3KS8A

Crystal structure of reston ebolavirus vp35 rna binding domain in complex with 18bp dsrna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
b'ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*AP*GP*AP*AP*GP*GP*AP*GP*GP*GP*AP*GP*GP*GP*AP*GP*GP*A)-
molecule tags Viral protein/rna
source organism Reston ebolavirus
publication title Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression.
pubmed doi rcsb
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ks8A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3ks8A02
4GHLA 4GH9A 3FKEA 4IBCA 4IBBA 4IBDA 4IBJA 3L28A 5BPVA 3KS4A 4IBFA 4IBGA 4IJEA 4IBIA 3L29A 3KS8A 3L25A 3L26A 4GHAA 3L27A 4LG2A 4IBKA 3L2AA 4IJFA 4IBEA
chains in the Genus database with same CATH superfamily
1L2BA 3UK6A 3GRVA 4GRIA 1NJFA 4LRTA 1IBLM 3QAUA 2KZSA 1DV0A 3PVSA 4NC6A 4HMEA 2CV0A 2R46A 4IBBA 1XNRM 3B7QA 2L7IA 1YE9A 3A46A 4MB5A 3HU2A 5FTLA 1SXJD 2CE7A 2LVAA 4BB9A 4NRWA 3TQSA 4R3DA 4WW0A 1FNNA 2CRUA 4DR3M 3T38A 4KO8A 4LFAM 5GKNA 4I4LA 3GLFB 1OTRA 1WXQA 3T1HM 1N34M 1AIPC 3AJIB 4R71A 2FFFB 2OOBA 4LF8M 2O25A 7CATA 2J7OA 3RGSA 4TUWA 3KP1E 4GKJM 2C99A 1SXJB 4LG2A 3J27B 2VF7A 2CFOA 4NRVA 4LGMA 3UZUA 3NBIA 4DR7M 1XXHA 3W67A 4G4QA 2DWMA 3DFZA 1LV7A 4XGIA 2Y2GA 4REZA 3WD3A 1L6JA 3N3FA 3K1JA 2A5YB 4JV5M 2OOAA 4GMQA 5EXSA 2DKLA 2DENA 4M9ZA 3AOGA 2ZAOA 2ZM6M 1L8QA 3J81S 2DAIA 1TR8A 3GLHB 3HHXA 4JI8M 1E15A 4OW0A 3HY5A 1GLNA 2R4EA 4CJ6A 2GNOA 3UJNA 3SC3A 1VDDA 3GPPA 4AG6A 3CF0A 2LH0A 3U60B 4GHAA 3L27A 1VEGA 4P16A 3WHKA 4B7GA 5JI2E 2K9DA 2Y20A 3AL0C 3C9PA 4LF9M 5EXPA 4B7FA 1QYRA 2F5PA 1D0KA 1OAIA 3FUWA 3FTCA 3GLHA 4M0DA 3VLFB 3GPUA 4ITQA 4DV5M 1ZMUA 4GH9A 3QYBA 4B3MM 2JE5A 3WD0A 4IBCA 4W5WA 4AKIA 1W5TA 2FFJA 2JY7A 3RE8A 4JI4M 4Z2GA 3EIHA 1L2DA 2QBYA 4NZ3A 2JA2A 3HU3A 1G4AE 1PM5A 4BLCA 2Y21A 4MH0E 3R9XB 1ZMVA 3GRYA 2DWLA 3I4YA 8CATA 3M6AA 2LTUA 4OJLA 1S3SA 1JR3E 2R62A 1E9SA 4HL4A 3J2PB 4FW9A 1NO1A 2QQ8A 4L8RC 1E6RA 3TE6A 2KHHA 2KNZA 1Q3CA 1QUSA 3W0FA 5LMNM 2L2DA 4R7GA 1QDRA 4FCWA 4LJ9A 1H0IA 2L6OA 2LHGA 4GIPA 5DNYA 1UR8A 4Z2IA 3KOYE 1AIWA 4FWHA 2JY6B 3WD4A 2V6ZM 1N36M 1EIJA 3MK6A 2V5OA 4HEOA 3HWSA 4NSRA 3W0LB 3M7PA 3BOSA 4OJ6A 2XZFA 2UXDM 4AQYM 2RGOA 3HGIA 3HZJA 2Y2MA 2OQ4A 3IHPA 3HHYA 3WD1A 3U5ZA 1KSFX 1NVMA 1UFZA 2XSZD 5ITQA 3R8FA 3FUTA 2BJVA 2KXEA 4KHPM 3U6CA 5FSWA 3HU1A 3L25A 1EAKA 1YU0A 1OFHA 4AKHA 1WHCA 3SARA 1T6OA 1HQYE 1I94M 2IOUA 2XGNA 4K0KM 1YU1A 2L4FA 1X37A 4LF5M 1IBMM 5DFLA 3ILKA 2Y2PA 1XC8A 2DZNB 2YNMD 3HJ8A 3VK8A 1G59A 3H4JA 2CHQA 5KQDA 1IN4A 1XWIA 4B7HA 2VQEM 5ITYA 2Y2JA 2YQZA 2JZ1A 2VIIA 3SASA 1DO0A 1E94E 4FCTA 4DUYM 4LF6M 1UR9A 1GABA 4LJ8A 3GLGB 1V33A 1R7RA 1ZAEA 3SATA 2BG1A 4DR4M 4DR2M 1NV9A 5IREB 4KODA 4IBIA 1QQWA 2FE8A 1VDLA 4G6ZA 2R0IA 1Q3BA 4LJ5A 2C9CA 2ERCA 2I7PA 1XXHE 3I04M 2VF8A 4QHSA 5KPRA 1D0MA 4GEWA 1TDZA 4WP2A 4B3SM 3LVVA 2DXIA 1GO5A 2QBYB 1PDCA 1QAQA 3E9SA 3E46A 3HJQA 2K0BX 4B08A 3A42A 2QHOB 3SMSA 2NQ8C 4LGYA 1Z6TA 2UUCM 3HHZA 4HLQA 1R2YA 2JZ0A 4ANRA 1BVSA 1GJSA 1A5TA 4PDIA 3U6EA 1DGBA 3HX3A 2UXCM 4NXNM 1IN6A 3GLFA 3KS4A 4Y28F 3C58A 2MGWA 3U61B 4DBGB 1H6UA 5EP3A 1YU3A 3K8ZA 3T15A 2F4VM 4OJ5A 3VDUA 5EP1A 4Z6YA 1VEJA 3GP1A 3SAVA 4NZ4A 5FTJA 2KA6B 2C96A 3U6DA 2Y2IA 5BR8M 2KDLA 1OFIA 1VEKA 4JI5M 3K9OA 3FTDA 1Q39A 4II7A 4UN2B 3PFIA 4F2LA 4NXMM 2RTSA 2FH0A 1V92A 3I01M 1KFVA 1ED7A 1YSYA 3TWMA 2V1CA 4CHTB 2X4AA 1LTMA 1HR0M 5DYGA 4JN6A 2N35A 2DWNA 4LF4M 2DZLA 3PNVA 1IQPA 3KXEC 1E9RA 2M60A 2O5RA 1Z5AA 5EP4A 2OPFA 3U60A 5IT9S 4L4UA 3W68A 2R65A 2DVWB 5EP2A 3TWKA 5L8RF 5H37D 1N75A 1IXRC 4IBFA 4OVZA 1MN3A 3JR4A 2F5OA 4DR1M 3DZDA 2XD5A 3KS8A 1E6NA 3JAMS 4AKGA 4JXJA 2DAGA 4L16A 4MB7A 2P5TA 3K2LA 3U6OA 4G4RA 3C3EA 1HNZM 1Q02A 5EXTA 2MROB 1R6BX 1PJIA 2MJ5B 3RFWA 4LFCM 2BWEA 4IBEA 1TH4A 3TPZA 3NBXX 1JB0F 5F3WA 1AUAA 3BXWA 4HMDA 4D80A 3FUXA 4QNRA 2XSZA 5EQTA 3GQ3A 3GLIE 4DV7M 4MB4A 4IBDA 2CWBA 4KT0F 