3KS8A

Crystal structure of reston ebolavirus vp35 rna binding domain in complex with 18bp dsrna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
ISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Viral protein/rna
molecule keywords 5'-R(*AP*GP*AP*AP*GP*GP*AP*GP*GP*GP*AP*GP*GP*GP*AP*GP*GP*A)-
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ks8A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3ks8A02
4GHAA 4LG2A 4GH9A 3L29A 3L26A 4IBFA 4GHLA 3KS4A 4IBBA 4IBEA 4IBGA 3L28A 4IJEA 4IBDA 3L2AA 3L27A 4IJFA 4IBIA 4IBKA 3KS8A 3FKEA 3L25A 4IBJA 5BPVA 4IBCA
chains in the Genus database with same CATH superfamily
3GRRA 2BNKA 3GPPA 4ITQA 4G4NA 1TDZA 4AG6A 4PDGA 1WHCA 2XH9A 1H6UA 1EFUB 1IN4A 3B74A 4LJ8A 1L8QA 2C98A 3A98B 3DA1A 3SARA 4KO8A 1IFYA 2FOIC 3QYBA 5KO3A 2H1RA 3EIEA 1P3QQ 4LF8M 3HX3A 1N32M 3PFIA 2CWBA 1G59A 1D2NA 2F5QA 3I4VA 3FUTA 2Y2NA 2KNZA 1T43A 3QAUA 5IREB 2CV0A 1Q02A 2VQFM 4QNRA 1HJPA 2F5SA 1IN6A 1V33A 3K9PA 4I8OA 1YLAA 5KQ8A 1F4IA 2DAIA 4OVZB 3SYLA 1CUKA 1VG5A 3T15A 5FTKA 4FWDA 2K0BX 4NSOB 3MJ5A 4CISA 3KSXA 2Y2PA 2CRUA 2K47A 1T6OA 1UR9A 2LXEA 3W0LB 3U6OA 3SHGB 5EJCA 3B7ZA 3GLGE 1XMQM 1QZMA 2IOUA 4NZ4A 3J2PB 3AV0A 2XLJA 1N34M 3H4MA 5DNYA 2WSEF 4LFCM 3B89A 4OJ6A 2MR9A 4IJEA 2LVNC 3L2AA 2D7HA 3MQLA 7CATA 3U6DA 3B7NA 2ZBKB 4L6V6 4G3OA 3SC3A 1GVNA 2XGNA 3M7GA 4R3DA 2QBYA 2XZUA 2KHHA 1XB2B 1N75A 3E4RA 5ITYA 3SFZA 1QZEA 3BBZA 3KP1E 4IBJA 1J7KA 2HL7A 3HWSA 4JI3M 1KFVA 4DR6M 2C9CA 4FCTA 3THGA 5ITXE 4LG2A 4FW9A 2QZ4A 1SXJC 3W67A 4X66M 1UFZA 1IBMM 2LHGA 4OJ5A 1ED7A 4B3SM 3BXWA 4JI1M 4NYUA 4F2LA 2ZTCA 1CK7A 1OGGA 3K8ZA 1KS0A 1OTRA 4MGYE 2DAKA 2L6OA 3L28A 4L4UA 3KOZE 3LVVA 3M0EA 4GC9A 1DO2A 5C1BA 1GXDA 3HKPA 2MROB 2R4JA 1OAOC 1NHWC 3F92A 3WD4A 2DZNB 3SAVA 4LF5M 3U61A 1R4GA 3LCUA 1SXJA 2JUJA 1MX0A 3RE8A 4X65M 1HNWM 2BWEA 4LF9M 4B7HA 4YHHM 3DFZA 1Z5BA 3SASA 4GRIA 1XXHB 3TE6A 4S12A 3PNVA 2XSZA 4G6ZA 4GC5A 1PJTA 3C3EA 1QAMA 2W82A 1E6ZA 1EE8A 1HQYE 3VFDA 4A3VB 5BR8M 3U60B 1I4WA 4MGKE 4Z2KA 2AHMA 4LRSA 2R4EA 2QBYB 4EIWA 2XEPA 1QDTA 3AOEA 2MJ5B 3A46A 2I7NA 1QQWA 1V34A 4AKGA 3FRHA 4PDIA 1HNZM 1DGHB 2R0IA 1J5EM 1GL6A 1R6BX 4B7GA 2WZJA 3JR5A 4MGIE 2Y2GA 4Z2LA 3K2LA 3GLFE 1OKSA 1NVMA 5EP3A 4LCBA 5EP1A 3GLHE 5FTMA 3WD2A 1ZQ9A 2QCUA 1GL7A 3Q8GA 5GKNA 2I7PA 4LJ4A 2F5PA 1Z6TA 2DI0A 1Z5CA 5IT9S 1E6RA 4OW0A 3Q8XA 1G71A 3KP0E 4HMEA 3EIHA 1NNJA 2HHHM 3VLFB 4LGMA 3SMPA 3T1HM 1FJGM 1ZMUA 3U5ZB 2Y2MA 1GJTA 2Z4SA 4M9ZA 3TQSA 2V1CA 1OFHA 3GRUA 3RGSA 4AQYM 1JB0F 3UZUA 2EUCA 2DKLA 2R6FA 3KDSE 3LVWA 4IBDA 3GO8A 1K3WA 3FTEA 4P17A 1IN8A 3AOGA 2Z7JA 2WSFF 1IXSA 4LZZA 4B3RM 1GOIA 1WJ7A 1TTEA 1WGNA 4AI6A 4I5SA 4LGYA 4NZ3A 2JY7A 4FD2A 4ANRA 1G8PA 3HGIA 2LHCA 2Q2EB 2CUZA 2KZUA 2DAEA 1DGGA 4IIWA 3T38A 3JAMS 4L16A 4LZJA 3GQ4A 3WX7A 2L7IA 1MU5A 4NXMM 1Y8GA 3FE3A 2Y21A 5FSWA 3HZJA 4XGIA 2FE8A 3A45A 3LW5F 1IM2A 2KNVA 3BOSA 4IBEA 4XBOA 3U6CA 4WURA 2XFSA 2L7HA 2CEAA 5JI3E 3CTWB 2UXDM 2CE7A 3GPYA 4X62M 2JP7A 3LCVB 1VEKA 2Y2JA 4LJ7A 4JI4M 1G3IA 1VEJA 2DWZB 1NJFA 2N35A 1IBKM 3M7PA 3HHXA 4GIPA 5L8RF 2XF3A 2YFQA 2BJVA 2L4EA 3IG5A 3GQ3A 4L78A 2UXBM 4M9XA 1OQYA 2APLA 2OOBA 4P16A 4JI0M 2EJSA 2CP8A 1SG9A 2DWLA 4JV5M 1IXSB 1W1PA 3FUXA 2ERCA 2RGHA 4FCWA 3L26A 2JY6B 3CF6E 4M0WA 3FTFA 1S3SA 4MB5A 2DHRA 2J5YA 2FH0A 5IZ7D 3A42A 3UGJA 4IBGA 3HU3A 2CFOA 2KEBA 1Z5AA 4PCZA 4DR5M 3CF0A 4RKUF 3J81S 1ZMVA 4I81A 4CGYB 2X8AA 4YY3M 4D80A 1D0LA 1HQCA 2CV1A 2Y2KA 1DO0A 4BB9A 3J80S 2F5OA 1XC8A 1UM8A 2JXNA 2MGWA 3AOEC 4OJLA 4DBGB 4AW4A 4HL4A 1JR3D 4QHTA 4JI7M 3VKHA 2LVOC 2OO9A 4PT5A 3N3FA 2YQZA 3LQQA 4Y28F 2C5RA 3FYDA 3HY5A 5EP4A 4DV7M 1E9RA 2C9OA 2NQ8C 3VDPA 2KZSA 1NSFA 1NV9A 4DR7M 2V1UA 1GJSA 5FTNA 4B08A 1HT1E 3VK7A 3J7BA 1XXHE 4W5WA 2VQEM 1G4AE 1OIPA 1WR1B 2KDLA 1TDHA 4F1IA 2LVAA 4DV3M 4LF7M 1G41A 3V76A 3L27A 4LFAM 3WD3A 1QAOA 4NSRA 2Y2IA 4GMQA 1OAIA 4NOOB 1R7RA 3TWMA 1T3TA 5FTLA 