3KSFA

Structure of frmsr of staphylococcus aureus (reduced form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title structure of fRMsr of Staphylococcus aureus
rcsb
molecule keywords Putative uncharacterized protein
molecule tags Oxidoreductase
source organism Staphylococcus aureus
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksfA00
4ZRRA 4Q0HA 1YSPA 3E0YA 4ME4A 5HL6A 3CI6A 3C2WA 1TF1A 5HPIA 2VKSA 3KSFA 4EUVA 3IBRA 2W3EA 2LB9A 3D3OA 4DMZA 3HCYA 2GX5A 1MC0A 3OOVA 2XROA 2OOLA 3W2ZA 5I5LA 5HSQA 4Q0IA 2VZWA 5L8MA 5K5BA 3O5YA 2LB5A 4MCWA 3NOPC 4ETXA 4FOFA 1YKDA 3NOUC 3KSIA 5C5KA 2W3FA 4O8GA 4PAUA 2M7UA 2M7VA 3CITA 4LRXC 3MMHA 3VV4A 2ZMFA 2XSSA 1MKMA 4IUKA 4IJGA 2O9CA 3EEAA 2IA2A 4CQHA 2W3GA 4LRYC 4DN0A 2VJWA 1STZA 4G3KA 4E04A 3NHQA 4YOFA 5TJJA 4GLQA 4R70A 4Y5FA 4MN7A 4BWIA 4G3WA 4Y2FA 3LFVA 5DFXA 2K31A 3BJNA 3S7PA 3S7OA 5HPFA 4MDZA 2B18A 4QPRA 2Y79A 4LRZE 3OBFA 3S7QA 4O0PA 2W1TA 3ZQ5A 4EU0A 2QYBA 4YNRA 3KSGA 3RFBA 3S7NA 3TRCA 1TD5A 5AJGA 4Y3IA 3G6OA 2VEAA 3MF0A 3E98A 2O99A 3DBAA 2W1RA 4G3VA 2O9BA 2K2NA 2O0YA 1ZTUA 4Q0JA 2W1TB 3KO6A 2W3DA 2W3HA 2HGVA 3MQ0A 2G7UA 1VHMA 3NOTC 2XRNA 3KSHA 2O9AA 4GW9A 4O01A 5DFYA 3IBJA 2KLIA 1F5MA 4IUHA 1YSQA 4RQ9A 2KOIA 3R4KA 4Z1WA 3K2NA 2Y8HA 4ETZA 4R6LA 5LBRA 4MMNA
chains in the Genus database with same CATH superfamily
1OT9A 3M2JA 5CHMA 1NXYA 4QD4A 1TF1A 2H10A 2ZJ9A 3IX8A 3O3VA 3E4QA 4EUVA 4X69A 4OOLA 4XUXA 2ZQ7A 3P98A 4PM9A 5HSQA 2XFSA 4E3IA 2WKIA 1SCWA 1MWUA 2QJ7A 1UWNX 1W8YA 2BLSA 3IHAA 2JN7A 1JNUA 4EBNA 3DTEA 4WZ5C 4FCFA 4YFMA 4Z9QA 3HLEA 4P6ZM 1ZKJA 4P87A 3UB9A 5CGXA 4LRXC 4ZTKA 2HDSA 3VV4A 1T19A 2PDRA 4L0LA 3GDIA 2KDKA 2I9VA 4OLGA 3SH8A 1ZG6A 3HLWA 4CQHA 5F5YA 4K91A 3G4PA 4HP9A 4DXCA 4YWZA 1XGJA 2XEPA 4MN7A 4L9GA 4RA7A 3ZDJA 5HPFA 1XJ3A 2XH9A 2AVXA 4DE3A 1SZVA 3MKEA 3AGEA 3ZQ5A 4IHQA 4PKYG 3S7NA 3TSGA 2A3UA 1W8QA 1FQGA 1M6KA 3G6OA 3E98A 4IVKA 1A0KA 4OKPA 1PI4A 1RGZA 4S2KA 3S4XA 5M19A 4HY8A 4Q0JA 5FA7A 4CPKA 1Y54A 1RGYA 2XRNA 3T4QA 3WRZA 3KYZA 1I5QA 2WZXA 3MS6A 1FIKA 3HJIA 4S2OA 1L0EA 1C3BA 4X6TA 3Q81A 3E4PA 3JPUA 3Q7VA 4LV3A 1GSWA 1BLCA 4RYEA 3NC8A 4LFUA 5L09A 2PT7A 3IS2A 3HLDA 2ZBBA 2GX5A 4S2LA 3NDGA 2X02A 4GJ4A 1WA9A 3H82B 2EX9A 2HP9A 4IBRA 4ZJ3A 1BLSA 5EM1A 3B47A 3Q82A 3BLMA 5CEBA 4R3AA 1PWDA 1T18A 2W3FA 1XFNA 2L0WA 3UB8A 2VGKA 5GLBA 2XF3A 1IYPA 1E3UA 3Q7VB 3UB7A 3CPTB 2RL3A 3BY8A 3BFDA 1IOUA 4JKTA 1LSVA 1Y28A 3NHQA 5F68A 2WKPA 5F83A 3IS2B 1VETA 4G3WA 4Y2FA 3S7PA 1RP5A 1E4DA 1K6SA 3K3DA 5EPHA 4MN6A 1S4RA 4JBFA 4JF5A 3UDIA 1OPXA 4O0PA 3ZG0A 5GHYA 5JYOA 2WAEA 2OLVA 3G35A 1NLZA 3CUEC 5FSRA 2WZZA 2O99A 4R1GA 2O9BA 3MFDA 2W1TB 3R7WA 3LIEA 3ULFA 4EBLA 3CG5A 2JCHA 1K4EA 4ESPA 5FEFA 2Z2MB 5EOOA 4E3MA 1BZAA 1KE4A 3UPNA 4H8RA 2Z2LB 3PXPA 2JBFA 1CEFA 3T1QB 3MXQA 3HLFA 4MLLA 3KYEA 1IKGA 1YLJA 4K0XA 5TR7A 2PD8A 3UE3A 1FILA 3T4KA 3M6HA 4Q0IA 1DP9A 3FKWA 5FDHA 3WS2A 3QP4A 4FUWA 1G6AA 4A5RA 3ZFZA 1K56A 3ZVTA 3R7WB 1HVBA 4S2IA 4ID4A 4WBGA 3G31A 2J9OA 3ZNTA 3BQAA 5TGFA 3ZG8B 4KUOA 2W3GA 3BLSA 5TFQA 2ZQCA 2H5SA 4LGWA 4DXBA 2ZQ8A 4YOFA 1CEGA 2WGWB 3FV7A 3QP8A 2K7SA 2B18A 1PWGA 3MJQA 2R9XA 3P09A 4UA9A 4WEJA 1ZC2A 3LO7A 2J8YA 1S0WA 4R4RA 2H28A 4X56A 1NJ4A 2DRWA 3UDFA 2Y2OA 3I7JA 3KX0X 2QPNA 1O7EA 1XGIA 3EOIA 4BENA 3IXBA 2X01A 2L1MA 5KZHA 3ICYA 3HLBA 4D2OA 4OH0A 4Q0HA 1YSPA 3T4TA 5AVEA 2XFTA 2WKQA 3CUEA 1YLWA 2INWA 2ZC7A 2ZC5B 3N6IA 4DDSA 4DMZA 3HCYA 3U4LP 1E3UD 1S66L 3W2ZA 2R9WA 2ZC4B 4PMAA 1TVFA 4BD0A 5K5BA 2ZM2A 4E3NA 5EVIC 3BW6A 4DJ2A 1CI9A 2PYRA 5F82A 3Q7ZA 3LEZA 3U2AA 1N9BA 4G3KA 4KZAA 3F1PA 3N8RA 1DY6A 4OVDA 3OPHA 4I3IA 2Y91A 4JXVA 5DTSA 4ZJ1A 5IT5A 1PNEA 4QPRA 1XXMA 1OTDA 5M18A 3G30A 5KIZA 1GHMA 1S6RA 1OTBA 5HDSA 4PM7A 3RFBA 1W5DA 3LICA 1TD5A 1LSXA 5HWWA 4K08A 3UE0A 1H3QA 3PHYA 1PRQA 1L0DA 4E3JA 1VHMA 4HIAA 5J7EA 5MC7A 5HDDA 3T50A 5EUAA 1IYQA 4S2JA 5CRFA 3IBJA 3C4OA 1SDEA 1BLPA 1FSWA 4KZ5A 4DE0A 1H0MA 2A24B 2XQZA 4GHIB 1YLZA 1NY0A 1J9MA 3C7UA 1MBLA 2VK3A 2ZMAA 4YINA 1K38A 3P01A 2ZM0A 4WEKA 2XROA 1TS6A 4NKPA 3C8CA 3LR0A 1LT0A 4JPMA 5HAQA 1DRMA 5L8MA 1VM1A 1D7EA 3C5AA 5GL9A 3BM6A 5DJTA 3Q1FA 2XA7S 4BQMA 1P9WA 3RH8B 3ZYTA 2FH5A 2QMIA 4KG5A 2ZC6B 3AGDA 4GDNA 1FR6A 4HI4A 2V8FA 2JC7A 4WELA 4NXFA 5L07A 3IWOA 3TG9A 1SKOA 2WUQA 5F1FA 3T4LA 3BJNA 4OOMA 3GRJA 5FQIA 3PTEA 3S7QA 5BOHA 2Y2HA 3TJZC 3LIDA 4JXSA 4KENB 1K54C 2JKFA 3ZGAB 4R4SA 2OWJA 3OPLA 3VP2A 1ZTUA 1K25A 4IBXA 2EWVA 5GLCA 5FQKA 4LV0A 3O88A 5M1AA 4OONA 5DKLA 2C5WB 1MY8A 3OPRA 4NG2A 1G5UA 1DJCA 3Q07A 5GLAA 1YAXA 3E0YA 4R0QA 1XJ2A 1FCNA 5CHJA 1ZHHB 4LLOB 2GDNA 5HPIA 1VEUA 2VKSA 2Y2PA 1NLYA 2VA0A 4JF4A 3IBRA 3LIBA 3C4PA 3W4PA 4LPZA 3IXGA 3N8SA 4MNRA 2HDUA 4X68A 1ONHA 2PBDP 