3KSFA

Structure of frmsr of staphylococcus aureus (reduced form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksfA00
2K31A 3G6OA 3NOUC 4YOFA 4Q0JA 4RQ9A 2B18A 2W1TB 4GW9A 4ETXA 3RFBA 3C2WA 2XROA 3KSHA 1STZA 3OBFA 4IUHA 5K5BA 3VV4A 3E98A 1MC0A 2O0YA 3CI6A 4G3VA 4DMZA 1YKDA 2GX5A 1MKMA 3KSFA 2XRNA 4CQHA 5HL6A 4E04A 3DBAA 3S7NA 2O99A 4ETZA 4GLQA 2O9BA 4MDZA 4Y3IA 1TD5A 5AJGA 3NOTC 2IA2A 4BWIA 5L8MA 4O8GA 3CITA 3KO6A 3MF0A 1F5MA 4ME4A 2LB5A 1VHMA 3KSIA 5HPIA 1ZTUA 1TF1A 5HSQA 2LB9A 3ZQ5A 2W1TA 2K2NA 4Z1WA 4MCWA 2W3DA 2W3GA 2O9CA 4LRYC 2Y79A 2W3FA 2QYBA 4LRZE 3W2ZA 4PAUA 3S7OA 4Y5FA 2ZMFA 4O01A 4ZRRA 2VJWA 2KLIA 4IUKA 2OOLA 3LFVA 5DFXA 1YSPA 3NHQA 4IJGA 4R6LA 3E0YA 2M7UA 2G7UA 3OOVA 5TJJA 2VKSA 3MMHA 3HCYA 3NOPC 3MQ0A 3S7QA 1YSQA 3R4KA 2W3EA 4O0PA 3D3OA 4LRXC 5I5LA 2VEAA 3IBJA 3KSGA 4Y2FA 5DFYA 5LBRA 4R70A 3EEAA 3BJNA 2O9AA 2HGVA 4DN0A 4MN7A 5C5KA 2M7VA 2VZWA 4FOFA 4Q0HA 4EU0A 3O5YA 4YNRA 2W3HA 3TRCA 4MMNA 2XSSA 4EUVA 4QPRA 3IBRA 4G3KA 2KOIA 4Q0IA 3S7PA 5HPFA 4G3WA 2W1RA 2Y8HA 3K2NA
chains in the Genus database with same CATH superfamily
3PBNA 3BRMA 5CXWA 3PTEA 1W63M 2G2WA 2EX6A 5FI7A 3FG8A 4X53A 3BQ8A 2Z2LB 3GV9A 3RFBA 5FQQA 3KSHA 3PXPA 1YMXA 2DMWA 5K5BA 5EOEA 3G2ZA 1Z09A 3E2KA 2VA0A 2VX8A 5EFWA 3BECA 3PBOA 3F1OB 3BW6A 4IVKA 3V3RA 5HL6A 1EW0A 2Q9NA 3GMWA 3DBAA 4U0TA 2ZD8A 5KSCA 3PBRA 1XA1A 3NOTC 1G28A 2GZAA 1KVMA 4R4RA 1HVBA 3GTCA 3DWKA 5DTKA 1X0OA 4DRTA 5HSQA 2QKPA 3EQUA 1HTZA 2PYPA 2L1MA 3C4OA 1I2WA 1PFLA 2B5RA 2W3FA 4LRZE 3VOLA 1YLWA 4WZ5A 4DDYA 3C5AA 1TS7A 1K4FA 2J3TC 3E0YA 3ZG5A 1FILA 1BLHA 1P97A 1HZOA 2Y2GA 2VKSA 3LY4A 3F1OA 1YSQA 4BL2A 1YQSA 4WMCD 3DAVA 3QHYA 3TJZC 4MN7A 3BFEA 2VZWA 1OJGA 