QA 3M5ZA 1TQXA 1CGTA 2YCEA 4UTMA 2XTKA 2WMGA 4UTHA 4MNKA 4DBUA 4FOKA 3ZO9A 4CEXC 3LZ5A 1DHPA 1M03A 3F4CA 2XH7A 2FTPA 1HJSA 1UYQA 3PPCA 5H8MA 1OGGA 2TYSA 5A8NA 1CECA 4KH2A 4W5ZA 5HNUA 3QPYA 3W7MA 3G1XA 1PTGA 1RVGA 4FR6A 1QOPA 5JBFA 4XBJA 2VVNA 3NXLA 3MP5A 1OVDA 1Q2SA 3U3HA 1PX8A 2ZTJA 8TIMA 2VZUA 2YCLA 4Q32A 4UQAA 4AU0A 4AVOA 4ZE4A 3O05A 3DG6A 5CAHA 3NPVA 3SGGA 1Q7MA 3WZ0E 3C2OA 1TTJA 4IGNA 2E68A 3FS2A 1DORA 2CKRA 3L4YA 4JQ3A 4ZENA 5KZ6A 1I45A 2W91A 4HHMA 5JIPA 3UEQA 2GGJA 1YDVA 2E8ZA 3RN6A 4RNJA 1I75A 3VUPA 3RRXA 4WGHA 1Q63A 3KRZA 5ABEA 4JTUA 1BWVA 1POKA 4GABA 1MI3A 4RNHA 4IFKA 1VFHA 1UKOA 1K7FA 1RPKA 2CZ5A 2POZA 2W6RA 3SQSA 4YTUA 1W5QA 2E28A 1P6BA 1QMLA 2VZSA 3B4YA 1VFFA 2Q71A 1A4MA 1TKKA 4PCSA 1EJTC 4HSOA 3HQPA 1QW9A 3W74A 1G01A 2UV8G 3RYSA 4JN7A 4CLMA 1R87A 2YR1A 4YCOA 1LLOA 1KBBA 4Q6JA 4MY9A 3C2RA 4DJFD 1EDTA 3DHPA 3W83A 3T2OA 1VHCA 3ELFA 2VOMA 1BWKA 1WXZA 3QXBA 4IX0A 4KETA 4PCPA 1S5WA 1Q3NA 4FNRA 4O1BA 3TK7A 1K4GA 3HA1A 5ABFA 3URNA 4YWIA 4W87A 5AYYA 4GNVA 3U7VA 3DHFA 4DVOA 3ZMRA 3BAIA 3BO9A 3IJ9A 3SRFA 1TE1A 4IMFA 1SO6A 2ZA1A 1LRQA 2WKLA 5M2FX 2YB4A 1SZEA 1E9ZB 1U30A 1UWQA 2NQHA 1I60A 3OGVA 4K7YA 1P4CA 3EZ4A 2EPOA 2PTDA 2ZXQA 3K2GA 1G94A 4X60A 3RX3A 3GE7A 1HL8A 3FEMA 4MLRA 3FIGA 1QDSA 1R2TA 1O6IA 3E0WA 3SR7A 2QCHA 4W84A 3W7QA 1VAHA 3FYYA 3FVMA 1H3GA 4YYFA 3S9ZA 3WF0A 3I7QA 1LF1A 1UW9A 1V3MA 5BNKA 2UY4A 1LT8A 2DU2A 3LV6A 3E0VA 2QPSA 1W3NA 3PUOA 4GXWA 3JZUA 3QZAA 4FS9A 5C5YA 2V5KA 3K13A 4M29A 2FVLA 3G24A 4G1KA 2PTZA 4Z0SA 2E7FA 3WNOA 1EJXC 1XLFA 1Q6EA 2VEIA 4US5D 4NNCA 4M6VA 2NZLA 3FVDA 2X2YA 3BLEA 3F2DA 4FO4A 3UYIA 3REQB 1EPVA 3FSTA 1R9ZA 1IR1A 4L6DA 3ITXA 3DN5A 2P50A 1PSCA 1UBSA 5PTDA 1OM0A 2NV9A 3CGTA 2C91A 1EJWC 3QV6A 3VNIA 1JGMA 5D8ZA 3BW2A 5CC6A 3G0SA 3VE7A 2QULA 1LRNA 3P81A 3W1RA 4HNOA 1JR1A 5C54A 1J5SA 2CETA 4WQ6A 1K8CA 2Z27A 3UWUA 2TRSA 1KM5A 3QMTA 3RIKA 3W1NA 2QDDA 2DUZA 1TIWA 2FJUB 2QT3A 1V77A 4L1GA 2FPYA 1JZ8A 1HVQA 4O17A 1K4HA 3SECA 2QR6A 4EKJA 1XYZA 3MSRA 1QU4A 3PZQA 4LYPA 3VGEA 3MPGA 1QNQA 3UXKA 3LXAA 3AIEA 4LBSA 3THCA 3I4KA 4UFJA 3GY1A 4RDVA 1ITXA 4REQA 2WVTA 1XP3A 2ISDA 4H8VA 1CT5A 1QUMA 4BZYA 4HNCA 5A8OA 5A6AA 4DNHA 3G1YA 3NQ8A 1IZKA 3AWNA 3TKFA 3TYEA 1W8GA 5CPMA 1TV2A 4DJDD 1XBXA 3EDJA 4GUIA 3A22A 2PWVA 1NP0A 3ALGA 2X0HA 4Q4KA 2ASHA 3DHDA 3CAVA 1KXTA 3N3TA 4CCDA 3V5OA 1HTIA 3RM4A 4W9TA 1W2PA 4RW5A 3UG5A 2NUXA 1TA3A 5EYWA 5I2UA 1WPCA 1LP6A 2QUMA 1HQTA 4Y9NA 3AFBA 1VRDA 2BOFX 2QDEA 2CBJA 4WUIA 3C0JA 1QNRA 3LTYA 5AECA 2O92A 2NQJA 3B9DA 4M6QA 1CIUA 2Z0IA 3BW3A 4KKXA 4EVZA 5LIYX 4UQDA 5D2WA 4WOQA 2GUBA 1Z41A 1ZBVA 2XH2A 4Y6GA 4ORIA 3UXLA 5EPDA 1D8CA 2EAWA 3SCOA 4XZLX 4U5KA 2PP1A 1TYGA 4PMXA 1T96A 3MANA 1V6XA 1HKJA 2YPIA 3SRKA 3EKGA 1Y5VA 1EIXA 3TH6A 1EF2A 2JEPA 4YVXA 1I0DA 1XLIA 2X2GA 4DZ5A 5BMXA 4HMCA 3DFHA 1AL7A 3MDWA 1XKYA 2DQWA 4UB9A 4Y2WA 3QKZA 3S9YA 3TQPA 1BF6A 3DFQA 3MA8A 1GVOA 2QV5A 4JHZA 2ZDRA 4UMBA 5REQB 2XN2A 3IWPA 4LEQA 1YNYA 2DORA 