1E15A 4LJ9A 1H8PA 4FWHA 2JY5A 5ITUA 3HSHA 1EIJA 3E46A 4OVZA 5EXXA 1E9SA 2L09A 5E6JA 4REZA 4Z6YA 2QNJA 5LMUM 1PJJA 1QUSA 3AKZA 1C7YA 1HR0M 4MB7A 4DR4M 4HEOA 4G4RA 4LF4M 3KW6A 4LJ5A 2BJWA 2O01F 3LMMA 5EXSA 3MK6A 4MGHA 1TF0B 3L29A 1QAQA 1Q3CA 1SXJD 5H37D 3J7AS 4RNAA 1H0GA 4DV5M 1L1ZA 1PDCA 2FN2A 4L8RC 2G8LA 4WP2A 1K82A 1UR8A 2C99A 5ITQA 1IY2A 1GKIA 2EO2A 2QQ8A 1NO1A 5EXPA 1XNRM 1Z59A 3DZDA 1W5SA 4K0KM 2R65A 4Z2IA 2JA2A 1K3XA 1LTMA 1ORYB 2KA6B 2R44A 2Y0TA 1W1TA 3HHWA 1W5TA 2Y2LA 3TWLA 1HNXM 3KS8A 1R2ZA 3SAUA 3JR4A 1D0MA 3ZH9B 3I01M 4R7GA 3U6PA 1IXZA 2DWNA 2J7NA 2CHGA 3VKGA 1PGYA 2R46A 2RGOA 3U6QA 4NZ5A 1E88A 2Y2OA 1XHBA 1QUTA 1KYIA 3CGWA 5EXTA 1J09A 2KRKA 4LFBM 1IY0A 2A5YB 4I4LA 3U6SA 3U6LA 3FRIA 2B3TA 4BBAA 1GO5A 2HWJA 4LRTA 3IECA 4PD2A 8CATA 1OIZA 3FUVA 4JXJA 1OFIA 1BVSA 1TH4A 2P5TA 2YR0A 3KSJA 1I94M 1N33M 2UU9M 1EAKA 3SYKA 2Y0QA 3GPXA 3FUWA 4II7A 3FKEA 1X37A 3C58A 2KW0A 3RFWA 2XZFA 5KPTA 2JE5A 3GLHB 2FS1A 4KLNA 1PM5A 1NHGC 5ITXA 3KFUG 3KOWE 1NNUC 4AKIA 4FVMA 1WXQA 2O25A 4NRVA 2OPFA 2LTUA 4LJAA 2DXIA 1VDLA 3U6EA 2GQFA 4AKHA 3U60A 5FTJA 1L2BA 2BWBA 2GNOA 2VF7A 2KNAA 3WHLA 1AUAA 1MN3A 2FFJA 3K1JA 1MJGM 3C3DA 4DV0M 4DV6M 2R62A 2X4AA 2DENA 3U5ZA 4OUIA 2JCHA 2K9DA 2J7OA 3AFHA 1DGHA 4IBKA 2ZAOA 2M5ZA 1VDDA 4X64M 4DR3M 3QYEA 4OJPA 2JWSA 3E9SA 3K9OA 2V5OA 5FLXS 2QP9X 4QNLA 4LJ6A 2H5XA 3HJQA 3KVWA 4QHSA 3TPZA 3ZCBB 2DAMA 3GLIB 3UMMA 2UWXA 1Q3BA 4NYYA 2JY8A 4NXNM 4MH0E 2LWXA 2ZTDA 2JNHA 2YNMD 3PNYA 1E94E 3SMSA 3GP1A 2LH0A 4DR1M 5EP2A 4OX9M 4GHLA 4M9SA 4LF6M 1GLNA 3I04M 4JYAM 1YU3A 1J7MA 3PVSA 4Z2HA 3AJIB 1N36M 4LY6A 2OOAA 5ITRA 1TH2A 1R2YA 4DV4M 3SAWA 2D7EA 4G4OA 4JI2M 1IY1A 3MHVC 3KOXE 1QANA 3NWLA 3B7QA 3HU2A 4IBIA 4CJ6A 1GABA 2M60A 1W1YA 1WIVA 2LVQD 1XNQM 4DUYM 3TWKA 2C96A 2R18A 3GLFA 1NJGA 4AZFA 5JI2E 2Z4RA 3HHZA 1PJQA 2RTSA 4NZ1A 3GQ5A 2XSZD 4B3TM 3CF2A 1YU4A 2BG1A 4IBFA 3KXEC 3ZC7B 5KPZA 3GPUA 2LBCA 4MM3B 4NRWA 4IBBA 1JR3A 4QNMA 4B3MM 1YU2A 1XXHA 2ZM6M 4GITA 1WGLA 2Z3XA 3LQRA 1DV0A 1LV7A 1GPFA 2F4VM 5LMNM 4B7FA 2QHOB 2CV2A 4JI8M 2XFTA 4JI5M 3KOYE 1OGBA 1N77A 4ZPXA 2Y2QA 2JZ1A 4HLQA 2RRUA 2FNAA 4MGZE 3WD1A 1YU0A 1DGFA 2DWMA 2ZANA 3M6AA 2VF8A 3SBJA 5F3WA 3L25A 1O6IA 4M0DA 2RKOA 1E6PA 1H0IA 3R9XB 1A5TA 4RF1A 1QYRA 1XMOM 1ZV1A 2E5LM 3FD9A 4RF0A 4GKJM 3D8LA 1OJLA 3GRVA 1L2DA 3U6MA 2DNAA 1AIPC 3D8BA 5KQDA 2DZOB 5KPRA 2KXEA 3AL0C 1NY6A 1NV8A 2EKFA 3H4JA 1V92A 2G5GX 4QOSA 3FYCA 3KS4A 3VDUA 1JR3E 3ZQJA 1CXWA 1C1KA 2DVWB 4HMDA 1IN7A 2UUBM 5A2QS 4D81A 3FTCA 3OTOM 3R8FA 1IN5A 4UN2B 1NY5A 1N78A 1E8BA 2D7GA 4TUWA 4IJFA 3SHFA 5DYGA 4DV1M 3C9PA 4DUZM 3TL4X 4FCVA 3GLFB 3GRYA 3GLGA 4WW0A 1FNNA 3K92A 2F5NA 3FTDA 1VEGA 3GLHA 4AG5A 3B9PA 2QENA 4CIZA 3UJNA 3GLIE 1TGUA 2L4FA 2QPAA 4KHPM 2EA0A 2KRUA 5BPVA 1IQPA 4OU7A 2DZLA 1HT2E 4NC6A 2O5RA 3GLGB 3DOAA 1DGBA 2UXCM 1W1VA 1SXJB 1R5LA 1RU3A 2UUCM 2L2DA 1PJSA 2DAGA 2ZAMA 2D49A 3T6PA 3GLIA 4JI6M 2CHQA 4Q7JA 3SATA 3W0FA 3PXGA 4D82A 4R71A 4GKKM 4Z2GA 2HKJA 2MH8A 1PRBA 1QVRA 2Z8YM 2X49A 2XD5A 2VDBB 1SXJE 4L15A 4JN6A 1E6NA 4MB4A 1XWIA 1KSFX 3HONA 4QOZC 1ZAEA 4Z8XA 3J27B 3E21A 3VK8A 1QO6A 2K6BA 4Z2JA 1L6JA 5IWAM 3IG8A 2JZ0A 1IBLM 1YSYA 4DV2M 3U61B 4KODA 2HAKA 3ILKA 3I4YA 4HMCA 4NY2A 2EKKA 1Q39A 4CHTB 5EQTA 4FWGA 1VQ1A 2OQ4A 4GHAA 2DHYA 3T1YM 3FUUA 3MMPA 4GH9A 1D0KA 5DYIA 3W68A 2FFFB 2VIIA 3IHPA 4G4QA 2XD1A 1YUBA 3NBXX 4KT0F 3WD0A 1AIWA 2HCBA 3HJ8A 2CHVA 4XK8F 2UUAM 5C18A 2Y2HA 4OJOA 1E32A 2LNHC 4TX8A 4MB3A 1JQJC 3HHYA 1TH3A 2Y20A 5DFLA 1L2CA 3WHKA 3NBIA 1YUEA 2R45A 1ZMWA 5E26A 3RGPA 1YU1A 2QSFX 1IXRC 2LVPC 1PJIA 3HU1A 3HJSA 4NL4H 3I51A 1YE9A 4BLCA 4DR2M 2G3QA 1QDRA 2V6ZM 1TR8A 2WSCF 5ITTA 3UK6A 3QWLA 4GEWA 1L1TA 4IBCA
chains in the Genus database with same CATH topology