4OJPA 1IY0A 1F4IA 3GLIB 3MJ5A 1JR3A 2HCBA 2XFSA 4IBJA 3WX7A 1PRBA 3L28A 3LVWA 4JI1M 3AKZA 3LQQA 2KNAA 2WSEF 2R18A 4DR6M 1WGLA 2QENA 4IBGA 1L2CA 4I8OA 3J7AS 4JYAM 3L29A 3ZH9B 3KOWE 3GLGA 4P17A 2F5SA 2O01F 1RU3A 2H1RA 2ZTDA 3MMPA 1HNXM 1IXSA 1E6ZA 2FNAA 4QOSA 1HT2E 1OGBA 1NY5A 3KW6A 3M0EA 2ZTCA 4RF1A 1C7YA 1WGNA 4RNAA 3SAWA 1NNJA 4L15A 1XMQM 2QCUA 4ZPXA 3UGJA 2UUAM 2RKOA 1IM2A 1OQYA 2ZAMA 3AOEA 2B3TA 4MM3B 3ZQJA 1OIZA 2KRUA 3U6MA 4GKKM 3B7NA 4M9SA 3SHGB 2FOIC 3J7BA 4X62M 4G4NA 4GC9A 4QNLA 1Y8GA 4DR5M 4MGIE 1NHGC 3GRRA 1IY1A 1E32A 1XXHB 1IN5A 4IJEA 1JR3D 2MH8A 4WURA 3LQRA 1DGHB 3RGPA 4NOOB 2CP8A 2BJWA 3SYKA 3FYCA 4DV6M 1C1KA 2OO9A 3B89A 5DYIA 2CHGA 2J5YA 1KS0A 3CF2A 3Q8GA 4OJOA 2FN2A 2HWJA 2Y2KA 4PCZA 2R4JA 3KOXE 1K3WA 2WSCF 1T3TA 3GLGE 3GLFE 4IJFA 4NZ5A 4CISA 5C18A 3FRIA 1IN8A 2BWBA 2VQFM 3PNYA 2UUBM 1FJGM 2CUZA 2C9OA 1YU4A 4XBOA 2JCHA 1MU5A 3A45A 4LJ4A 3KVWA 5JI3E 4AI6A 2EKFA 2LNHC 2CV1A 1D2NA 2LVOC 4G3OA 3THGA 2HHHM 1IN7A 1ZMWA 4MGKE 2LBCA 1W1PA 2E5LM 5BPVA 4I5SA 4D82A 1K3XA 3DOAA 4NYUA 3HHWA 3D8LA 1GVNA 2KNVA 2CHVA 5IZ7D 3KDSE 2JY5A 3GRUA 1CUKA 3IECA 1NNUC 3SAUA 3GQ5A 4BBAA 2Z8YM 3E21A 4FCVA 4IBKA 4NSOB 1J5EM 4LRSA 4LZZA 2Y2HA 1YUBA 4X64M 1XMOM 1GXDA 1QVRA 1QZMA 3FUUA 2KRKA 3LMMA 1EFUB 3U5ZB 1R2ZA 3FTFA 4GHLA 2JP7A 3BBZA 1H8PA 1E8BA 1MJGM 1N32M 3LCUA 1HJPA 1SG9A 1IXSB 3SMPA 3FYDA 2C5RA 2D7GA 5FLXS 2LVNC 1IFYA 1W1YA 4LZJA 3AFHA 4KLNA 3UMMA 1CXWA 1W5SA 4JI2M 3AOEC 3ZCBB 1TDHA 2DZOB 3HONA 1VG5A 2L7HA 2K47A 3FRHA 2LXEA 4DV1M 1IXZA 4AZFA 3OTOM 2DAEA 2RRUA 2EKKA 1PJTA 3GLIA 3VK7A 1TH2A 3K9PA 2LHCA 1L1ZA 2L4EA 2LWXA 1NSFA 1WIVA 2ZBKB 3K92A 4MGHA 1WR1B 5KQ8A 2Z7JA 2R6FA 5EXXA 2XD1A 3A98B 2X49A 2APLA 5E26A 3GQ4A 1G71A 2Z3XA 5LMUM 1KYIA 1Z5CA 4GITA 1PJJA 1NY6A 4XK8F 1PJQA 5FTNA 2AHMA 1OJLA 4DV3M 3U6LA 2DWZB 3KFUG 3VDPA 1TF0B 1N77A 2XZUA 1J7MA 2QNJA 2XH9A 5ITUA 1L1TA 5FTMA 4QNMA 4LY6A 1TTEA 4LJ7A 3J80S 3EIEA 2M5ZA 1YU2A 2XEPA 3GLHE 4YY3M 4CGYB 5A2QS 2JNHA 4Z2JA 3T1YM 3TWLA 4AG5A 2QSFX 2Y2OA 3VKHA 1OKSA 2YFQA 4MGYE 1HQCA 2XF3A 2G8LA 1N33M 1N78A 2C98A 2GQFA 2J7NA 3NWLA 4LCBA 1QZEA 5E6JA 2DAKA 3GPXA 4PT5A 2Z4RA 4L6V6 1D0LA 2BNKA 3WD2A 4DUZM 2UU9M 4YHHM 1QUTA 3B74A 4Z2KA 2HKJA 4JI3M 1H0GA 1Z5BA 3PXGA 3VFDA 2DI0A 4DV4M 4D81A 1E6PA 1SXJC 3TL4X 1J7KA 3I51A 5C1BA 3C3DA 3DA1A 5ITTA 4QOZC 1O6IA 2DHYA 1WJ7A 4OX9M 2Y0QA 2YR0A 3F92A 4JI6M 4LF7M 3HKPA 2F5NA 1MX0A 1DGFA 1NV8A 1R4GA 1R5LA 3T6PA 1I4WA 4B3TM 1YUEA 1DO2A 1HT1E 4FVMA 2XFTA 4NL4H 4CIZA 1QDTA 4NYYA 1PJSA 4M9XA 2Z4SA 3QWLA 4OVZB 3KOZE 3FD9A 1OGGA 1NHWC 4JI7M 3KSJA 2L09A 1W1VA 3Q8XA 1TH3A 2G5GX 3CTWB 5ITXA 5FTKA 1XB2B 3KP0E 2R44A 4Q7JA 3SFZA 1GOIA 1QO6A 2RGHA 2LVPC 4TX8A 3I4VA 2DHRA 1G41A 2JY8A 5ITXE 1DGHA 1G8PA 4Z8XA 2KW0A 4AW4A 1J09A 2Y2LA 1OIPA 1NJGA 4FWGA 2UWXA 1OAOC 4X65M 4S12A 2ZANA 5IWAM 5KPZA 3GO8A 1GL7A 4JI0M 4NZ1A 3CF6E 3V76A 3SYLA 3FE3A 3HSHA 3L26A 3FUVA 1IY2A 2R45A 3AV0A 3E4RA 5KPTA 3FTEA 4LFBM 4Z2LA 5EJCA 1QAMA 3KSXA 1ZV1A 1TGUA 4LJ6A 3U61A 4B3RM 3LW5F 2X8AA 4RKUF 4OU7A 3MHVC 1UM8A 3IG8A 2DNAA 3FKEA 2QPAA 2DAMA 4X66M 1HNWM 4LJAA 2F5QA 2UXBM 3D8BA 4I81A 5ITRA 3JR5A 2MR9A 5KO3A 1GPFA 1VQ1A 4MB3A 2JXNA 1V34A 3U6QA 2D49A 1QANA 1PGYA 4A3VB 2EJSA 1GKIA 3SHFA 2EO2A 1T43A 4M0WA 1W1TA 3IG5A 2Y2NA 1G3IA 1JQJC 3H4MA 1CK7A 2EUCA 4Z2HA 2QP9X 4IIWA 4PD2A 3GPYA 3U6SA 3MQLA 2XLJA 2CEAA 4OUIA 4G4OA 4QHTA 4DV0M 2I7NA 2Y0TA 1GJTA 4PDGA 1SXJE 2HAKA 3B7ZA 3L2AA 2H5XA 4RF0A 4FWDA 4GC5A 3U6PA 2WZJA 4F1IA 3HJSA 1Z59A 4HMCA 2JUJA 3WHLA 3ZC7B 4NY2A 2V1UA 1SXJA 3VKGA 1GL6A 4MGZE 2Y2QA 2LVQD 2JWSA 1K82A 3SBJA 1QAOA 2KZUA 4EIWA 1E88A 1XHBA 1XNQM 1IBKM 1ORYB 2KEBA 3CGWA 1P3QQ 4FD2A 2D7EA 1YLAA 2G3QA 4DV2M 1ZQ9A 3QYEA 3M7GA 2QZ4A 2HL7A 2D7HA 2W82A 1DGGA 1EE8A 2CV2A 2EA0A 2K6BA 2FS1A 2Q2EB 2VDBB 3B9PA 4L78A 3LCVB 2WSFF
chains in the Genus database with same CATH topology
