3KS8A

Crystal structure of reston ebolavirus vp35 rna binding domain in complex with 18bp dsrna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
b'ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*AP*GP*AP*AP*GP*GP*AP*GP*GP*GP*AP*GP*GP*GP*AP*GP*GP*A)-
publication title Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Viral protein/rna
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ks8A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3ks8A02
3L29A 3L2AA 4IBDA 4IBFA 4GHAA 4IJEA 4IBGA 3FKEA 4IBCA 4IBKA 4LG2A 4GHLA 5BPVA 4IBEA 4IBJA 3KS8A 3KS4A 3L28A 4IBBA 4GH9A 4IJFA 3L25A 3L27A 4IBIA 3L26A
chains in the Genus database with same CATH superfamily
1HQYE 5ITXE 4M0WA 5EP1A 4B7FA 4RKUF 3TL4X 4QHTA 5EP4A 5E26A 3SYLA 3W0LB 1W1TA 1NHGC 3SBJA 1QDTA 4X66M 3KVWA 4FCTA 4IBKA 3E4RA 4B3MM 1ZAEA 2HL7A 4NXNM 4ITQA 1EIJA 4LJ5A 5KO3A 1QZMA 1IFYA 2Y2KA 1BVSA 5DFLA 2FNAA 4R71A 3VK8A 1IN5A 1PJIA 4B3TM 4L8RC 4R3DA 2C98A 2L09A 3HGIA 1HJPA 4LJ9A 2EUCA 3D8LA 4QHSA 2HAKA 3AV0A 4G4RA 3U6CA 3KSXA 4DR1M 2R0IA 1JR3A 4OJ5A 1IXRC 1OAOC 1SXJA 4B08A 2V6ZM 2OPFA 2C9OA 1HR0M 3WD0A 3K1JA 3GPYA 2MGWA 4L78A 4LFAM 4OJOA 4DV0M 1QDRA 1R7RA 2ZTCA 2FOIC 2GQFA 2M60A 5EXSA 4EIWA 5FTMA 4DBGB 3VK7A 1IBLM 1PJSA 1HNXM 1GPFA 2Y2IA 1GKIA 1N34M 2E5LM 1YU3A 4NYUA 1R2ZA 4MGZE 1NV8A 2KW0A 3HHYA 3GLFB 2R65A 1Q02A 2Y2GA 2Y2OA 1DGGA 1TDHA 2BJWA 4LCBA 2DHRA 2XZUA 3QWLA 2Y2HA 3GPUA 2AHMA 3A45A 4GRIA 1N77A 3GLGB 3HY5A 4S12A 3GRRA 3FUTA 2ZAOA 4CISA 3R9XB 3UMMA 3L29A 2JE5A 2KRUA 2LHGA 3LQRA 4LRTA 2QBYA 1XNRM 2F4VM 1Z59A 4LJ6A 1L1TA 1QYRA 3E46A 3GLIE 4LF4M 1YU2A 2D7EA 5FTNA 1A5TA 4M9ZA 1MJGM 1K3XA 1IBMM 3UGJA 1N33M 2UUCM 5EXTA 2UUAM 4QNMA 2DAKA 3GLHE 2UWXA 1T6OA 4LGMA 1N75A 4OUIA 4L15A 4DR2M 2XFTA 1QZEA 3HHWA 2CEAA 3GPXA 4NRWA 4AKHA 1OJLA 1G3IA 4LF6M 1V92A 4G4NA 1V34A 2KNVA 1W5SA 3RGSA 1I94M 3HX3A 3U6OA 1HT1E 4B3SM 4LF9M 3R8FA 2BWBA 2C5RA 3A42A 3SATA 2K9DA 1XXHE 2R18A 3BBZA 4OW0A 3U6PA 2DWNA 3PNYA 4LFBM 5IT9S 4DR3M 4LJAA 1MU5A 4YHHM 1D2NA 2KHHA 3FD9A 1R2YA 4NZ1A 1NY5A 1OKSA 2DWZB 2JXNA 2VQFM 2APLA 3SAVA 4DV2M 1JR3D 1WXQA 3HJSA 3U5ZB 3WD3A 3V76A 5ITRA 3MJ5A 1NV9A 3HU1A 3K92A 2DAGA 3FUVA 4Y28F 2L7HA 1SXJD 1NSFA 1Z5BA 2KZUA 1AUAA 2CFOA 4NRVA 1I4WA 4JI3M 2KA6B 1T43A 4G6ZA 1MN3A 3SHGB 1OQYA 2D7HA 4CIZA 2JY5A 1IXZA 3GO8A 2OQ4A 3GQ5A 1W1VA 4CGYB 3B7QA 3DZDA 1IXSA 3AOGA 2C96A 4FWDA 4LY6A 3AFHA 2FN2A 4A3VB 4IBIA 3SMSA 1AIWA 1Z6TA 3JAMS 4NZ3A 2NQ8C 4TUWA 2ZBKB 2EJSA 2C99A 1VEJA 3T38A 1TH3A 4YY3M 1XHBA 5FSWA 1E94E 1NJFA 2FE8A 1MX0A 2R62A 3KXEC 4LJ8A 4G4QA 3E9SA 4HL4A 1VG5A 4GITA 5EXXA 2KEBA 3U60B 1OGBA 4NZ4A 5KPZA 2JZ1A 4MGKE 2N35A 5BPVA 3U6QA 2Y2MA 3HKPA 1TR8A 2Y0QA 5C18A 2KDLA 3TQSA 1TDZA 1NNJA 3HJ8A 1TF0B 3HWSA 2DNAA 4GEWA 4DUYM 4P16A 1SXJC 3BXWA 1ZMUA 4GH9A 4AKGA 5FTJA 1WIVA 2Y2NA 3J2PB 4NC6A 3GLFA 4GC9A 4JI5M 4L4UA 4Z8XA 1NHWC 4I5SA 2UUBM 3M0EA 3U6MA 3GLGA 1UFZA 1GVNA 1NJGA 5ITUA 1UR8A 2R4EA 1EE8A 1ORYB 1PDCA 1PJQA 2K0BX 2QQ8A 2R6FA 4BBAA 2C9CA 3J81S 3WX7A 3VKHA 3ILKA 4NOOB 3IG5A 4X64M 4AKIA 1G8PA 4NXMM 3EIHA 4NSRA 2LVOC 1H0IA 1J5EM 1QVRA 3U6EA 1F4IA 3KOWE 4JV5M 2MH8A 2VF8A 1XWIA 1IM2A 3SARA 4LRSA 2L2DA 3NBXX 1Q3BA 4JI0M 2LVAA 2O01F 3AOEA 1HNZM 3Q8GA 4GKKM 3SC3A 1YSYA 4IBFA 4KT0F 2VIIA 4B7HA 5FTLA 2JWSA 2CV0A 4IBGA 4JI1M 2UXBM 4JI6M 3HONA 4Z2HA 1E88A 3KW6A 1YE9A 1R6BX 2OOBA 2DENA 2MROB 2DHYA 2XD5A 2OOAA 2I7NA 2ZTDA 2JA2A 4IBJA 4I81A 1PM5A 3GLIA 1E15A 3HSHA 2F5SA 1L2CA 2H1RA 3A98B 3C3DA 3KSJA 4MB5A 1IN8A 3T1YM 2DKLA 2O5RA 3U6DA 3L27A 1NY6A 1WR1B 2A5YB 3L25A 3MK6A 1PJTA 2F5OA 1G59A 4QNLA 4NSOB 1N32M 2EO2A 4I4LA 4LZZA 2FFJA 3D8BA 1IBKM 1GLNA 3B7NA 2Y21A 1NNUC 3B9PA 2OO9A 5KQ8A 3HJQA 1GL7A 3AKZA 3FKEA 3NWLA 1H8PA 4HMDA 3IHPA 3EIEA 1E6RA 1PGYA 3U60A 3ZC7B 4GHLA 3J7BA 4DUZM 4LJ7A 4Z2IA 3WHLA 2Y20A 3I04M 1N78A 1C1KA 1V33A 3JR4A 1XMQM 2HWJA 2GNOA 3LCVB 4JN6A 1JB0F 4LF5M 3KS8A 1JR3E 