3GRRA 2BNKA 3GPPA 4ITQA 4G4NA 1TDZA 4AG6A 4PDGA 2XH9A 1H6UA 1IN4A 4LJ8A 1L8QA 2C98A 3A98B 3DA1A 3SARA 4KO8A 2FOIC 5KO3A 2H1RA 3EIEA 4LF8M 1N32M 3PFIA 1G59A 1D2NA 2F5QA 3I4VA 3FUTA 2Y2NA 3QAUA 5IREB 2CV0A 2VQFM 4QNRA 2F5SA 1IN6A 5KQ8A 4I8OA 4OVZB 3SYLA 3T15A 5FTKA 4FWDA 4NSOB 3MJ5A 4CISA 3KSXA 2Y2PA 2K47A 2LXEA 3W0LB 3U6OA 3SHGB 5EJCA 1XMQM 1QZMA 2IOUA 4NZ4A 3J2PB 3AV0A 2XLJA 1N34M 3H4MA 5DNYA 4LFCM 4OJ6A 4IJEA 3L2AA 2D7HA 7CATA 3U6DA 3SC3A 2ZBKB 1GVNA 2XGNA 3M7GA 4R3DA 2QBYA 2XZUA 5ITYA 1N75A 3E4RA 3SFZA 3KP1E 4IBJA 1KFVA 1J7KA 2HL7A 3HWSA 4JI3M 4DR6M 2C9CA 4FCTA 3THGA 5ITXE 4LG2A 4FW9A 2QZ4A 1SXJC 4X66M 1IBMM 4OJ5A 4B3SM 4JI1M 4NYUA 3K8ZA 4MGYE 2L6OA 3L28A 4L4UA 4GC9A 3KOZE 3M0EA 3LVVA 1DO2A 5C1BA 3HKPA 2R4JA 1NHWC 2DZNB 3SAVA 4LF5M 3U61A 1SXJA 3RE8A 1MX0A 4X65M 1HNWM 4LF9M 4B7HA 4YHHM 3DFZA 1Z5BA 3SASA 4GRIA 1XXHB 3TE6A 4S12A 3PNVA 4GC5A 2XSZA 4G6ZA 1QAMA 2W82A 1EE8A 1HQYE 3VFDA 4A3VB 5BR8M 3U60B 1I4WA 4MGKE 2AHMA 4LRSA 2R4EA 2QBYB 4EIWA 2XEPA 3AOEA 3A46A 2I7NA 1QQWA 4AKGA 4PDIA 1HNZM 1DGHB 1J5EM 1GL6A 1R6BX 4B7GA 3JR5A 2Y2GA 4MGIE 3K2LA 5EP3A 1NVMA 4LCBA 5EP1A 5FTMA 1ZQ9A 2QCUA 1GL7A 5GKNA 2I7PA 4LJ4A 2F5PA 1Z6TA 1Z5CA 5IT9S 4OW0A 3Q8XA 3KP0E 3EIHA 1NNJA 2HHHM 3VLFB 4LGMA 3SMPA 3T1HM 1FJGM 3U5ZB 2Y2MA 2Z4SA 4M9ZA 3TQSA 2V1CA 1OFHA 3GRUA 3RGSA 4AQYM 3UZUA 2EUCA 3KDSE 4IBDA 3LVWA 3FTEA 3GO8A 1K3WA 1IN8A 3AOGA 2Z7JA 4LZZA 4B3RM 4AI6A 4I5SA 4LGYA 4NZ3A 4FD2A 1G8PA 3HGIA 2Q2EB 2CUZA 2KZUA 1DGGA 4IIWA 3T38A 3JAMS 4L16A 4LZJA 3GQ4A 3WX7A 2L7IA 1MU5A 4NXMM 2Y21A 5FSWA 4XGIA 2FE8A 3A45A 4IBEA 1IM2A 3BOSA 4XBOA 3U6CA 4WURA 2XFSA 2L7HA 2CEAA 5JI3E 3CTWB 2UXDM 2CE7A 3GPYA 4X62M 2Y2JA 4LJ7A 4JI4M 1G3IA 2DWZB 1NJFA 1IBKM 3HHXA 4GIPA 2XF3A 2YFQA 2BJVA 3IG5A 3GQ3A 2UXBM 4L78A 4M9XA 4JI0M 4P16A 2DWLA 4JV5M 1IXSB 3FUXA 2ERCA 2RGHA 4FCWA 3L26A 3FTFA 3CF6E 4M0WA 1S3SA 2DHRA 5IZ7D 3A42A 3UGJA 4IBGA 3HU3A 2CFOA 2KEBA 1Z5AA 4PCZA 4DR5M 3CF0A 3J81S 4I81A 4CGYB 2X8AA 4YY3M 4D80A 2CV1A 1HQCA 2Y2KA 1DO0A 4BB9A 3J80S 2F5OA 1XC8A 1UM8A 3AOEC 4OJLA 4AW4A 4HL4A 1JR3D 4QHTA 4JI7M 3VKHA 4PT5A 3N3FA 2YQZA 3LQQA 2C5RA 3FYDA 5EP4A 4DV7M 1E9RA 2C9OA 2NQ8C 3VDPA 2KZSA 1NSFA 4DR7M 2V1UA 5FTNA 4B08A 1HT1E 3VK7A 3J7BA 4W5WA 2VQEM 1G4AE 1TDHA 4DV3M 4LF7M 1G41A 3L27A 4LFAM 1QAOA 4NSRA 2Y2IA 4GMQA 4NOOB 1R7RA 3TWMA 1T3TA 5FTLA 4LJ9A 4FWHA 5ITUA 3HSHA 4OVZA 5EXXA 1E9SA 2L09A 5E6JA 4REZA 4Z6YA 5LMUM 1PJJA 1HR0M 3AKZA 4DR4M 4MB7A 4G4RA 4LF4M 3KW6A 4LJ5A 2BJWA 3LMMA 5EXSA 3MK6A 4MGHA 3L29A 3J7AS 1QAQA 1Q3CA 1SXJD 5H37D 4RNAA 4DV5M 1L1ZA 4L8RC 2G8LA 1K82A 2C99A 5ITQA 1IY2A 1GKIA 2EO2A 5EXPA 1XNRM 1Z59A 3DZDA 1W5SA 4K0KM 2R65A 2JA2A 1K3XA 1ORYB 2KA6B 2Y0TA 3HHWA 1W5TA 2Y2LA 3TWLA 1HNXM 3KS8A 1R2ZA 3SAUA 3JR4A 3ZH9B 4R7GA 3U6PA 1IXZA 2DWNA 2J7NA 2CHGA 3VKGA 2R46A 2RGOA 3U6QA 4NZ5A 2Y2OA 1XHBA 1KYIA 5EXTA 1J09A 2KRKA 4LFBM 1IY0A 2A5YB 4I4LA 3U6SA 3U6LA 4BBAA 4LRTA 4PD2A 8CATA 3FUVA 4JXJA 1OFIA 1TH4A 2P5TA 3KSJA 2YR0A 1I94M 1N33M 2UU9M 3SYKA 2Y0QA 3GPXA 3FUWA 4II7A 3FKEA 1X37A 3C58A 2KW0A 3RFWA 2XZFA 5KPTA 2JE5A 3GLHB 4KLNA 1PM5A 1NHGC 5ITXA 3KFUG 3KOWE 1NNUC 4AKIA 4FVMA 1WXQA 4NRVA 2OPFA 4LJAA 2DXIA 3U6EA 4AKHA 3U60A 5FTJA 1L2BA 3WHLA 4DV0M 2FFJA 1YU4A 3K1JA 4DV6M 2R62A 2X4AA 3U5ZA 4OUIA 2JCHA 2J7OA 3AFHA 1DGHA 4IBKA 2ZAOA 2M5ZA 1VDDA 4X64M 4DR3M 4OJPA 3E9SA 4QNLA 5FLXS 2QP9X 4LJ6A 3GLIB 3HJQA 3KVWA 4QHSA 3TPZA 3ZCBB 3UMMA 2UWXA 1Q3BA 4NYYA 4NXNM 4MH0E 2LWXA 2YNMD 3PNYA 1E94E 3SMSA 3GP1A 2LH0A 4DR1M 5EP2A 4OX9M 4GHLA 4M9SA 4LF6M 1GLNA 4JYAM 1YU3A 3PVSA 3AJIB 1N36M 4LY6A 5ITRA 1TH2A 1R2YA 4DV4M 3SAWA 2D7EA 4G4OA 4JI2M 1IY1A 3MHVC 3KOXE 1QANA 3NWLA 3HU2A 4IBIA 2M60A 1XNQM 4DUYM 3TWKA 2C96A 2R18A 3GLFA 1NJGA 4AZFA 5JI2E 2Z4RA 3HHZA 4NZ1A 3GQ5A 2XSZD 4B3TM 3CF2A 2BG1A 4IBFA 3KXEC 3ZC7B 5KPZA 3GPUA 4MM3B 4NRWA 4IBBA 1JR3A 4QNMA 4B3MM 1YU2A 1XXHA 2ZM6M 4GITA 2Z3XA 3LQRA 1LV7A 2F4VM 5LMNM 4B7FA 2CV2A 4JI8M 2XFTA 4JI5M 3KOYE 1N77A 4ZPXA 2Y2QA 4HLQA 2FNAA 4MGZE 1YU0A 1DGFA 2DWMA 2ZANA 3M6AA 3SBJA 5F3WA 3L25A 