1TDLA 3LUQA 1KDSA 5A90A 3DAVA 4X53A 3UB5P 3A3DA 3KSIA 4O8GA 4HHDA 4D60A 1P0ZA 3V50A 4GD6A 2HF6A 2P04A 3IQAA 1MKMA 5FAPA 4EWFA 3UDXA 2VV6A 2HDQA 4HESA 4LENA 1VEUB 4R70A 4QY5A 4OLDA 3GTCA 1BUEA 1AWIA 3CMZA 3BEBA 1H5XA 1DP6A 2GZAA 5FEGA 2J3TD 2ZMVA 4OP8A 5CERA 3T1XA 1YQSA 1ZG4A 2QYBA 4DDYA 4ZDXA 1JWVA 2PBYA 3BFFA 2HGVA 4KZ4A 5DF9A 2O9AA 5DFYA 5HZHA 3VOLA 2JHEA 2KLIA 3LGOA 1EI5A 5CEDA 1XPBA 1XA7A 3V5MA 1GA0A 2OV5A 3EQVA 2HPBA 3H82A 5HL6A 4LCMA 3MQQA 3RJUA 4GNUA 1K54A 5A92A 1TEMA 1JWPA 4PHTA 1MWRA 4HH2A 3GECA 3B42A 4EQIA 4UEYA 3TOIA 2WGVA 3ZG5A 3BECA 2Y2JA 2DCFA 2VZWA 3T1SA 3LCEA 3CPTA 3IF6B 4E3KA 3LI8A 2V8CA 4QU3A 3UO9A 4X1MA 3ZVWA 4AFIA 4I3AA 3MR0A 4WM9A 2ZMFA 1IELA 1AXBA 2VX8A 2XSSA 4OP5A 3GSGA 4GN2A 1ES2A 2BASA 3BY9A 2Z6CA 3NULA 1KDWA 1L3LA 4E04A 2XLNA 5TJJA 2PD7A 2GNXA 4PM5A 4OPRA 5CGSA 1HTZA 5DFXA 1ESUA 1S1ZA 1K55A 4DE1A 4OQ0A 2W1TA 2A2LA 1KGFA 4GS9B 3IXHA 3JYIA 3NECA 3W8KA 4YNRA 2IWBA 3TW8A 5IS1A 3HLCA 1FR1A 3VOYA 4BLMA 3KSHA 4GW9A 3KYQA 4HQAA 3B33A 3FKVA 4FD8A 3FC7A 2V0UA 5LBRA 1SHVA 2ZOHA 2XA7M 2Y55A 3VSKA 4M3KA 4E6XA 3N8LA 5HFOA 5I94A 2E8JA 1XKZA 5GLDA 1CQAA 4FSFA 5I5LA 3UMEA 2EXAA 1YM1A 3NJAA 3NBLA 5IHVA 4II7A 5D3OA 3MZEA 5C5KA 5FL3A 3RXWA 3VP1A 2VLGA 4KQOA 4S2NA 4U0TA 2WGWA 4OQGA 4H6JB 3WRTA 1PWCA 1OMEA 5KSCA 3O86A 4IJGA 4QHCA 3V3SA 3A0RA 4LRYC 4OPQA 3IH9A 2HP5A 3PAEA 1BYWA 3CJMA 4K0WA 4JLFA 3VFFA 3LY3A 3OLOA 3MFXA 1XA1A 3EEHA 3OBFA 3H7WB 2Y2KA 3N7WA 2PHYA 5F1GA 5HWTA 1WYBA 1SKFA 3RTYA 3A3FA 1IKIA 1TS8A 2K2NA 5CTNA 4KZ3A 4UA7A 1K0KA 4LV1A 2J3TC 2HP6A 2X71A 4JF6A 2E8IA 2V1ZA 5TBMA 4I3JA 1LLBA 2V9AA 5DTKA 4GCZA 5G4ZA 3FYZA 3OZHA 4ZRRA 3QP6A 1PFLA 3C7VA 1PZPA 1EWZA 5HWVA 2WYXA 3V3RA 3OPPA 2LB9A 2Y59A 2OOLA 2V1AA 2W0NA 4LV2A 5HW3A 4B4ZA 4I38A 3LEQA 3SW1A 2HDRA 2HJEA 2LB5A 1Y4OA 3PBNA 2FFYA 3VP4A 3G32A 5TBMB 1QMFA 4EEUA 2W27A 2M7UA 2J80A 5HAIA 5HAPA 1NRFA 2PR6A 2UV0E 2HJ9C 1D06A 4B93A 4BD1A 2XR0A 4U3TA 4QWOA 1ODVA 4KZ8A 1IFQA 3F1OB 1WYCA 4E3OA 5E2FA 1DJBA 2XDMA 3NCKA 2PYPA 4UQIS 3LFVA 1T1CA 4IVIA 2XK1A 3VFHA 3UB6A 5EM0A 3GVBA 3BQ8A 3MQOA 3A3EA 2Y2LA 3G2YA 1XJ6A 1MKIA 5FAOA 3DW0A 2QWSA 5KSHA 4Y0UA 3TRCA 3KSGA 1N4OA 2BTFP 3VE4A 3K3CA 3DWKA 2J7VA 3F1NB 2A24A 2ZLYA 4GHIA 5FAQA 2XD5A 3OCLA 4EW7A 3NIAA 3WS1A 1BULA 1W7FA 1ESIA 5EECA 3WS0A 1LI0A 2V1BA 5DF7A 3LY4A 4KQQA 1K4FA 4MEZA 4Z1WA 4R6LA 4Y0OA 3E4OA 4QB8A 3VMAA 4ME4A 3OCNA 4X55A 3MSHA 1PW8A 3IWIA 3HUMA 4ZAMA 4S2PA 1P97A 1YMSA 4N9LA 3FPWA 4PM8A 3UPPA 3DTIA 4KZBA 3BFCA 3QHYA 2YKFA 3M2KA 4MBKA 4HBTA 4Y0TA 4KQDA 4HEFA 1G6OA 3QNBA 1LI9A 4Q8IA 5HD3A 2WKEA 3FZCA 1LHYA 5U47A 3CZDA 3WWXA 5CHUA 5KMWA 5E2HA 2DMWA 1S4SA 3P7NA 4Y5FA 3ZG7B 4BBVA 1Q2PA 5HARA 3S7OA 4MDZA 1YMXA 1K57A 4EU0A 1UWPX 1JTDA 2RCXA 4DF6A 3HBRA 5HX9A 2MJ6A 1D1JA 2XGNA 1CJFA 4OPZA 2J3WA 1S67L 1CF0A 2G2WA 2W3HA 1MXOA 1EW0A 4HH3A 5EVEA 3PR6A 3LYXA 2EX2A 5CTMA 1KGGA 1F5MA 5FQMA 2KOIA 2P08A 4R3JA 4CLCE 5HD5A 1W79A 1XFQA 4WZ4A 2OWHA 3SS5A 1OJGA 1DJAA 2PU2A 3WS5A 5DVAA 5AQ7A 4WMCD 5E43A 2ZQAA 1SDNA 2JKRM 1GCEA 4ARZB 3IHBA 1JVJA 2PAVP 4WUJA 3S22A 5HL1A 4QY6A 2P7JA 4IEDA 3ZHHA 4P85A 2D02A 2M7VA 4E6WA 2QJ5A 1QMEA 1PI5A 4L9EA 3LR4A 1WE4A 3QP1A 2V0WA 3SS4A 4FH2A 2OLUA 2IA2A 3EEAA 1PYYA 1STZA 3A0VA 1K55C 4I39A 3BYDA 5FASA 2H0YA 4FH4A 3D72A 4EETB 2Y2NA 5EVIB 4EEPA 3FWLA 3A0SA 3RXXA 4BBTA 5FQ9A 1Z6FA 4RVAA 2ZC3B 4UHUA 3DBAA 1LL9A 3HREA 4NXBA 1RCJA 4F3LB 3LIAA 2VV7A 5AQBA 4KZ6A 4CLCB 4B9OA 2EWWA 4DJ3A 4OOYA 4O01A 2WKHA 5DF8A 1PZOA 5L2FA 2I72A 2JKRI 2M1CA 3EQUA 4MMNA 5FDSA 1Q2QA 1HLUP 3WS4A 1T1AA 4NXGA 3IF6A 3MZFA 3PBSA 4HOIA 2W3EA 2ZQDA 1MC0A 3D9YA 2WAFA 5IU1A 5CECA 1OJ5A 5G4YA 2PR5A 1XP4A 3LIFA 4WN5A 3PBQA 1VB6A 4S2NC 1BT5A 4KUKA 3NOPC 4UQIM 3IH8A 1IEMA 3SH9A 4ZBEA 5CXWA 2ZM8A 1YLTA 5FI7A 4GD8A 4C75A 4EXOA 1FSYA 3T4SA 2A49A 2JKTM 3EGDC 2Q0OA 1ONGA 4HJ4A 4EBPA 4GS9A 2DNSA 5FQQA 4RX3A 3ITBA 1N9OA 1NYMA 4XT2A 4R38A 1N9LA 1IYOA 3GQZA 4E3LA 1PW1A 4BL2A 3AGFA 1V9YA 1W63Q 4Y3IA 4P6BA 3MF0A 1MWSA 4G3VA 5FI2A 2Q9MA 4JGRA 4M4XA 2W3DA 3UY6A 3GR2A 2G7UA 1CK3A 1GSXA 3VP3A 1KVMA 4PPRA 3HJKA 1S1YA 4JGPA 5EVID 2OAP1 2Y2IA 5GHZA 3VE3A 3T1RA 4GZBA 4XT2B 1XX2A 4R23A 2V20A 3C2WA 4BMWA 3LR5A 2ZQ9A 1NZUA 4MN5A 3ISGA 1F98A 4CLCD 1E25A 5AVFA 5J4EA 4H6JA 4HJ6A 4HBUA 5E2EA 3HUOA 3C38A 2JE5A 4BJPA 2JKTI 1NZOA 3O5YA 2C6WB 4HJ3A 4DKIA 1H8MA 3ZCZA 3LR3A 1I2SA 2IWDA 3IX3A 5JYPA 1H8ZA 4WZ5A 1JWZA 3MBZA 4L9FA 4IUKA 5FQJA 4C6YA 1YT4A 1F9IA 2D01A 2O9CA 2OAQ1 1U60A 3H7WA 2B02A 4ZJ2A 3HL9A 2BG1A 3GV9A 3NI9A 4GLQA 3FG8A 5A93A 1H8YA 1LL8A 4OPYA 2EFXA 3N4IA 4LRZE 3HLGA 4XXRA 3SH7A 1NYYA 3W4QA 3PYPA 4N1XA 4NK3A 1VETB 2OSUA 3CHWP 3BFGA 5AQAA 4GDBA 2O0YA 1FCOA 2PU4A 3VSLA 4R3BA 1YLYA 3QP5A 1BTLA 1FCMA 4EESA 2Y2QA 