5KPRA 2FFFB 1YU4A 1CUKA 2HHHM 1OTRA 1SXJE 2UU9M 4DR5M 3VDUA 4OJLA 1L1ZA 3K9OA 1DGFA 2ERCA 5IWAM 3QAUA 1E6NA 2YFQA 4KLNA 3TWMA 4JI4M 2DWMA 2IOUA 3K2LA 3GQ4A 3L2AA 2H5XA 4D82A 1E32A 2XSZA 3ZCBB 4IJEA 4XK8F 2R46A 4PCZA 1VDLA 3SASA 2L7IA 5A2QS 4LF7M 5LMUM 3SMPA 4HMEA 1OGGA 2XF3A 3J7AS 2XH9A 4BB9A 4MB4A 2QP9X 3M7GA 3GQ3A 1Q3CA 1TH4A 2CV2A 3KFUG 4DR4M 2CRUA 1G4AE 2W82A 2G5GX 4I8OA 1KSFX 4LZJA 3KOZE 2JZ0A 2K6BA 4K0KM 3C9PA 3UK6A 4GIPA 3GLHB 3RFWA 3U6LA 2CHQA 5EJCA 4CHTB 2EKFA 1YLAA 2DI0A 4REZA 4W5WA 4FCVA 1OIZA 3U6SA 1XMOM 4Z2KA 1D0MA 2QSFX 2L4EA 2V1UA 3C58A 1QQWA 4GHAA 2RTSA 4XBOA 1IQPA 2X4AA 3MHVC 1H0GA 2CV1A 1XXHB 1N36M 2LNHC 2CWBA 3DOAA 3JR5A 5ITXA 3I4VA 2VDBB 1VDDA 4MM3B 1HT2E 2KNAA 4G3OA 1VQ1A 2DXIA 4F1IA 1VEKA 4D80A 2KXEA 3QYBA 2QPAA 3AOEC 3FRIA 1UM8A 4AQYM 1DO2A 1K3WA 4AG5A 2Z8YM 2DAIA 4LFCM 3H4JA 2LBCA 3WD2A 3UZUA 2P5TA 2DVWB 3C3EA 2L6OA 3W68A 1NO1A 1J7KA 2JNHA 2CUZA 2HCBA 3F92A 2F5NA 2XZFA 2V1CA 1L2DA 4L16A 2BG1A 2D49A 4MB7A 1TH2A 1LTMA 3ZH9B 1ZV1A 4AG6A 3TE6A 1PJJA 3FUUA 3LQQA 1QUSA 3W0FA 2F5QA 4HMCA 1PRBA 4LJ4A 2DAMA 1YU0A 3PFIA 2LVPC 3HZJA 3LMMA 1L8QA 3B89A 3A46A 1S3SA 3K9PA 4FVMA 4X65M 2MR9A 3MMPA 4ZPXA 5ITQA 4JI2M 4NL4H 1AIPC 2FH0A 1FNNA 4MGYE 2LXEA 1E8BA 2Z3XA 1P3QQ 1WGLA 1GOIA 2XSZD 4M9XA 5DYGA 1RU3A 3THGA 1GJTA 4BLCA 2DZOB 2WSEF 1Y8GA 2LWXA 3LVVA 4G4OA 2DWLA 3L26A 4JXJA 3T15A 4LF8M 2YQZA 1OFHA 1GXDA 1J09A 3FE3A 5GKNA 1ZMWA 4QOZC 4OJ6A 3GP1A 5H37D 1NVMA 2XLJA 2D7GA 1L6JA 3SAUA 3RE8A 3FTCA 1CK7A 3U61B 1R5LA 5DYIA 1QAMA 2JUJA 5C1BA 3J80S 4PD2A 2L4FA 3DFZA 4WW0A 1EAKA 2JCHA 2JY7A 2KZSA 2R4JA 5L8RF 5IREB 3T6PA 2XEPA 4QOSA 1QUTA 3AJIB 5EQTA 4KHPM 1WJ7A 4M9SA 4DR6M 2EA0A 3GLFE 3LW5F 5ITTA 3CF0A 1GABA 3U5ZA 5E6JA 3CF6E 2J7NA 1GJSA 1IXSB 3B7ZA 3GLGE 2J7OA 2X49A 4JI8M 1E6PA 3LVWA 1HQCA 4DV6M 2XD1A 4DV4M 1IY1A 2I7PA 2LTUA 2QENA 3GLHA 1IY2A 1DGBA 4OVZB 3HHZA 4GKJM 3FUXA 2V5OA 3T1HM 2R45A 3KDSE 3KOYE 4MH0E 4R7GA 4RF0A 3FTDA 4IBDA 4HEOA 1OFIA 1E9SA 1DGHB 1Q39A 1TTEA 4P17A 5EP2A 1WGNA 2M5ZA 4RNAA 3GLIB 2KRKA 4AZFA 2DZNB 3WHKA 1TGUA 4TX8A 3FYDA 1XXHA 1VEGA 2UXDM 4LG2A 2Z4RA 1EFUB 2ZANA 2YNMD 4IBEA 4L6V6 3KP0E 4Q7JA 3RGPA 4II7A 2BNKA 2J5YA 4CJ6A 1D0KA 2F5PA 1ED7A 3GPPA 5LMNM 1KS0A 3GRUA 3HU3A 4XGIA 2UXCM 2O25A 1K82A 3BOSA 3VLFB 1GO5A 4FD2A 3PXGA 1KFVA 3TWKA 5JI3E 1IN6A 1JQJC 1QAQA 4WP2A 4QNRA 5BR8M 4UN2B 1SG9A 3IG8A 4IIWA 1KYIA 3FUWA 3SAWA 1D0LA 3M7PA 1YUBA 1L2BA 4AW4A 3FTFA 4WURA 1E6ZA 2XFSA 4LGYA 4MGIE 3SHFA 2DAEA 1W1PA 4X62M 2FS1A 1FJGM 3M6AA 2CHGA 4KO8A 4OJPA 1CXWA 4NY2A 4OX9M 2QNJA 1E9RA 2BWEA 4HLQA 4PT5A 2DZLA 5FTKA 2RRUA 1QANA 4FWHA 3TPZA 1W5TA 2Y2PA 4DR7M 4JYAM 1YUEA 4Z2LA 3L28A 2ZM6M 3CTWB 3J27B 3VKGA 2WSFF 3HU2A 2LVNC 2RGOA 2JP7A 1DV0A 2HKJA 2RGHA 3UJNA 1G71A 1SXJB 3E21A 2CE7A 4DV7M 2CHVA 1UR9A 3SYKA 1Z5AA 3KP1E 3B74A 2BJVA 4DV5M 3U61A 1R4GA 4Z2JA 4NYYA 2VQEM 4MB3A 1ZQ9A 3I51A 4IBCA 3IECA 4M0DA 3WD1A 4MGHA 2QHOB 1OIPA 3LCUA 1QO6A 1W1YA 5JI2E 3QYEA 4KODA 4D81A 3MQLA 3WD4A 1XC8A 1J7MA 3GRVA 1C7YA 3OTOM 3I4YA 3FTEA 1X37A 4B3RM 1XB2B 1LV7A 2R44A 2VF7A 2LH0A 4AI6A 2CP8A 1G41A 3ZQJA 2JY6B 3DA1A 3KS4A 5EP3A 2G8LA 2WZJA 5ITYA 8CATA 2RKOA 3NBIA 5KQDA 5FLXS 3I01M 4IJFA 4PDGA 1O6IA 2Z4SA 5DNYA 2Y2JA 3PNVA 2Y0TA 1HNWM 4FCWA 2MJ5B 3FRHA 3K8ZA 2K47A 1H6UA 2WSCF 4FW9A 4OVZA 4DV1M 1YU1A 3HHXA 3CF2A 2G3QA 2QZ4A 1QAOA 3Q8XA 2QBYB 4JI7M 3VFDA 1IN7A 4PDIA 2XGNA 4ANRA 3AL0C 3N3FA 5EXPA 1DGHA 1Z5CA 2JY8A 4Z6YA 3H4MA 1WHCA 2LVQD 4B7GA 4Z2GA 1XNQM 1IY0A 3KOXE 1GL6A 4GMQA 2ZAMA 1ZMVA 1DO0A 4DV3M 2YR0A 2QCUA 2KNZA 2EKKA 1IN4A 3SFZA 3GRYA 5F3WA 4IBBA 3TWLA 2Y2LA 1T3TA 2Q2EB 3VDPA 2LHCA 4GC5A 2B3TA 7CATA 3W67A 3FYCA 4F2LA 2Z7JA 4RF1A 4NZ5A 2Y2QA 1OAIA 2X8AA 3CGWA 3PVSA 4FWGA 5IZ7D 4OU7A 5KPTA
chains in the Genus database with same CATH topology