3WQ5A 4CN6A 1H62A 3VDHA 2PWHA 5TNVA 2IKGA 4O1EA 3WBEA 4JTFA 4O19A 4GC4A 3VOGA 4W8LA 3LLDA 3KM8A 2ZOXA 4HPJA 2CLIA 4ATDA 1V7AA 3KDNA 4HYVA 4YLWA 1HT6A 5CQ1A 3SGUA 5IDZA 1NP2A 3WH5A 2FZ8A 1U2YA 3OJGA 1Z8AA 2C18A 3HPFA 4N4PA 3LNPA 1D8WA 4UMAA 2V3GA 1NWRA 5D03A 3BURA 1SPQA 2R1MA 5A6BD 2ODOA 4GI8A 3WMLA 2UY3A 5HUPA 1NOWA 2ZWYA 4LEFA 3TOYA 3UR2A 4PTXA 2R1LA 1E6SM 3EPNA 2WB5A 2DSWA 3N29A 5D9PA 2ON3A 3MCMA 3VIOA 3ZJ8A 3C2EA 3N2MA 4P61A 3QMRA 2PODA 1P48A 1JUBA 1ZL1A 2NWRA 3MSGA 4NF7A 4J3ZA 3PN8A 4O10A 1ODUA 3EKZA 1V6WA 2OSWA 2VCCA 1Q6DA 4IMDA 1OEPA 2WBGA 1QHOA 3LENA 3UQNA 4XUYA 2PDJA 4OOUA 4PFMA 3B8VA 4W7VA 3LCFA 4ZOCA 3SCTA 3GG7A 3ITLA 2WVUA 3TTYA 2J88A 4QLLA 1DIEA 4K8GA 1YPIA 3KS6A 5M17A 4S2CA 1GGOA 4AXNA 1JFXA 4D6IA 4JD4A 2X16A 1IGWA 1J11A 3DDMA 4H01A 3BSMA 4H00A 1EWEA 3TJXA 4JHMA 3WH6A 1WDDA 2NWSA 4LTSA 3NZPA 2JEQA 1J0HA 2BV9A 1MYRA 4BQ3A 1GPFA 3IIXA 4XZNX 3VGGA 3BW4A 4URIA 3BLIA 4MZYA 3AHXA 3AYTA 2R82A 3LBCA 4Y8EA 3NVTA 4DBEA 1VEOA 2GLKA 3VGFA 1EC9A 5AYIA 3LCLA 3RLUA 4F0KA 1UC4A 1QO5A 3W7NA 4C6IA 1GVIA 1AUSL 2NXGA 1XICA 2W92A 2Y5EA 1YMYA 1JRBA 4YWSA 4KW2A 4Z2LA 1DYSA 3NOEA 1BQGA 2FJKA 2QUNA 1OFPA 1ME9A 4DJEA 3M4HA 4WK9A 1GQLA 1AZ2A 5A6JA 4E6MA 4I9TA 3NQDA 1YBQB 1C93A 1RQEA 3CS2A 1LOLA 3OHMB 3MO4A 3C2YA 3STCA 3W6MA 1XFBA 1EFZA 4EANA 2VVSA 3L23A 3LQLA 3W24A 4J7RA 2YLAA 2XDFA 4UQEA 4ENLA 2G37A 4AIBA 3H2CA 4RZBA 1H60A 2P5NA 1OGBA 1BYAA 3DYPA 5K4XA 1UWSA 3W26A 4WY0F 5CH9A 4GJIA 2ICSA 4A8RA 1S1PA 3D3AA 3SN4A 2FVMA 5DT5A 5I3GA 1TWZA 3ABRA 4K1GA 1TVPA 3AS3A 1XIDA 3DKLA 1GVYA 3VOFA 6REQB 2A3EA 2O7QA 4EWJA 4M80A 2P0IA 4RR4A 1SGJA 2OJPA 1RY8A 2G3JA 2O55A 2ZQ0A 2ZRXA 4GBDA 2V5JA 1K9EA 1ZPTA 3T8LA 3KTCA 1UP3A 3RGTA 4B5NA 2I56A 3WMBA 1VJIA 3BUVA 2AL2A 4ZO9A 3M7SA 2Z24A 2QJGA 1D2KA 4J40A 4JX6A 1FVPA 4QE5A 1F8IA 5HJXA 4HCDA 2B7OA 4JNMA 3TE9A 3DX5A 3C61A 4JQ2A 3SURA 4HNLA 2PZNA 3FYOA 2PI6A 1J2BA 2RKXA 2GWGA 1FHDA 1UKSA 2AMGA 4IWWA 1TB3A 4V1XA 5DT7A 2XIBA 3CIVA 2I9EA 1AQMA 3BV7A 1BXNA 1RJRA 1W56A 3NQVA 1EJRC 2CLMA 4IJRA 1L8NA 2V68A 1AFSA 4GO9A 4BEQA 1AK5A 5JIWA 5E5CA 1FA2A 3E0LA 4CQBA 4O15A 2GK1B 1WZAA 4MB5A 4B5SA 4JXCA 3EOLA 2HS8A 3L4UA 4WOZA 3OB8A 2RGMA 3GFXA 4PUJA 3OLDA 2DQXA 2CYGA 4LANA 4O50A 4Q8PA 4HN4A 3B0PA 4FALA 4N9EA 1HL2A 4XKYA 3TCEA 4RDYA 3GB6A 1J2WA 5F4WA 1FX6A 1E3ZA 3PJUA 2NX1A 5KITA 2O9TA 4FLSA 3NM3A 4HB7A 3M46A 1A53A 1K77A 4AMAA 1A5BA 4EPKA 4ACZB 3TQVA 1KXHA 2FB3A 4A4AA 1H09A 1VR6A 2H8ZA 4HA3A 2ZRUA 3UNDA 1FRBA 4NZFA 3H55A 1HO1A 5DFAA 2O4QA 4O53A 3K5XA 1EA0A 1JDFA 5AC6A 4OBRA 1Y5WA 3VKCA 4GRSA 1SJDA 5CGTA 1AZ1A 4JX5A 5AYXA 2DUXA 3I3DA 1UOKA 4L4LA 4B5XA 3M7WA 1TV5A 3EDFA 4QBXA 3W88A 4PGLA 3B05A 4CQCA 5H1WA 3B4UA 4QG9A 5I09A 4GNJA 2PB1A 1SFJA 5H6HA 3W81A 2OOFA 4J3XA 1XLMA 3WKZA 4Q4QA 2L5HA 2BX7A 3W7GA 5AFDA 3GZAA 3OQEA 4FXFA 4ZO6A 4F4RA 1BPLB 9CGTA 4DUWA 3GNOA 1IT0A 2GOKA 1B54A 2ZA2A 2BBFA 4UQBA 1XSKA 1KXQA 1K8YA 4KESA 2F7FA 1VBHA 2J79A 3W53A 2GDUA 2EPLX 4JAWA 3BGJA 1SO3A 