4XUZA 4NEED 4NETA 4RX2A 3T4JA 2UWXA 4X25A 1YPRA 2NUTC 3K2NA 2Y2MA 1ERQA 1HD8A 1NWZA 3CLOA 5A8BA 3MKFA 1L0GA 1J3WA 2GJ3A 2VV8A 1G68A 2PRFA 4I5SA 3LI9A 1ES5A 2EX8A 3D3OA 3B3XA 4O7DA 3PBTA 1GHPA 2VGLS 1LL5A 5AQ9A 4F94A 3G2ZA 4JXWA 3TE8A 4ETXA 1N9NA 3ZG9B 3F1OA 5E2GA 1G28A 1ES4A 1GHIA 3SS3A 5A91A 4B4XA 3MMHA 3BFEA 2XD1A 5DJUA 4OQIA 1GSVA 4JXGA 2L4RA 2VJWA 4BBUA 2J9PA 1X0OA 3MZDA 2EFUA 2ZOIA 4PM6A 1F2KA 4NXEA 2Z6DA 1K57C 3G34A 5J3WA 1OTIA 1KE0A 1P9RA 4P6ZS 4KZ7A 3F1NA 2H0TA 4WMCA 3MXSA 2NUPC 1KOUA 2B95A 1DP8A 2VEAA 2W1RA 4BL3A 4N1HA 3KO6A 2Y4AA 4CJNA 3IT9A 3E2KA 3BWLA 5L10A 3NOTC 3CAXA 5EVLA 3W4OA 5F69A 4HNBA 1YSQA 3VOZA 5FATA 5G18A 3JVVA 5HDCA 2Y8HA 3UE1A 1MZUA 4WLAA 3UMDA 2EA9A 1FOFA 3V67A 4LCLA 2ACGA 3IX4A 3IWQA 1PIOA 4Y7PA 1L0FA 3O87A 3UE6A 1MPLA 4P0MA 1K6RA 1W63M 4EV4A 3A3JA 1ERMA 1GA9A 4MCWA 2V2FF 4FOFA 1YKDA 4B88A 4CLCC 4MBHA 2WADA 2HV1A 4PAUA 1HZOA 1ES3A 2VGJA 3HUNA 3EGXC 4PKYA 4WL9A 1TS0A 2FZ0A 2IWCA 4BWIA 1KGEA 5FI6A 1YLPA 3PBOA 4FTXA 3QP2A 4JGOA 2Y79A 3EWKA 1UGUA 3S1YA 4WF0A 2ZL1A 3F1PB 1IYSA 4Y13A 2P74A 4Y15A 5AJGA 1K56D 1OT6A 3JVUA 2R78A 3VP0A 1BSGA 3DTMA 1OTAA 3NY4A 4DE2A 2CMNA 1LSWA 2WGIA 1M40A 4IUHA 4RQ9A 4EERA 1L2SA 4QJGA 4KZ9A 4JGQA 1ALQA 3IF6C 4GB7A 5CGWA 4DRTA 5EE8A 4ARZA 3T12B 3M6BA 3CI6A 3UNWA 2QHKA 2QZ6A 3KSFA 1NRJA 2ZL1B 4WYYA 3ZNYA 2WK0A 3OOVA 2EXBA 1CI8A 3SOIA 3L7HA 3FPVA 3D4FA 4GKUA 1ACFA 5DKKA 4C3QA 3IF5A 3NOUC 4EQ1A 1O07A 2CC1A 2EX6A 3NDEA 2P9VA 5DTTA 3CITA 2QKPA 3QNCA 4KQRA 5EFWA 3OC2A 2B5RA 3H9WA 2KX6A 1KE3A 3DTKA 5EVIA 4OQHA 2HZ5A 1JTGA 3C30A 1EROA 4DN0A 3T4OA 4HP4A 3BRMA 4U0XA 3A3IA 5GHXA 1Z09A 2K31A 4N92A 1OTEA 2Y2GA 4S2MA 1KVLA 1TS7A 5CX7A 1TDGA 4F3LA 2Q9NA 3DWZA 4X1LA 1XJ4A 3E2LA 4CLCA 1VQQA 3V39A 1V9ZA 2YKHA 3L9KA 4Y17A 1SKOB 4EUZA 3PBRA 4MBFA 2JKGA 2P9VB 3ITAA 3MXRA 1BLHA 5EOEA 5F6AA 3IXDA 3MQ0A 3SZTA 1MWTA 3GMWA 4KG6A 4UAAA 1I2WA 4GOGA 3CWFA 3PAGA 5EV0A 4UA6A 2VGLM 1T1BA 3R4KA 3HVFA 2ZD8A 5J8XA 4N9KA 4ETZA 3UN7A 3UPOA 2FFFB 2WKRA 2G2UA 4KG2A
chains in the Genus database with same CATH topology
4ZRRA 1OT9A 4XT2B 5HWVA 3C2WA 1TF1A 4BMWA 3LR5A 3E4QA 4EUVA 3P01A 4OOLA 4MN5A 2LB9A 1F98A 4WEKA 4CLCD 2XROA 2OOLA 1TS6A 2V1AA 5AVFA 5HSQA 2W0NA 4NKPA 5J4EA 3C8CA 3LR0A 4H6JA 4HJ6A 1LT0A 2QJ7A 3C38A 1UWNX 4I38A 1DRMA 3SW1A 4BJPA 2JKTI 5L8MA 2HJEA 2LB5A 3O5YA 2JN7A 1JNUA 1D7EA 4HJ3A 3PBNA 5DJTA 5TBMB 2XA7S 1H8MA 4EEUA 1P9WA 3RH8B 2W27A 3ZYTA 2FH5A 4P6ZM 2J80A 2M7UA 3LR3A 3UB9A 4LRXC 2PR6A 3VV4A 1T19A 2PDRA 2HJ9C 1D06A 4L0LA 4L9FA 4IUKA 3GDIA 2KDKA 4B93A 2I9VA 1F9IA 4HI4A 2D01A 2O9CA 2OAQ1 4CQHA 3H7WA 1ODVA 2B02A 5F5YA 1IFQA 4WELA 3F1OB 4NXFA 4HP9A 4YWZA 4GLQA 3FG8A 4MN7A 4L9GA 2PYPA 4UQIS 3LFVA 1LL8A 3T4LA 1T1CA 3BJNA 4OOMA 5HPFA 1XJ3A 3UB6A 3BQ8A 4LRZE 3S7QA 3MQOA 3ZQ5A 1XJ6A 4IHQA 4PKYG 3PYPA 2QWSA 5KSHA 3S7NA 3TRCA 3KSGA 3G6OA 3LIDA 3TJZC 3E98A 2OWJA 3VE4A 3K3CA 1ZTUA 2O0YA 4HY8A 4Q0JA 2EWVA 3F1NB 2A24A 4GHIA 3OCLA 4EW7A 2XRNA 3T4QA 3KYZA 4EESA 3HJIA 5DKLA 4NEED 3T4JA 2V1BA 4Z1WA 3K2NA 2NUTC 3E4PA 4R6LA 1GSWA 3E4OA 1NWZA 3CLOA 5A8BA 1YAXA 3E0YA 4ME4A 3OCNA 1XJ2A 2GJ3A 1ZHHB 2VV8A 4LLOB 5HPIA 2PT7A 2VKSA 4I5SA 3IS2A 1NLYA 3LI9A 2VA0A 3IBRA 1P97A 3LIBA 2ZBBA 3D3OA 3FPWA 2GX5A 4LPZA 3PBTA 4GJ4A 2VGLS 1WA9A 3H82B 3LUQA 2YKFA 3TE8A 4ETXA 3B47A 1N9NA 4R3AA 4KQDA 3KSIA 1T18A 2W3FA 4O8GA 1XFNA 1G6OA 2L0WA 3F1OA 4HHDA 3UB8A 1P0ZA 1G28A 2HF6A 3MMHA 2P04A 1MKMA 5DJUA 5HD3A 3UB7A 3BY8A 1GSVA 1IOUA 2VV6A 2L4RA 2VJWA 4BBUA 1LSVA 1X0OA 1Y28A 3NHQA 2ZOIA 2WKPA 5F68A 4R70A 2DMWA 1S4SA 3P7NA 4Y5FA 4NXEA 3IS2B 2Z6DA 4G3WA 4Y2FA 4BBVA 5J3WA 1OTIA 3S7PA 3S7OA 4MDZA 3K3DA 4MN6A 1S4RA 1P9RA 4P6ZS 3F1NA 1OPXA 1DP6A 4O0PA 2GZAA 2J3TD 2ZMVA 2NUPC 4EU0A 1KOUA 1NLZA 1UWPX 2QYBA 3CUEC 1DP8A 2VEAA 2O99A 2MJ6A 2W1RA 2O9BA 2J3WA 1S67L 2W1TB 3KO6A 3R7WA 3LIEA 3ULFA 2W3HA 2HGVA 1EW0A 3BWLA 3NOTC 5DF9A 3CAXA 4HH3A 2O9AA 3PR6A 5DFYA 3LYXA 5HZHA 3VOLA 2JHEA 2KLIA 1F5MA 5F69A 4HNBA 1YSQA 2KOIA 2P08A 3JVVA 5HDCA 2Y8HA 4CLCE 5HD5A 3EQVA 1MZUA 4WLAA 3UMDA 2EA9A 3PXPA 3V67A 3H82A 1XFQA 5HL6A 2OWHA 3MXQA 1OJGA 3MQQA 3UE6A 4PHTA 2PD8A 3UE3A 3T4KA 4HH2A 2JKRM 3GECA 3B42A 1DP9A 4Q0IA 1W63M 4UEYA 4ARZB 4WUJA 2VZWA 3R7WB 4MCWA 4FOFA 1YKDA 2P7JA 4CLCC 3LI8A 2HV1A 4PAUA 2D02A 2M7VA 2QJ5A 4AFIA 4I3AA 3MR0A 4L9EA 3LR4A 2ZMFA 2VX8A 2XSSA 3BQAA 2V0WA 2BASA 3BY9A 2Z6CA 3EGXC 4PKYA 3EEAA 2IA2A 4KUOA 2W3GA 4WL9A 1STZA 1TS0A 4E04A 3A0VA 2FZ0A 4I39A 4YOFA 5TJJA 2PD7A 2GNXA 4BWIA 5DFXA 2K7SA 3D72A 3PBOA 2B18A 4JGOA 1S1ZA 2Y79A 4EETB 3MJQA 4EEPA 3EWKA 2W1TA 1UGUA 2A2LA 3A0SA 4WF0A 4GS9B 4BBTA 3F1PB 4WEJA 4YNRA 5AJGA 3TW8A 2H28A 1OT6A 5IS1A 3JVUA 3DBAA 2R78A 4NXBA 4F3LB 3LIAA 2VV7A 4CLCB 4B9OA 