1HQYE 5ITXE 4M0WA 5EP1A 4B7FA 3TL4X 4QHTA 5EP4A 5E26A 3SYLA 3W0LB 1NHGC 3SBJA 4X66M 3KVWA 4FCTA 4IBKA 3E4RA 4B3MM 1ZAEA 2HL7A 4NXNM 4ITQA 4LJ5A 5KO3A 1QZMA 2Y2KA 1PJIA 2FNAA 3VK8A 4B3TM 1IN5A 4L8RC 4R3DA 2C98A 2L09A 3HGIA 4LJ9A 2EUCA 3D8LA 4QHSA 3AV0A 4G4RA 3U6CA 3KSXA 4DR1M 1JR3A 4OJ5A 1IXRC 1SXJA 4B08A 2V6ZM 2OPFA 2C9OA 1HR0M 3K1JA 3GPYA 4L78A 4LFAM 4OJOA 1R7RA 2FOIC 2M60A 5EXSA 4EIWA 3VK7A 5FTMA 1IBLM 2Y2IA 1HNXM 1GKIA 1N34M 2E5LM 1YU3A 4NYUA 1R2ZA 4MGZE 2KW0A 3HHYA 3GLFB 2R65A 2Y2GA 2Y2OA 1DGGA 1TDHA 2BJWA 4LCBA 2DHRA 2XZUA 3QWLA 2Y2HA 3GPUA 2AHMA 3A45A 4GRIA 1N77A 3GLGB 4S12A 3GRRA 3FUTA 2ZAOA 4CISA 3R9XB 3UMMA 3L29A 2JE5A 2KRUA 3LQRA 4LRTA 2QBYA 1XNRM 2F4VM 1Z59A 4LJ6A 1L1TA 1QYRA 4LF4M 1YU2A 2D7EA 5FTNA 1K3XA 4M9ZA 1IBMM 1N33M 3UGJA 2UUCM 5EXTA 4QNMA 2UWXA 4LGMA 1N75A 4OUIA 4L15A 4DR2M 2XFTA 3HHWA 2CEAA 3GPXA 4NRWA 1OJLA 1G3IA 4LF6M 4G4NA 1W5SA 3RGSA 1I94M 3U6OA 1HT1E 4B3SM 4LF9M 3R8FA 3SATA 2C5RA 3A42A 2R18A 3U6PA 4OW0A 2DWNA 3PNYA 4LFBM 5IT9S 4DR3M 4LJAA 1MU5A 4YHHM 1D2NA 1R2YA 3FD9A 4NZ1A 1NY5A 2DWZB 2VQFM 3SAVA 4DV2M 1JR3D 1WXQA 3HJSA 3U5ZB 5ITRA 3MJ5A 2UUAM 3HU1A 3K92A 3GLIB 3FUVA 4BBAA 1SXJD 1NSFA 1Z5BA 2CFOA 2KZUA 2L7HA 4NRVA 4JI3M 1I4WA 3SHGB 2KA6B 4G6ZA 2DWMA 4AKHA 3GO8A 2D7HA 2OQ4A 1IXZA 3GQ5A 4CGYB 3DZDA 4FWDA 3AOGA 2C96A 4LY6A 3AFHA 4A3VB 4IBIA 3SMSA 1Z6TA 3JAMS 4NZ3A 2NQ8C 4TUWA 2ZBKB 2C99A 3T38A 1TH3A 4YY3M 1XHBA 5FSWA 1E94E 1NJFA 2FE8A 1MX0A 2R62A 3KXEC 4LJ8A 4G4QA 3E9SA 4HL4A 4GITA 5EXXA 2KEBA 3U60B 4NZ4A 5KPZA 4MGKE 5BPVA 3U6QA 2Y2MA 3HKPA 2Y0QA 5C18A 3TQSA 1TDZA 3HJ8A 3HWSA 4DUYM 4P16A 1SXJC 4GH9A 4AKGA 5FTJA 2Y2NA 3J2PB 3GLFA 4GC9A 4JI5M 4L4UA 4Z8XA 1NHWC 4I5SA 3M0EA 3U6MA 3GLGA 1GVNA 1NJGA 5ITUA 2R4EA 1EE8A 1ORYB 2C9CA 3J81S 3WX7A 3VKHA 3ILKA 4NOOB 3IG5A 4X64M 4AKIA 1G8PA 4NXMM 3EIHA 4NSRA 1J5EM 1QVRA 3U6EA 3KOWE 4JV5M 1XWIA 1IM2A 3SARA 4LRSA 1Q3BA 4JI0M 3AOEA 1HNZM 4GKKM 3SC3A 1YSYA 4IBFA 2CV0A 2VIIA 4B7HA 5FTLA 4JI1M 4IBGA 2UXBM 4JI6M 3HONA 3KW6A 1YE9A 1R6BX 2XD5A 2I7NA 2JA2A 4IBJA 4I81A 3GLIA 3HSHA 2F5SA 1L2CA 2H1RA 3A98B 3KSJA 1IN8A 3T1YM 2O5RA 3U6DA 3L27A 1NY6A 3L25A 2A5YB 3MK6A 2F5OA 1G59A 4QNLA 4NSOB 1N32M 2EO2A 4I4LA 4LZZA 2FFJA 3D8BA 1IBKM 1GLNA 3B9PA 2Y21A 1NNUC 5KQ8A 3HJQA 1GL7A 3AKZA 3FKEA 3NWLA 3EIEA 3U60A 3ZC7B 4GHLA 3J7BA 4DUZM 4LJ7A 3WHLA 2Y20A 1N78A 1C1KA 3JR4A 1XMQM 4JN6A 4LF5M 3KS8A 5KPRA 2FFFB 1YU4A 2HHHM 1SXJE 2UU9M 4DR5M 3VDUA 4OJLA 1L1ZA 1DGFA 2ERCA 5IWAM 3QAUA 2YFQA 4KLNA 3TWMA 4JI4M 2IOUA 3K2LA 3GQ4A 3L2AA 4D82A 1E32A 2XSZA 3ZCBB 4IJEA 2R46A 4PCZA 3SASA 2L7IA 5A2QS 4LF7M 5LMUM 3SMPA 2XF3A 3J7AS 2XH9A 4BB9A 2QP9X 3M7GA 3GQ3A 1Q3CA 1TH4A 2CV2A 3KFUG 4DR4M 4I8OA 1G4AE 2W82A 2G5GX 1KSFX 4LZJA 3KOZE 4K0KM 3UK6A 4GIPA 3GLHB 3RFWA 3U6LA 2CHQA 5EJCA 4CHTB 2UUBM 4REZA 3U6SA 4W5WA 1XMOM 4FCVA 2V1UA 3C58A 1QQWA 4GHAA 4XBOA 1IQPA 2X4AA 3MHVC 2CV1A 1XXHB 1N36M 2LNHC 3DOAA 3JR5A 5ITXA 3I4VA 1VDDA 4MM3B 1HT2E 2DXIA 4D80A 2KXEA 2QPAA 3AOEC 1K3WA 1UM8A 4AQYM 1DO2A 4LFCM 4AG5A 3UZUA 2P5TA 2DVWB 2L6OA 2F5NA 1J7KA 2CUZA 2HCBA 2BG1A 2XZFA 2V1CA 1L2DA 4L16A 4MB7A 1TH2A 3ZH9B 4AG6A 3TE6A 1PJJA 3FUUA 3LQQA 3W0FA 2F5QA 4LJ4A 1YU0A 3PFIA 3LMMA 1L8QA 3A46A 1S3SA 4FVMA 4X65M 5ITQA 4ZPXA 4JI2M 4NL4H 1FNNA 4MGYE 2LXEA 2Z3XA 2XSZD 4M9XA 5DYGA 3THGA 4BLCA 2DZOB 2LWXA 3LVVA 4G4OA 2DWLA 3L26A 4JXJA 3T15A 4LF8M 2YQZA 1OFHA 1J09A 5GKNA 4QOZC 4OJ6A 3GP1A 5H37D 1NVMA 2XLJA 2D7GA 3SAUA 3RE8A 3FTCA 3U61B 5DYIA 1QAMA 5C1BA 3J80S 4PD2A 3DFZA 4WW0A 2JCHA 2KZSA 2R4JA 4DV0M 5IREB 2XEPA 4QOSA 3AJIB 5EQTA 4KHPM 4M9SA 4DR6M 2EA0A 5ITTA 3CF0A 3U5ZA 5E6JA 3CF6E 2J7NA 1IXSB 2J7OA 2X49A 4JI8M 3LVWA 1HQCA 4DV6M 2XD1A 4DV4M 1IY1A 2I7PA 2QENA 3GLHA 1IY2A 1DGBA 4OVZB 3HHZA 4GKJM 3FUXA 3T1HM 2R45A 3KDSE 3KOYE 4MH0E 4R7GA 4RF0A 3FTDA 4IBDA 1PM5A 1OFIA 1E9SA 1DGHB 1Q39A 5EP2A 1NNJA 2M5ZA 4RNAA 2KRKA 4AZFA 2DZNB 3WHKA 1TGUA 3FYDA 1XXHA 2UXDM 4LG2A 2Z4RA 2ZANA 2YNMD 4IBEA 3RGPA 3KP0E 4II7A 2BNKA 2F5PA 3GPPA 5LMNM 3GRUA 3HU3A 4XGIA 