4M0DA 2RKOA 3R9XB 4RF1A 1QYRA 1XMOM 2E5LM 3FD9A 4RF0A 4GKJM 3D8LA 1OJLA 3GRVA 1L2DA 3U6MA 5KQDA 3AL0C 3D8BA 5KPRA 2DZOB 2KXEA 1NY6A 2G5GX 4QOSA 3KS4A 3FYCA 3VDUA 1C1KA 2DVWB 1IN7A 2UUBM 5A2QS 4D81A 3FTCA 3OTOM 3R8FA 1IN5A 1N78A 1NY5A 2D7GA 4TUWA 4IJFA 3SHFA 5DYGA 4DV1M 4DUZM 3TL4X 4FCVA 3GLFB 3GRYA 3GLGA 4WW0A 1FNNA 3K92A 2F5NA 3FTDA 3GLHA 4AG5A 3B9PA 2QENA 3UJNA 1TGUA 2QPAA 4KHPM 2EA0A 2KRUA 5BPVA 1IQPA 4OU7A 1HT2E 2O5RA 3GLGB 3DOAA 1DGBA 2UXCM 1SXJB 2UUCM 2ZAMA 3GLIA 4JI6M 2CHQA 3SATA 3W0FA 3PXGA 4D82A 4GKKM 2HKJA 1QVRA 2X49A 2XD5A 1SXJE 4L15A 4JN6A 1XWIA 1KSFX 3HONA 4QOZC 1ZAEA 4Z8XA 3J27B 3VK8A 5IWAM 3IG8A 1IBLM 1YSYA 4DV2M 3U61B 4KODA 3ILKA 3I4YA 4NY2A 1Q39A 4CHTB 5EQTA 4FWGA 2OQ4A 4GHAA 3T1YM 3FUUA 4GH9A 5DYIA 2FFFB 2VIIA 4G4QA 2XD1A 1YUBA 2HCBA 3HJ8A 2CHVA 2UUAM 5C18A 2Y2HA 4OJOA 1E32A 2LNHC 1JQJC 3HHYA 1TH3A 2Y20A 1L2CA 3WHKA 3NBIA 1YUEA 2R45A 5E26A 3RGPA 1YU1A 1IXRC 1PJIA 3HU1A 3HJSA 4NL4H 3I51A 1YE9A 4BLCA 4DR2M 2V6ZM 5ITTA 3UK6A 3QWLA 1L1TA 4IBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4LG2 A;  4GH9 A;  3L29 A;  3L26 A;  4IBF A;  4GHL A;  3KS4 A;  4IBB A;  4IBE A;  4IBG A;  3L28 A;  4IJE A;  4IBD A;  3L2A A;  3L27 A;  4IJF A;  4IBI A;  4IBK A;  3KS8 A;  3FKE A;  3L25 A;  4IBJ A;  5BPV A;  4IBC A; 
#chains in the Genus database with same CATH topology
 3GRR A;  2BNK A;  3GPP A;  4ITQ A;  4G4N A;  1TDZ A;  4AG6 A;  4PDG A;  1WHC A;  2XH9 A;  1H6U A;  1EFU B;  1IN4 A;  3B74 A;  4LJ8 A;  1L8Q A;  2C98 A;  3A98 B;  3DA1 A;  3SAR A;  4KO8 A;  1IFY A;  2FOI C;  3QYB A;  5KO3 A;  2H1R A;  3EIE A;  1P3Q Q;  4LF8 M;  3HX3 A;  1N32 M;  3PFI A;  2CWB A;  1G59 A;  1D2N A;  2F5Q A;  3I4V A;  3FUT A;  2Y2N A;  2KNZ A;  1T43 A;  3QAU A;  5IRE B;  2CV0 A;  1Q02 A;  2VQF M;  4QNR A;  1HJP A;  2F5S A;  1IN6 A;  1V33 A;  3K9P A;  4I8O A;  1YLA A;  5KQ8 A;  1F4I A;  2DAI A;  4OVZ B;  3SYL A;  1CUK A;  1VG5 A;  3T15 A;  5FTK A;  4FWD A;  2K0B X;  4NSO B;  3MJ5 A;  4CIS A;  3KSX A;  2Y2P A;  2CRU A;  2K47 A;  1T6O A;  1UR9 A;  2LXE A;  3W0L B;  3U6O A;  3SHG B;  5EJC A;  3B7Z A;  3GLG E;  1XMQ M;  1QZM A;  2IOU A;  4NZ4 A;  3J2P B;  3AV0 A;  2XLJ A;  1N34 M;  3H4M A;  5DNY A;  2WSE F;  4LFC M;  3B89 A;  4OJ6 A;  2MR9 A;  4IJE A;  2LVN C;  3L2A A;  2D7H A;  3MQL A;  7CAT A;  3U6D A;  3B7N A;  2ZBK B;  4L6V 6;  4G3O A;  3SC3 A;  1GVN A;  2XGN A;  3M7G A;  4R3D A;  2QBY A;  2XZU A;  2KHH A;  1XB2 B;  1N75 A;  3E4R A;  5ITY A;  3SFZ A;  1QZE A;  3BBZ A;  3KP1 E;  4IBJ A;  1J7K A;  2HL7 A;  3HWS A;  4JI3 M;  1KFV A;  4DR6 M;  2C9C A;  4FCT A;  3THG A;  5ITX E;  4LG2 A;  4FW9 A;  2QZ4 A;  1SXJ C;  3W67 A;  4X66 M;  1UFZ A;  1IBM M;  2LHG A;  4OJ5 A;  1ED7 A;  4B3S M;  3BXW A;  4JI1 M;  4NYU A;  4F2L A;  2ZTC A;  1CK7 A;  1OGG A;  3K8Z A;  1KS0 A;  1OTR A;  4MGY E;  2DAK A;  2L6O A;  3L28 A;  4L4U A;  3KOZ E;  3LVV A;  3M0E A;  4GC9 A;  1DO2 A;  5C1B A;  1GXD A;  3HKP A;  2MRO B;  2R4J A;  1OAO C;  1NHW C;  3F92 A;  3WD4 A;  2DZN B;  3SAV A;  4LF5 M;  3U61 A;  1R4G A;  3LCU A;  1SXJ A;  2JUJ A;  1MX0 A;  3RE8 A;  4X65 M;  1HNW M;  2BWE A;  4LF9 M;  4B7H A;  4YHH M;  3DFZ A;  1Z5B A;  3SAS A;  4GRI A;  1XXH B;  3TE6 A;  4S12 A;  3PNV A;  2XSZ A;  4G6Z A;  4GC5 A;  1PJT A;  3C3E A;  1QAM A;  2W82 A;  1E6Z A;  1EE8 A;  1HQY E;  3VFD A;  4A3V B;  5BR8 M;  3U60 B;  1I4W A;  4MGK E;  4Z2K A;  2AHM A;  4LRS A;  2R4E A;  2QBY B;  4EIW A;  2XEP A;  1QDT A;  3AOE A;  2MJ5 B;  3A46 A;  2I7N A;  1QQW A;  1V34 A;  4AKG A;  3FRH A;  4PDI A;  1HNZ M;  1DGH B;  2R0I A;  1J5E M;  1GL6 A;  1R6B X;  4B7G A;  2WZJ A;  3JR5 A;  4MGI E;  2Y2G A;  4Z2L A;  3K2L A;  3GLF E;  1OKS A;  1NVM A;  5EP3 A;  4LCB A;  5EP1 A;  3GLH E;  5FTM A;  3WD2 A;  1ZQ9 A;  2QCU A;  1GL7 A;  3Q8G A;  5GKN A;  2I7P A;  4LJ4 A;  2F5P A;  1Z6T A;  2DI0 A;  1Z5C A;  5IT9 