3KX0X 2EWWA 1OTAA 3EOIA 4DJ3A 3KSHA 2CMNA 1LSWA 4GW9A 4O01A 2L1MA 4IUHA 4RQ9A 4EERA 3KYQA 3ICYA 4HQAA 4JGQA 3B33A 3FC7A 2JKRI 2V0UA 2M1CA 3EQUA 4MMNA 2ZOHA 5LBRA 4ARZA 4Q0HA 1YSPA 1T1AA 2XA7M 3CI6A 4NXGA 3T4TA 2QHKA 5AVEA 3CUEA 2WKQA 3KSFA 3PBSA 1NRJA 2INWA 4HOIA 2W3EA 4DMZA 3HCYA 1MC0A 3OOVA 1S66L 5IU1A 3W2ZA 4FSFA 5I5LA 1OJ5A 5G4YA 2PR5A 3UMEA 3NJAA 3LIFA 3FPVA 4WN5A 3PBQA 4II7A 1VB6A 4KUKA 5K5BA 3NOPC 5DKKA 4UQIM 3NOUC 4EQ1A 5C5KA 5FL3A 2VLGA 4KQOA 3BW6A 3CITA 2QKPA 4DJ2A 5EFWA 4H6JB 3OC2A 3H9WA 2PYRA 2KX6A 4EXOA 4IJGA 3T4SA 2JKTM 3EGDC 4HJ4A 3C30A 3U2AA 3A0RA 4LRYC 4DN0A 3T4OA 4GS9A 4G3KA 1BYWA 4HP4A 3F1PA 4I3IA 3OLOA 5IT5A 2K31A 3MFXA 1N9OA 1OTEA 4QPRA 3EEHA 4XT2A 1TS7A 1OTDA 5CX7A 4R38A 3OBFA 1N9LA 4F3LA 5KIZA 3H7WB 2PHYA 1XJ4A 5HWTA 4CLCA 1V9ZA 1OTBA 5HDSA 2YKHA 3RFBA 3LICA 1V9YA 1TD5A 1LSXA 1W63Q 4Y3IA 3RTYA 3MF0A 3PBRA 5HWWA 4K08A 4G3VA 1TS8A 2K2NA 1H3QA 2J3TC 3PHYA 4JGRA 4M4XA 5F6AA 2W3DA 3MQ0A 2G7UA 1VHMA 4HIAA 5J7EA 5MC7A 5HDDA 5TBMA 1GSXA 3T50A 3CWFA 3HJKA 3IBJA 1S1YA 4I3JA 2VGLM 1T1BA 2V9AA 4JGPA 2OAP1 3R4KA 4GCZA 5G4ZA 4ETZA 2A24B 4GHIB 2WKRA 3VE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRR A;  4Q0H A;  1YSP A;  3E0Y A;  4ME4 A;  5HL6 A;  3CI6 A;  3C2W A;  1TF1 A;  5HPI A;  2VKS A;  3KSF A;  4EUV A;  3IBR A;  2W3E A;  2LB9 A;  3D3O A;  4DMZ A;  3HCY A;  2GX5 A;  1MC0 A;  3OOV A;  2XRO A;  2OOL A;  3W2Z A;  5I5L A;  5HSQ A;  4Q0I A;  2VZW A;  5L8M A;  5K5B A;  3O5Y A;  2LB5 A;  4MCW A;  3NOP C;  4ETX A;  4FOF A;  1YKD A;  3NOU C;  3KSI A;  5C5K A;  2W3F A;  4O8G A;  4PAU A;  2M7U A;  2M7V A;  3CIT A;  4LRX C;  3MMH A;  3VV4 A;  2ZMF A;  2XSS A;  1MKM A;  4IUK A;  4IJG A;  2O9C A;  3EEA A;  2IA2 A;  4CQH A;  2W3G A;  4LRY C;  4DN0 A;  2VJW A;  1STZ A;  4G3K A;  4E04 A;  3NHQ A;  4YOF A;  5TJJ A;  4GLQ A;  4R70 A;  4Y5F A;  4MN7 A;  4BWI A;  4G3W A;  4Y2F A;  3LFV A;  5DFX A;  2K31 A;  3BJN A;  3S7P A;  3S7O A;  5HPF A;  4MDZ A;  2B18 A;  4QPR A;  2Y79 A;  4LRZ E;  3OBF A;  3S7Q A;  4O0P A;  2W1T A;  3ZQ5 A;  4EU0 A;  2QYB A;  4YNR A;  3KSG A;  3RFB A;  3S7N A;  3TRC A;  1TD5 A;  5AJG A;  4Y3I A;  3G6O A;  2VEA A;  3MF0 A;  3E98 A;  2O99 A;  3DBA A;  2W1R A;  4G3V A;  2O9B A;  2K2N A;  2O0Y A;  1ZTU A;  4Q0J A;  2W1T B;  3KO6 A;  2W3D A;  2W3H A;  2HGV A;  3MQ0 A;  2G7U A;  1VHM A;  3NOT C;  2XRN A;  3KSH A;  2O9A A;  4GW9 A;  4O01 A;  5DFY A;  3IBJ A;  2KLI A;  1F5M A;  4IUH A;  1YSQ A;  4RQ9 A;  2KOI A;  3R4K A;  4Z1W A;  3K2N A;  2Y8H A;  4ETZ A;  4R6L A;  5LBR A;  4MMN A; 
#chains in the Genus database with same CATH topology
 1OT9 A;  3M2J A;  5CHM A;  1NXY A;  4QD4 A;  1TF1 A;  2H10 A;  2ZJ9 A;  3IX8 A;  3O3V A;  3E4Q A;  4EUV A;  4X69 A;  4OOL A;  4XUX A;  2ZQ7 A;  3P98 A;  4PM9 A;  5HSQ A;  2XFS A;  4E3I A;  2WKI A;  1SCW A;  1MWU A;  2QJ7 A;  1UWN X;  1W8Y A;  2BLS A;  3IHA A;  2JN7 A;  1JNU A;  4EBN A;  3DTE A;  4WZ5 C;  4FCF A;  4YFM A;  4Z9Q A;  3HLE A;  4P6Z M;  1ZKJ A;  4P87 A;  3UB9 A;  5CGX A;  4LRX C;  4ZTK A;  2HDS A;  3VV4 A;  1T19 A;  2PDR A;  4L0L A;  3GDI A;  2KDK A;  2I9V A;  4OLG A;  3SH8 A;  1ZG6 A;  3HLW A;  4CQH A;  5F5Y A;  4K91 A;  3G4P A;  4HP9 A;  4DXC A;  4YWZ A;  1XGJ A;  2XEP A;  4MN7 A;  4L9G A;  4RA7 A;  3ZDJ A;  5HPF A;  1XJ3 A;  2XH9 A;  2AVX A;  4DE3 A;  1SZV A;  3MKE A;  3AGE A;  3ZQ5 A;  4IHQ A;  4PKY G;  3S7N A;  3TSG A;  2A3U A;  1W8Q A;  1FQG A;  1M6K A;  3G6O A;  3E98 A;  4IVK A;  1A0K A;  4OKP A;  1PI4 A;  1RGZ A;  4S2K A;  3S4X A;  5M19 A;  4HY8 A;  4Q0J A;  5FA7 A;  4CPK A;  1Y54 A;  1RGY A;  2XRN A;  3T4Q A;  3WRZ A;  3KYZ A;  1I5Q A;  2WZX A;  3MS6 A;  1FIK A;  3HJI A;  4S2O A;  1L0E A;  1C3B A;  4X6T A;  3Q81 A;  3E4P A;  3JPU A;  3Q7V A;  4LV3 A;  1GSW A;  1BLC A;  4RYE A;  3NC8 A;  4LFU A;  5L09 A;  2PT7 A;  3IS2 A;  3HLD A;  2ZBB A;  2GX5 A;  4S2L A;  3NDG A;  2X02 A;  4GJ4 A;  1WA9 A;  3H82 B;  2EX9 A;  2HP9 A;  4IBR A;  4ZJ3 A;  1BLS A;  5EM1 A;  3B47 A;  3Q82 A;  3BLM A;  5CEB A;  4R3A A;  1PWD A;  1T18 A;  2W3F A;  1XFN A;  2L0W A;  3UB8 A;  2VGK A;  5GLB A;  2XF3 A;  1IYP A;  1E3U A;  3Q7V B;  3UB7 A;  3CPT B;  2RL3 A;  3BY8 A;  3BFD A;  1IOU A;  4JKT A;  1LSV A;  1Y28 A;  3NHQ A;  5F68 A;  2WKP A;  5F83 A;  3IS2 B;  1VET A;  4G3W A;  4Y2F A;  3S7P A;  1RP5 A;  1E4D A;  1K6S A;  3K3D A;  5EPH A;  4MN6 A;  1S4R A;  4JBF A;  4JF5 A;  3UDI A;  1OPX A;  4O0P A;  3ZG0 A;  5GHY A;  5JYO A;  2WAE A;  2OLV A;  3G35 A;  1NLZ A;  3CUE C;  5FSR A;  2WZZ A;  2O99 A;  4R1G A;  2O9B A;  3MFD A;  2W1T B;  3R7W A;  3LIE A;  3ULF A;  4EBL A;  3CG5 A;  2JCH A;  1K4E A;  4ESP A;  5FEF A;  2Z2M B;  