2UXCM 1K82A 3BOSA 3VLFB 4FD2A 3PXGA 1KFVA 3TWKA 5JI3E 1IN6A 1JQJC 1QAQA 5BR8M 4QNRA 3IG8A 4IIWA 1KYIA 3FUWA 3SAWA 1YUBA 1L2BA 4AW4A 3FTFA 4WURA 2XFSA 4LGYA 4MGIE 3SHFA 4X62M 1FJGM 3M6AA 2CHGA 4KO8A 4OJPA 4NY2A 4OX9M 1E9RA 4PT5A 4HLQA 5FTKA 4FWHA 1QANA 3TPZA 1W5TA 2Y2PA 4DR7M 4JYAM 1YUEA 3L28A 2ZM6M 3CTWB 3J27B 3VKGA 3HU2A 2RGOA 2HKJA 2RGHA 3UJNA 1SXJB 4DV7M 2CE7A 2CHVA 3SYKA 1Z5AA 3KP1E 2BJVA 4DV5M 3U61A 4NYYA 2VQEM 1ZQ9A 3I51A 4IBCA 4M0DA 4MGHA 5JI2E 4D81A 4KODA 1XC8A 3GRVA 3OTOM 3I4YA 3FTEA 1X37A 4B3RM 1LV7A 2LH0A 4AI6A 1G41A 3KS4A 3DA1A 5EP3A 2G8LA 8CATA 5ITYA 2RKOA 3NBIA 5KQDA 5FLXS 4IJFA 4PDGA 2Z4SA 5DNYA 2Y2JA 3PNVA 2Y0TA 1HNWM 4FCWA 3K8ZA 4FW9A 2K47A 1H6UA 4OVZA 4DV1M 1YU1A 3HHXA 3CF2A 2QZ4A 1QAOA 3Q8XA 2QBYB 4JI7M 3VFDA 1IN7A 4PDIA 2XGNA 3AL0C 3N3FA 5EXPA 1DGHA 1Z5CA 4Z6YA 3H4MA 4B7GA 1XNQM 1IY0A 3KOXE 1GL6A 4GMQA 2ZAMA 4DV3M 1DO0A 2YR0A 2QCUA 3SFZA 1IN4A 5F3WA 3GRYA 2Y2LA 4IBBA 3TWLA 1T3TA 2Q2EB 3VDPA 4GC5A 7CATA 3FYCA 2Z7JA 4RF1A 4NZ5A 2Y2QA 2X8AA 4FWGA 3PVSA 5IZ7D 4OU7A 5KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L29 A;  3L2A A;  4IBD A;  4IBF A;  4GHA A;  4IJE A;  4IBG A;  3FKE A;  4IBC A;  4IBK A;  4LG2 A;  4GHL A;  5BPV A;  4IBE A;  4IBJ A;  3KS8 A;  3KS4 A;  3L28 A;  4IBB A;  4GH9 A;  4IJF A;  3L25 A;  3L27 A;  4IBI A;  3L26 A; 
#chains in the Genus database with same CATH topology
 1HQY E;  5ITX E;  4M0W A;  5EP1 A;  4B7F A;  4RKU F;  3TL4 X;  4QHT A;  5EP4 A;  5E26 A;  3SYL A;  3W0L B;  1W1T A;  1NHG C;  3SBJ A;  1QDT A;  4X66 M;  3KVW A;  4FCT A;  4IBK A;  3E4R A;  4B3M M;  1ZAE A;  2HL7 A;  4NXN M;  4ITQ A;  1EIJ A;  4LJ5 A;  5KO3 A;  1QZM A;  1IFY A;  2Y2K A;  1BVS A;  5DFL A;  2FNA A;  4R71 A;  3VK8 A;  1IN5 A;  1PJI A;  4B3T M;  4L8R C;  4R3D A;  2C98 A;  2L09 A;  3HGI A;  1HJP A;  4LJ9 A;  2EUC A;  3D8L A;  4QHS A;  2HAK A;  3AV0 A;  4G4R A;  3U6C A;  3KSX A;  4DR1 M;  2R0I A;  1JR3 A;  4OJ5 A;  1IXR C;  1OAO C;  1SXJ A;  4B08 A;  2V6Z M;  2OPF A;  2C9O A;  1HR0 M;  3WD0 A;  3K1J A;  3GPY A;  2MGW A;  4L78 A;  4LFA M;  4OJO A;  4DV0 M;  1QDR A;  1R7R A;  2ZTC A;  2FOI C;  2GQF A;  2M60 A;  5EXS A;  4EIW A;  5FTM A;  4DBG B;  3VK7 A;  1IBL M;  1PJS A;  1HNX M;  1GPF A;  2Y2I A;  1GKI A;  1N34 M;  2E5L M;  1YU3 A;  4NYU A;  1R2Z A;  4MGZ E;  1NV8 A;  2KW0 A;  3HHY A;  3GLF B;  2R65 A;  1Q02 A;  2Y2G A;  2Y2O A;  1DGG A;  1TDH A;  2BJW A;  4LCB A;  2DHR A;  2XZU A;  3QWL A;  2Y2H A;  3GPU A;  2AHM A;  3A45 A;  4GRI A;  1N77 A;  3GLG B;  3HY5 A;  4S12 A;  3GRR A;  3FUT A;  2ZAO A;  4CIS A;  3R9X B;  3UMM A;  3L29 A;  2JE5 A;  2KRU A;  2LHG A;  3LQR A;  4LRT A;  2QBY A;  1XNR M;  2F4V M;  1Z59 A;  4LJ6 A;  1L1T A;  1QYR A;  3E46 A;  3GLI E;  4LF4 M;  1YU2 A;  2D7E A;  5FTN A;  1A5T A;  4M9Z A;  1MJG M;  1K3X A;  1IBM M;  3UGJ A;  1N33 M;  2UUC M;  5EXT A;  2UUA M;  4QNM A;  2DAK A;  3GLH E;  2UWX A;  1T6O A;  4LGM A;  1N75 A;  4OUI A;  4L15 A;  4DR2 M;  2XFT A;  1QZE A;  3HHW A;  2CEA A;  3GPX A;  4NRW A;  4AKH A;  1OJL A;  1G3I A;  4LF6 M;  1V92 A;  4G4N A;  1V34 A;  2KNV A;  1W5S A;  3RGS A;  1I94 M;  3HX3 A;  3U6O A;  1HT1 E;  4B3S M;  4LF9 M;  3R8F A;  2BWB A;  2C5R A;  3A42 A;  3SAT A;  2K9D A;  1XXH E;  2R18 A;  3BBZ A;  4OW0 A;  3U6P A;  2DWN A;  3PNY A;  4LFB M;  5IT9 S;  4DR3 M;  4LJA A;  1MU5 A;  4YHH M;  1D2N A;  2KHH A;  3FD9 A;  1R2Y A;  4NZ1 A;  1NY5 A;  1OKS A;  2DWZ B;  2JXN A;  2VQF M;  2APL A;  3SAV A;  4DV2 M;  1JR3 D;  1WXQ A;  3HJS A;  3U5Z B;  3WD3 A;  3V76 A;  5ITR A;  3MJ5 A;  1NV9 A;  3HU1 A;  3K92 A;  2DAG A;  3FUV A;  4Y28 F;  2L7H A;  1SXJ D;  1NSF A;  1Z5B A;  2KZU A;  1AUA A;  2CFO A;  4NRV A;  1I4W A;  4JI3 M;  2KA6 B;  1T43 A;  4G6Z A;  1MN3 A;  3SHG B;  1OQY A;  2D7H A;  4CIZ A;  2JY5 A;  1IXZ A;  3GO8 A;  2OQ4 A;  3GQ5 A;  1W1V A;  4CGY B;  3B7Q A;  3DZD A;  1IXS