5HDCA 3UB6A 3ZFZA 1GCEA 4DXCA 3ITBA 3RH8B 3C30A 3S7PA 2XFTA 4G3WA 2WYXA 1UGUA 4OPRA 1SZVA 4Y7PA 3UE3A 2UV0E 1VQQA 2DRWA 3CMZA 4Q0JA 1E3UA 4RQ9A 2EA9A 1M40A 1NLYA 2B95A 5M19A 2HP9A 1OJ5A 3IX4A 1STZA 3SH7A 4IHQA 1PWDA 1MC0A 2HDSA 4HJ4A 4UQIS 3HJKA 3LI9A 4HOIA 3ULFA 2OLUA 1ERQA 1GSVA 2ZOIA 3GRJA 5FATA 1A0KA 4X1MA 3R7WA 1SDEA 3DTKA 3CITA 1F5MA 1VHMA 1L3LA 4RVAA 4BENA 3N4IA 1T1AA 2HV1A 2JKFA 1DJBA 5I94A 3OLOA 3S4XA 3V5MA 2XA7S 4B9OA 1KGFA 3QP5A 3JVVA 4LLOB 3T4SA 2ZC3B 3UB5P 1YMSA 2PRFA 5EVIA 3GVBA 1L0GA 3WRTA 4IJGA 4R6LA 1Y4OA 1N9OA 3OOVA 1BSGA 3MQ0A 1XJ6A 3E4PA 4LV1A 4QWOA 5AQ9A 5KMWA 1FCOA 4E3LA 3LO7A 5CX7A 3IF5A 2V1ZA 2YKFA 4EERA 5IS1A 1MBLA 4YNRA 1Z6FA 1MWUA 4N9LA 1YLPA 3H7WB 1SDNA 1JTGA 3T1XA 4WL9A 4L9GA 3VFHA 4NG2A 4Q0IA 4BBUA 4YFMA 1MZUA 3T50A 2HDUA 3IT9A 5EPHA 3RJUA 4X56A 4CJNA 1LHYA 3MSHA 5J4EA 3A3FA 1IYSA 1VEUB 4I39A 1IYQA 4GD8A 3LI8A 2XR0A 1K38A 4IEDA 4ARZA 2L4RA 4UA6A 1GHPA 4E04A 4D2OA 5HAPA 2M1CA 3S7NA 1BLPA 1NY0A 1PZOA 2PU4A 1ZTUA 3ZQ5A 3VP4A 4H8RA 4HIAA 3W4QA 3LIDA 4JF6A 3WS5A 1E4DA 2QYBA 1SKOB 2P04A 4ID4A 3A3JA 2PD7A 1Y54A 4OPQA 3DW0A 3TSGA 3UE0A 5AQBA 1IYOA 3P7NA 2EWVA 5KIZA 1MWRA 1PIOA 4RA7A 2PBYA 2PT7A 3GDIA 5HWWA 1P9WA 4NETA 1K25A 1NYMA 2VEAA 3BEBA 2FFFB 5DFYA 3BJNA 2Y2LA 4OQIA 3TW8A 4CLCA 1RGYA 2Y2NA 4S2OA 1T19A 3U4LP 5F69A 5FDSA 1CI8A 3H7WA 4JGQA 3OC2A 1EWZA 4LENA 4D60A 3OPRA 4O7DA 1VETA 3ZVTA 3D9YA 4EEUA 2X71A 5F82A 4UEYA 2D02A 2Y59A 1IYPA 4KZ4A 2ZQ8A 2ZMVA 4ZJ3A 2GJ3A 4IUHA 4L9FA 2PAVP 4JGPA 3CI6A 4DMZA 3LYXA 4HJ6A 5L09A 4ESPA 4XXRA 2VGKA 2MJ6A 2XD1A 5HL1A 3B33A 1DP8A 5CHJA 4HP4A 1YLJA 1TD5A 3A3DA 2JKRI 1BULA 4LPZA 1TF1A 4KZBA 1S66L 4DE1A 3AGDA 1ALQA 1PWGA 5IT5A 4PM9A 5J3WA 