1L2QA 3WQWA 3TCSA 3IRDA 1LQAA 3Q94A 1OC5A 5FF2A 3FA5A 3VI2A 1R3YA 3DFNA 4JKLA 3ZOAA 1NDZA 4ZSTA 5AHFA 1XHGA 4JHOA 1G4PA 3BG5A 2WNWA 2WPGA 1QI3A 1TE6A 3AMCA 1ISZA 3VIPA 3IIPA 4YCPA 3K1GA 3GBDA 1CZ1A 4J3SA 1GVRA 3N19B 4Z2KA 1O1HA 4MZ8A 2YKKA 1QNVA 2OGYA 1PPIA 1YIXA 4EACA 3H7RA 1A5UA 4I5XA 2PDIA 3CU2A 2PLMA 1X1NA 2OQHA 3UZXA 2I17A 4RE2A 3USBA 4JYDA 3SJNA 1GHRA 2QQ6A 5EMJA 3SADA 3WH8A 4TX6A 3KRSA 3CMFA 1QAPA 4A3QA 3KBWA 2E6FA 3KOFA 1JZ5A 4RUBA 3VIGA 1OADA 3G3DA 1GYMA 4XVEA 4LWWA 1XCFA 4MWAB 1R3RA 3GG8A 5AHLA 2P3EA 3LN3A 1JPMA 3LUTA 4JFUA 2R6OA 3WK2A 2NLIA 2R14A 3VC5A 2YA0A 2HK0A 2V5LA 4AHPA 3W86A 1PS9A 1BG4A 5FJOA 1XBZA 3QY8A 1M7OA 3LBOA 2QNEA 3LI0A 1DWHM 2VFIA 1UD8A 3F4DA 4NZ1A 3ES8A 3ZXWA 2IKHA 3VX0A 3V0SA 2BB0A 1GPWA 1EXPA 1W1VA 3SM0A 3NQCA 4Q4OA 4JFTA 3KX6A 3HGOA 1PWLA 1EO5A 4L61A 2G8ZA 4PC8A 4LSBA 2PDHA 3L5MA 2CZFA 4KFOA 1OFBA 3EEZA 3L4ZA 3CK5A 3PPHA 2XG9A 3NJ3A 2B81A 4QITA 3CL8A 5HJLA 1RAKA 4PB5A 2XISA 2CZVA 2QGYA 3EA3A 2Q6ZA 1GTHA 4EE9A 4H6KA 5BXPA 1U5JA 3LPOA 2OG9A 1LG1A 2OR2A 4P8UA 3A4WA 1T41A 3FHAA 1S38A 3PB0A 1K8ZA 5HANA 1XLJA 3TP4A 1DJWA 1O1ZA 1FWCC 1OGSA 2YL5A 3TVAA 5CBBA 4OQVA 1W5OA 3LTPA 4GISA 1Y7VA 1G69A 4ML4A 1T99A 5FL1A 3QR1A 1UMYA 4AD2A 3GC5A 2PWDA 4LAKA 4TR9A 3G8RA 4O1AA 1E1CB 4UTWC 3VGHA 3UF9A 1ESWA 4YHEA 1KRBC 3LRMA 3T7VA 3I7RA 1BVNP 5A6MA 1V6YA 4IXHA 3ZJKA 2CITA 1W9VA 1RJPA 2WJFA 2HDJA 2CEQA 1B3OA 1XLAA 4HN8A 2DZBA 4GUFA 5E0CA 4IXXA 2GVEA 5DXXA 1GW1A 4X0NA 5JMUA 2JKPA 4XIMA 1KBIA 4Z0JA 5KSWA 4EAMA 1LBMA 3RLGA 1YXCA 4YHGA 2BOEX 1GCYA 4AYSA 3CUIA 1W6TA 1GZGA 4K7VA 3LCWA 4DUOA 4NILA 1XSIA 4IGSA 4Q8OA 1BWLA 3RX4A 1JCMP 2UBPC 2TAAA 1VF8A 3F7JA 1DWJM 2Y8UA 4HZMA 4GH1A 3E12A 3AU6A 3ZR5A 5M1TA 2ATSA 3JVAA 3OG2A 2CIPA 2DUAA 2C14A 2V8ZA 3GU2A 2VENA 1P6CA 3C0LA 1LORA 2PDCA 5HPOA 3WQ8A 3GFZA 3B04A 2KX9A 2ALDA 4ZEPA 4A8IA 4AX6A 2XVLA 3AMLA 1EBGA 2A1YA 3TNBA 4IUGA 4ZZ9A 3NQBA 3EX1A 3M47A 1Z48A 4HPXA 4PCTA 2WHJA 3APGA 1P0KA 4H8HA 3EBVA 1TELA 3D0CA 2Z2UA 5FI8A 2NVDA 5IBXC 4FMVA 2W66A 4FA3A 4QQUA 3M0ZA 3AI0A 1YEYA 2WKJA 4M6UA 3T81A 3E5BA 1J4EA 3HURA 3IIZA 4JYEA 1QRQA 5CG0A 3L68A 1DQWA 4DO6A 3DG7A 2GQAA 4LF2A 5FJJA 3RPDA 2H9AB 3Q45A 4D6FA 1RD6A 4G7EB 4MDPA 1EP2A 1OX4A 3SUVA 4HBKA 4GIRA 5I3IA 2QJHA 4IICA 1ICPA 2CCRA 1MNZA 1M04A 3GK0A 3K4DA 2DSUA 1W3JA 3IS4A 1M01A 2REQA 3OGSA 2EPNA 4XV0A 4NYUA 1YW1A 1ZRQA 4ZO7A 3WUEA 3GW3A 2F2HA 4E2DA 2QGHA 4DYJA 3NSNA 4LUSB 3GKAA 1XC4A 3WD1A 1YXYA 2DZWA 2D2OA 2IQDA 3VMOA 2Q09A 4UTLA 3VABA 1K6WA 2DZPA 1UZ4A 3LV5A 1Z7AA 1KM0A 1J0JA 2PLJA 1UH2A 2C1IA 3PZNA 1UJPA 3KL3A 3T6CA 3GM8A 5FCZA 2G0WA 2C19A 2FPVA 2OGJA 3L9CA 2P3ZA 1UP0A 1L2UA 4JDBA 1ISWA 3VIFA 5EL1A 3KTXA 1RJQA 3ZT7A 2Z1BA 3U6WA 4NU7A 4JTKA 4UMCA 5G1TA 3AQUA 2X7WA 1GVEA 5I79A 1W9BM 1XG4A 4NXKA 2VQTA 3M43A 5D05A 3W01A 1MEHA 3N9RA 3PUGA 2ALRA 4AWEA 3UXDA 1OFRA 1R3TA 1JDAA 4B5VA 4QROA 4CUCA 1W1PA 3VNMA 3VNLA 3L4WA 3WLPA 1KRAC 1HG3A 3NGJA 3UR8A 5IFTA 4QSFA 2A5HA 3ABZA 3C52A 