S;  1E6R A;  4OW0 A;  3Q8X A;  1G71 A;  3KP0 E;  4HME A;  3EIH A;  1NNJ A;  2HHH M;  3VLF B;  4LGM A;  3SMP A;  3T1H M;  1FJG M;  1ZMU A;  3U5Z B;  2Y2M A;  1GJT A;  2Z4S A;  4M9Z A;  3TQS A;  2V1C A;  1OFH A;  3GRU A;  3RGS A;  4AQY M;  1JB0 F;  3UZU A;  2EUC A;  2DKL A;  2R6F A;  3KDS E;  3LVW A;  4IBD A;  3GO8 A;  1K3W A;  3FTE A;  4P17 A;  1IN8 A;  3AOG A;  2Z7J A;  2WSF F;  1IXS A;  4LZZ A;  4B3R M;  1GOI A;  1WJ7 A;  1TTE A;  1WGN A;  4AI6 A;  4I5S A;  4LGY A;  4NZ3 A;  2JY7 A;  4FD2 A;  4ANR A;  1G8P A;  3HGI A;  2LHC A;  2Q2E B;  2CUZ A;  2KZU A;  2DAE A;  1DGG A;  4IIW A;  3T38 A;  3JAM S;  4L16 A;  4LZJ A;  3GQ4 A;  3WX7 A;  2L7I A;  1MU5 A;  4NXM M;  1Y8G A;  3FE3 A;  2Y21 A;  5FSW A;  3HZJ A;  4XGI A;  2FE8 A;  3A45 A;  3LW5 F;  1IM2 A;  2KNV A;  3BOS A;  4IBE A;  4XBO A;  3U6C A;  4WUR A;  2XFS A;  2L7H A;  2CEA A;  5JI3 E;  3CTW B;  2UXD M;  2CE7 A;  3GPY A;  4X62 M;  2JP7 A;  3LCV B;  1VEK A;  2Y2J A;  4LJ7 A;  4JI4 M;  1G3I A;  1VEJ A;  2DWZ B;  1NJF A;  2N35 A;  1IBK M;  3M7P A;  3HHX A;  4GIP A;  5L8R F;  2XF3 A;  2YFQ A;  2BJV A;  2L4E A;  3IG5 A;  3GQ3 A;  4L78 A;  2UXB M;  4M9X A;  1OQY A;  2APL A;  2OOB A;  4P16 A;  4JI0 M;  2EJS A;  2CP8 A;  1SG9 A;  2DWL A;  4JV5 M;  1IXS B;  1W1P A;  3FUX A;  2ERC A;  2RGH A;  4FCW A;  3L26 A;  2JY6 B;  3CF6 E;  4M0W A;  3FTF A;  1S3S A;  4MB5 A;  2DHR A;  2J5Y A;  2FH0 A;  5IZ7 D;  3A42 A;  3UGJ A;  4IBG A;  3HU3 A;  2CFO A;  2KEB A;  1Z5A A;  4PCZ A;  4DR5 M;  3CF0 A;  4RKU F;  3J81 S;  1ZMV A;  4I81 A;  4CGY B;  2X8A A;  4YY3 M;  4D80 A;  1D0L A;  1HQC A;  2CV1 A;  2Y2K A;  1DO0 A;  4BB9 A;  3J80 S;  2F5O A;  1XC8 A;  1UM8 A;  2JXN A;  2MGW A;  3AOE C;  4OJL A;  4DBG B;  4AW4 A;  4HL4 A;  1JR3 D;  4QHT A;  4JI7 M;  3VKH A;  2LVO C;  2OO9 A;  4PT5 A;  3N3F A;  2YQZ A;  3LQQ A;  4Y28 F;  2C5R A;  3FYD A;  3HY5 A;  5EP4 A;  4DV7 M;  1E9R A;  2C9O A;  2NQ8 C;  3VDP A;  2KZS A;  1NSF A;  1NV9 A;  4DR7 M;  2V1U A;  1GJS A;  5FTN A;  4B08 A;  1HT1 E;  3VK7 A;  3J7B A;  1XXH E;  4W5W A;  2VQE M;  1G4A E;  1OIP A;  1WR1 B;  2KDL A;  1TDH A;  4F1I A;  2LVA A;  4DV3 M;  4LF7 M;  1G41 A;  3V76 A;  3L27 A;  4LFA M;  3WD3 A;  1QAO A;  4NSR A;  2Y2I A;  4GMQ A;  1OAI A;  4NOO B;  1R7R A;  3TWM A;  1T3T A;  5FTL A;  1E15 A;  4LJ9 A;  1H8P A;  4FWH A;  2JY5 A;  5ITU A;  3HSH A;  1EIJ A;  3E46 A;  4OVZ A;  5EXX A;  1E9S A;  2L09 A;  5E6J A;  4REZ A;  4Z6Y A;  2QNJ A;  5LMU M;  1PJJ A;  1QUS A;  3AKZ A;  1C7Y A;  1HR0 M;  4MB7 A;  4DR4 M;  4HEO A;  4G4R A;  4LF4 M;  3KW6 A;  4LJ5 A;  2BJW A;  2O01 F;  3LMM A;  5EXS A;  3MK6 A;  4MGH A;  1TF0 B;  3L29 A;  1QAQ A;  1Q3C A;  1SXJ D;  5H37 D;  3J7A S;  4RNA A;  1H0G A;  4DV5 M;  1L1Z A;  1PDC A;  2FN2 A;  4L8R C;  2G8L A;  4WP2 A;  1K82 A;  1UR8 A;  2C99 A;  5ITQ A;  1IY2 A;  1GKI A;  2EO2 A;  2QQ8 A;  1NO1 A;  5EXP A;  1XNR M;  1Z59 A;  3DZD A;  1W5S A;  4K0K M;  2R65 A;  4Z2I A;  2JA2 A;  1K3X A;  1LTM A;  1ORY B;  2KA6 B;  2R44 A;  2Y0T A;  1W1T A;  3HHW A;  1W5T A;  2Y2L A;  3TWL A;  1HNX M;  3KS8 A;  1R2Z A;  3SAU A;  3JR4 A;  1D0M A;  3ZH9 B;  3I01 M;  4R7G A;  3U6P A;  1IXZ A;  2DWN A;  2J7N A;  2CHG A;  3VKG A;  1PGY A;  2R46 A;  2RGO A;  3U6Q A;  4NZ5 A;  1E88 A;  2Y2O A;  1XHB A;  1QUT A;  1KYI A;  3CGW A;  5EXT A;  1J09 A;  2KRK A;  4LFB M;  1IY0 A;  2A5Y B;  4I4L A;  3U6S A;  3U6L A;  3FRI A;  2B3T A;  4BBA A;  1GO5 A;  2HWJ A;  4LRT A;  3IEC A;  4PD2 A;  8CAT A;  1OIZ A;  3FUV A;  4JXJ A;  1OFI A;  1BVS A;  1TH4 A;  2P5T A;  2YR0 A;  3KSJ A;  1I94 M;  1N33 M;  2UU9 M;  1EAK A;  3SYK A;  2Y0Q A;  3GPX A;  3FUW A;  4II7 A;  3FKE A;  1X37 A;  3C58 A;  2KW0 A;  3RFW A;  2XZF A;  5KPT A;  2JE5 A;  3GLH B;  2FS1 A;  4KLN A;  1PM5 A;  1NHG C;  5ITX A;  3KFU G;  3KOW E;  1NNU C;  4AKI A;  4FVM A;  1WXQ A;  2O25 A;  4NRV