2JN7A 2ZC4B 4E3KA 4ZTKA 3T12B 1D06A 1PI5A 4WLAA 1GHMA 2YKHA 2OOLA 3LFVA 3ITAA 3NHQA 1W8YA 5EVIB 4PMAA 3UB7A 4Y0OA 4WMCA 1BLCA 1XJ2A 1S67L 3D3OA 4FUWA 4NXBA 2BG1A 2QMIA 3VSKA 5GLDA 3EOIA 3IX3A 4DDSA 4QJGA 4HBUA 4IVIA 3BLSA 4FOFA 1FOFA 2K7SA 1Q2QA 3IXGA 4MMNA 2VV8A 3G35A 4HBTA 1IKGA 3IBRA 1ES2A 4LGWA 1BUEA 1K56D 2VV7A 1W7FA 1G5UA 1G6AA 4NXEA 4GNUA 2K31A 2B02A 2FZ0A 2W1TB 1H8YA 3C2WA 4GDBA 3IXHA 1KDSA 1HLUP 3RXXA 3ZNYA 1CI9A 3KYZA 2GDNA 3FWLA 1YLTA 1VB6A 2G2UA 3V39A 3Q07A 4LCMA 4MDZA 3SS5A 3CHWP 4Y0UA 1T1BA 3EEHA 1ZG4A 2EXBA 3B3XA 2BLSA 5EM1A 1JVJA 4MCWA 4M3KA 4XUXA 4JXSA 3FZCA 3LEZA 3W2ZA 4WM9A 4WBGA 2PYRA 1CEFA 5HDDA 2R78A 3HLWA 2ZM2A 4N92A 1WYCA 1LI0A 5E2HA 4PM5A 4DE2A 4KG2A 3K3CA 3LY3A 3IWOA 5FASA 5HD5A 2ZC5B 3IS2B 3IBJA 1V9YA 3DTIA 2O9AA 5AVEA 1Y28A 4PPRA 1OPXA 1PYYA 4U3TA 3Q7VB 1L2SA 3LEQA 3HLCA 5EVLA 2XDMA 1ESIA 5FQJA 1AWIA 1XX2A 1TS8A 3W4OA 4R1GA 2VK3A 3OCLA 4FH4A 3JVUA 4EETB 1OTDA 4ZBEA 2WGIA 1K4EA 3DWZA 4ZAMA 2BTFP 3MZEA 2Z2MB 3FC7A 4BD1A 4KQQA 4I5SA 1XFQA 4HY8A 4WUJA 2ZQ7A 3Q82A 3PR6A 2WKIA 1FQGA 3G34A 5CRFA 4YWZA 1MXOA 4WZ4A 3ZHHA 4QB8A 3S1YA 3ICYA 3VFFA 3KX0X 2JKTI 1CQAA 2EWWA 4P87A 5HAIA 2EX9A 1GHIA 1KDWA 4PAUA 5EVEA 3MKEA 2Y2KA 3CUEC 2PD8A 4WYYA 3UY6A 3OPPA 5F1FA 4E3NA 5HZHA 3CPTB 4K91A 3HLEA 4NXFA 3QNBA 5DFXA 1YSPA 1IELA 2M7UA 4KZ5A 3Q81A 5TGFA 5TJJA 4KUKA 1CJFA 3MMHA 1O7EA 3V67A 2ZQ9A 2WKRA 3KSGA 1N4OA 5GL9A 3UDIA 1HD8A 4I38A 3A3EA 2J80A 4DN0A 5E2GA 3JPUA 1S0WA 2NUTC 3VP0A 5F68A 1WYBA 4EU0A 1OTEA 3PAEA 3UN7A 3NDGA 1GSXA 2ZC7A 3DTMA 4CLCB 1L0EA 4HEFA 3MQQA 4HHDA 3MFDA 3BYDA 4MN6A 1NRJA 5HW3A 1MWTA 4GW9A 4WN5A 3MZDA 4MBHA 1TVFA 1W79A 2V8CA 1I5QA 4FH2A 1SKFA 4EEPA 3C4PA 4BQMA 1ONGA 3GR2A 