1L2BA 3UK6A 3GRVA 4GRIA 1NJFA 4LRTA 1IBLM 3QAUA 2KZSA 3PVSA 2CV0A 2R46A 4IBBA 1XNRM 2L7IA 1YE9A 3A46A 3HU2A 5FTLA 1SXJD 2CE7A 4BB9A 4NRWA 3TQSA 4R3DA 4WW0A 1FNNA 4DR3M 3T38A 4KO8A 4LFAM 5GKNA 4I4LA 3GLFB 1WXQA 3T1HM 1N34M 2FFFB 3AJIB 4LF8M 7CATA 2J7OA 3RGSA 4TUWA 3KP1E 4GKJM 2C99A 1SXJB 4LG2A 3J27B 2CFOA 4NRVA 4LGMA 3UZUA 3NBIA 4DR7M 1XXHA 4G4QA 2DWMA 3DFZA 1LV7A 4XGIA 2Y2GA 4REZA 3N3FA 3K1JA 2A5YB 4JV5M 4GMQA 5EXSA 4M9ZA 3AOGA 2ZAOA 2ZM6M 1L8QA 3J81S 3GLHB 3HHXA 4JI8M 4OW0A 1GLNA 2R4EA 3UJNA 3SC3A 1VDDA 3GPPA 4AG6A 3CF0A 2LH0A 3U60B 4GHAA 3L27A 4P16A 3WHKA 4B7GA 5JI2E 2Y20A 3AL0C 4LF9M 5EXPA 4B7FA 1QYRA 2F5PA 3GLHA 3FUWA 3FTCA 4M0DA 3VLFB 3GPUA 4ITQA 4DV5M 4GH9A 4B3MM 2JE5A 4IBCA 4W5WA 4AKIA 1W5TA 2FFJA 3RE8A 4JI4M 3EIHA 1L2DA 2QBYA 4NZ3A 2JA2A 3HU3A 1G4AE 1PM5A 4BLCA 2Y21A 4MH0E 3R9XB 3GRYA 2DWLA 3I4YA 8CATA 3M6AA 4OJLA 1S3SA 2R62A 1E9SA 4HL4A 3J2PB 4FW9A 4L8RC 3TE6A 1Q3CA 3W0FA 5LMNM 4R7GA 4FCWA 4LJ9A 2L6OA 4GIPA 5DNYA 3KOYE 4FWHA 2V6ZM 1N36M 3MK6A 3W0LB 3HWSA 4NSRA 4OJ6A 3BOSA 2XZFA 2UXDM 4AQYM 2RGOA 3HGIA 2Y2MA 2OQ4A 3HHYA 3U5ZA 1KSFX 1NVMA 2XSZD 5ITQA 3R8FA 3FUTA 2BJVA 2KXEA 4KHPM 3U6CA 5FSWA 3HU1A 3L25A 1YU0A 1OFHA 4AKHA 3SARA 1HQYE 1I94M 2IOUA 2XGNA 4K0KM 1YU1A 1X37A 4LF5M 1IBMM 3ILKA 2Y2PA 1XC8A 2YNMD 3HJ8A 2DZNB 3VK8A 1G59A 2CHQA 5KQDA 1IN4A 1XWIA 4B7HA 2VQEM 5ITYA 2Y2JA 2YQZA 3SASA 2VIIA 1DO0A 1E94E 4FCTA 4DUYM 4LF6M 4LJ8A 3GLGB 1R7RA 1ZAEA 3SATA 2BG1A 4DR4M 4DR2M 5IREB 4KODA 4IBIA 1QQWA 2FE8A 4G6ZA 4LJ5A 1Q3BA 2C9CA 2ERCA 2I7PA 4QHSA 1TDZA 5KPRA 4B3SM 3LVVA 2DXIA 2QBYB 1QAQA 3E9SA 3HJQA 4B08A 3A42A 3SMSA 2NQ8C 4LGYA 1Z6TA 2UUCM 3HHZA 4HLQA 1R2YA 4PDIA 3U6EA 2UXCM 1DGBA 4NXNM 1IN6A 3GLFA 3KS4A 3C58A 3U61B 1H6UA 5EP3A 1YU3A 3K8ZA 3T15A 2F4VM 4OJ5A 3VDUA 5EP1A 4Z6YA 3GP1A 3SAVA 4NZ4A 5FTJA 2KA6B 2C96A 3U6DA 2Y2IA 5BR8M 1OFIA 4JI5M 3FTDA 1Q39A 4II7A 4NXMM 3PFIA 1KFVA 1YSYA 3TWMA 2V1CA 4CHTB 2X4AA 1HR0M 5DYGA 4JN6A 2DWNA 4LF4M 3PNVA 1IQPA 3KXEC 1E9RA 2M60A 2O5RA 1Z5AA 5EP4A 2OPFA 3U60A 5IT9S 4L4UA 2R65A 2DVWB 5EP2A 3TWKA 5H37D 1N75A 1IXRC 4IBFA 4OVZA 3JR4A 2F5OA 4DR1M 3DZDA 2XD5A 3KS8A 3JAMS 4AKGA 4JXJA 4L16A 4MB7A 3U6OA 2P5TA 3K2LA 4G4RA 1HNZM 5EXTA 1R6BX 1PJIA 3RFWA 4LFCM 4IBEA 1TH4A 3TPZA 5F3WA 4D80A 3FUXA 4QNRA 2XSZA 5EQTA 3GQ3A 4DV7M 4IBDA 4OJPA 1IY0A 3GLIB 3MJ5A 1JR3A 2HCBA 2XFSA 4IBJA 3WX7A 3L28A 3LVWA 4JI1M 3AKZA 3LQQA 2R18A 4DR6M 2QENA 4IBGA 1L2CA 4I8OA 3J7AS 4JYAM 3L29A 3ZH9B 3KOWE 3GLGA 2F5SA 2H1RA 1HNXM 2FNAA 4QOSA 1HT2E 1NY5A 3KW6A 3M0EA 4RF1A 4RNAA 3SAWA 1NNJA 4L15A 1XMQM 2QCUA 4ZPXA 3UGJA 2UUAM 2RKOA 1IM2A 2ZAMA 3AOEA 4MM3B 2KRUA 3U6MA 4GKKM 4M9SA 3SHGB 2FOIC 3J7BA 4X62M 4G4NA 4GC9A 4QNLA 4DR5M 4MGIE 1NHGC 3GRRA 1IY1A 1E32A 1XXHB 1IN5A 4IJEA 1JR3D 4WURA 3LQRA 1DGHB 3RGPA 4NOOB 3SYKA 2BJWA 4DV6M 3FYCA 1C1KA 5DYIA 2CHGA 3CF2A 4OJOA 2Y2KA 4PCZA 2R4JA 3KOXE 1K3WA 1T3TA 4NZ5A 4IJFA 4CISA 5C18A 1IN8A 2VQFM 3PNYA 2UUBM 1FJGM 2CUZA 2C9OA 1YU4A 4XBOA 2JCHA 1MU5A 3A45A 4LJ4A 3KVWA 5JI3E 4AI6A 2LNHC 2CV1A 2HHHM 1D2NA 3THGA 1IN7A 4MGKE 2E5LM 5BPVA 4I5SA 4D82A 1K3XA 3DOAA 4NYUA 3HHWA 3D8LA 1GVNA 2CHVA 5IZ7D 3KDSE 3GRUA 3SAUA 1NNUC 3GQ5A 4BBAA 4FCVA 4IBKA 4NSOB 1J5EM 2Y2HA 4LRSA 4LZZA 1YUBA 4X64M 1XMOM 1QVRA 1QZMA 3FUUA 2KRKA 3LMMA 3U5ZB 3FTFA 1R2ZA 4GHLA 1N32M 3SMPA 1IXSB 2C5RA 3FYDA 2D7GA 5FLXS 4LZJA 3AFHA 4KLNA 3UMMA 1W5SA 4JI2M 3AOEC 3ZCBB 1TDHA 2DZOB 3HONA 2L7HA 2K47A 2LXEA 4DV1M 1IXZA 4AZFA 3OTOM 3GLIA 3VK7A 1TH2A 1L1ZA 2LWXA 1NSFA 2ZBKB 3K92A 4MGHA 5KQ8A 2Z7JA 5EXXA 2XD1A 3A98B 2X49A 5E26A 3GQ4A 2Z3XA 5LMUM 1KYIA 1Z5CA 4GITA 1PJJA 1NY6A 4DV3M 5FTNA 3U6LA 2AHMA 1OJLA 2DWZB 3KFUG 3VDPA 1N77A 2XZUA 2XH9A 5ITUA 1L1TA 5FTMA 4QNMA 4LY6A 4LJ7A 3J80S 3EIEA 2M5ZA 1YU2A 2XEPA 4YY3M 4CGYB 5A2QS 3T1YM 3TWLA 4AG5A 2Y2OA 3VKHA 2YFQA 4MGYE 1HQCA 2XF3A 2G8LA 1N33M 1N78A 2C98A 2J7NA 3NWLA 4LCBA 5E6JA 3GPXA 4PT5A 2Z4RA 2BNKA 4DUZM 2UU9M 4YHHM 2HKJA 4JI3M 1Z5BA 3PXGA 3VFDA 4DV4M 4D81A 