5EOO A;  4E3M A;  1BZA A;  1KE4 A;  3UPN A;  4H8R A;  2Z2L B;  3PXP A;  2JBF A;  1CEF A;  3T1Q B;  3MXQ A;  3HLF A;  4MLL A;  3KYE A;  1IKG A;  1YLJ A;  4K0X A;  5TR7 A;  2PD8 A;  3UE3 A;  1FIL A;  3T4K A;  3M6H A;  4Q0I A;  1DP9 A;  3FKW A;  5FDH A;  3WS2 A;  3QP4 A;  4FUW A;  1G6A A;  4A5R A;  3ZFZ A;  1K56 A;  3ZVT A;  3R7W B;  1HVB A;  4S2I A;  4ID4 A;  4WBG A;  3G31 A;  2J9O A;  3ZNT A;  3BQA A;  5TGF A;  3ZG8 B;  4KUO A;  2W3G A;  3BLS A;  5TFQ A;  2ZQC A;  2H5S A;  4LGW A;  4DXB A;  2ZQ8 A;  4YOF A;  1CEG A;  2WGW B;  3FV7 A;  3QP8 A;  2K7S A;  2B18 A;  1PWG A;  3MJQ A;  2R9X A;  3P09 A;  4UA9 A;  4WEJ A;  1ZC2 A;  3LO7 A;  2J8Y A;  1S0W A;  4R4R A;  2H28 A;  4X56 A;  1NJ4 A;  2DRW A;  3UDF A;  2Y2O A;  3I7J A;  3KX0 X;  2QPN A;  1O7E A;  1XGI A;  3EOI A;  4BEN A;  3IXB A;  2X01 A;  2L1M A;  5KZH A;  3ICY A;  3HLB A;  4D2O A;  4OH0 A;  4Q0H A;  1YSP A;  3T4T A;  5AVE A;  2XFT A;  2WKQ A;  3CUE A;  1YLW A;  2INW A;  2ZC7 A;  2ZC5 B;  3N6I A;  4DDS A;  4DMZ A;  3HCY A;  3U4L P;  1E3U D;  1S66 L;  3W2Z A;  2R9W A;  2ZC4 B;  4PMA A;  1TVF A;  4BD0 A;  5K5B A;  2ZM2 A;  4E3N A;  5EVI C;  3BW6 A;  4DJ2 A;  1CI9 A;  2PYR A;  5F82 A;  3Q7Z A;  3LEZ A;  3U2A A;  1N9B A;  4G3K A;  4KZA A;  3F1P A;  3N8R A;  1DY6 A;  4OVD A;  3OPH A;  4I3I A;  2Y91 A;  4JXV A;  5DTS A;  4ZJ1 A;  5IT5 A;  1PNE A;  4QPR A;  1XXM A;  1OTD A;  5M18 A;  3G30 A;  5KIZ A;  1GHM A;  1S6R A;  1OTB A;  5HDS A;  4PM7 A;  3RFB A;  1W5D A;  3LIC A;  1TD5 A;  1LSX A;  5HWW A;  4K08 A;  3UE0 A;  1H3Q A;  3PHY A;  1PRQ A;  1L0D A;  4E3J A;  1VHM A;  4HIA A;  5J7E A;  5MC7 A;  5HDD A;  3T50 A;  5EUA A;  1IYQ A;  4S2J A;  5CRF A;  3IBJ A;  3C4O A;  1SDE A;  1BLP A;  1FSW A;  4KZ5 A;  4DE0 A;  1H0M A;  2A24 B;  2XQZ A;  4GHI B;  1YLZ A;  1NY0 A;  1J9M A;  3C7U A;  1MBL A;  2VK3 A;  2ZMA A;  4YIN A;  1K38 A;  3P01 A;  2ZM0 A;  4WEK A;  2XRO A;  1TS6 A;  4NKP A;  3C8C A;  3LR0 A;  1LT0 A;  4JPM A;  5HAQ A;  1DRM A;  5L8M A;  1VM1 A;  1D7E A;  3C5A A;  5GL9 A;  3BM6 A;  5DJT A;  3Q1F A;  2XA7 S;  4BQM A;  1P9W A;  3RH8 B;  3ZYT A;  2FH5 A;  2QMI A;  4KG5 A;  2ZC6 B;  3AGD A;  4GDN A;  1FR6 A;  4HI4 A;  2V8F A;  2JC7 A;  4WEL A;  4NXF A;  5L07 A;  3IWO A;  3TG9 A;  1SKO A;  2WUQ A;  5F1F A;  3T4L A;  3BJN A;  4OOM A;  3GRJ A;  5FQI A;  3PTE A;  3S7Q A;  5BOH A;  2Y2H A;  3TJZ C;  3LID A;  4JXS A;  4KEN B;  1K54 C;  2JKF A;  3ZGA B;  4R4S A;  2OWJ A;  3OPL A;  3VP2 A;  1ZTU A;  1K25 A;  4IBX A;  2EWV A;  5GLC A;  5FQK A;  4LV0 A;  3O88 A;  5M1A A;  4OON A;  5DKL A;  2C5W B;  1MY8 A;  3OPR A;  4NG2 A;  1G5U A;  1DJC A;  3Q07 A;  5GLA A;  1YAX A;  3E0Y A;  4R0Q A;  1XJ2 A;  1FCN A;  5CHJ A;  1ZHH B;  4LLO B;  2GDN A;  5HPI A;  1VEU A;  2VKS A;  2Y2P A;  1NLY A;  2VA0 A;  4JF4 A;  3IBR A;  3LIB A;  3C4P A;  3W4P A;  4LPZ A;  3IXG A;  3N8S A;  4MNR A;  2HDU A;  4X68 A;  1ONH A;  2PBD P;  1TDL A;  3LUQ A;  1KDS A;  5A90 A;  3DAV A;  4X53 A;  3UB5 P;  3A3D A;  3KSI A;  4O8G A;  4HHD A;  4D60 A;  1P0Z A;  3V50 A;  4GD6 A;  2HF6 A;  2P04 A;  3IQA A;  1MKM A;  5FAP A;  4EWF A;  3UDX A;  2VV6 A;  2HDQ A;  4HES A;  4LEN A;  1VEU B;  4R70 A;  4QY5 A;  4OLD A;  3GTC A;  1BUE A;  1AWI A;  3CMZ A;  3BEB A;  1H5X A;  1DP6 A;  2GZA A;  5FEG A;  2J3T D;  2ZMV A;  4OP8 A;  5CER A;  3T1X A;  1YQS A;  1ZG4 A;  2QYB A;  4DDY A;  4ZDX A;  1JWV A;  2PBY A;  3BFF A;  2HGV A;  4KZ4 A;  5DF9 A;  2O9A A;  5DFY A;  5HZH A;  3VOL A;  2JHE A;  2KLI A;  3LGO A;  1EI5 A;  5CED A;  1XPB A;  1XA7 A;  3V5M A;  1GA0 A;  2OV5 A;  3EQV A;  2HPB A;  3H82 A;  5HL6 A;  4LCM A;  3MQQ A;  3RJU A;  4GNU A;  1K54 A;  5A92 A;  1TEM A;  1JWP A;  4PHT A;  1MWR A;  4HH2 A;  3GEC A;  3B42 A;  4EQI A;  4UEY A;  3TOI A;  2WGV A;  3ZG5 A;  3BEC A;  2Y2J A;  2DCF A;  2VZW A;  3T1S A;  3LCE A;  3CPT A;  3IF6 B;  4E3K A;  3LI8 A;  2V8C A;  4QU3 A;  3UO9 A;  4X1M A;  3ZVW A;  4AFI A;  4I3A A;  3MR0 A;  4WM9 A;  2ZMF A;  1IEL A;  1AXB A;  2VX8 A;  2XSS A;  4OP5 A;  3GSG A;  4GN2 A;  1ES2 A;  2BAS A;  3BY9 A;  2Z6C A;  3NUL A;  1KDW A;  1L3L A;  4E04 A;  2XLN A;  5TJJ A;  2PD7 A;  2GNX A;  4PM5 A;  4OPR A;  5CGS A;  1HTZ A;  5DFX A;  1ESU A;  1S1Z A;  1K55 A;  4DE1 A;  4OQ0 A;  2W1T A;  2A2L A;  1KGF A;  4GS9 B;  3IXH A;  3JYI A;  3NEC A;  3W8K A;  4YNR A;  2IWB A;  3TW8 A;  5IS1 A;  3HLC A;  1FR1 A;  3VOY A;  4BLM A;  3KSH A;  4GW9 A;  3KYQ A;  4HQA A;  3B33 A;  3FKV A;  4FD8 A;  3FC7 A;  2V0U A;  5LBR A;  1SHV A;  2ZOH A;  2XA7 M;  2Y55 A;  3VSK A;  4M3K A;  4E6X A;  3N8L A;  5HFO A;  5I94 A;  2E8J A;  1XKZ A;  5GLD A;  1CQA A;  4FSF A;  5I5L A;  3UME A;  2EXA