3N8LA 4X55A 3UB8A 3O87A 3E4QA 5FA7A 1PNEA 2EFUA 2R9XA 4GLQA 2V8FA 4DE0A 1NJ4A 2IA2A 3H82A 3EGDC 1KE3A 5GLCA 4KZ8A 2LB5A 4P85A 4B88A 2ZOHA 1K0KA 3M6BA 4MN5A 4X25A 1YT4A 2W3GA 3LIBA 4EW7A 4S2PA 2HP6A 1JWVA 1YLZA 3HLBA 4KENB 1K56A 3BY8A 3T1RA 4NEED 1XKZA 4Y5FA 1LL9A 2PR5A 4Y17A 3VOZA 4JXVA 2PBDP 3M6HA 2Y2PA 4KQRA 1ES4A 3BWLA 2R9WA 1FCNA 4JKTA 3A0RA 1YLYA 1K6RA 2JKRM 1K55C 3MXRA 3L9KA 4OH0A 2J3TD 4FTXA 4GZBA 3NIAA 3T4LA 1CK3A 4GS9A 4F3LA 2V9AA 1IEMA 2Y2JA 3A0SA 3JYIA 4MLLA 3NBLA 1F98A 2VLGA 2QPNA 5IU1A 4Y0TA 4KZAA 4G3KA 5CEDA 2PU2A 4JXWA 4PHTA 4LV2A 3G6OA 1N9BA 4DJ3A 3BLMA 2WKQA 1LSXA 4OQ0A 4CLCD 1XJ3A 3VP3A 3FKWA 4GD6A 1WE4A 4K0XA 3CG5A 1TS0A 5EVID 3IXBA 2W27A 2HDRA 3BFFA 3MKFA 3OPHA 3NECA 3KSFA 3UMEA 1H8ZA 1FR1A 2O99A 5CECA 2HJEA 4OLGA 1NWZA 1MKIA 1QMEA 4XT2A 4A5RA 1KE4A 2WADA 2QHKA 2HDQA 1W63Q 2XGNA 1ERMA 1XGIA 2Y79A 3G2YA 5FQKA 5L07A 3SH8A 1FIKA 3KYQA 2XFSA 2ACGA 4H6JB 4UAAA 3HUMA 2ZMFA 1ESUA 5A92A 4EBNA 3UE1A 3FPVA 4S2NA 1NRFA 1SHVA 3EQVA 3Q7ZA 3IH9A 1ONHA 1XJ4A 2WZXA 3EGXC 5G18A 1T18A 3Q7VA 4MBFA 5I5LA 4JF5A 1KOUA 3HREA 5LBRA 3ZG8B 1JTDA 3W8KA 2XK1A 5EM0A 1TDGA 3LIAA 4OLDA 5FI6A 4B4XA 2H28A 4GHIB 3AGFA 4Q0HA 5M18A 2ZL1B 1MPLA 4BD0A 3U2AA 3VMAA 1PWCA 3KYEA 3UPPA 4NK3A 5EE8A 1NXYA 2ZQCA 3K2NA 3GQZA 3NOUC 3UPOA 2J9PA 5M1AA 3QP6A 4E3MA 2P74A 2WKHA 2A2LA 2DCFA 1JWPA 3SW1A 1YAXA 2CMNA 5FL3A 3A0VA 3E98A 4QD4A 1GA9A 2O0YA 2ZC6B 5AQAA 3ZG0A 3IHBA 1MY8A 4EQIA 3RTYA 2EX2A 3QP1A 3UE6A 5AJGA 2J8YA 5HX9A 2E8JA 5FAQA 4NXGA 4HI4A 2Y55A 4NKPA 3CZDA 2VV6A 5FQMA 1ES3A 1U60A 3PHYA 4LRYC 3TE8A 1SCWA 4ZJ2A 1LLBA 1EI5A 4HH2A 4E6XA 1P0ZA 1Q2PA 1K55A 1FSYA 4I3IA 2DNSA 2ZL1A 2RL3A 4Y15A 3H9WA 5D3OA 5KZHA 2JCHA 2EXAA 