1SXJC 3TL4X 1J7KA 3I51A 5C1BA 3DA1A 5ITTA 4QOZC 4OX9M 2Y0QA 2YR0A 4JI6M 4LF7M 3HKPA 2F5NA 1MX0A 1DGFA 4B3TM 1YUEA 1I4WA 1DO2A 1HT1E 4FVMA 2XFTA 4NL4H 4NYYA 4M9XA 2Z4SA 3QWLA 4OVZB 3KOZE 3FD9A 1NHWC 4JI7M 3KSJA 2L09A 3Q8XA 1TH3A 2G5GX 3CTWB 5ITXA 5FTKA 3KP0E 3SFZA 2RGHA 3I4VA 2DHRA 1G41A 5ITXE 1DGHA 1G8PA 4Z8XA 2KW0A 4AW4A 1J09A 2Y2LA 1NJGA 4FWGA 2UWXA 4X65M 4S12A 2ZANA 5IWAM 5KPZA 3GO8A 1GL7A 4JI0M 4NZ1A 3CF6E 3SYLA 3HSHA 3L26A 3FUVA 1IY2A 2R45A 3AV0A 3E4RA 5KPTA 3FTEA 4LFBM 5EJCA 1QAMA 3KSXA 1TGUA 4LJ6A 3U61A 4B3RM 2X8AA 4OU7A 3MHVC 1UM8A 3IG8A 3FKEA 4X66M 2QPAA 1HNWM 2UXBM 4LJAA 2F5QA 3D8BA 4I81A 5ITRA 3JR5A 5KO3A 3U6QA 1QANA 4A3VB 3SHFA 1GKIA 2EO2A 4M0WA 3IG5A 2Y2NA 1G3IA 1JQJC 3H4MA 2EUCA 2QP9X 4IIWA 4PD2A 3GPYA 3U6SA 4OUIA 2XLJA 2CEAA 4G4OA 4QHTA 4DV0M 2I7NA 2Y0TA 4PDGA 3U6PA 1SXJE 3L2AA 4RF0A 1K82A 4FWDA 4GC5A 3HJSA 1Z59A 3WHLA 3ZC7B 4NY2A 2V1UA 1SXJA 3VKGA 1GL6A 4MGZE 2Y2QA 3SBJA 1QAOA 2KZUA 4EIWA 1XHBA 1XNQM 1IBKM 1ORYB 2KEBA 4FD2A 2D7EA 4DV2M 1ZQ9A 3M7GA 2QZ4A 2HL7A 2D7HA 2W82A 1DGGA 1EE8A 2CV2A 2EA0A 2Q2EB 3B9PA 4L78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHL A;  4GH9 A;  3FKE A;  4IBC A;  4IBB A;  4IBD A;  4IBJ A;  3L28 A;  5BPV A;  3KS4 A;  4IBF A;  4IBG A;  4IJE A;  4IBI A;  3L29 A;  3KS8 A;  3L25 A;  3L26 A;  4GHA A;  3L27 A;  4LG2 A;  4IBK A;  3L2A A;  4IJF A;  4IBE A; 
#chains in the Genus database with same CATH topology
 1L2B A;  3UK6 A;  3GRV A;  4GRI A;  1NJF A;  4LRT A;  1IBL M;  3QAU A;  2KZS A;  1DV0 A;  3PVS A;  4NC6 A;  4HME A;  2CV0 A;  2R46 A;  4IBB A;  1XNR M;  3B7Q A;  2L7I A;  1YE9 A;  3A46 A;  4MB5 A;  3HU2 A;  5FTL A;  1SXJ D;  2CE7 A;  2LVA A;  4BB9 A;  4NRW A;  3TQS A;  4R3D A;  4WW0 A;  1FNN A;  2CRU A;  4DR3 M;  3T38 A;  4KO8 A;  4LFA M;  5GKN A;  4I4L A;  3GLF B;  1OTR A;  1WXQ A;  3T1H M;  1N34 M;  1AIP C;  3AJI B;  4R71 A;  2FFF B;  2OOB A;  4LF8 M;  2O25 A;  7CAT A;  2J7O A;  3RGS A;  4TUW A;  3KP1 E;  4GKJ M;  2C99 A;  1SXJ B;  4LG2 A;  3J27 B;  2VF7 A;  2CFO A;  4NRV A;  4LGM A;  3UZU A;  3NBI A;  4DR7 M;  1XXH A;  3W67 A;  4G4Q A;  2DWM A;  3DFZ A;  1LV7 A;  4XGI A;  2Y2G A;  4REZ A;  3WD3 A;  1L6J A;  3N3F A;  3K1J A;  2A5Y B;  4JV5 M;  2OOA A;  4GMQ A;  5EXS A;  2DKL A;  2DEN A;  4M9Z A;  3AOG A;  2ZAO A;  2ZM6 M;  1L8Q A;  3J81 S;  2DAI A;  1TR8 A;  3GLH B;  3HHX A;  4JI8 M;  1E15 A;  4OW0 A;  3HY5 A;  1GLN A;  2R4E A;  4CJ6 A;  2GNO A;  3UJN A;  3SC3 A;  1VDD A;  3GPP A;  4AG6 A;  3CF0 A;  2LH0 A;  3U60 B;  4GHA A;  3L27 A;  1VEG A;  4P16 A;  3WHK A;  4B7G A;  5JI2 E;  2K9D A;  2Y20 A;  3AL0 C;  3C9P A;  4LF9 M;  5EXP A;  4B7F A;  1QYR A;  2F5P A;  1D0K A;  1OAI A;  3FUW A;  3FTC A;  3GLH A;  4M0D A;  3VLF B;  3GPU A;  4ITQ A;  4DV5 M;  1ZMU A;  4GH9 A;  3QYB A;  4B3M M;  2JE5 A;  3WD0 A;  4IBC A;  4W5W A;  4AKI A;  1W5T A;  2FFJ A;  2JY7 A;  3RE8 A;  4JI4 M;  4Z2G A;  3EIH A;  1L2D A;  2QBY A;  4NZ3 A;  2JA2 A;  3HU3 A;  1G4A E;  1PM5 A;  4BLC A;  2Y21 A;  4MH0 E;  3R9X B;  1ZMV A;  3GRY A;  2DWL A;  3I4Y A;  8CAT A;  3M6A A;  2LTU A;  4OJL A;  1S3S A;  1JR3 E;  2R62 A;  1E9S A;  4HL4 A;  3J2P B;  4FW9 A;  1NO1 A;  2QQ8 A;  4L8R C;  1E6R A;  3TE6 A;  2KHH A;  2KNZ A;  1Q3C A;  1QUS A;  3W0F A;  5LMN M;  2L2D A;  4R7G A;  1QDR A;  4FCW A;  4LJ9 A;  1H0I A;  2L6O A;  2LHG A;  4GIP A;  5DNY A;  1UR8 A;  4Z2I A;  3KOY E;  1AIW A;  4FWH A;  2JY6 B;  3WD4 A;  2V6Z M;  1N36 M;  1EIJ A;  3MK6 A;  2V5O A;  4HEO A;  3HWS A;  4NSR A;  3W0L B;  3M7P A;  3BOS A;  4OJ6 A;  2XZF A;  2UXD M;  4AQY M;  2RGO A;  3HGI A;  3HZJ A;  2Y2M A;  2OQ4 A;  3IHP A;  3HHY A;  3WD1 A;  3U5Z A;  1KSF X;  1NVM A;  1UFZ A;  2XSZ D;  5ITQ A;  3R8F A;  3FUT A;  2BJV A;  2KXE A;  4KHP M;  3U6C A;  5FSW A;  3HU1 A;  3L25 A;  1EAK A;  1YU0 A;  1OFH A;  4AKH A;  1WHC A;  3SAR A;  1T6O A;  1HQY E;  1I94 M;  2IOU