A;  1YM1 A;  3NJA A;  3NBL A;  5IHV A;  4II7 A;  5D3O A;  3MZE A;  5C5K A;  5FL3 A;  3RXW A;  3VP1 A;  2VLG A;  4KQO A;  4S2N A;  4U0T A;  2WGW A;  4OQG A;  4H6J B;  3WRT A;  1PWC A;  1OME A;  5KSC A;  3O86 A;  4IJG A;  4QHC A;  3V3S A;  3A0R A;  4LRY C;  4OPQ A;  3IH9 A;  2HP5 A;  3PAE A;  1BYW A;  3CJM A;  4K0W A;  4JLF A;  3VFF A;  3LY3 A;  3OLO A;  3MFX A;  1XA1 A;  3EEH A;  3OBF A;  3H7W B;  2Y2K A;  3N7W A;  2PHY A;  5F1G A;  5HWT A;  1WYB A;  1SKF A;  3RTY A;  3A3F A;  1IKI A;  1TS8 A;  2K2N A;  5CTN A;  4KZ3 A;  4UA7 A;  1K0K A;  4LV1 A;  2J3T C;  2HP6 A;  2X71 A;  4JF6 A;  2E8I A;  2V1Z A;  5TBM A;  4I3J A;  1LLB A;  2V9A A;  5DTK A;  4GCZ A;  5G4Z A;  3FYZ A;  3OZH A;  4ZRR A;  3QP6 A;  1PFL A;  3C7V A;  1PZP A;  1EWZ A;  5HWV A;  2WYX A;  3V3R A;  3OPP A;  2LB9 A;  2Y59 A;  2OOL A;  2V1A A;  2W0N A;  4LV2 A;  5HW3 A;  4B4Z A;  4I38 A;  3LEQ A;  3SW1 A;  2HDR A;  2HJE A;  2LB5 A;  1Y4O A;  3PBN A;  2FFY A;  3VP4 A;  3G32 A;  5TBM B;  1QMF A;  4EEU A;  2W27 A;  2M7U A;  2J80 A;  5HAI A;  5HAP A;  1NRF A;  2PR6 A;  2UV0 E;  2HJ9 C;  1D06 A;  4B93 A;  4BD1 A;  2XR0 A;  4U3T A;  4QWO A;  1ODV A;  4KZ8 A;  1IFQ A;  3F1O B;  1WYC A;  4E3O A;  5E2F A;  1DJB A;  2XDM A;  3NCK A;  2PYP A;  4UQI S;  3LFV A;  1T1C A;  4IVI A;  2XK1 A;  3VFH A;  3UB6 A;  5EM0 A;  3GVB A;  3BQ8 A;  3MQO A;  3A3E A;  2Y2L A;  3G2Y A;  1XJ6 A;  1MKI A;  5FAO A;  3DW0 A;  2QWS A;  5KSH A;  4Y0U A;  3TRC A;  3KSG A;  1N4O A;  2BTF P;  3VE4 A;  3K3C A;  3DWK A;  2J7V A;  3F1N B;  2A24 A;  2ZLY A;  4GHI A;  5FAQ A;  2XD5 A;  3OCL A;  4EW7 A;  3NIA A;  3WS1 A;  1BUL A;  1W7F A;  1ESI A;  5EEC A;  3WS0 A;  1LI0 A;  2V1B A;  5DF7 A;  3LY4 A;  4KQQ A;  1K4F A;  4MEZ A;  4Z1W A;  4R6L A;  4Y0O A;  3E4O A;  4QB8 A;  3VMA A;  4ME4 A;  3OCN A;  4X55 A;  3MSH A;  1PW8 A;  3IWI A;  3HUM A;  4ZAM A;  4S2P A;  1P97 A;  1YMS A;  4N9L A;  3FPW A;  4PM8 A;  3UPP A;  3DTI A;  4KZB A;  3BFC A;  3QHY A;  2YKF A;  3M2K A;  4MBK A;  4HBT A;  4Y0T A;  4KQD A;  4HEF A;  1G6O A;  3QNB A;  1LI9 A;  4Q8I A;  5HD3 A;  2WKE A;  3FZC A;  1LHY A;  5U47 A;  3CZD A;  3WWX A;  5CHU A;  5KMW A;  5E2H A;  2DMW A;  1S4S A;  3P7N A;  4Y5F A;  3ZG7 B;  4BBV A;  1Q2P A;  5HAR A;  3S7O A;  4MDZ A;  1YMX A;  1K57 A;  4EU0 A;  1UWP X;  1JTD A;  2RCX A;  4DF6 A;  3HBR A;  5HX9 A;  2MJ6 A;  1D1J A;  2XGN A;  1CJF A;  4OPZ A;  2J3W A;  1S67 L;  1CF0 A;  2G2W A;  2W3H A;  1MXO A;  1EW0 A;  4HH3 A;  5EVE A;  3PR6 A;  3LYX A;  2EX2 A;  5CTM A;  1KGG A;  1F5M A;  5FQM A;  2KOI A;  2P08 A;  4R3J A;  4CLC E;  5HD5 A;  1W79 A;  1XFQ A;  4WZ4 A;  2OWH A;  3SS5 A;  1OJG A;  1DJA A;  2PU2 A;  3WS5 A;  5DVA A;  5AQ7 A;  4WMC D;  5E43 A;  2ZQA A;  1SDN A;  2JKR M;  1GCE A;  4ARZ B;  3IHB A;  1JVJ A;  2PAV P;  4WUJ A;  3S22 A;  5HL1 A;  4QY6 A;  2P7J A;  4IED A;  3ZHH A;  4P85 A;  2D02 A;  2M7V A;  4E6W A;  2QJ5 A;  1QME A;  1PI5 A;  4L9E A;  3LR4 A;  1WE4 A;  3QP1 A;  2V0W A;  3SS4 A;  4FH2 A;  2OLU A;  2IA2 A;  3EEA A;  1PYY A;  1STZ A;  3A0V A;  1K55 C;  4I39 A;  3BYD A;  5FAS A;  2H0Y A;  4FH4 A;  3D72 A;  4EET B;  2Y2N A;  5EVI B;  4EEP A;  3FWL A;  3A0S A;  3RXX A;  4BBT A;  5FQ9 A;  1Z6F A;  4RVA A;  2ZC3 B;  4UHU A;  3DBA A;  1LL9 A;  3HRE A;  4NXB A;  1RCJ A;  4F3L B;  3LIA A;  2VV7 A;  5AQB A;  4KZ6 A;  4CLC B;  4B9O A;  2EWW A;  4DJ3 A;  4OOY A;  4O01 A;  2WKH A;  5DF8 A;  1PZO A;  5L2F A;  2I72 A;  2JKR I;  2M1C A;  3EQU A;  4MMN A;  5FDS A;  1Q2Q A;  1HLU P;  3WS4 A;  1T1A A;  4NXG A;  3IF6 A;  3MZF A;  3PBS A;  4HOI A;  2W3E A;  2ZQD A;  1MC0 A;  3D9Y A;  2WAF A;  5IU1 A;  5CEC A;  1OJ5 A;  5G4Y A;  2PR5 A;  1XP4 A;  3LIF A;  4WN5 A;  3PBQ A;  1VB6 A;  4S2N C;  1BT5 A;  4KUK A;  3NOP C;  4UQI M;  3IH8 A;  1IEM A;  3SH9 A;  4ZBE A;  5CXW A;  2ZM8 A;  1YLT A;  5FI7 A;  4GD8 A;  4C75 A;  4EXO A;  1FSY A;  3T4S A;  2A49 A;  2JKT M;  3EGD C;  2Q0O A;  1ONG A;  4HJ4 A;  4EBP A;  4GS9 A;  2DNS A;  5FQQ A;  4RX3 A;  3ITB A;  1N9O A;  1NYM A;  4XT2 A;  4R38 A;  1N9L A;  1IYO A;  3GQZ A;  4E3L A;  1PW1 A;  4BL2 A;  3AGF A;  1V9Y A;  1W63 Q;  4Y3I A;  4P6B A;  3MF0 A;  1MWS A;  4G3V A;  5FI2 A;  2Q9M A;  4JGR A;  4M4X A;  2W3D A;  3UY6 A;  3GR2 A;  2G7U A;  1CK3 A;  1GSX A;  3VP3 A;  1KVM A;  4PPR A;  3HJK A;  1S1Y A;  4JGP A;  5EVI D;  2OAP 1;  2Y2I A;  5GHZ A;  3VE3 A;  3T1R A;  4GZB A;  4XT2 B;  1XX2 A;  4R23 A;  2V20 A;  3C2W A;  4BMW A;  3LR5 A;  2ZQ9 A;  1NZU A;  4MN5 A;  3ISG A;  1F98 A;  4CLC D;  1E25 A;  5AVF A;  5J4E A;  4H6J A;  4HJ6 A;  4HBU A;  5E2E A;  3HUO A;  3C38 A;  2JE5 A;  4BJP A;  2JKT I;  1NZO A;  3O5Y A;  2C6W B;  