4Q8TA 2YJQA 1QNOA 3UJFA 1CPUA 4MJ2A 2HROA 1JIBA 2GZXA 4N42A 8A3HA 2DSKA 4NVTA 3V75A 3KP1A 1P7TB 2D20A 4DRSA 1IXPA 2ATMA 2VGBA 1AQ0A 1W31A 1VPQA 1KCZA 2F6XA 5L9FA 2X40A 3OBKA 3R58A 4M82A 2GVLA 4ZO8A 2V9DA 2QPXA 2RFGA 2YB1A 2ZXAA 4ZBCA 3FX4A 1T8XA 3O3RA 4LB3A 3K8LA 1NTHA 1RD5A 5C7HA 3N6QA 4KFNA 4ZB5A 1WBJA 2CLFA 4UBPC 3S2CA 2PDFA 1FWSA 2G3MA 4FX6M 1LL4A 6ENLA 1DJNA 3ITYA 3OVRA 3RO6A 2OEKA 4NNBA 3WX7A 3N11A 4CU7A 3STGA 3FGCA 1QASA 4QGCA 1FWBC 1TSIA 4QLJA 4PH6A 2VNCA 3GTHA 1O12A 2E9MA 2PTWA 4NX0A 4A22A 4M51A 4NAEA 3WJZA 1N7KA 1P5BA 4L1WA 1ONRA 2DP3A 2HBXA 1JULA 2AMXA 3DFSA 1UA3A 3Q2DA 1YPFA 3V16A 1TMQA 5DBUA 3EB3A 2PD9A 3NEHA 2XVNA 4DYKA 1VCVA 3P5YA 3UPWA 3AMDA 3K46A 4A3HA 4M56A 4XD6A 3TJLA 1DE5A 2VXNA 4QEHA 2QMKA 3TXZA 3TW6A 1LM1A 3HPZA 4TV6A 2R9RA 4I7WA 1VYPX 4NJHA 4LC8A 1R0MA 2VR4A 5DMMA 1CLKA 1MZHA 3B06A 4MYAA 1EH9A 4TV5A 1DJXA 2DY3A 3IJDA 1XJBA 1GOWA 3ATYA 1FWWA 2ZE0A 2H90A 2HS6A 4IMCA 3MDUA 1WDWA 5G2WA 4C6LA 4UNKA 4GHRA 3RLVA 3WJWA 3CAKA 1X1OA 4GINA 1MXSA 2ACSA 4F0HA 4W8BA 5U7SA 4A8LA 2WHKA 4JIEA 2P8BA 5CKSA 1FFQA 1MSSA 1XLCA 3N2BA 2OPJA 3V5FA 3AO0A 4BS0A 3MJMA 3S6TA 3M6YA 3OTRA 1HKVA 3RFAA 1WDQA 4FB7A 3ENLA 4M24A 5B80A 1TTIA 1H5VA 4JKKA 5HMEA 4BR1A 5EBUA 4E8DA 4ICMA 1ZGDA 2CLEA 2VURA 1R9XA 3UZJA 5LNWA 3HM7A 4S1FA 1CXEA 3BLPX 4YS1A 2VGIA 1B9ZA 1AJZA 4MAZA 3WK0A 1KCKA 2PDMA 3UZWA 1L6SA 3VXGA 3MMWA 3F4NA 3WSUA 2WMIB 1KB3A 4Q33A 1XUUA 1NDYA 1R8LA 2WKGA 3DGBA 3PUEA 2Z2BA 3VK5A 1R85A 1E3XA 3S9IA 2PGEA 2VDHA 5T26A 5BWAA 4UTKA 3THQA 3PAOA 1VPYA 1MXDA 2E25A 3N17A 3RMJA 4DJED 1F6KA 3U2EA 1BTMA 3WLMA 1V0NA 2YCKX 2DT2A 3BK0A 3LDVA 3UG8A 4AY1A 2FFCA 3CO4A 4FXSA 3W76A 3AJ7A 4JBRA 3EX4A 2W79A 2FYMA 2GGEA 1GG1A 3W22A 4NX5A 5G2IA 4FZIA 3MUCA 3WMSA 4RXFA 4GA8A 1WXJA 4DO4A 1BYBA 2JIWA 3H2MA 1EGVA 3BDKA 4AW7A 4WDTA 3KBSA 1OF8A 4ZR8A 3ZSTA 3QOKA 2PC4A 3C2FA 4EF8A 2I9UA 4B2DA 4MNLA 2XH4A 4LAZA 1GG0A 3QC0A 4J28A 3FEQA 4O8RA 5G4HC 1UWTA 4ZFMA 1NVMA 3MKKA 1L9WA 1XIBA 4PSPA 4K68A 4UFLA 4R9XA 4UTTA 4JIPA 3M0KA 1XPGA 1J6OA 3UG3A 3CASA 2ZVRA 1ZAIA 1DOSA 5LYRA 3V5CA 3AROA 4MFDA 1GOQA 3GVWA 3SO7A 3GBEA 4ADSA 4Z1AA 2VWSA 3WUGA 5FEZA 4LVBA 1A5AA 2VEMA 2OMAA 4DAIA 3EWDA 2QUVA 4NI3A 3GNNA 3GYCA 4I9MA 3POHA 1N55A 3NPUA 4PCNA 1ITQA 3EB4A 4D8LA 3HZ3A 1B2YA 4ZSUA 2WCAA 3CPUA 3NQGA 1JXJA 5BOFA 2XSXA 5A2AA 4AZCB 3B0YA 3JU2A 3NO1A 4JTJA 1NWSA 3T07A 1MRAA 3PTDA 4AAJA 4D6GA 2A3HA 4ZQNA 3A5FA 1VH7A 2F9RA 1A80A 2YA2A 2X1IA 4FLRA 1NWTA 5A8GA 1UZDA 4ZVJA 5HATA 3ORWA 3IJIA 3QEZA 1I9CB 3NQMA 1AODA 3VINA 4C6CA 4BCEA 4HSNA 4J2PA 1EC8A 5IDIA 3A9IA 1L6FA 2VDGA 5EGRA 1VKFA 3ZM8A 3ZLHA 2NSXA 4UFIA 4G7FA 5EKYA 1XLBA 3VIKA 1PIFA 5RUBA 3EA2A 3AIVA 1WP6A 3L4XA 3N14A 1KQYA 4KEZA 2EG7A 1YLVA 3CUXA 1PCKA 4KPLA 3RCYA 3WK3A 2PP3A 4CD4A 3DFOA 4GO8A 2DJLA 1EP1A 3APYA 5FEWA 3FKRA 4I5UA 3B8TA 5ECVA 2YDSA 4L5ZA 4E5TA 2E6DA 3T05A 2B31A 1JCJA 3U5YA 3O63A 4S3FA 3THUA 4XZ9A 4IZGA 2GQ3A 3UW6A 1GT8A 2Y7FA 4MM1A 3LPGA 3ME3A 2Z1WA 1E6NA 