A;  3AOG A;  2C96 A;  4FWD A;  4LY6 A;  3AFH A;  2FN2 A;  4A3V B;  4IBI A;  3SMS A;  1AIW A;  1Z6T A;  3JAM S;  4NZ3 A;  2NQ8 C;  4TUW A;  2ZBK B;  2EJS A;  2C99 A;  1VEJ A;  3T38 A;  1TH3 A;  4YY3 M;  1XHB A;  5FSW A;  1E94 E;  1NJF A;  2FE8 A;  1MX0 A;  2R62 A;  3KXE C;  4LJ8 A;  4G4Q A;  3E9S A;  4HL4 A;  1VG5 A;  4GIT A;  5EXX A;  2KEB A;  3U60 B;  1OGB A;  4NZ4 A;  5KPZ A;  2JZ1 A;  4MGK E;  2N35 A;  5BPV A;  3U6Q A;  2Y2M A;  3HKP A;  1TR8 A;  2Y0Q A;  5C18 A;  2KDL A;  3TQS A;  1TDZ A;  1NNJ A;  3HJ8 A;  1TF0 B;  3HWS A;  2DNA A;  4GEW A;  4DUY M;  4P16 A;  1SXJ C;  3BXW A;  1ZMU A;  4GH9 A;  4AKG A;  5FTJ A;  1WIV A;  2Y2N A;  3J2P B;  4NC6 A;  3GLF A;  4GC9 A;  4JI5 M;  4L4U A;  4Z8X A;  1NHW C;  4I5S A;  2UUB M;  3M0E A;  3U6M A;  3GLG A;  1UFZ A;  1GVN A;  1NJG A;  5ITU A;  1UR8 A;  2R4E A;  1EE8 A;  1ORY B;  1PDC A;  1PJQ A;  2K0B X;  2QQ8 A;  2R6F A;  4BBA A;  2C9C A;  3J81 S;  3WX7 A;  3VKH A;  3ILK A;  4NOO B;  3IG5 A;  4X64 M;  4AKI A;  1G8P A;  4NXM M;  3EIH A;  4NSR A;  2LVO C;  1H0I A;  1J5E M;  1QVR A;  3U6E A;  1F4I A;  3KOW E;  4JV5 M;  2MH8 A;  2VF8 A;  1XWI A;  1IM2 A;  3SAR A;  4LRS A;  2L2D A;  3NBX X;  1Q3B A;  4JI0 M;  2LVA A;  2O01 F;  3AOE A;  1HNZ M;  3Q8G A;  4GKK M;  3SC3 A;  1YSY A;  4IBF A;  4KT0 F;  2VII A;  4B7H A;  5FTL A;  2JWS A;  2CV0 A;  4IBG A;  4JI1 M;  2UXB M;  4JI6 M;  3HON A;  4Z2H A;  1E88 A;  3KW6 A;  1YE9 A;  1R6B X;  2OOB A;  2DEN A;  2MRO B;  2DHY A;  2XD5 A;  2OOA A;  2I7N A;  2ZTD A;  2JA2 A;  4IBJ A;  4I81 A;  1PM5 A;  3GLI A;  1E15 A;  3HSH A;  2F5S A;  1L2C A;  2H1R A;  3A98 B;  3C3D A;  3KSJ A;  4MB5 A;  1IN8 A;  3T1Y M;  2DKL A;  2O5R A;  3U6D A;  3L27 A;  1NY6 A;  1WR1 B;  2A5Y B;  3L25 A;  3MK6 A;  1PJT A;  2F5O A;  1G59 A;  4QNL A;  4NSO B;  1N32 M;  2EO2 A;  4I4L A;  4LZZ A;  2FFJ A;  3D8B A;  1IBK M;  1GLN A;  3B7N A;  2Y21 A;  1NNU C;  3B9P A;  2OO9 A;  5KQ8 A;  3HJQ A;  1GL7 A;  3AKZ A;  3FKE A;  3NWL A;  1H8P A;  4HMD A;  3IHP A;  3EIE A;  1E6R A;  1PGY A;  3U60 A;  3ZC7 B;  4GHL A;  3J7B A;  4DUZ M;  4LJ7 A;  4Z2I A;  3WHL A;  2Y20 A;  3I04 M;  1N78 A;  1C1K A;  1V33 A;  3JR4 A;  1XMQ M;  2HWJ A;  2GNO A;  3LCV B;  4JN6 A;  1JB0 F;  4LF5 M;  3KS8 A;  1JR3 E;  5KPR A;  2FFF B;  1YU4 A;  1CUK A;  2HHH M;  1OTR A;  1SXJ E;  2UU9 M;  4DR5 M;  3VDU A;  4OJL A;  1L1Z A;  3K9O A;  1DGF A;  2ERC A;  5IWA M;  3QAU A;  1E6N A;  2YFQ A;  4KLN A;  3TWM A;  4JI4 M;  2DWM A;  2IOU A;  3K2L A;  3GQ4 A;  3L2A A;  2H5X A;  4D82 A;  1E32 A;  2XSZ A;  3ZCB B;  4IJE A;  4XK8 F;  2R46 A;  4PCZ A;  1VDL A;  3SAS A;  2L7I A;  5A2Q S;  4LF7 M;  5LMU M;  3SMP A;  4HME A;  1OGG A;  2XF3 A;  3J7A S;  2XH9 A;  4BB9 A;  4MB4 A;  2QP9 X;  3M7G A;  3GQ3 A;  1Q3C A;  1TH4 A;  2CV2 A;  3KFU G;  4DR4 M;  2CRU A;  1G4A E;  2W82 A;  2G5G X;  4I8O A;  1KSF X;  4LZJ A;  3KOZ E;  2JZ0 A;  2K6B A;  4K0K M;  3C9P A;  3UK6 A;  4GIP A;  3GLH B;  3RFW A;  3U6L A;  2CHQ A;  5EJC A;  4CHT B;  2EKF A;  1YLA A;  2DI0 A;  4REZ A;  4W5W A;  4FCV A;  1OIZ A;  3U6S A;  1XMO M;  4Z2K A;  1D0M A;  2QSF X;  2L4E A;  2V1U A;  3C58 A;  1QQW A;  4GHA A;  2RTS A;  4XBO A;  1IQP A;  2X4A A;  3MHV C;  1H0G A;  2CV1 A;  1XXH B;  1N36 M;  2LNH C;  2CWB A;  3DOA A;  3JR5 A;  5ITX A;  3I4V A;  2VDB B;  1VDD A;  4MM3 B;  1HT2 E;  2KNA A;  4G3O A;  1VQ1 A;  2DXI A;  4F1I A;  1VEK A;  4D80 A;  2KXE A;  3QYB A;  2QPA A;  3AOE C;  3FRI A;  1UM8 A;  4AQY M;  1DO2 A;  1K3W A;  4AG5 A;  2Z8Y M;  2DAI A;  4LFC M;  3H4J A;  2LBC A;  3WD2 A;  3UZU A;  2P5T A;  2DVW B;  3C3E A;  2L6O A;  3W68 A;  1NO1 A;  1J7K A;  2JNH A;  2CUZ A;  2HCB A;  3F92 A;  2F5N A;  2XZF A;  2V1C A;  1L2D A;  4L16 A;  2BG1 A;  2D49 A;  4MB7 A;  1TH2 A;  1LTM A;  3ZH9 B;  1ZV1 A;  4AG6 A;  3TE6 A;  1PJJ A;  3FUU A;  3LQQ A;  1QUS A;  3W0F A;  2F5Q A;  4HMC