4KZ6A 3HL9A 4WF0A 2A3UA 5E2EA 2Y2MA 4EESA 1OTBA 3N8RA 4UA9A 4KZ3A 1ZC2A 5FSRA 3MQOA 2M7VA 2WGWB 4K08A 4LFUA 2W3HA 2XSSA 2ZQAA 4WEJA 4JBFA 3PBQA 4QPRA 3NY4A 1IKIA 4JF4A 3TG9A 4HP9A 4Z9QA 3LIEA 3MXSA 4YOFA 5DJUA 4KUOA 2IWDA 1LT0A 3N7WA 1VETB 2Y2QA 2XROA 5GLBA 5A90A 4JGOA 5FAOA 1ODVA 2J3WA 5IHVA 4EV4A 3NULA 3Q1FA 5GHYA 4GN2A 4JGRA 5L8MA 5F1GA 4KZ9A 2Y2OA 2V1BA 3IS2A 3MFXA 3SOIA 4S2NC 2HZ5A 3IH8A 1ZG6A 5TFQA 3IF6B 3ISGA 4B4ZA 3LICA 1OMEA 1K54A 5EECA 4RX3A 5G4ZA 5HWVA 2VJWA 4IUKA 5FDHA 2ZMAA 4KQDA 3B42A 2VGLS 3T1QB 4P6ZM 5DVAA 2P9VA 2C6WB 3ZYTA 1DY6A 4PKYA 5J8XA 2XD5A 1OTAA 1XXMA 5C5KA 1P9RA 5A91A 1S4RA 5A93A 2C5WB 1H3QA 4S2MA 2UWXA 3N6IA 5F83A 1KGGA 2V0UA 3IWIA 2OWHA 1YM1A 4JXGA 4CLCE 3GSGA 2Y8HA 4DF6A 1XPBA 4E3IA 3WWXA 5AQ7A 3FYZA 2JKTM 3A3IA 4EUZA 3P98A 4R4SA 4L9EA 4ETXA 4S2LA 2EFXA 5HARA 3UNWA 4C75A 3BFGA 4BL3A 4G3VA 2Y4AA 5FQ9A 3D4FA 3NJAA 3CJMA 4U0XA 3HLGA 2WKPA 4OQGA 4OOYA 3IWQA 1G6OA 4LCLA 3VP1A 3IXDA 2A24A 2O9CA 3OPLA 3WS2A 5EOOA 5FI2A 5EV0A 2PDRA 3O3VA 4RYEA 3PAGA 1PW1A 4O01A 4UA7A 1JWZA 1TS6A 3CAXA 4OONA 4GOGA 1VM1A 4WEKA 5FQIA 4I3JA 1M6KA 4FCFA 5DTTA 3LGOA 4EXOA 5DF9A 4R70A 3EEAA 4OPZA 3PBSA 4DJ2A 2QWSA 5TR7A 2E8IA 1E3UD 3T1SA 5KSHA 5HWTA 4N9KA 2WUQA 3NI9A 2A24B 3HLDA 1FCMA 2OV5A 4GCZA 1LL8A 4PM6A 2JC7A 2ZJ9A 3B47A 3GECA 4FD8A 1L0FA 1DJCA 5FEGA 5CTNA 1KGEA 4R23A 1FR6A 2D01A 3VV4A 3WS0A 1NLZA 1S6RA 4C6YA 1AXBA 2GNXA 4BBVA 3SZTA 3HUOA 5FAPA 1RCJA 2GX5A 2VGJA 4CQHA 2XRNA 3NCKA 1I2SA 1J9MA 4QY6A 1PI4A 4N1XA 2WAEA 3UB9A 2O9BA 2HP5A 2VGLM 4DXBA 3QP2A 1C3BA 2LB9A 5CTMA 3CWFA 4BMWA 5HFOA 2JE5A 3ZG7B 2RCXA 2V2FF 2Z6CA 4GHIA 5DF7A 4E6WA 4ZRRA 4GB7A 2KLIA 5E43A 1T1CA 2WGWA 3MJQA 3M2JA 3N8SA 4LV0A 5DF8A 