A;  2OPF A;  2LTU A;  4LJA A;  2DXI A;  1VDL A;  3U6E A;  2GQF A;  4AKH A;  3U60 A;  5FTJ A;  1L2B A;  2BWB A;  2GNO A;  2VF7 A;  2KNA A;  3WHL A;  1AUA A;  1MN3 A;  2FFJ A;  3K1J A;  1MJG M;  3C3D A;  4DV0 M;  4DV6 M;  2R62 A;  2X4A A;  2DEN A;  3U5Z A;  4OUI A;  2JCH A;  2K9D A;  2J7O A;  3AFH A;  1DGH A;  4IBK A;  2ZAO A;  2M5Z A;  1VDD A;  4X64 M;  4DR3 M;  3QYE A;  4OJP A;  2JWS A;  3E9S A;  3K9O A;  2V5O A;  5FLX S;  2QP9 X;  4QNL A;  4LJ6 A;  2H5X A;  3HJQ A;  3KVW A;  4QHS A;  3TPZ A;  3ZCB B;  2DAM A;  3GLI B;  3UMM A;  2UWX A;  1Q3B A;  4NYY A;  2JY8 A;  4NXN M;  4MH0 E;  2LWX A;  2ZTD A;  2JNH A;  2YNM D;  3PNY A;  1E94 E;  3SMS A;  3GP1 A;  2LH0 A;  4DR1 M;  5EP2 A;  4OX9 M;  4GHL A;  4M9S A;  4LF6 M;  1GLN A;  3I04 M;  4JYA M;  1YU3 A;  1J7M A;  3PVS A;  4Z2H A;  3AJI B;  1N36 M;  4LY6 A;  2OOA A;  5ITR A;  1TH2 A;  1R2Y A;  4DV4 M;  3SAW A;  2D7E A;  4G4O A;  4JI2 M;  1IY1 A;  3MHV C;  3KOX E;  1QAN A;  3NWL A;  3B7Q A;  3HU2 A;  4IBI A;  4CJ6 A;  1GAB A;  2M60 A;  1W1Y A;  1WIV A;  2LVQ D;  1XNQ M;  4DUY M;  3TWK A;  2C96 A;  2R18 A;  3GLF A;  1NJG A;  4AZF A;  5JI2 E;  2Z4R A;  3HHZ A;  1PJQ A;  2RTS A;  4NZ1 A;  3GQ5 A;  2XSZ D;  4B3T M;  3CF2 A;  1YU4 A;  2BG1 A;  4IBF A;  3KXE C;  3ZC7 B;  5KPZ A;  3GPU A;  2LBC A;  4MM3 B;  4NRW A;  4IBB A;  1JR3 A;  4QNM A;  4B3M M;  1YU2 A;  1XXH A;  2ZM6 M;  4GIT A;  1WGL A;  2Z3X A;  3LQR A;  1DV0 A;  1LV7 A;  1GPF A;  2F4V M;  5LMN M;  4B7F A;  2QHO B;  2CV2 A;  4JI8 M;  2XFT A;  4JI5 M;  3KOY E;  1OGB A;  1N77 A;  4ZPX A;  2Y2Q A;  2JZ1 A;  4HLQ A;  2RRU A;  2FNA A;  4MGZ E;  3WD1 A;  1YU0 A;  1DGF A;  2DWM A;  2ZAN A;  3M6A A;  2VF8 A;  3SBJ A;  5F3W A;  3L25 A;  1O6I A;  4M0D A;  2RKO A;  1E6P A;  1H0I A;  3R9X B;  1A5T A;  4RF1 A;  1QYR A;  1XMO M;  1ZV1 A;  2E5L M;  3FD9 A;  4RF0 A;  4GKJ M;  3D8L A;  1OJL A;  3GRV A;  1L2D A;  3U6M A;  2DNA A;  1AIP C;  3D8B A;  5KQD A;  2DZO B;  5KPR A;  2KXE A;  3AL0 C;  1NY6 A;  1NV8 A;  2EKF A;  3H4J A;  1V92 A;  2G5G X;  4QOS A;  3FYC A;  3KS4 A;  3VDU A;  1JR3 E;  3ZQJ A;  1CXW A;  1C1K A;  2DVW B;  4HMD A;  1IN7 A;  2UUB M;  5A2Q S;  4D81 A;  3FTC A;  3OTO M;  3R8F A;  1IN5 A;  4UN2 B;  1NY5 A;  1N78 A;  1E8B A;  2D7G A;  4TUW A;  4IJF A;  3SHF A;  5DYG A;  4DV1 M;  3C9P A;  4DUZ M;  3TL4 X;  4FCV A;  3GLF B;  3GRY A;  3GLG A;  4WW0 A;  1FNN A;  3K92 A;  2F5N A;  3FTD A;  1VEG A;  3GLH A;  4AG5 A;  3B9P A;  2QEN A;  4CIZ A;  3UJN A;  3GLI E;  1TGU A;  2L4F A;  2QPA A;  4KHP M;  2EA0 A;  2KRU A;  5BPV A;  1IQP A;  4OU7 A;  2DZL A;  1HT2 E;  4NC6 A;  2O5R A;  3GLG B;  3DOA A;  1DGB A;  2UXC M;  1W1V A;  1SXJ B;  1R5L A;  1RU3 A;  2UUC M;  2L2D A;  1PJS A;  2DAG A;  2ZAM A;  2D49 A;  3T6P A;  3GLI A;  4JI6 M;  2CHQ A;  4Q7J A;  3SAT A;  3W0F A;  3PXG A;  4D82 A;  4R71 A;  4GKK M;  4Z2G A;  2HKJ A;  2MH8 A;  1PRB A;  1QVR A;  2Z8Y M;  2X49 A;  2XD5 A;  2VDB B;  1SXJ E;  4L15 A;  4JN6 A;  1E6N A;  4MB4 A;  1XWI A;  1KSF X;  3HON A;  4QOZ C;  1ZAE A;  4Z8X A;  3J27 B;  3E21 A;  3VK8 A;  1QO6 A;  2K6B A;  4Z2J A;  1L6J A;  5IWA M;  3IG8 A;  2JZ0 A;  1IBL M;  1YSY A;  4DV2 M;  3U61 B;  4KOD A;  2HAK A;  3ILK A;  3I4Y A;  4HMC A;  4NY2 A;  2EKK A;  1Q39 A;  4CHT B;  5EQT A;  4FWG A;  1VQ1 A;  2OQ4 A;  4GHA A;  2DHY A;  3T1Y M;  3FUU A;  3MMP A;  4GH9 A;  1D0K A;  5DYI A;  3W68 A;  2FFF B;  2VII A;  3IHP A;  4G4Q A;  2XD1 A;  1YUB A;  3NBX X;  4KT0 F;  3WD0 A;  1AIW A;  2HCB A;  3HJ8 A;  2CHV A;  4XK8 F;  2UUA M;  5C18 A;  2Y2H A;  4OJO A;  1E32 A;  2LNH C;  4TX8 A;  4MB3 A;  1JQJ C;  3HHY A;  1TH3 A;  2Y20 A;  5DFL A;  1L2C A;  3WHK A;  3NBI A;  1YUE A;  2R45 A;  1ZMW A;  5E26 A;  3RGP A;  1YU1 A;  2QSF X;  1IXR C;  2LVP C;  1PJI A;  3HU1 A;  3HJS A;  4NL4 H;  3I51 A;  1YE9 A;  4BLC A;  4DR2 M;  2G3Q A;  1QDR A;  2V6Z M;  1TR8 A;  2WSC F;  5ITT A;  3UK6 A;  3QWL A;  4GEW A;  1L1T A;  4IBC A; 