A;  1PRB A;  4LJ4 A;  2DAM A;  1YU0 A;  3PFI A;  2LVP C;  3HZJ A;  3LMM A;  1L8Q A;  3B89 A;  3A46 A;  1S3S A;  3K9P A;  4FVM A;  4X65 M;  2MR9 A;  3MMP A;  4ZPX A;  5ITQ A;  4JI2 M;  4NL4 H;  1AIP C;  2FH0 A;  1FNN A;  4MGY E;  2LXE A;  1E8B A;  2Z3X A;  1P3Q Q;  1WGL A;  1GOI A;  2XSZ D;  4M9X A;  5DYG A;  1RU3 A;  3THG A;  1GJT A;  4BLC A;  2DZO B;  2WSE F;  1Y8G A;  2LWX A;  3LVV A;  4G4O A;  2DWL A;  3L26 A;  4JXJ A;  3T15 A;  4LF8 M;  2YQZ A;  1OFH A;  1GXD A;  1J09 A;  3FE3 A;  5GKN A;  1ZMW A;  4QOZ C;  4OJ6 A;  3GP1 A;  5H37 D;  1NVM A;  2XLJ A;  2D7G A;  1L6J A;  3SAU A;  3RE8 A;  3FTC A;  1CK7 A;  3U61 B;  1R5L A;  5DYI A;  1QAM A;  2JUJ A;  5C1B A;  3J80 S;  4PD2 A;  2L4F A;  3DFZ A;  4WW0 A;  1EAK A;  2JCH A;  2JY7 A;  2KZS A;  2R4J A;  5L8R F;  5IRE B;  3T6P A;  2XEP A;  4QOS A;  1QUT A;  3AJI B;  5EQT A;  4KHP M;  1WJ7 A;  4M9S A;  4DR6 M;  2EA0 A;  3GLF E;  3LW5 F;  5ITT A;  3CF0 A;  1GAB A;  3U5Z A;  5E6J A;  3CF6 E;  2J7N A;  1GJS A;  1IXS B;  3B7Z A;  3GLG E;  2J7O A;  2X49 A;  4JI8 M;  1E6P A;  3LVW A;  1HQC A;  4DV6 M;  2XD1 A;  4DV4 M;  1IY1 A;  2I7P A;  2LTU A;  2QEN A;  3GLH A;  1IY2 A;  1DGB A;  4OVZ B;  3HHZ A;  4GKJ M;  3FUX A;  2V5O A;  3T1H M;  2R45 A;  3KDS E;  3KOY E;  4MH0 E;  4R7G A;  4RF0 A;  3FTD A;  4IBD A;  4HEO A;  1OFI A;  1E9S A;  1DGH B;  1Q39 A;  1TTE A;  4P17 A;  5EP2 A;  1WGN A;  2M5Z A;  4RNA A;  3GLI B;  2KRK A;  4AZF A;  2DZN B;  3WHK A;  1TGU A;  4TX8 A;  3FYD A;  1XXH A;  1VEG A;  2UXD M;  4LG2 A;  2Z4R A;  1EFU B;  2ZAN A;  2YNM D;  4IBE A;  4L6V 6;  3KP0 E;  4Q7J A;  3RGP A;  4II7 A;  2BNK A;  2J5Y A;  4CJ6 A;  1D0K A;  2F5P A;  1ED7 A;  3GPP A;  5LMN M;  1KS0 A;  3GRU A;  3HU3 A;  4XGI A;  2UXC M;  2O25 A;  1K82 A;  3BOS A;  3VLF B;  1GO5 A;  4FD2 A;  3PXG A;  1KFV A;  3TWK A;  5JI3 E;  1IN6 A;  1JQJ C;  1QAQ A;  4WP2 A;  4QNR A;  5BR8 M;  4UN2 B;  1SG9 A;  3IG8 A;  4IIW A;  1KYI A;  3FUW A;  3SAW A;  1D0L A;  3M7P A;  1YUB A;  1L2B A;  4AW4 A;  3FTF A;  4WUR A;  1E6Z A;  2XFS A;  4LGY A;  4MGI E;  3SHF A;  2DAE A;  1W1P A;  4X62 M;  2FS1 A;  1FJG M;  3M6A A;  2CHG A;  4KO8 A;  4OJP A;  1CXW A;  4NY2 A;  4OX9 M;  2QNJ A;  1E9R A;  2BWE A;  4HLQ A;  4PT5 A;  2DZL A;  5FTK A;  2RRU A;  1QAN A;  4FWH A;  3TPZ A;  1W5T A;  2Y2P A;  4DR7 M;  4JYA M;  1YUE A;  4Z2L A;  3L28 A;  2ZM6 M;  3CTW B;  3J27 B;  3VKG A;  2WSF F;  3HU2 A;  2LVN C;  2RGO A;  2JP7 A;  1DV0 A;  2HKJ A;  2RGH A;  3UJN A;  1G71 A;  1SXJ B;  3E21 A;  2CE7 A;  4DV7 M;  2CHV A;  1UR9 A;  3SYK A;  1Z5A A;  3KP1 E;  3B74 A;  2BJV A;  4DV5 M;  3U61 A;  1R4G A;  4Z2J A;  4NYY A;  2VQE M;  4MB3 A;  1ZQ9 A;  3I51 A;  4IBC A;  3IEC A;  4M0D A;  3WD1 A;  4MGH A;  2QHO B;  1OIP A;  3LCU A;  1QO6 A;  1W1Y A;  5JI2 E;  3QYE A;  4KOD A;  4D81 A;  3MQL A;  3WD4 A;  1XC8 A;  1J7M A;  3GRV A;  1C7Y A;  3OTO M;  3I4Y A;  3FTE A;  1X37 A;  4B3R M;  1XB2 B;  1LV7 A;  2R44 A;  2VF7 A;  2LH0 A;  4AI6 A;  2CP8 A;  1G41 A;  3ZQJ A;  2JY6 B;  3DA1 A;  3KS4 A;  5EP3 A;  2G8L A;  2WZJ A;  5ITY A;  8CAT A;  2RKO A;  3NBI A;  5KQD A;  5FLX S;  3I01 M;  4IJF A;  4PDG A;  1O6I A;  2Z4S A;  5DNY A;  2Y2J A;  3PNV A;  2Y0T A;  1HNW M;  4FCW A;  2MJ5 B;  3FRH A;  3K8Z A;  2K47 A;  1H6U A;  2WSC F;  4FW9 A;  4OVZ A;  4DV1 M;  1YU1 A;  3HHX A;  3CF2 A;  2G3Q A;  2QZ4 A;  1QAO A;  3Q8X A;  2QBY B;  4JI7 M;  3VFD A;  1IN7 A;  4PDI A;  2XGN A;  4ANR A;  3AL0 C;  3N3F A;  5EXP A;  1DGH A;  1Z5C A;  2JY8 A;  4Z6Y A;  3H4M A;  1WHC A;  2LVQ D;  4B7G A;  4Z2G A;  1XNQ M;  1IY0 A;  3KOX E;  1GL6 A;  4GMQ A;  2ZAM A;  1ZMV A;  1DO0 A;  4DV3 M;  2YR0 A;  2QCU A;  2KNZ A;  2EKK A;  1IN4 A;  3SFZ A;  3GRY A;  5F3W A;  4IBB A;  3TWL A;  2Y2L A;  1T3T A;  2Q2E B;  3VDP A;  2LHC A;  4GC5 A;  2B3T A;  7CAT A;  3W67 A;  3FYC A;  4F2L A;  2Z7J A;  4RF1 A;  4NZ5 A;  2Y2Q A;  1OAI A;  2X8A A;  3CGW A;  3PVS A;  4FWG A;  5IZ7 D;  4OU7 A;  5KPT A; 