4WRHA 1W1YA 4CN1A 1U83A 4YL2A 3ANUA 1J0YA 1IEVA 3GUGA 1HKWA 4OV9A 4QJ4B 5BU9A 4Z17A 1P0DA 1B3XA 3N2TA 2R1NA 2EQDA 4JTEA 1VFOA 3UGVA 4O8AA 5D2XA 2R8WA 4CQDA 3BQ6A 4GIYA 3WLOA 3I10A 3W7DA 1KWKA 5FJUA 1JPHA 2CFFA 1O5RA 1JNEA 1XS2A 1JF6A 1VC4A 1FWGC 1E43A 4GY7A 2F8QA 1JVNA 4MPKA 4P8XA 1DV7A 1NIUA 4UTIA 5C9RA 1QPNA 3V0TA 1V7YA 2VMFA 3A9BA 2E4TA 2DVUA 4LRTA 3TC3A 1EZ2A 4EK7A 5G5IA 2IS7A 1YTKA 3V36A 1VLWA 4WVXA 2Y88A 1MO0A 4ZFCA 3LXCA 1REQB 4LY8A 3KS5A 2XSAA 4AEEA 5LHEA 2Y4SA 3QQ0A 2GUUA 2I16A 2YSWA 1BYCA 1GEHA 1LDCA 1ZFJA 2VFGA 3H4WA 2HSAA 1EBHA 1YE4A 5MKGA 4ML9A 1NEYA 2Z1VA 1DIKA 3OPSA 3V1HA 4OVXA 3HF3A 3WH9A 3UYCA 1V0KA 4C7FA 3OGRA 1TV4A 5J5DA 1VP5A 4KGJA 1J5TA 3T2QA 2A4AA 5CSSA 1MFVA 2H8XA 5I3JA 5D9MA 1CBGA 3WG6A 1BLIA 2W27A 2HXTA 3W2UA 3N12A 1U5VA 1E0UA 2G95A 3TW9A 4J35A 2BVTA 5GJPA 3W7JA 2GVGA 5E70A 4M81A 3ZS4A 1R3VA 3REQA 2XINA 1EB3A 3T9PA 4CCCA 2JF6A 5I06A 5G1MA 5A1AA 3CZJA 4K39A 1I4NA 3M5XA 1Q2RA 4YVVA 1UA7A 5I3DA 3GHRA 1CCWB 1US3A 1I2QA 1D3HA 1B30A 1M65A 3W1PA 5ECUA 5D9NA 4DWDA 5K9XA 2VKZG 5D38A 5HQMA 2HTMA 1OINA 4UR8A 1XIHA 4C1NB 4LCRA 4BFAA 1XIIA 4DZHA 4LAOA 4C6MA 3PZGA 3S2JA 2CPUA 3AYRA 2ZUNA 1WZKA 4DHGA 2VOTA 2MUCA 1O5KA 3O0KA 1C90A 4LY4A 4TX8A 3BH4A 4H04A 3A6OA 2CHOA 1JGIA 4ZTYA 5JH1A 4MF4A 3EOEA 3T2PA 1OCNA 1NJJA 3RILA 4LXFA 3AIWA 2I57A 1PL9A 4MIMA 5FL0A 4H4IA 4LJ3A 1R2SA 4C6KA 3FN9A 3EXRA 1O68A 4X9SA 1ME7A 3GH4A 4CCEA 3DG3A 4UZUA 3KLLA 3CHDA 4TO8A 3VCRA 1RR2A 5EU9A 4X0VA 2Z1SA 4WX2A 1DE6A 3BCJA 2QYGA 4AXKA 3TA9A 5M3WA 2BASA 3ITOA 1TTQA 4U2YA 4IP7A 1KR0A 1FWAC 1KFCA 2G41A 1EIBA 4L4MA 3NL2A 5C70A 1M3UA 1DHKA 1X7IA 3SQMA 2GOUA 1HXJA 4H6QA 3WY1A 3QR0A 2IXUA 1FWTA 1M53A 5CPOA 4GKLA 2QCLA 4KGLA 1UWIA 3UJSA 4HA0A 1Q7ZA 3CL7A 4GC3A 4Q8MA 3TX9A 1AQFA 3I3EA 1ELSA 2J9XA 3S2NA 1GZJA 1A0DA 2PZ0A 1S2UA 3L4VA 4LAUA 1VBRA 1UG6A 2W67A 4PB3A 4IT1A 3W1MA 4ZXLA 1J12A 4RK8A 3XINA 4MY1A 3UXIA 3CT2A 4N0RA 2VC6A 4YMZA 1OT2A 2C7FA 1ZBKA 3CB8A 2WZIA 4CKQA 4JY8A 3MS8A 4XX6A 3WLJA 4FXJA 1RZMA 3QGAC 3B9AA 4DI8A 3C5QA 1CXLA 1E4NA 2W0UA 2HXUA 3WD3A 1MQPA 3NAVA 4FOJA 3GX9A 2ZUVA 1QOXA 3O15A 4ERIA 3LY0A 1JZ7A 3UWVA 7REQA 3ZIZA 4IG2A 5REQA 2WSPA 2ZBTA 3EWXA 2Y0FA 4QDWA 2ONEA 4XIAA 3TSDA 4B15A 1V3KA 2I1OA 3B9NA 3UZYA 1CGUA 1JPIA 1VJSA 5AVHA 3S4TA 4AD3A 5TBOA 8CGTA 4G6CA 3T78A 1KR1A 1HF6A 4L9XA 4B16A 4JTSA 4DJDC 2WSQA 4C7DA 3P61A 2VJXA 1RA0A 4XSLA 1JRCA 2V6AA 4RV3A 1C7TA 2IQ0A 4R7WA 3R0UA 4RZ6A 3S5NA 4B92A 3AICA 1EOKA 1EHNA 1H61A 2BWGA 4GVGA 1XF0A 3PBMA 1H1YA 2OYKA 2JK2A 2O9RA 3R8RA 3NVDA 1XKJA 4LX4A 3O8AA 3STEA 3VOIA 2OEJA 5IOBA 1LUCB 3FXYA 1OQFA 1FCQA 3PF3A 4LS2A 1WXYA 3EOOA 3GHUA 2D0HA 4O12A 5K2ZA 3TWBA 2YDQA 1A3HA 1UD2A 2TSYA 5EMYA 3RAOA 2ZZ2A 5F4XA 4AWUA 4GACA 2OXNA 4DWSA 1XRTA 3G0XA 1OYCA 4DWSC 5C2XA 2J25A 4NXSA 1NDWA 1TG7A 1I0BA 4KIEA 3CO8A 3NWRA 4IFKB 4MVAA 5HQLA 3GVGA 5FEPA 4ZOEA 2WZMA 1S2VA 3FCPA 4QG6A 4ZGYA 4ALDA 2A3BA 3R25A 4GZEA 3ID7A 2ISVA 1DL3A 5D04C 3F1QA 2R91A 3OYZA 