A;  2XGN A;  4K0K M;  1YU1 A;  2L4F A;  1X37 A;  4LF5 M;  1IBM M;  5DFL A;  3ILK A;  2Y2P A;  1XC8 A;  2DZN B;  2YNM D;  3HJ8 A;  3VK8 A;  1G59 A;  3H4J A;  2CHQ A;  5KQD A;  1IN4 A;  1XWI A;  4B7H A;  2VQE M;  5ITY A;  2Y2J A;  2YQZ A;  2JZ1 A;  2VII A;  3SAS A;  1DO0 A;  1E94 E;  4FCT A;  4DUY M;  4LF6 M;  1UR9 A;  1GAB A;  4LJ8 A;  3GLG B;  1V33 A;  1R7R A;  1ZAE A;  3SAT A;  2BG1 A;  4DR4 M;  4DR2 M;  1NV9 A;  5IRE B;  4KOD A;  4IBI A;  1QQW A;  2FE8 A;  1VDL A;  4G6Z A;  2R0I A;  1Q3B A;  4LJ5 A;  2C9C A;  2ERC A;  2I7P A;  1XXH E;  3I04 M;  2VF8 A;  4QHS A;  5KPR A;  1D0M A;  4GEW A;  1TDZ A;  4WP2 A;  4B3S M;  3LVV A;  2DXI A;  1GO5 A;  2QBY B;  1PDC A;  1QAQ A;  3E9S A;  3E46 A;  3HJQ A;  2K0B X;  4B08 A;  3A42 A;  2QHO B;  3SMS A;  2NQ8 C;  4LGY A;  1Z6T A;  2UUC M;  3HHZ A;  4HLQ A;  1R2Y A;  2JZ0 A;  4ANR A;  1BVS A;  1GJS A;  1A5T A;  4PDI A;  3U6E A;  1DGB A;  3HX3 A;  2UXC M;  4NXN M;  1IN6 A;  3GLF A;  3KS4 A;  4Y28 F;  3C58 A;  2MGW A;  3U61 B;  4DBG B;  1H6U A;  5EP3 A;  1YU3 A;  3K8Z A;  3T15 A;  2F4V M;  4OJ5 A;  3VDU A;  5EP1 A;  4Z6Y A;  1VEJ A;  3GP1 A;  3SAV A;  4NZ4 A;  5FTJ A;  2KA6 B;  2C96 A;  3U6D A;  2Y2I A;  5BR8 M;  2KDL A;  1OFI A;  1VEK A;  4JI5 M;  3K9O A;  3FTD A;  1Q39 A;  4II7 A;  4UN2 B;  3PFI A;  4F2L A;  4NXM M;  2RTS A;  2FH0 A;  1V92 A;  3I01 M;  1KFV A;  1ED7 A;  1YSY A;  3TWM A;  2V1C A;  4CHT B;  2X4A A;  1LTM A;  1HR0 M;  5DYG A;  4JN6 A;  2N35 A;  2DWN A;  4LF4 M;  2DZL A;  3PNV A;  1IQP A;  3KXE C;  1E9R A;  2M60 A;  2O5R A;  1Z5A A;  5EP4 A;  2OPF A;  3U60 A;  5IT9 S;  4L4U A;  3W68 A;  2R65 A;  2DVW B;  5EP2 A;  3TWK A;  5L8R F;  5H37 D;  1N75 A;  1IXR C;  4IBF A;  4OVZ A;  1MN3 A;  3JR4 A;  2F5O A;  4DR1 M;  3DZD A;  2XD5 A;  3KS8 A;  1E6N A;  3JAM S;  4AKG A;  4JXJ A;  2DAG A;  4L16 A;  4MB7 A;  2P5T A;  3K2L A;  3U6O A;  4G4R A;  3C3E A;  1HNZ M;  1Q02 A;  5EXT A;  2MRO B;  1R6B X;  1PJI A;  2MJ5 B;  3RFW A;  4LFC M;  2BWE A;  4IBE A;  1TH4 A;  3TPZ A;  3NBX X;  1JB0 F;  5F3W A;  1AUA A;  3BXW A;  4HMD A;  4D80 A;  3FUX A;  4QNR A;  2XSZ A;  5EQT A;  3GQ3 A;  3GLI E;  4DV7 M;  4MB4 A;  4IBD A;  2CWB A;  4KT0 F;  4OJP A;  1IY0 A;  1F4I A;  3GLI B;  3MJ5 A;  1JR3 A;  2HCB A;  2XFS A;  4IBJ A;  3WX7 A;  1PRB A;  3L28 A;  3LVW A;  4JI1 M;  3AKZ A;  3LQQ A;  2KNA A;  2WSE F;  2R18 A;  4DR6 M;  1WGL A;  2QEN A;  4IBG A;  1L2C A;  4I8O A;  3J7A S;  4JYA M;  3L29 A;  3ZH9 B;  3KOW E;  3GLG A;  4P17 A;  2F5S A;  2O01 F;  1RU3 A;  2H1R A;  2ZTD A;  3MMP A;  1HNX M;  1IXS A;  1E6Z A;  2FNA A;  4QOS A;  1HT2 E;  1OGB A;  1NY5 A;  3KW6 A;  3M0E A;  2ZTC A;  4RF1 A;  1C7Y A;  1WGN A;  4RNA A;  3SAW A;  1NNJ A;  4L15 A;  1XMQ M;  2QCU A;  4ZPX A;  3UGJ A;  2UUA M;  2RKO A;  1IM2 A;  1OQY A;  2ZAM A;  3AOE A;  2B3T A;  4MM3 B;  3ZQJ A;  1OIZ A;  2KRU A;  3U6M A;  4GKK M;  3B7N A;  4M9S A;  3SHG B;  2FOI C;  3J7B A;  4X62 M;  4G4N A;  4GC9 A;  4QNL A;  1Y8G A;  4DR5 M;  4MGI E;  1NHG C;  3GRR A;  1IY1 A;  1E32 A;  1XXH B;  1IN5 A;  4IJE A;  1JR3 D;  2MH8 A;  4WUR A;  3LQR A;  1DGH B;  3RGP A;  4NOO B;  2CP8 A;  2BJW A;  3SYK A;  3FYC A;  4DV6 M;  1C1K A;  2OO9 A;  3B89 A;  5DYI A;  2CHG A;  2J5Y A;  1KS0 A;  3CF2 A;  3Q8G A;  4OJO A;  2FN2 A;  2HWJ A;  2Y2K A;  4PCZ A;  2R4J A;  3KOX E;  1K3W A;  2WSC F;  1T3T A;  3GLG E;  3GLF E;  4IJF A;  4NZ5 A;  4CIS A;  5C18 A;  3FRI A;  1IN8 A;  2BWB A;  2VQF M;  3PNY A;  2UUB M;  1FJG M;  2CUZ A;  2C9O A;  1YU4 A;  4XBO A;  2JCH A;  1MU5 A;  3A45 A;  4LJ4 A;  3KVW A;  5JI3 E;  4AI6 A;  2EKF A;  2LNH C;  2CV1 A;  1D2N A;  2LVO C;  4G3O A;  3THG A;  2HHH M;  1IN7 A;  1ZMW A;  4MGK E;  2LBC A;  1W1P A;  2E5L M;  5BPV A;  4I5S A;  4D82 A;  1K3X A;  3DOA A;  4NYU A;  3HHW A;  3D8L A;  1GVN A;  2KNV A;  2CHV A;  5IZ7 D;  3KDS E;  2JY5 A;  3GRU A;  1CUK A;  3IEC