#chains in the Genus database with same CATH homology
 1HQY E;  5ITX E;  4M0W A;  5EP1 A;  4B7F A;  3TL4 X;  4QHT A;  5EP4 A;  5E26 A;  3SYL A;  3W0L B;  1NHG C;  3SBJ A;  4X66 M;  3KVW A;  4FCT A;  4IBK A;  3E4R A;  4B3M M;  1ZAE A;  2HL7 A;  4NXN M;  4ITQ A;  4LJ5 A;  5KO3 A;  1QZM A;  2Y2K A;  1PJI A;  2FNA A;  3VK8 A;  4B3T M;  1IN5 A;  4L8R C;  4R3D A;  2C98 A;  2L09 A;  3HGI A;  4LJ9 A;  2EUC A;  3D8L A;  4QHS A;  3AV0 A;  4G4R A;  3U6C A;  3KSX A;  4DR1 M;  1JR3 A;  4OJ5 A;  1IXR C;  1SXJ A;  4B08 A;  2V6Z M;  2OPF A;  2C9O A;  1HR0 M;  3K1J A;  3GPY A;  4L78 A;  4LFA M;  4OJO A;  1R7R A;  2FOI C;  2M60 A;  5EXS A;  4EIW A;  3VK7 A;  5FTM A;  1IBL M;  2Y2I A;  1HNX M;  1GKI A;  1N34 M;  2E5L M;  1YU3 A;  4NYU A;  1R2Z A;  4MGZ E;  2KW0 A;  3HHY A;  3GLF B;  2R65 A;  2Y2G A;  2Y2O A;  1DGG A;  1TDH A;  2BJW A;  4LCB A;  2DHR A;  2XZU A;  3QWL A;  2Y2H A;  3GPU A;  2AHM A;  3A45 A;  4GRI A;  1N77 A;  3GLG B;  4S12 A;  3GRR A;  3FUT A;  2ZAO A;  4CIS A;  3R9X B;  3UMM A;  3L29 A;  2JE5 A;  2KRU A;  3LQR A;  4LRT A;  2QBY A;  1XNR M;  2F4V M;  1Z59 A;  4LJ6 A;  1L1T A;  1QYR A;  4LF4 M;  1YU2 A;  2D7E A;  5FTN A;  1K3X A;  4M9Z A;  1IBM M;  1N33 M;  3UGJ A;  2UUC M;  5EXT A;  4QNM A;  2UWX A;  4LGM A;  1N75 A;  4OUI A;  4L15 A;  4DR2 M;  2XFT A;  3HHW A;  2CEA A;  3GPX A;  4NRW A;  1OJL A;  1G3I A;  4LF6 M;  4G4N A;  1W5S A;  3RGS A;  1I94 M;  3U6O A;  1HT1 E;  4B3S M;  4LF9 M;  3R8F A;  3SAT A;  2C5R A;  3A42 A;  2R18 A;  3U6P A;  4OW0 A;  2DWN A;  3PNY A;  4LFB M;  5IT9 S;  4DR3 M;  4LJA A;  1MU5 A;  4YHH M;  1D2N A;  1R2Y A;  3FD9 A;  4NZ1 A;  1NY5 A;  2DWZ B;  2VQF M;  3SAV A;  4DV2 M;  1JR3 D;  1WXQ A;  3HJS A;  3U5Z B;  5ITR A;  3MJ5 A;  2UUA M;  3HU1 A;  3K92 A;  3GLI B;  3FUV A;  4BBA A;  1SXJ D;  1NSF A;  1Z5B A;  2CFO A;  2KZU A;  2L7H A;  4NRV A;  4JI3 M;  1I4W A;  3SHG B;  2KA6 B;  4G6Z A;  2DWM A;  4AKH A;  3GO8 A;  2D7H A;  2OQ4 A;  1IXZ A;  3GQ5 A;  4CGY B;  3DZD A;  4FWD A;  3AOG A;  2C96 A;  4LY6 A;  3AFH A;  4A3V B;  4IBI A;  3SMS A;  1Z6T A;  3JAM S;  4NZ3 A;  2NQ8 C;  4TUW A;  2ZBK B;  2C99 A;  3T38 A;  1TH3 A;  4YY3 M;  1XHB A;  5FSW A;  1E94 E;  1NJF A;  2FE8 A;  1MX0 A;  2R62 A;  3KXE C;  4LJ8 A;  4G4Q A;  3E9S A;  4HL4 A;  4GIT A;  5EXX A;  2KEB A;  3U60 B;  4NZ4 A;  5KPZ A;  4MGK E;  5BPV A;  3U6Q A;  2Y2M A;  3HKP A;  2Y0Q A;  5C18 A;  3TQS A;  1TDZ A;  3HJ8 A;  3HWS A;  4DUY M;  4P16 A;  1SXJ C;  4GH9 A;  4AKG A;  5FTJ A;  2Y2N A;  3J2P B;  3GLF A;  4GC9 A;  4JI5 M;  4L4U A;  4Z8X A;  1NHW C;  4I5S A;  3M0E A;  3U6M A;  3GLG A;  1GVN A;  1NJG A;  5ITU A;  2R4E A;  1EE8 A;  1ORY B;  2C9C A;  3J81 S;  3WX7 A;  3VKH A;  3ILK A;  4NOO B;  3IG5 A;  4X64 M;  4AKI A;  1G8P A;  4NXM M;  3EIH A;  4NSR A;  1J5E M;  1QVR A;  3U6E A;  3KOW E;  4JV5 M;  1XWI A;  1IM2 A;  3SAR A;  4LRS A;  1Q3B A;  4JI0 M;  3AOE A;  1HNZ M;  4GKK M;  3SC3 A;  1YSY A;  4IBF A;  2CV0 A;  2VII A;  4B7H A;  5FTL A;  4JI1 M;  4IBG A;  2UXB M;  4JI6 M;  3HON A;  3KW6 A;  1YE9 A;  1R6B X;  2XD5 A;  2I7N A;  2JA2 A;  4IBJ A;  4I81 A;  3GLI A;  3HSH A;  2F5S A;  1L2C A;  2H1R A;  3A98 B;  3KSJ A;  1IN8 A;  3T1Y M;  2O5R A;  3U6D A;  3L27 A;  1NY6 A;  3L25 A;  2A5Y B;  3MK6 A;  2F5O A;  1G59 A;  4QNL A;  4NSO B;  1N32 M;  2EO2 A;  4I4L A;  4LZZ A;  2FFJ A;  3D8B A;  1IBK M;  1GLN A;  3B9P A;  2Y21 A;  1NNU C;  5KQ8 A;  3HJQ A;  1GL7 A;  3AKZ A;  3FKE A;  3NWL A;  3EIE A;  3U60 A;  3ZC7 B;  4GHL A;  3J7B A;  4DUZ M;  4LJ7 A;  3WHL A;  2Y20 A;  1N78 A;  1C1K A;  3JR4 A;  1XMQ M;  4JN6 A;  4LF5 M;  3KS8 A;  5KPR A;  2FFF B;  1YU4 A;  2HHH M;  1SXJ E;  2UU9 M;  4DR5 M;  3VDU A;  4OJL A;  1L1Z A;  1DGF A;  2ERC A;  5IWA M;  3QAU A;  2YFQ A;  4KLN A;  3TWM