1PZ0A 3RM9A 2JALA 4JN6A 4PSRA 2ACQA 2ZZ5A 1H7XA 2V67A 1I2RA 1QW8A 2BHUA 3M0IA 3LK6A 4W89A 1ZQ5A 1PTDA 4I5RA 2NQLA 5LHFA 2PCQA 1VFUA 2ESCA 1Z44A 3EXSA 3CB3A 1W1TA 1JPKA 1CLXA 1YADA 2OWXA 1RCXB 2OLHA 5HQEA 3QTPA 4O0KA 1T7LA 2ACUA 2ZDSA 1GOXA 1TJPA 4O18A 4LW7A 1IGSA 3SY5A 2X30A 2C1HA 2J74A 5HR7A 3S6DA 1KM6A 5GNYA 4LS0A 1V51A 5ABFB 2OZ8A 1GQKA 2C79A 5DCBA 2QDGA 3W23A 2QJNA 1H11A 2X1TA 3IUHA 1PHQA 1YBQA 1F73A 2A3LA 3N1AA 4GNKB 4W85A 4H9VA 3GSMA 4K37A 2YYTA 2C0AA 3RJYA 4FHAA 2WVSA 1U1JA 4E2VA 3TTQA 3GDLA 1FUYA 1TQJA 3TTEA 4JDYA 4KCWA 5GNXA 1UWUA 2PDQA 2VRQA 4E38A 3I3BA 3M07A 1MDLA 3NG3A 3EDEA 5CC7A 4AQLA 2HCVA 3NCOA 2SFPA 3KCJA 4MNMA 4QXIA 2FVKA 1V08A 1DJZA 2OODA 1AW5A 3ONCA 1KM3A 3G0UA 1FP9A 4PA8A 3CWNA 3E96A 1FWEC 1M9HA 5AYBA 5GJMA 4AHQA 1KFWA 3AMGA 2YW3A 4WSJA 1K02A 1S2WA 5I07A 3C6CA 1CW2A 4HZ6A 3A4AA 4TOQA 3GNXA 1LOQA 3FAWA 3RK8A 2BGQA 3W38A 2PS2A 3CLWA 3NO3A 1KCLA 4IPLA 2ZXBA 1CTNA 4MUPA 2OO6A 2HEJA 4K3ZA 5C55A 4CNUA 3BAKA 1ADOA 2RH9A 4GYJA 3EWZA 5AHIA 5CZTA 2RAGA 2B4GA 1VFLA 3IIVA 2GK1A 4FLQA 5BRBA 3G18A 2PLCA 4TVDA 3TN5A 4DM1A 2QS8A 2J27A 2QAFA 2IPFA 2IXVA 1ZBWA 1TMLA 4AMCA 1V3HA 3EYPA 1HGYA 4GCAA 2OWCA 1E9LA 2J77A 3S3GA 3CZLA 1JF5A 2BVWA 3A3XA 3EPOA 4O4VA 1WO2A 4F48A 1LBFA 3P0WA 4E4PA 3BZGA 1U5HA 3VX1A 2HQAA 2ZE3A 4E4UA 5BXRA 3V4BA 4L1XA 3VNZA 1J8VA 5CSYA 2VWTA 3U8GA 3SW6A 1FBAA 4IPIA 3USZA 4FNSA 5I00A 4H3DA 1LWIA 2PF8A 1TREA 3DYOA 3MBFA 2HPIA 4HHLA 1FHUA 4EP8C 2PDNA 4ACZA 5DLCA 2BGNE 1KA9F 1Q6GA 2A85A 2WSKA 4YNGA 3EWYA 3UWZA 3N6HA 4JTAA 1DIDA 2ABAA 4MAVA 1JQVA 3PZVA 4XK2A 4O57A 4ONVA 1BEUA 1OD8A 3SRHA 2V3DA 3R2GA 1PJ9A 2HBVA 3OVGA 1IWAA 2DV0A 4O28A 2DPEA 1GONA 3G6LA 1EYEA 4D72A 4N7QA 2I14A 4LH8A 4DLFA 4EIVA 3W7RA 1PTAA 4ERAA 3SBFA 4BWLC 1LG2A 1SM9A 3GYEA 1TJ0A 3R89A 1PXGA 9XIAA 2DZVA 3PBUA 1TZ9A 5H8UA 3M0LA 2GUYA 3SSJA 2Q3RA 3LPFA 3NFUA 3AZRA 4U3AA 3BCDA 2NUWA 3SUWA 2NQ9A 3S8HA 3GAYA 2AAMA 4XB3A 3AOFA 1EZWA 1UD4A 4E2OA 5LXXA 2F84A 3LCHA 2VYOA 3ARQA 2DVXA 3HFTA 4HNNA 4QSHA 3NL6A 3RCMA 2IPGA 2HNHA 4W7UA 4OT7A 3PNZA 1EJUC 1A0EA 4AZ7A 4CNNA 3PPFA 2FTYA 1KBJA 3ARRA 3CPRA 1ZJAA 1RSCA 2BY2A 2CBIA 1U1HA 5DQPA 4Z2JA 4D1IA 2PGRA 3GVQA 3LGGA 3MHFA 2X0SA 3CHFA 2EJ1A 5DRIA 3N9SA 1UD3A 3P2VA 1ONEA 1F05A 1KFKA 3GZ3A 2ZUTA 4M5PA 2WWDA 4B2DD 5IRPA 4S3JA 4KEUA 3CM4A 3H2FA 5KTLA 4GQ0A 4J1OA 1WOBA 5D37A 4KFPA 3GTIA 3TQKA 4ZQCA 1O7AA 7TAAA 2QIIA 3CIXA 1ZNNA 3TR2A 4R3UA 3WLLA 3LHZA 3LLXA 4FF7A 2EKCA 5G4EA 4I8YA 4S3BA 3A4JA 4MJZA 1LLZA 2CLHA 2X09A 1OT1A 5H2ZA 4S3EA 1KFBA 1LWJA 1WKDA 5E1QA 1V0LA 5GJNA 1ML1A 3W75A 2OLAA 3SFWA 3CH9A 3UCQA 5HWMA 2E8YA 3C3UA 3PB2A 3F2CA 1GOKA 3BLDA 4P2VA 2X1UA 4B5UA 2WWCA 5CPTA 3LRLA 3MHGA 3EDDA 4FOUA 2WLYA 3SUUA 1KM4A 3W02A 3VOHA 4BF9A 3NR0A 4DO5A 1BGAA 1NFPA 1OC6A 4KWUA 1M7PA 3H2EA 3NZ1A 3V18A 3SCUA 1W9UA 1T40A 9RUBA 3WJXA 3LTSA 3URAA 5A6SA 1R47A 2GWNA 5CC3A 1HJVA 1V3IA 5DY2A 4A21A 4AIUA 1H51A 4QHRA 4JEQA 1XYFA 3NQ2A 1HJXA 2ABBA 3PZOA 2J7BA 4C1KA 1KTBA 