A;  1NNU C;  3SAU A;  3GQ5 A;  4BBA A;  2Z8Y M;  3E21 A;  4FCV A;  4IBK A;  4NSO B;  1J5E M;  4LRS A;  4LZZ A;  2Y2H A;  1YUB A;  4X64 M;  1XMO M;  1GXD A;  1QVR A;  1QZM A;  3FUU A;  2KRK A;  3LMM A;  1EFU B;  3U5Z B;  1R2Z A;  3FTF A;  4GHL A;  2JP7 A;  3BBZ A;  1H8P A;  1E8B A;  1MJG M;  1N32 M;  3LCU A;  1HJP A;  1SG9 A;  1IXS B;  3SMP A;  3FYD A;  2C5R A;  2D7G A;  5FLX S;  2LVN C;  1IFY A;  1W1Y A;  4LZJ A;  3AFH A;  4KLN A;  3UMM A;  1CXW A;  1W5S A;  4JI2 M;  3AOE C;  3ZCB B;  1TDH A;  2DZO B;  3HON A;  1VG5 A;  2L7H A;  2K47 A;  3FRH A;  2LXE A;  4DV1 M;  1IXZ A;  4AZF A;  3OTO M;  2DAE A;  2RRU A;  2EKK A;  1PJT A;  3GLI A;  3VK7 A;  1TH2 A;  3K9P A;  2LHC A;  1L1Z A;  2L4E A;  2LWX A;  1NSF A;  1WIV A;  2ZBK B;  3K92 A;  4MGH A;  1WR1 B;  5KQ8 A;  2Z7J A;  2R6F A;  5EXX A;  2XD1 A;  3A98 B;  2X49 A;  2APL A;  5E26 A;  3GQ4 A;  1G71 A;  2Z3X A;  5LMU M;  1KYI A;  1Z5C A;  4GIT A;  1PJJ A;  1NY6 A;  4XK8 F;  1PJQ A;  5FTN A;  2AHM A;  1OJL A;  4DV3 M;  3U6L A;  2DWZ B;  3KFU G;  3VDP A;  1TF0 B;  1N77 A;  2XZU A;  1J7M A;  2QNJ A;  2XH9 A;  5ITU A;  1L1T A;  5FTM A;  4QNM A;  4LY6 A;  1TTE A;  4LJ7 A;  3J80 S;  3EIE A;  2M5Z A;  1YU2 A;  2XEP A;  3GLH E;  4YY3 M;  4CGY B;  5A2Q S;  2JNH A;  4Z2J A;  3T1Y M;  3TWL A;  4AG5 A;  2QSF X;  2Y2O A;  3VKH A;  1OKS A;  2YFQ A;  4MGY E;  1HQC A;  2XF3 A;  2G8L A;  1N33 M;  1N78 A;  2C98 A;  2GQF A;  2J7N A;  3NWL A;  4LCB A;  1QZE A;  5E6J A;  2DAK A;  3GPX A;  4PT5 A;  2Z4R A;  4L6V 6;  1D0L A;  2BNK A;  3WD2 A;  4DUZ M;  2UU9 M;  4YHH M;  1QUT A;  3B74 A;  4Z2K A;  2HKJ A;  4JI3 M;  1H0G A;  1Z5B A;  3PXG A;  3VFD A;  2DI0 A;  4DV4 M;  4D81 A;  1E6P A;  1SXJ C;  3TL4 X;  1J7K A;  3I51 A;  5C1B A;  3C3D A;  3DA1 A;  5ITT A;  4QOZ C;  1O6I A;  2DHY A;  1WJ7 A;  4OX9 M;  2Y0Q A;  2YR0 A;  3F92 A;  4JI6 M;  4LF7 M;  3HKP A;  2F5N A;  1MX0 A;  1DGF A;  1NV8 A;  1R4G A;  1R5L A;  3T6P A;  1I4W A;  4B3T M;  1YUE A;  1DO2 A;  1HT1 E;  4FVM A;  2XFT A;  4NL4 H;  4CIZ A;  1QDT A;  4NYY A;  1PJS A;  4M9X A;  2Z4S A;  3QWL A;  4OVZ B;  3KOZ E;  3FD9 A;  1OGG A;  1NHW C;  4JI7 M;  3KSJ A;  2L09 A;  1W1V A;  3Q8X A;  1TH3 A;  2G5G X;  3CTW B;  5ITX A;  5FTK A;  1XB2 B;  3KP0 E;  2R44 A;  4Q7J A;  3SFZ A;  1GOI A;  1QO6 A;  2RGH A;  2LVP C;  4TX8 A;  3I4V A;  2DHR A;  1G41 A;  2JY8 A;  5ITX E;  1DGH A;  1G8P A;  4Z8X A;  2KW0 A;  4AW4 A;  1J09 A;  2Y2L A;  1OIP A;  1NJG A;  4FWG A;  2UWX A;  1OAO C;  4X65 M;  4S12 A;  2ZAN A;  5IWA M;  5KPZ A;  3GO8 A;  1GL7 A;  4JI0 M;  4NZ1 A;  3CF6 E;  3V76 A;  3SYL A;  3FE3 A;  3HSH A;  3L26 A;  3FUV A;  1IY2 A;  2R45 A;  3AV0 A;  3E4R A;  5KPT A;  3FTE A;  4LFB M;  4Z2L A;  5EJC A;  1QAM A;  3KSX A;  1ZV1 A;  1TGU A;  4LJ6 A;  3U61 A;  4B3R M;  3LW5 F;  2X8A A;  4RKU F;  4OU7 A;  3MHV C;  1UM8 A;  3IG8 A;  2DNA A;  3FKE A;  2QPA A;  2DAM A;  4X66 M;  1HNW M;  4LJA A;  2F5Q A;  2UXB M;  3D8B A;  4I81 A;  5ITR A;  3JR5 A;  2MR9 A;  5KO3 A;  1GPF A;  1VQ1 A;  4MB3 A;  2JXN A;  1V34 A;  3U6Q A;  2D49 A;  1QAN A;  1PGY A;  4A3V B;  2EJS A;  1GKI A;  3SHF A;  2EO2 A;  1T43 A;  4M0W A;  1W1T A;  3IG5 A;  2Y2N A;  1G3I A;  1JQJ C;  3H4M A;  1CK7 A;  2EUC A;  4Z2H A;  2QP9 X;  4IIW A;  4PD2 A;  3GPY A;  3U6S A;  3MQL A;  2XLJ A;  2CEA A;  4OUI A;  4G4O A;  4QHT A;  4DV0 M;  2I7N A;  2Y0T A;  1GJT A;  4PDG A;  1SXJ E;  2HAK A;  3B7Z A;  3L2A A;  2H5X A;  4RF0 A;  4FWD A;  4GC5 A;  3U6P A;  2WZJ A;  4F1I A;  3HJS A;  1Z59 A;  4HMC A;  2JUJ A;  3WHL A;  3ZC7 B;  4NY2 A;  2V1U A;  1SXJ A;  3VKG A;  1GL6 A;  4MGZ E;  2Y2Q A;  2LVQ D;  2JWS A;  1K82 A;  3SBJ A;  1QAO A;  2KZU A;  4EIW A;  1E88 A;  1XHB A;  1XNQ M;  1IBK M;  1ORY B;  2KEB A;  3CGW A;  1P3Q Q;  4FD2 A;  2D7E A;  1YLA A;  2G3Q A;  4DV2 M;  1ZQ9 A;  3QYE A;  3M7G A;  2QZ4 A;  2HL7 A;  2D7H A;  2W82 A;  1DGG A;  1EE8 A;  2CV2 A;  2EA0 A;  2K6B A;  2FS1 A;  2Q2E B;  2VDB B;  3B9P A;  4L78 A;  3LCV B;  2WSF F; 