4HJ3 A;  4DKI A;  1H8M A;  3ZCZ A;  3LR3 A;  1I2S A;  2IWD A;  3IX3 A;  5JYP A;  1H8Z A;  4WZ5 A;  1JWZ A;  3MBZ A;  4L9F A;  4IUK A;  5FQJ A;  4C6Y A;  1YT4 A;  1F9I A;  2D01 A;  2O9C A;  2OAQ 1;  1U60 A;  3H7W A;  2B02 A;  4ZJ2 A;  3HL9 A;  2BG1 A;  3GV9 A;  3NI9 A;  4GLQ A;  3FG8 A;  5A93 A;  1H8Y A;  1LL8 A;  4OPY A;  2EFX A;  3N4I A;  4LRZ E;  3HLG A;  4XXR A;  3SH7 A;  1NYY A;  3W4Q A;  3PYP A;  4N1X A;  4NK3 A;  1VET B;  2OSU A;  3CHW P;  3BFG A;  5AQA A;  4GDB A;  2O0Y A;  1FCO A;  2PU4 A;  3VSL A;  4R3B A;  1YLY A;  3QP5 A;  1BTL A;  1FCM A;  4EES A;  2Y2Q A;  4XUZ A;  4NEE D;  4NET A;  4RX2 A;  3T4J A;  2UWX A;  4X25 A;  1YPR A;  2NUT C;  3K2N A;  2Y2M A;  1ERQ A;  1HD8 A;  1NWZ A;  3CLO A;  5A8B A;  3MKF A;  1L0G A;  1J3W A;  2GJ3 A;  2VV8 A;  1G68 A;  2PRF A;  4I5S A;  3LI9 A;  1ES5 A;  2EX8 A;  3D3O A;  3B3X A;  4O7D A;  3PBT A;  1GHP A;  2VGL S;  1LL5 A;  5AQ9 A;  4F94 A;  3G2Z A;  4JXW A;  3TE8 A;  4ETX A;  1N9N A;  3ZG9 B;  3F1O A;  5E2G A;  1G28 A;  1ES4 A;  1GHI A;  3SS3 A;  5A91 A;  4B4X A;  3MMH A;  3BFE A;  2XD1 A;  5DJU A;  4OQI A;  1GSV A;  4JXG A;  2L4R A;  2VJW A;  4BBU A;  2J9P A;  1X0O A;  3MZD A;  2EFU A;  2ZOI A;  4PM6 A;  1F2K A;  4NXE A;  2Z6D A;  1K57 C;  3G34 A;  5J3W A;  1OTI A;  1KE0 A;  1P9R A;  4P6Z S;  4KZ7 A;  3F1N A;  2H0T A;  4WMC A;  3MXS A;  2NUP C;  1KOU A;  2B95 A;  1DP8 A;  2VEA A;  2W1R A;  4BL3 A;  4N1H A;  3KO6 A;  2Y4A A;  4CJN A;  3IT9 A;  3E2K A;  3BWL A;  5L10 A;  3NOT C;  3CAX A;  5EVL A;  3W4O A;  5F69 A;  4HNB A;  1YSQ A;  3VOZ A;  5FAT A;  5G18 A;  3JVV A;  5HDC A;  2Y8H A;  3UE1 A;  1MZU A;  4WLA A;  3UMD A;  2EA9 A;  1FOF A;  3V67 A;  4LCL A;  2ACG A;  3IX4 A;  3IWQ A;  1PIO A;  4Y7P A;  1L0F A;  3O87 A;  3UE6 A;  1MPL A;  4P0M A;  1K6R A;  1W63 M;  4EV4 A;  3A3J A;  1ERM A;  1GA9 A;  4MCW A;  2V2F F;  4FOF A;  1YKD A;  4B88 A;  4CLC C;  4MBH A;  2WAD A;  2HV1 A;  4PAU A;  1HZO A;  1ES3 A;  2VGJ A;  3HUN A;  3EGX C;  4PKY A;  4WL9 A;  1TS0 A;  2FZ0 A;  2IWC A;  4BWI A;  1KGE A;  5FI6 A;  1YLP A;  3PBO A;  4FTX A;  3QP2 A;  4JGO A;  2Y79 A;  3EWK A;  1UGU A;  3S1Y A;  4WF0 A;  2ZL1 A;  3F1P B;  1IYS A;  4Y13 A;  2P74 A;  4Y15 A;  5AJG A;  1K56 D;  1OT6 A;  3JVU A;  2R78 A;  3VP0 A;  1BSG A;  3DTM A;  1OTA A;  3NY4 A;  4DE2 A;  2CMN A;  1LSW A;  2WGI A;  1M40 A;  4IUH A;  4RQ9 A;  4EER A;  1L2S A;  4QJG A;  4KZ9 A;  4JGQ A;  1ALQ A;  3IF6 C;  4GB7 A;  5CGW A;  4DRT A;  5EE8 A;  4ARZ A;  3T12 B;  3M6B A;  3CI6 A;  3UNW A;  2QHK A;  2QZ6 A;  3KSF A;  1NRJ A;  2ZL1 B;  4WYY A;  3ZNY A;  2WK0 A;  3OOV A;  2EXB A;  1CI8 A;  3SOI A;  3L7H A;  3FPV A;  3D4F A;  4GKU A;  1ACF A;  5DKK A;  4C3Q A;  3IF5 A;  3NOU C;  4EQ1 A;  1O07 A;  2CC1 A;  2EX6 A;  3NDE A;  2P9V A;  5DTT A;  3CIT A;  2QKP A;  3QNC A;  4KQR A;  5EFW A;  3OC2 A;  2B5R A;  3H9W A;  2KX6 A;  1KE3 A;  3DTK A;  5EVI A;  4OQH A;  2HZ5 A;  1JTG A;  3C30 A;  1ERO A;  4DN0 A;  3T4O A;  4HP4 A;  3BRM A;  4U0X A;  3A3I A;  5GHX A;  1Z09 A;  2K31 A;  4N92 A;  1OTE A;  2Y2G A;  4S2M A;  1KVL A;  1TS7 A;  5CX7 A;  1TDG A;  4F3L A;  2Q9N A;  3DWZ A;  4X1L A;  1XJ4 A;  3E2L A;  4CLC A;  1VQQ A;  3V39 A;  1V9Z A;  2YKH A;  3L9K A;  4Y17 A;  1SKO B;  4EUZ A;  3PBR A;  4MBF A;  2JKG A;  2P9V B;  3ITA A;  3MXR A;  1BLH A;  5EOE A;  5F6A A;  3IXD A;  3MQ0 A;  3SZT A;  1MWT A;  3GMW A;  4KG6 A;  4UAA A;  1I2W A;  4GOG A;  3CWF A;  3PAG A;  5EV0 A;  4UA6 A;  2VGL M;  1T1B A;  3R4K A;  3HVF A;  2ZD8 A;  5J8X A;  4N9K A;  4ETZ A;  3UN7 A;  3UPO A;  2FFF B;  2WKR A;  2G2U A;  4KG2 A; 
#chains in the Genus database with same CATH homology
 4ZRR A;  1OT9 A;  4XT2 B;  5HWV A;  3C2W A;  1TF1 A;  4BMW A;  3LR5 A;  3E4Q A;  4EUV A;  3P01 A;  4OOL A;  4MN5 A;  2LB9 A;  1F98 A;  4WEK A;  4CLC D;  2XRO A;  2OOL A;  1TS6 A;  2V1A A;  5AVF A;  5HSQ A;  2W0N A;  4NKP A;  5J4E A;  3C8C A;  3LR0 A;  4H6J A;  4HJ6 A;  1LT0 A;  2QJ7 A;  3C38 A;  1UWN X;  4I38 A;  1DRM A;  3SW1 A;  4BJP A;  2JKT I;  5L8M A;  2HJE A;  2LB5 A;  3O5Y A;  2JN7 A;  1JNU A;  1D7E A;  4HJ3 A;  3PBN A;  5DJT A;  5TBM B;  2XA7 S;  1H8M A;  4EEU A;  1P9W A;  3RH8 B;  2W27 A;  3ZYT A;  2FH5 A;  4P6Z M;  2J80 A;  2M7U A;  3LR3 A;  3UB9 A;  4LRX C;  2PR6 A;  3VV4 A;  1T19 A;  2PDR A;  2HJ9 C;  1D06 A;  4L0L A;  4L9F A;  4IUK A;  3GDI A;  2KDK A;  4B93 A;  2I9V A;  1F9I A;  4HI4 A;  2D01 A;  2O9C A;  2OAQ 1;  4CQH A;  3H7W A;  1ODV A;  2B02 A;  5F5Y A;  1IFQ A;  4WEL A;  3F1O B;  4NXF A;  4HP9 A;  4YWZ A;  4GLQ A;  3FG8 A;  4MN7 A;  4L9G A;  2PYP A;  4UQI S;  3LFV A;  1LL8 A;  3T4L A;  1T1C A;  3BJN A;  4OOM A;  