A;  4JI4 M;  2IOU A;  3K2L A;  3GQ4 A;  3L2A A;  4D82 A;  1E32 A;  2XSZ A;  3ZCB B;  4IJE A;  2R46 A;  4PCZ A;  3SAS A;  2L7I A;  5A2Q S;  4LF7 M;  5LMU M;  3SMP A;  2XF3 A;  3J7A S;  2XH9 A;  4BB9 A;  2QP9 X;  3M7G A;  3GQ3 A;  1Q3C A;  1TH4 A;  2CV2 A;  3KFU G;  4DR4 M;  4I8O A;  1G4A E;  2W82 A;  2G5G X;  1KSF X;  4LZJ A;  3KOZ E;  4K0K M;  3UK6 A;  4GIP A;  3GLH B;  3RFW A;  3U6L A;  2CHQ A;  5EJC A;  4CHT B;  2UUB M;  4REZ A;  3U6S A;  4W5W A;  1XMO M;  4FCV A;  2V1U A;  3C58 A;  1QQW A;  4GHA A;  4XBO A;  1IQP A;  2X4A A;  3MHV C;  2CV1 A;  1XXH B;  1N36 M;  2LNH C;  3DOA A;  3JR5 A;  5ITX A;  3I4V A;  1VDD A;  4MM3 B;  1HT2 E;  2DXI A;  4D80 A;  2KXE A;  2QPA A;  3AOE C;  1K3W A;  1UM8 A;  4AQY M;  1DO2 A;  4LFC M;  4AG5 A;  3UZU A;  2P5T A;  2DVW B;  2L6O A;  2F5N A;  1J7K A;  2CUZ A;  2HCB A;  2BG1 A;  2XZF A;  2V1C A;  1L2D A;  4L16 A;  4MB7 A;  1TH2 A;  3ZH9 B;  4AG6 A;  3TE6 A;  1PJJ A;  3FUU A;  3LQQ A;  3W0F A;  2F5Q A;  4LJ4 A;  1YU0 A;  3PFI A;  3LMM A;  1L8Q A;  3A46 A;  1S3S A;  4FVM A;  4X65 M;  5ITQ A;  4ZPX A;  4JI2 M;  4NL4 H;  1FNN A;  4MGY E;  2LXE A;  2Z3X A;  2XSZ D;  4M9X A;  5DYG A;  3THG A;  4BLC A;  2DZO B;  2LWX A;  3LVV A;  4G4O A;  2DWL A;  3L26 A;  4JXJ A;  3T15 A;  4LF8 M;  2YQZ A;  1OFH A;  1J09 A;  5GKN A;  4QOZ C;  4OJ6 A;  3GP1 A;  5H37 D;  1NVM A;  2XLJ A;  2D7G A;  3SAU A;  3RE8 A;  3FTC A;  3U61 B;  5DYI A;  1QAM A;  5C1B A;  3J80 S;  4PD2 A;  3DFZ A;  4WW0 A;  2JCH A;  2KZS A;  2R4J A;  4DV0 M;  5IRE B;  2XEP A;  4QOS A;  3AJI B;  5EQT A;  4KHP M;  4M9S A;  4DR6 M;  2EA0 A;  5ITT A;  3CF0 A;  3U5Z A;  5E6J A;  3CF6 E;  2J7N A;  1IXS B;  2J7O A;  2X49 A;  4JI8 M;  3LVW A;  1HQC A;  4DV6 M;  2XD1 A;  4DV4 M;  1IY1 A;  2I7P A;  2QEN A;  3GLH A;  1IY2 A;  1DGB A;  4OVZ B;  3HHZ A;  4GKJ M;  3FUX A;  3T1H M;  2R45 A;  3KDS E;  3KOY E;  4MH0 E;  4R7G A;  4RF0 A;  3FTD A;  4IBD A;  1PM5 A;  1OFI A;  1E9S A;  1DGH B;  1Q39 A;  5EP2 A;  1NNJ A;  2M5Z A;  4RNA A;  2KRK A;  4AZF A;  2DZN B;  3WHK A;  1TGU A;  3FYD A;  1XXH A;  2UXD M;  4LG2 A;  2Z4R A;  2ZAN A;  2YNM D;  4IBE A;  3RGP A;  3KP0 E;  4II7 A;  2BNK A;  2F5P A;  3GPP A;  5LMN M;  3GRU A;  3HU3 A;  4XGI A;  2UXC M;  1K82 A;  3BOS A;  3VLF B;  4FD2 A;  3PXG A;  1KFV A;  3TWK A;  5JI3 E;  1IN6 A;  1JQJ C;  1QAQ A;  5BR8 M;  4QNR A;  3IG8 A;  4IIW A;  1KYI A;  3FUW A;  3SAW A;  1YUB A;  1L2B A;  4AW4 A;  3FTF A;  4WUR A;  2XFS A;  4LGY A;  4MGI E;  3SHF A;  4X62 M;  1FJG M;  3M6A A;  2CHG A;  4KO8 A;  4OJP A;  4NY2 A;  4OX9 M;  1E9R A;  4PT5 A;  4HLQ A;  5FTK A;  4FWH A;  1QAN A;  3TPZ A;  1W5T A;  2Y2P A;  4DR7 M;  4JYA M;  1YUE A;  3L28 A;  2ZM6 M;  3CTW B;  3J27 B;  3VKG A;  3HU2 A;  2RGO A;  2HKJ A;  2RGH A;  3UJN A;  1SXJ B;  4DV7 M;  2CE7 A;  2CHV A;  3SYK A;  1Z5A A;  3KP1 E;  2BJV A;  4DV5 M;  3U61 A;  4NYY A;  2VQE M;  1ZQ9 A;  3I51 A;  4IBC A;  4M0D A;  4MGH A;  5JI2 E;  4D81 A;  4KOD A;  1XC8 A;  3GRV A;  3OTO M;  3I4Y A;  3FTE A;  1X37 A;  4B3R M;  1LV7 A;  2LH0 A;  4AI6 A;  1G41 A;  3KS4 A;  3DA1 A;  5EP3 A;  2G8L A;  8CAT A;  5ITY A;  2RKO A;  3NBI A;  5KQD A;  5FLX S;  4IJF A;  4PDG A;  2Z4S A;  5DNY A;  2Y2J A;  3PNV A;  2Y0T A;  1HNW M;  4FCW A;  3K8Z A;  4FW9 A;  2K47 A;  1H6U A;  4OVZ A;  4DV1 M;  1YU1 A;  3HHX A;  3CF2 A;  2QZ4 A;  1QAO A;  3Q8X A;  2QBY B;  4JI7 M;  3VFD A;  1IN7 A;  4PDI A;  2XGN A;  3AL0 C;  3N3F A;  5EXP A;  1DGH A;  1Z5C A;  4Z6Y A;  3H4M A;  4B7G A;  1XNQ M;  1IY0 A;  3KOX E;  1GL6 A;  4GMQ A;  2ZAM A;  4DV3 M;  1DO0 A;  2YR0 A;  2QCU A;  3SFZ A;  1IN4 A;  5F3W A;  3GRY A;  2Y2L A;  4IBB A;  3TWL A;  1T3T A;  2Q2E B;  3VDP A;  4GC5 A;  7CAT A;  3FYC A;  2Z7J A;  4RF1 A;  4NZ5 A;  2Y2Q A;  2X8A A;  4FWG A;  3PVS A;  5IZ7 D;  4OU7 A;  5KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...