#chains in the Genus database with same CATH homology
 1L2B A;  3UK6 A;  3GRV A;  4GRI A;  1NJF A;  4LRT A;  1IBL M;  3QAU A;  2KZS A;  3PVS A;  2CV0 A;  2R46 A;  4IBB A;  1XNR M;  2L7I A;  1YE9 A;  3A46 A;  3HU2 A;  5FTL A;  1SXJ D;  2CE7 A;  4BB9 A;  4NRW A;  3TQS A;  4R3D A;  4WW0 A;  1FNN A;  4DR3 M;  3T38 A;  4KO8 A;  4LFA M;  5GKN A;  4I4L A;  3GLF B;  1WXQ A;  3T1H M;  1N34 M;  2FFF B;  3AJI B;  4LF8 M;  7CAT A;  2J7O A;  3RGS A;  4TUW A;  3KP1 E;  4GKJ M;  2C99 A;  1SXJ B;  4LG2 A;  3J27 B;  2CFO A;  4NRV A;  4LGM A;  3UZU A;  3NBI A;  4DR7 M;  1XXH A;  4G4Q A;  2DWM A;  3DFZ A;  1LV7 A;  4XGI A;  2Y2G A;  4REZ A;  3N3F A;  3K1J A;  2A5Y B;  4JV5 M;  4GMQ A;  5EXS A;  4M9Z A;  3AOG A;  2ZAO A;  2ZM6 M;  1L8Q A;  3J81 S;  3GLH B;  3HHX A;  4JI8 M;  4OW0 A;  1GLN A;  2R4E A;  3UJN A;  3SC3 A;  1VDD A;  3GPP A;  4AG6 A;  3CF0 A;  2LH0 A;  3U60 B;  4GHA A;  3L27 A;  4P16 A;  3WHK A;  4B7G A;  5JI2 E;  2Y20 A;  3AL0 C;  4LF9 M;  5EXP A;  4B7F A;  1QYR A;  2F5P A;  3GLH A;  3FUW A;  3FTC A;  4M0D A;  3VLF B;  3GPU A;  4ITQ A;  4DV5 M;  4GH9 A;  4B3M M;  2JE5 A;  4IBC A;  4W5W A;  4AKI A;  1W5T A;  2FFJ A;  3RE8 A;  4JI4 M;  3EIH A;  1L2D A;  2QBY A;  4NZ3 A;  2JA2 A;  3HU3 A;  1G4A E;  1PM5 A;  4BLC A;  2Y21 A;  4MH0 E;  3R9X B;  3GRY A;  2DWL A;  3I4Y A;  8CAT A;  3M6A A;  4OJL A;  1S3S A;  2R62 A;  1E9S A;  4HL4 A;  3J2P B;  4FW9 A;  4L8R C;  3TE6 A;  1Q3C A;  3W0F A;  5LMN M;  4R7G A;  4FCW A;  4LJ9 A;  2L6O A;  4GIP A;  5DNY A;  3KOY E;  4FWH A;  2V6Z M;  1N36 M;  3MK6 A;  3W0L B;  3HWS A;  4NSR A;  4OJ6 A;  3BOS A;  2XZF A;  2UXD M;  4AQY M;  2RGO A;  3HGI A;  2Y2M A;  2OQ4 A;  3HHY A;  3U5Z A;  1KSF X;  1NVM A;  2XSZ D;  5ITQ A;  3R8F A;  3FUT A;  2BJV A;  2KXE A;  4KHP M;  3U6C A;  5FSW A;  3HU1 A;  3L25 A;  1YU0 A;  1OFH A;  4AKH A;  3SAR A;  1HQY E;  1I94 M;  2IOU A;  2XGN A;  4K0K M;  1YU1 A;  1X37 A;  4LF5 M;  1IBM M;  3ILK A;  2Y2P A;  1XC8 A;  2YNM D;  3HJ8 A;  2DZN B;  3VK8 A;  1G59 A;  2CHQ A;  5KQD A;  1IN4 A;  1XWI A;  4B7H A;  2VQE M;  5ITY A;  2Y2J A;  2YQZ A;  3SAS A;  2VII A;  1DO0 A;  1E94 E;  4FCT A;  4DUY M;  4LF6 M;  4LJ8 A;  3GLG B;  1R7R A;  1ZAE A;  3SAT A;  2BG1 A;  4DR4 M;  4DR2 M;  5IRE B;  4KOD A;  4IBI A;  1QQW A;  2FE8 A;  4G6Z A;  4LJ5 A;  1Q3B A;  2C9C A;  2ERC A;  2I7P A;  4QHS A;  1TDZ A;  5KPR A;  4B3S M;  3LVV A;  2DXI A;  2QBY B;  1QAQ A;  3E9S A;  3HJQ A;  4B08 A;  3A42 A;  3SMS A;  2NQ8 C;  4LGY A;  1Z6T A;  2UUC M;  3HHZ A;  4HLQ A;  1R2Y A;  4PDI A;  3U6E A;  2UXC M;  1DGB A;  4NXN M;  1IN6 A;  3GLF A;  3KS4 A;  3C58 A;  3U61 B;  1H6U A;  5EP3 A;  1YU3 A;  3K8Z A;  3T15 A;  2F4V M;  4OJ5 A;  3VDU A;  5EP1 A;  4Z6Y A;  3GP1 A;  3SAV A;  4NZ4 A;  5FTJ A;  2KA6 B;  2C96 A;  3U6D A;  2Y2I A;  5BR8 M;  1OFI A;  4JI5 M;  3FTD A;  1Q39 A;  4II7 A;  4NXM M;  3PFI A;  1KFV A;  1YSY A;  3TWM A;  2V1C A;  4CHT B;  2X4A A;  1HR0 M;  5DYG A;  4JN6 A;  2DWN A;  4LF4 M;  3PNV A;  1IQP A;  3KXE C;  1E9R A;  2M60 A;  2O5R A;  1Z5A A;  5EP4 A;  2OPF A;  3U60 A;  5IT9 S;  4L4U A;  2R65 A;  2DVW B;  5EP2 A;  3TWK A;  5H37 D;  1N75 A;  1IXR C;  4IBF A;  4OVZ A;  3JR4 A;  2F5O A;  4DR1 M;  3DZD A;  2XD5 A;  3KS8 A;  3JAM S;  4AKG A;  4JXJ A;  4L16 A;  4MB7 A;  3U6O A;  2P5T A;  3K2L A;  4G4R A;  1HNZ M;  5EXT A;  1R6B X;  1PJI A;  3RFW A;  4LFC M;  4IBE A;  1TH4 A;  3TPZ A;  5F3W A;  4D80 A;  3FUX A;  4QNR A;  2XSZ A;  5EQT A;  3GQ3 A;  4DV7 M;  4IBD A;  4OJP A;  1IY0 A;  3GLI B;  3MJ5 A;  1JR3 A;  2HCB A;  2XFS A;  4IBJ A;  3WX7 A;  3L28 A;  3LVW A;  4JI1 M;  3AKZ A;  3LQQ A;  2R18 A;  4DR6 M;  2QEN A;  4IBG A;  1L2C A;  4I8O A;  3J7A S;  4JYA M;  3L29 A;  3ZH9 B;  3KOW E;  3GLG A;  2F5S A;  2H1R A;  1HNX