#chains in the Genus database with same CATH homology
 3GRR A;  2BNK A;  3GPP A;  4ITQ A;  4G4N A;  1TDZ A;  4AG6 A;  4PDG A;  2XH9 A;  1H6U A;  1IN4 A;  4LJ8 A;  1L8Q A;  2C98 A;  3A98 B;  3DA1 A;  3SAR A;  4KO8 A;  2FOI C;  5KO3 A;  2H1R A;  3EIE A;  4LF8 M;  1N32 M;  3PFI A;  1G59 A;  1D2N A;  2F5Q A;  3I4V A;  3FUT A;  2Y2N A;  3QAU A;  5IRE B;  2CV0 A;  2VQF M;  4QNR A;  2F5S A;  1IN6 A;  5KQ8 A;  4I8O A;  4OVZ B;  3SYL A;  3T15 A;  5FTK A;  4FWD A;  4NSO B;  3MJ5 A;  4CIS A;  3KSX A;  2Y2P A;  2K47 A;  2LXE A;  3W0L B;  3U6O A;  3SHG B;  5EJC A;  1XMQ M;  1QZM A;  2IOU A;  4NZ4 A;  3J2P B;  3AV0 A;  2XLJ A;  1N34 M;  3H4M A;  5DNY A;  4LFC M;  4OJ6 A;  4IJE A;  3L2A A;  2D7H A;  7CAT A;  3U6D A;  3SC3 A;  2ZBK B;  1GVN A;  2XGN A;  3M7G A;  4R3D A;  2QBY A;  2XZU A;  5ITY A;  1N75 A;  3E4R A;  3SFZ A;  3KP1 E;  4IBJ A;  1KFV A;  1J7K A;  2HL7 A;  3HWS A;  4JI3 M;  4DR6 M;  2C9C A;  4FCT A;  3THG A;  5ITX E;  4LG2 A;  4FW9 A;  2QZ4 A;  1SXJ C;  4X66 M;  1IBM M;  4OJ5 A;  4B3S M;  4JI1 M;  4NYU A;  3K8Z A;  4MGY E;  2L6O A;  3L28 A;  4L4U A;  4GC9 A;  3KOZ E;  3M0E A;  3LVV A;  1DO2 A;  5C1B A;  3HKP A;  2R4J A;  1NHW C;  2DZN B;  3SAV A;  4LF5 M;  3U61 A;  1SXJ A;  3RE8 A;  1MX0 A;  4X65 M;  1HNW M;  4LF9 M;  4B7H A;  4YHH M;  3DFZ A;  1Z5B A;  3SAS A;  4GRI A;  1XXH B;  3TE6 A;  4S12 A;  3PNV A;  4GC5 A;  2XSZ A;  4G6Z A;  1QAM A;  2W82 A;  1EE8 A;  1HQY E;  3VFD A;  4A3V B;  5BR8 M;  3U60 B;  1I4W A;  4MGK E;  2AHM A;  4LRS A;  2R4E A;  2QBY B;  4EIW A;  2XEP A;  3AOE A;  3A46 A;  2I7N A;  1QQW A;  4AKG A;  4PDI A;  1HNZ M;  1DGH B;  1J5E M;  1GL6 A;  1R6B X;  4B7G A;  3JR5 A;  2Y2G A;  4MGI E;  3K2L A;  5EP3 A;  1NVM A;  4LCB A;  5EP1 A;  5FTM A;  1ZQ9 A;  2QCU A;  1GL7 A;  5GKN A;  2I7P A;  4LJ4 A;  2F5P A;  1Z6T A;  1Z5C A;  5IT9 S;  4OW0 A;  3Q8X A;  3KP0 E;  3EIH A;  1NNJ A;  2HHH M;  3VLF B;  4LGM A;  3SMP A;  3T1H M;  1FJG M;  3U5Z B;  2Y2M A;  2Z4S A;  4M9Z A;  3TQS A;  2V1C A;  1OFH A;  3GRU A;  3RGS A;  4AQY M;  3UZU A;  2EUC A;  3KDS E;  4IBD A;  3LVW A;  3FTE A;  3GO8 A;  1K3W A;  1IN8 A;  3AOG A;  2Z7J A;  4LZZ A;  4B3R M;  4AI6 A;  4I5S A;  4LGY A;  4NZ3 A;  4FD2 A;  1G8P A;  3HGI A;  2Q2E B;  2CUZ A;  2KZU A;  1DGG A;  4IIW A;  3T38 A;  3JAM S;  4L16 A;  4LZJ A;  3GQ4 A;  3WX7 A;  2L7I A;  1MU5 A;  4NXM M;  2Y21 A;  5FSW A;  4XGI A;  2FE8 A;  3A45 A;  4IBE A;  1IM2 A;  3BOS A;  4XBO A;  3U6C A;  4WUR A;  2XFS A;  2L7H A;  2CEA A;  5JI3 E;  3CTW B;  2UXD M;  2CE7 A;  3GPY A;  4X62 M;  2Y2J A;  4LJ7 A;  4JI4 M;  1G3I A;  2DWZ B;  1NJF A;  1IBK M;  3HHX A;  4GIP A;  2XF3 A;  2YFQ A;  2BJV A;  3IG5 A;  3GQ3 A;  2UXB M;  4L78 A;  4M9X A;  4JI0 M;  4P16 A;  2DWL A;  4JV5 M;  1IXS B;  3FUX A;  2ERC A;  2RGH A;  4FCW A;  3L26 A;  3FTF A;  3CF6 E;  4M0W A;  1S3S A;  2DHR A;  5IZ7 D;  3A42 A;  3UGJ A;  4IBG A;  3HU3 A;  2CFO A;  2KEB A;  1Z5A A;  4PCZ A;  4DR5 M;  3CF0 A;  3J81 S;  4I81 A;  4CGY B;  2X8A A;  4YY3 M;  4D80 A;  2CV1 A;  1HQC A;  2Y2K A;  1DO0 A;  4BB9 A;  3J80 S;  2F5O A;  1XC8 A;  1UM8 A;  3AOE C;  4OJL A;  4AW4 A;  4HL4 A;  1JR3 D;  4QHT A;  4JI7 M;  3VKH A;  4PT5 A;  3N3F A;  2YQZ A;  3LQQ A;  2C5R A;  3FYD A;  5EP4 A;  4DV7 M;  1E9R A;  2C9O A;  2NQ8 C;  3VDP A;  2KZS A;  1NSF A;  4DR7 M;  2V1U A;  5FTN A;  4B08 A;  1HT1 E;  3VK7 A;  3J7B A;  4W5W A;  2VQE M;  1G4A E;  1TDH A;  4DV3 M;  4LF7 M;  1G41 A;  3L27 A;  4LFA M;  1QAO A;  4NSR A;  2Y2I A;  4GMQ A;  4NOO B;  1R7R A;  3TWM A;  1T3T A;  5FTL A;  4LJ9 A;  4FWH A;  5ITU A;  3HSH A;  4OVZ A;  5EXX A;  1E9S A;  2L09 A;  5E6J A;  4REZ A;  4Z6Y A;  5LMU M;  1PJJ A;  1HR0 M;  3AKZ A;  4DR4 M;  4MB7 A;  4G4R A;  4LF4 M;  3KW6 A;  4LJ5 A;  2BJW A;  3LMM A;  5EXS A;  