3SI9A 1NQ6A 5I77A 2NX3A 3E9AA 3MKCA 2QVNA 1HX0A 2AAAA 3GR4A 4OFCA 1YHTA 2QCEA 1O5XA 4W7WA 3BJFA 3U2CA 2Z1KA 3N3MA 3WJSA 4S3DA 4DBWA 1XDMA 4LF1A 1PDZA 1X39A 3L2MA 1W54A 3LNMA 3GHTA 4RJEA 1WDRA 2VFFA 1UJQA 3ABOA 4MPQA 2LLEA 2YOCA 2GFTA 2NV1A 4RLIA 1T6MA 2J4GA 4AUBA 2AGTA 1IXOA 1DQUA 4BEUA 4G1NA 4IH3A 1WOAA 3B0VC 1X8FA 2HE8A 1ZB5A 1KFJA 1XXXA 3DESA 2WZTA 2QJMA 1E1CA 3WLRA 3GH5A 2EBNA 3QHMA 1QI0A 4LNYA 1AH0A 3PZTA 2BTMA 2VRJA 4K6AA 2Y63A 2DZSA 1H7RA 4GUGA 4IIEA 4H9MA 5A94A 2VDIA 1PYMA 4MLJA 3RX2A 3QRHA 2XGIA 4M7SA 2DIKA 3B0UX 1UD5A 1E56A 5CEWA 3SUSA 3QFEA 2QMJA 3AJXA 2BHYA 4XD3A 1KLZA 3IAPA 4A2RA 2PBGA 3IV3A 4OIFA 4WGXA 3VKDA 3OODA 1Z9AA 3CTLA 5DMNA 5AC5A 4PUMA 1J93A 2XWEA 5AC7A 4DELA 3UVIA 4Z08A 1VEMA 4D6DA 1S46A 2OX1A 1PHWA 1FDZA 4YTSA 4WDUA 5IHRA 3RRAA 3ZWSA 1M1BA 2AQOA 2YFOA 4HD5A 4P8VA 4CVWA 3DGRA 2J6XA 1DBTA 3UBPC 2PTXA 4JIRA 1R3WA 3UR5A 2UZ9A 1X7FA 2ISSA 1SZNA 1JYVA 1OSEA 1MW0A 1XL9A 2FZMA 5U4NA 3LCGA 2RDWA 4H7CA 1TUFA 4GXPA 3L21A 4EOUA 1N8FA 3XISA 3KVJA 3SAZA 1MUWA 2G96A 2WVVB 2GVJA 4JL2A 1ZJIA 2QAPA 1K1DA 2Q8LA 4OUEA 2VC5A 3OYXA 3QLLA 1NH6A 1OK6A 1BSIA 2XU2A 3PZ9A 2VGFA 3QOMA 1LYXA 2Q01A 3HG4A 2WMFA 1WZLA 5DO8A 2YCIX 2AL2B 3KFTA 4XD5A 3SN0A 1UR1A 1HW6A 1NELA 3CV1A 3W7OA 2OB3A 3T08A 4DXKA 2ZX5A 3S1VA 3D47A 1UUOA 5E6YA 3KRBA 2V3FA 1VIWA 5CJNA 2H9AA 2HV5A 2PAJA 4WD0A 1GKPA 2X41A 2J7HA 4IX2A 4OGZA 2OLSA 1YDNA 2VELA 4XSMA 3K8MA 3KCOA 4N9BA 5HNTA 4QAWA 3H4XA 4UTFA 3TNOA 2CU0A 1ALDA 2E3ZA 5C0QA 3VM7A 3QGVA 6PTDA 2BVYA 5K9CA 1QPQA 2DH3A 1W9DM 3KDOA 4HU0A 3N25A 4D6HA 4N6FA 1XIEA 2GGGA 4Y9OA 4LUSA 3BXWA 3EWCA 5A3HA 4E2BA 4LYQA 3VIHA 3DZ1A 3WLHA 4Q22A 4IF2A 2GJXA 2YDAA 4NAFA 3BJTA 3NZRA 2HVNA 2Z1XA 3A12A 5JXQA 6XIMA 1VYSX 3RITA 1PDYA 1W5NA 2ZCGA 2W4XA 4ZTXA 1WB0A 5JQ9A 3TLLA 4EPEC 4R88A 3G77A 4LFYA 3IEBA 1VIZA 3POCA 1RP9A 1OFDA 3MUZ1 3WUBA 3WNMA 1R30A 3N4AA 4MGGA 4FAMA 4MOZA 5AYZA 1EUAA 4MMWA 2F6UA 2NT1A 3ICJA 3QBUA 1IV8A 5DELA 3S1UA 3VIMA 1DJQA 2A79A 4PMRA 4D6EA 3MW7A 2EPHA 1NM9A 5AOUA 1XCWA 3U4FA 3GH7A 2H6RA 4WIWA 1XC6A 4H8NA 2D2HA 1O95A 5TD4A 2GSHA 1KKOA 3EA1A 1A5LC 2P0OA 1VB9A 3L4TA 4E4FA 3LBMA 2XZ7A 3WNNA 2OQLA 3SUTA 4DJFA 3FKKA 4QJ5B 5T9BG 2GSJA 2PC8A 3ARUA 1DJHA 2XHYA 2Y89A 3BG9A 1LRTA 3FLUA 1R86A 1TCMA 3SSZA 2ZX9A 1R3SA 4QDPA 2W63A 4GYFA 4JTLA 4B9YA 5A2BA 3BMVA 4V15A 2O0TA 1P7TA 5D30A 3P7YA 4N2YA 3T0TA 2ZC8A 3J7HA 2OSYA 3JR2A 4NI8A 1ICSA 3H24A 1KM2A 4B90A 3PVFA 3WQ4A 4ES4A 2VUYA 5LA1A 1GJPA 1ZJHA 3TU9A 3TFXA 1YKWA 3LXBA 3MT1A 3GXFA 1XDJA 3C8NA 2PTYA 4XQ6A 1M7JA 3O6AA 3UCCA 4GG9A 2WYSA 1JZ4A 4MJMA 3ABXA 1W3TA 1JXKA 4H9TA 3GU1A 1XGZA 3KCLA 1UPPA 1GKRA 2CLOA 4A05A 2ZICA 3ARYA 3IGUA 1UASA 5HA7A 2OCZA 1GOOA 1SJCA 5A95A 5MHBA 3QC3A 4K2SA 2V5DA 1Y0EA 1B0IA 2Y6ZA 4O54A 1XRFA 2WMJA 4UQCA 1MXGA 3A21A 1LQ2A 1XRSA 2QF8A 3PSVA 1U33A 4S3KA 3RG6A 3BGAA 3VZYA 4NYYA 4JCMA 2J47A 4PE8A 2JGYA 2D23A 2W3ZA 4BI5A 1EA9C 2RDTA 3V35A 2YGYA 1UR8A 1I6NA 3IJQA 4Q7IA 1W32A 2V38A 5I3KA 