M;  2FNA A;  4QOS A;  1HT2 E;  1NY5 A;  3KW6 A;  3M0E A;  4RF1 A;  4RNA A;  3SAW A;  1NNJ A;  4L15 A;  1XMQ M;  2QCU A;  4ZPX A;  3UGJ A;  2UUA M;  2RKO A;  1IM2 A;  2ZAM A;  3AOE A;  4MM3 B;  2KRU A;  3U6M A;  4GKK M;  4M9S A;  3SHG B;  2FOI C;  3J7B A;  4X62 M;  4G4N A;  4GC9 A;  4QNL A;  4DR5 M;  4MGI E;  1NHG C;  3GRR A;  1IY1 A;  1E32 A;  1XXH B;  1IN5 A;  4IJE A;  1JR3 D;  4WUR A;  3LQR A;  1DGH B;  3RGP A;  4NOO B;  3SYK A;  2BJW A;  4DV6 M;  3FYC A;  1C1K A;  5DYI A;  2CHG A;  3CF2 A;  4OJO A;  2Y2K A;  4PCZ A;  2R4J A;  3KOX E;  1K3W A;  1T3T A;  4NZ5 A;  4IJF A;  4CIS A;  5C18 A;  1IN8 A;  2VQF M;  3PNY A;  2UUB M;  1FJG M;  2CUZ A;  2C9O A;  1YU4 A;  4XBO A;  2JCH A;  1MU5 A;  3A45 A;  4LJ4 A;  3KVW A;  5JI3 E;  4AI6 A;  2LNH C;  2CV1 A;  2HHH M;  1D2N A;  3THG A;  1IN7 A;  4MGK E;  2E5L M;  5BPV A;  4I5S A;  4D82 A;  1K3X A;  3DOA A;  4NYU A;  3HHW A;  3D8L A;  1GVN A;  2CHV A;  5IZ7 D;  3KDS E;  3GRU A;  3SAU A;  1NNU C;  3GQ5 A;  4BBA A;  4FCV A;  4IBK A;  4NSO B;  1J5E M;  2Y2H A;  4LRS A;  4LZZ A;  1YUB A;  4X64 M;  1XMO M;  1QVR A;  1QZM A;  3FUU A;  2KRK A;  3LMM A;  3U5Z B;  3FTF A;  1R2Z A;  4GHL A;  1N32 M;  3SMP A;  1IXS B;  2C5R A;  3FYD A;  2D7G A;  5FLX S;  4LZJ A;  3AFH A;  4KLN A;  3UMM A;  1W5S A;  4JI2 M;  3AOE C;  3ZCB B;  1TDH A;  2DZO B;  3HON A;  2L7H A;  2K47 A;  2LXE A;  4DV1 M;  1IXZ A;  4AZF A;  3OTO M;  3GLI A;  3VK7 A;  1TH2 A;  1L1Z A;  2LWX A;  1NSF A;  2ZBK B;  3K92 A;  4MGH A;  5KQ8 A;  2Z7J A;  5EXX A;  2XD1 A;  3A98 B;  2X49 A;  5E26 A;  3GQ4 A;  2Z3X A;  5LMU M;  1KYI A;  1Z5C A;  4GIT A;  1PJJ A;  1NY6 A;  4DV3 M;  5FTN A;  3U6L A;  2AHM A;  1OJL A;  2DWZ B;  3KFU G;  3VDP A;  1N77 A;  2XZU A;  2XH9 A;  5ITU A;  1L1T A;  5FTM A;  4QNM A;  4LY6 A;  4LJ7 A;  3J80 S;  3EIE A;  2M5Z A;  1YU2 A;  2XEP A;  4YY3 M;  4CGY B;  5A2Q S;  3T1Y M;  3TWL A;  4AG5 A;  2Y2O A;  3VKH A;  2YFQ A;  4MGY E;  1HQC A;  2XF3 A;  2G8L A;  1N33 M;  1N78 A;  2C98 A;  2J7N A;  3NWL A;  4LCB A;  5E6J A;  3GPX A;  4PT5 A;  2Z4R A;  2BNK A;  4DUZ M;  2UU9 M;  4YHH M;  2HKJ A;  4JI3 M;  1Z5B A;  3PXG A;  3VFD A;  4DV4 M;  4D81 A;  1SXJ C;  3TL4 X;  1J7K A;  3I51 A;  5C1B A;  3DA1 A;  5ITT A;  4QOZ C;  4OX9 M;  2Y0Q A;  2YR0 A;  4JI6 M;  4LF7 M;  3HKP A;  2F5N A;  1MX0 A;  1DGF A;  4B3T M;  1YUE A;  1I4W A;  1DO2 A;  1HT1 E;  4FVM A;  2XFT A;  4NL4 H;  4NYY A;  4M9X A;  2Z4S A;  3QWL A;  4OVZ B;  3KOZ E;  3FD9 A;  1NHW C;  4JI7 M;  3KSJ A;  2L09 A;  3Q8X A;  1TH3 A;  2G5G X;  3CTW B;  5ITX A;  5FTK A;  3KP0 E;  3SFZ A;  2RGH A;  3I4V A;  2DHR A;  1G41 A;  5ITX E;  1DGH A;  1G8P A;  4Z8X A;  2KW0 A;  4AW4 A;  1J09 A;  2Y2L A;  1NJG A;  4FWG A;  2UWX A;  4X65 M;  4S12 A;  2ZAN A;  5IWA M;  5KPZ A;  3GO8 A;  1GL7 A;  4JI0 M;  4NZ1 A;  3CF6 E;  3SYL A;  3HSH A;  3L26 A;  3FUV A;  1IY2 A;  2R45 A;  3AV0 A;  3E4R A;  5KPT A;  3FTE A;  4LFB M;  5EJC A;  1QAM A;  3KSX A;  1TGU A;  4LJ6 A;  3U61 A;  4B3R M;  2X8A A;  4OU7 A;  3MHV C;  1UM8 A;  3IG8 A;  3FKE A;  4X66 M;  2QPA A;  1HNW M;  2UXB M;  4LJA A;  2F5Q A;  3D8B A;  4I81 A;  5ITR A;  3JR5 A;  5KO3 A;  3U6Q A;  1QAN A;  4A3V B;  3SHF A;  1GKI A;  2EO2 A;  4M0W A;  3IG5 A;  2Y2N A;  1G3I A;  1JQJ C;  3H4M A;  2EUC A;  2QP9 X;  4IIW A;  4PD2 A;  3GPY A;  3U6S A;  4OUI A;  2XLJ A;  2CEA A;  4G4O A;  4QHT A;  4DV0 M;  2I7N A;  2Y0T A;  4PDG A;  3U6P A;  1SXJ E;  3L2A A;  4RF0 A;  1K82 A;  4FWD A;  4GC5 A;  3HJS A;  1Z59 A;  3WHL A;  3ZC7 B;  4NY2 A;  2V1U A;  1SXJ A;  3VKG A;  1GL6 A;  4MGZ E;  2Y2Q A;  3SBJ A;  1QAO A;  2KZU A;  4EIW A;  1XHB A;  1XNQ M;  1IBK M;  1ORY B;  2KEB A;  4FD2 A;  2D7E A;  4DV2 M;  1ZQ9 A;  3M7G A;  2QZ4 A;  2HL7 A;  2D7H A;  2W82 A;  1DGG A;  1EE8 A;  2CV2 A;  2EA0 A;  2Q2E B;  3B9P A;  4L78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...