5HPF A;  1XJ3 A;  3UB6 A;  3BQ8 A;  4LRZ E;  3S7Q A;  3MQO A;  3ZQ5 A;  1XJ6 A;  4IHQ A;  4PKY G;  3PYP A;  2QWS A;  5KSH A;  3S7N A;  3TRC A;  3KSG A;  3G6O A;  3LID A;  3TJZ C;  3E98 A;  2OWJ A;  3VE4 A;  3K3C A;  1ZTU A;  2O0Y A;  4HY8 A;  4Q0J A;  2EWV A;  3F1N B;  2A24 A;  4GHI A;  3OCL A;  4EW7 A;  2XRN A;  3T4Q A;  3KYZ A;  4EES A;  3HJI A;  5DKL A;  4NEE D;  3T4J A;  2V1B A;  4Z1W A;  3K2N A;  2NUT C;  3E4P A;  4R6L A;  1GSW A;  3E4O A;  1NWZ A;  3CLO A;  5A8B A;  1YAX A;  3E0Y A;  4ME4 A;  3OCN A;  1XJ2 A;  2GJ3 A;  1ZHH B;  2VV8 A;  4LLO B;  5HPI A;  2PT7 A;  2VKS A;  4I5S A;  3IS2 A;  1NLY A;  3LI9 A;  2VA0 A;  3IBR A;  1P97 A;  3LIB A;  2ZBB A;  3D3O A;  3FPW A;  2GX5 A;  4LPZ A;  3PBT A;  4GJ4 A;  2VGL S;  1WA9 A;  3H82 B;  3LUQ A;  2YKF A;  3TE8 A;  4ETX A;  3B47 A;  1N9N A;  4R3A A;  4KQD A;  3KSI A;  1T18 A;  2W3F A;  4O8G A;  1XFN A;  1G6O A;  2L0W A;  3F1O A;  4HHD A;  3UB8 A;  1P0Z A;  1G28 A;  2HF6 A;  3MMH A;  2P04 A;  1MKM A;  5DJU A;  5HD3 A;  3UB7 A;  3BY8 A;  1GSV A;  1IOU A;  2VV6 A;  2L4R A;  2VJW A;  4BBU A;  1LSV A;  1X0O A;  1Y28 A;  3NHQ A;  2ZOI A;  2WKP A;  5F68 A;  4R70 A;  2DMW A;  1S4S A;  3P7N A;  4Y5F A;  4NXE A;  3IS2 B;  2Z6D A;  4G3W A;  4Y2F A;  4BBV A;  5J3W A;  1OTI A;  3S7P A;  3S7O A;  4MDZ A;  3K3D A;  4MN6 A;  1S4R A;  1P9R A;  4P6Z S;  3F1N A;  1OPX A;  1DP6 A;  4O0P A;  2GZA A;  2J3T D;  2ZMV A;  2NUP C;  4EU0 A;  1KOU A;  1NLZ A;  1UWP X;  2QYB A;  3CUE C;  1DP8 A;  2VEA A;  2O99 A;  2MJ6 A;  2W1R A;  2O9B A;  2J3W A;  1S67 L;  2W1T B;  3KO6 A;  3R7W A;  3LIE A;  3ULF A;  2W3H A;  2HGV A;  1EW0 A;  3BWL A;  3NOT C;  5DF9 A;  3CAX A;  4HH3 A;  2O9A A;  3PR6 A;  5DFY A;  3LYX A;  5HZH A;  3VOL A;  2JHE A;  2KLI A;  1F5M A;  5F69 A;  4HNB A;  1YSQ A;  2KOI A;  2P08 A;  3JVV A;  5HDC A;  2Y8H A;  4CLC E;  5HD5 A;  3EQV A;  1MZU A;  4WLA A;  3UMD A;  2EA9 A;  3PXP A;  3V67 A;  3H82 A;  1XFQ A;  5HL6 A;  2OWH A;  3MXQ A;  1OJG A;  3MQQ A;  3UE6 A;  4PHT A;  2PD8 A;  3UE3 A;  3T4K A;  4HH2 A;  2JKR M;  3GEC A;  3B42 A;  1DP9 A;  4Q0I A;  1W63 M;  4UEY A;  4ARZ B;  4WUJ A;  2VZW A;  3R7W B;  4MCW A;  4FOF A;  1YKD A;  2P7J A;  4CLC C;  3LI8 A;  2HV1 A;  4PAU A;  2D02 A;  2M7V A;  2QJ5 A;  4AFI A;  4I3A A;  3MR0 A;  4L9E A;  3LR4 A;  2ZMF A;  2VX8 A;  2XSS A;  3BQA A;  2V0W A;  2BAS A;  3BY9 A;  2Z6C A;  3EGX C;  4PKY A;  3EEA A;  2IA2 A;  4KUO A;  2W3G A;  4WL9 A;  1STZ A;  1TS0 A;  4E04 A;  3A0V A;  2FZ0 A;  4I39 A;  4YOF A;  5TJJ A;  2PD7 A;  2GNX A;  4BWI A;  5DFX A;  2K7S A;  3D72 A;  3PBO A;  2B18 A;  4JGO A;  1S1Z A;  2Y79 A;  4EET B;  3MJQ A;  4EEP A;  3EWK A;  2W1T A;  1UGU A;  2A2L A;  3A0S A;  4WF0 A;  4GS9 B;  4BBT A;  3F1P B;  4WEJ A;  4YNR A;  5AJG A;  3TW8 A;  2H28 A;  1OT6 A;  5IS1 A;  3JVU A;  3DBA A;  2R78 A;  4NXB A;  4F3L B;  3LIA A;  2VV7 A;  4CLC B;  4B9O A;  3KX0 X;  2EWW A;  1OTA A;  3EOI A;  4DJ3 A;  3KSH A;  2CMN A;  1LSW A;  4GW9 A;  4O01 A;  2L1M A;  4IUH A;  4RQ9 A;  4EER A;  3KYQ A;  3ICY A;  4HQA A;  4JGQ A;  3B33 A;  3FC7 A;  2JKR I;  2V0U A;  2M1C A;  3EQU A;  4MMN A;  2ZOH A;  5LBR A;  4ARZ A;  4Q0H A;  1YSP A;  1T1A A;  2XA7 M;  3CI6 A;  4NXG A;  3T4T A;  2QHK A;  5AVE A;  3CUE A;  2WKQ A;  3KSF A;  3PBS A;  1NRJ A;  2INW A;  4HOI A;  2W3E A;  4DMZ A;  3HCY A;  1MC0 A;  3OOV A;  1S66 L;  5IU1 A;  3W2Z A;  4FSF A;  5I5L A;  1OJ5 A;  5G4Y A;  2PR5 A;  3UME A;  3NJA A;  3LIF A;  3FPV A;  4WN5 A;  3PBQ A;  4II7 A;  1VB6 A;  4KUK A;  5K5B A;  3NOP C;  5DKK A;  4UQI M;  3NOU C;  4EQ1 A;  5C5K A;  5FL3 A;  2VLG A;  4KQO A;  3BW6 A;  3CIT A;  2QKP A;  4DJ2 A;  5EFW A;  4H6J B;  3OC2 A;  3H9W A;  2PYR A;  2KX6 A;  4EXO A;  4IJG A;  3T4S A;  2JKT M;  3EGD C;  4HJ4 A;  3C30 A;  3U2A A;  3A0R A;  4LRY C;  4DN0 A;  3T4O A;  4GS9 A;  4G3K A;  1BYW A;  4HP4 A;  3F1P A;  4I3I A;  3OLO A;  5IT5 A;  2K31 A;  3MFX A;  1N9O A;  1OTE A;  4QPR A;  3EEH A;  4XT2 A;  1TS7 A;  1OTD A;  5CX7 A;  4R38 A;  3OBF A;  1N9L A;  4F3L A;  5KIZ A;  3H7W B;  2PHY A;  1XJ4 A;  5HWT A;  4CLC A;  1V9Z A;  1OTB A;  5HDS A;  2YKH A;  3RFB A;  3LIC A;  1V9Y A;  1TD5 A;  1LSX A;  1W63 Q;  4Y3I A;  3RTY A;  3MF0 A;  3PBR A;  5HWW A;  4K08 A;  4G3V A;  1TS8 A;  2K2N A;  1H3Q A;  2J3T C;  3PHY A;  4JGR A;  4M4X A;  5F6A A;  2W3D A;  3MQ0 A;  2G7U A;  1VHM A;  4HIA A;  5J7E A;  5MC7 A;  5HDD A;  5TBM A;  1GSX A;  3T50 A;  3CWF A;  3HJK A;  3IBJ A;  1S1Y A;  4I3J A;  2VGL M;  1T1B A;  2V9A A;  4JGP A;  2OAP 1;  3R4K A;  4GCZ A;  5G4Z A;  4ETZ A;  2A24 B;  4GHI B;  2WKR A;  3VE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...