1E40A 1CGXA 2VX4A 5FF0A 3NQEA 1OFAA 5A6LA 4M3PA 1Q8JA 2GDVA 3O07A 4Q8WA 3L67A 2FHFA 4WSKA 4LVAA 1GEQA 4PRWA 4C6NA 4X22A 2J24A 3D3FA 1IYXA 1PZ1A 1CLVA 3WL1A 3N6JA 5I7GA 3AYVA 3IJ7A 3T0CA 4S39A 1LL7A 1TV7A 1GORA 5LIXX 3H22A 2A6NA 4HTBA 4RPQA 4U10A 4A35A 2VZOA 4JX4A 1X6UA 2Y2WA 1U22A 1J6PA 1SO5A 3ZJ7A 4EWND 3UU0A 4DWSD 3EMCA 3L0GA 4FNPA 5AHEA 1Q6LA 1ZZMA 2CWXA 1MW2A 3ERPA 4KWOA 4HT3A 3UWWA 2YBTA 3GRIA 2FKPA 2BNJA 4ADTA 3W70A 1UH3A 3O16A 5ENLA 4PTNA 3E1F1 4ECLA 2E40A 1GTEA 1BVWA 4ICNA 1EX1A 1FHVA 3H26A 5A8PA 3QYSA 2WSYA 1B31A 2YCJA 3GG0A 4D6CA 1W3LA 4J3TA 5HDRA 4DZIA 4JTIA 2WAGA 4LOCA 3CYJA 2J9YA 3STFA 3WQGA 3H2OA 3VO0A 3EB2A 4YN5A 1HKMA 2AKMA 2WMIA 2WM0A 2X1SA 2E6YA 4Q7BA 3NQ7A 3EEGA 5CBIA 3A3HA 1ZU8A 4IMGA 4R9OA 3PJWA 1NF0A 2CBVA 1E6QM 4Z1CA 2F38A 3GDBA 3TEVA 2Y5JA 3RF9A 3A13A 5BWFA 2V30A 1AW2A 1QWGA 2NVAA 2YXXA 1TPVA 3OO2A 1MDRA 3VOCA 1AW1A 2QCDA 3QV7A 4NSBA 3QSTA 1E1EA 4RV8A 3PP7A 2XVKA 3FK4A 4L64A 2RJGA 4BF5A 1R46A 1PX3A 5JBEA 1FH8A 4A3UA 3D6NA 2FLIA 4WKHA 4WY0A 1A5MC 3BARA 3R8GA 1UD6A 1JCLA 3PZUA 1TJ1A 4FK9A 3P82A 2OQYA 2MNRA 3S2MA 3MC5A 1J79A 3IAQA 7CGTA 1VYRA 2BXYA 1UMLA 1WAWA 3ZVHB 1I2NA 1G9HA 3O6CA 4OBTA 1ZS2A 3VMNA 2DVTA 2O4MA 1V03A 1AMYA 3GW0A 4LS1A 4QE1A 3FSUA 1H49A 5ABHA 3UJ2A 1WKYA 3ARSA 1VCGA 4U5IA 3G8EA 2NW0A 3UCDA 4RW3A 4CD8A 3WENA 5D09A 2WHMA 4HOZA 2C0HA 4QJ3B 4HA1A 4NHVA 3P14A 4XO6A 1SUXA 3GLCA 1BAGA 4F2TA 2WPBA 2ZZ7A 1S5MA 1H0GA 4ZODA 3E3HA 3KL5A 1AA1B 1TJ2A 3LHYA 1H4PA 4KMQA 3KOXA 4N6EA 1SFTA 3CEUA 3W0KA 3MZ2A 3WDPP 1TPC1 5E6ZA 4IL0A 3R5EA 4AZCA 1VZWA 1IZJA 1A3XA 1F6PA 3W73A 4DXXA 3C8FA 3BLLA 1OBAA 4JR5A 4JCLA 2XGBA 4DJEC 1KGUA 5LGXA 2WNQA 1W2VA 4V27A 3TN6A 5CPNA 1TWDA 4HTYA 5K9DA 2JFEX 2AQWA 4IPPA 2YL9A 4OKDA 1PBGA 3WYZA 3SFKA 3DI1A 5G1YA 4RE3A 2J7FA 4H6RA 4DM2A 2QJIA 1LOSA 4MY8A 3O9NA 4Q4RA 1ZCOA 4R5EA 3IARA 3F5JA 1EWDA 2PA6A 3TMLA 1IE7C 3KUMA 1PIGA 3LD5A 1FQ0A 2GJLA 1BRLB 4WF7A 2W5FA 3GNRA 4S23A 4H41A 2DIEA 4POCA 3W1TA 3N9KA 4UCFA 2DZUA 1NOFA 4UTJA 4OZOA 1J18A 3MCOA 2NXHA 4XAZA 1H0IA 3WFZA 3QV8A 2D2GA 4JTCA 1WX0A 4JYFA 3WQOA 4Y90A 5EMLA 3GS6A 2Y7DA 2QVHA 4IQEA 3WQFA 5E09A 1GQIA 1GWJA 2ZA3A 3OOQA 3UR7A 2J7DA 4C6BA 3LMYA 4EXQA 2P53A 2VD8A 5AN7A 2OWWA 3TWAA 4PTWA 3LOTA 1CGVA 3ZT5A 1PEZA 3OIXA 4D2JA 4L4OA 5IHSA 3ES7A 4QDMA 2WC4A 4WXYA 1ITCA 3RR4A 4IOTA 1RK5A 1CB2A 1E51A 3RPTA 1K3UA 3TN3A 3AZTA 3AHTA 2Y62A 2CLKA 1E9IA 2BVDA 3HG2A 5CC5A 3EAUA 4UXDA 1OFOA 1J0ZA 4IL2A 2WJZA 1CDGA 5C9ZA 2ADAA 5HMSA 4J2MA 3T55A 1L8PA 1P43A 4L6OA 3CUGA 1IF2A 3PWAA 4AZ6A 5D02A 2FH6A 2YDRA 1K7XA 5XINA 3W2MA 4QG8A 2G5WA 3GWQA 4A3YA 1REQA 1V8EA 5HWNA 2ZIDA 2XJ7A 3AIQA 4GX9A 5C9XA 3L5AA 1QWKA 3TYCA 2XSBA 2UWFA 2INFA 5HNRA 1JDCA 3G1RA 4JGDA 4LVDA 1C91A 2FZ9A 2GSEA 2C6QA 4M6PA 1MEIA 5K7JA 2XZ9A 3QLDA 2P8CA 2VX6A 4W88A 3DCPA 1B4EA 3NURA 2PDBA 1FHLA 2GL5A 1GOMA 3KOWA 4PCFA 4ZE5A 3RO8A 4NAEB 4CU6A 2FMOA 1SJAA 1YDYA 2AGKA 1MQRA 5AHNA 4MKSA 1EJVC 4QISA 1HNYA 1LBLA 2QCGA 3C0QA 3IVSA