3MK6 A;  4MGH A;  3L29 A;  3J7A S;  1QAQ A;  1Q3C A;  1SXJ D;  5H37 D;  4RNA A;  4DV5 M;  1L1Z A;  4L8R C;  2G8L A;  1K82 A;  2C99 A;  5ITQ A;  1IY2 A;  1GKI A;  2EO2 A;  5EXP A;  1XNR M;  1Z59 A;  3DZD A;  1W5S A;  4K0K M;  2R65 A;  2JA2 A;  1K3X A;  1ORY B;  2KA6 B;  2Y0T A;  3HHW A;  1W5T A;  2Y2L A;  3TWL A;  1HNX M;  3KS8 A;  1R2Z A;  3SAU A;  3JR4 A;  3ZH9 B;  4R7G A;  3U6P A;  1IXZ A;  2DWN A;  2J7N A;  2CHG A;  3VKG A;  2R46 A;  2RGO A;  3U6Q A;  4NZ5 A;  2Y2O A;  1XHB A;  1KYI A;  5EXT A;  1J09 A;  2KRK A;  4LFB M;  1IY0 A;  2A5Y B;  4I4L A;  3U6S A;  3U6L A;  4BBA A;  4LRT A;  4PD2 A;  8CAT A;  3FUV A;  4JXJ A;  1OFI A;  1TH4 A;  2P5T A;  3KSJ A;  2YR0 A;  1I94 M;  1N33 M;  2UU9 M;  3SYK A;  2Y0Q A;  3GPX A;  3FUW A;  4II7 A;  3FKE A;  1X37 A;  3C58 A;  2KW0 A;  3RFW A;  2XZF A;  5KPT A;  2JE5 A;  3GLH B;  4KLN A;  1PM5 A;  1NHG C;  5ITX A;  3KFU G;  3KOW E;  1NNU C;  4AKI A;  4FVM A;  1WXQ A;  4NRV A;  2OPF A;  4LJA A;  2DXI A;  3U6E A;  4AKH A;  3U60 A;  5FTJ A;  1L2B A;  3WHL A;  4DV0 M;  2FFJ A;  1YU4 A;  3K1J A;  4DV6 M;  2R62 A;  2X4A A;  3U5Z A;  4OUI A;  2JCH A;  2J7O A;  3AFH A;  1DGH A;  4IBK A;  2ZAO A;  2M5Z A;  1VDD A;  4X64 M;  4DR3 M;  4OJP A;  3E9S A;  4QNL A;  5FLX S;  2QP9 X;  4LJ6 A;  3GLI B;  3HJQ A;  3KVW A;  4QHS A;  3TPZ A;  3ZCB B;  3UMM A;  2UWX A;  1Q3B A;  4NYY A;  4NXN M;  4MH0 E;  2LWX A;  2YNM D;  3PNY A;  1E94 E;  3SMS A;  3GP1 A;  2LH0 A;  4DR1 M;  5EP2 A;  4OX9 M;  4GHL A;  4M9S A;  4LF6 M;  1GLN A;  4JYA M;  1YU3 A;  3PVS A;  3AJI B;  1N36 M;  4LY6 A;  5ITR A;  1TH2 A;  1R2Y A;  4DV4 M;  3SAW A;  2D7E A;  4G4O A;  4JI2 M;  1IY1 A;  3MHV C;  3KOX E;  1QAN A;  3NWL A;  3HU2 A;  4IBI A;  2M60 A;  1XNQ M;  4DUY M;  3TWK A;  2C96 A;  2R18 A;  3GLF A;  1NJG A;  4AZF A;  5JI2 E;  2Z4R A;  3HHZ A;  4NZ1 A;  3GQ5 A;  2XSZ D;  4B3T M;  3CF2 A;  2BG1 A;  4IBF A;  3KXE C;  3ZC7 B;  5KPZ A;  3GPU A;  4MM3 B;  4NRW A;  4IBB A;  1JR3 A;  4QNM A;  4B3M M;  1YU2 A;  1XXH A;  2ZM6 M;  4GIT A;  2Z3X A;  3LQR A;  1LV7 A;  2F4V M;  5LMN M;  4B7F A;  2CV2 A;  4JI8 M;  2XFT A;  4JI5 M;  3KOY E;  1N77 A;  4ZPX A;  2Y2Q A;  4HLQ A;  2FNA A;  4MGZ E;  1YU0 A;  1DGF A;  2DWM A;  2ZAN A;  3M6A A;  3SBJ A;  5F3W A;  3L25 A;  4M0D A;  2RKO A;  3R9X B;  4RF1 A;  1QYR A;  1XMO M;  2E5L M;  3FD9 A;  4RF0 A;  4GKJ M;  3D8L A;  1OJL A;  3GRV A;  1L2D A;  3U6M A;  5KQD A;  3AL0 C;  3D8B A;  5KPR A;  2DZO B;  2KXE A;  1NY6 A;  2G5G X;  4QOS A;  3KS4 A;  3FYC A;  3VDU A;  1C1K A;  2DVW B;  1IN7 A;  2UUB M;  5A2Q S;  4D81 A;  3FTC A;  3OTO M;  3R8F A;  1IN5 A;  1N78 A;  1NY5 A;  2D7G A;  4TUW A;  4IJF A;  3SHF A;  5DYG A;  4DV1 M;  4DUZ M;  3TL4 X;  4FCV A;  3GLF B;  3GRY A;  3GLG A;  4WW0 A;  1FNN A;  3K92 A;  2F5N A;  3FTD A;  3GLH A;  4AG5 A;  3B9P A;  2QEN A;  3UJN A;  1TGU A;  2QPA A;  4KHP M;  2EA0 A;  2KRU A;  5BPV A;  1IQP A;  4OU7 A;  1HT2 E;  2O5R A;  3GLG B;  3DOA A;  1DGB A;  2UXC M;  1SXJ B;  2UUC M;  2ZAM A;  3GLI A;  4JI6 M;  2CHQ A;  3SAT A;  3W0F A;  3PXG A;  4D82 A;  4GKK M;  2HKJ A;  1QVR A;  2X49 A;  2XD5 A;  1SXJ E;  4L15 A;  4JN6 A;  1XWI A;  1KSF X;  3HON A;  4QOZ C;  1ZAE A;  4Z8X A;  3J27 B;  3VK8 A;  5IWA M;  3IG8 A;  1IBL M;  1YSY A;  4DV2 M;  3U61 B;  4KOD A;  3ILK A;  3I4Y A;  4NY2 A;  1Q39 A;  4CHT B;  5EQT A;  4FWG A;  2OQ4 A;  4GHA A;  3T1Y M;  3FUU A;  4GH9 A;  5DYI A;  2FFF B;  2VII A;  4G4Q A;  2XD1 A;  1YUB A;  2HCB A;  3HJ8 A;  2CHV A;  2UUA M;  5C18 A;  2Y2H A;  4OJO A;  1E32 A;  2LNH C;  1JQJ C;  3HHY A;  1TH3 A;  2Y20 A;  1L2C A;  3WHK A;  3NBI A;  1YUE A;  2R45 A;  5E26 A;  3RGP A;  1YU1 A;  1IXR C;  1PJI A;  3HU1 A;  3HJS A;  4NL4 H;  3I51 A;  1YE9 A;  4BLC A;  4DR2 M;  2V6Z M;  5ITT A;  3UK6 A;  3QWL A;  1L1T A;  4IBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...