2XEPA 3H82B 3NOPC 3W4PA 4KZ7A 5DKLA 3G31A 4LRXC 2XLNA 3FKVA 3O86A 4IBRA 3IF6A 4HNBA 1NYYA 5EVIC 4S2KA 5GLAA 1H8MA 4II7A 2BASA 5F6AA 4KQOA 3T4QA 5MC7A 2QJ5A 5G4YA 2IWCA 1WA9A 5HPFA 1OTIA 1K57C 4EWFA 2W1RA 3S22A 3WS1A 2H10A 3D72A 1GA0A 3BFDA 2B18A 5F5YA 2FFYA 5AVFA 2NUPC 3OCNA 3IF6C 2PR6A 1DP6A 2A49A 1O07A 1YPRA 2WKEA 1ACFA 2ZLYA 3HLFA 2J7VA 1MKMA 3RXWA 5HAQA 2KDKA 1S1YA 3P01A 4B93A 3HVFA 3MF0A 4HH3A 2WGVA 3LCEA 3KSIA 4FSFA 4K0WA 5HPIA 4BJPA 1IFQA 3MR0A 1FSWA 3F1PB 5L2FA 1XFNA 1H5XA 4BLMA 4GDNA 3S7OA 5TBMB 2Y2HA 4R3JA 4WZ5C 3LR5A 4HESA 3BQAA 1XGJA 4QHCA 1ES5A 1KVLA 1JNUA 3ZDJA 1S1ZA 5L10A 4ZJ1A 3R7WB 2INWA 4Q8IA 1W8QA 4E3JA 4EBPA 3T4TA 5GHXA 4HJ3A 3C7UA 3F1PA 1PZPA 3MS6A 3V3SA 5GHZA 3M2KA 2OAQ1 4C3QA 3NC8A 4EQ1A 5EUAA 3ZVWA 4DKIA 4XUZA 4OP8A 2V20A 1QMFA 3T4KA 3FV7A 1DJAA 3C7VA 4GKUA 4XT2B 2P7JA 3I7JA 4OOMA 3T4OA 3V50A 2ZM8A 4HQAA 2OSUA 5TBMA 2PHYA 4S2JA 1GSWA 1K57A 3O88A 4ZDXA 2X01A 4PM8A 4QU3A 2ZM0A 1LI9A 1E25A 4N1HA 4H6JA 4E3OA 4PM7A 5A8BA 1XA7A 4OKPA 1RGZA 4BBTA 4BWIA 2I9VA 5DTSA 4ME4A 2H0YA 1OT6A 2WK0A 3HBRA 2K2NA 3VP2A 1D1JA 5HD3A 4Y13A 1LL5A 1OT9A 4M4XA 3AGEA 5CEBA 1PRQA 3BY9A 2H0TA 1G68A 4X6TA 4R3AA 2P9VB 5JYOA 3BFCA 5CGXA 3LUQA 4R3BA 2KX6A 1SKOA 5CGSA 3E4OA 5U47A 3QP8A 4L0LA 2W3EA 3ZGAB 4OQHA 1BYWA 1L0DA 1D7EA 4Y2FA 1TEMA 3F1NB 3IQAA 3CPTA 1CEGA 5CHMA 2V0WA 1BT5A 4CLCC 2Q9MA 3UDFA 3CUEA 3T4JA 3TRCA 4EBLA 2V1AA 4OOLA 4UQIM 3ZG9B 2H5SA 4PKYG 5DKKA 4UHUA 1MWSA 3UPNA 3VSLA 4P0MA 3PBTA 3LR4A 4KG6A 3L7HA 1LSWA 3UMDA 3VE4A 3OBFA 2J9OA 3MBZA 4DE3A 2OAP1 3P09A 1N9LA 2JHEA 2HF6A 5CHUA 2JKGA 4OVDA 1EROA 4QY5A 1K6SA 4ETZA 4Y3IA 2X02A 5E2FA 3LR3A 4OPYA 2QZ6A 3KO6A 3QP4A 4ARZB 1ZHHB 3TOIA 3NDEA 2W1TA 5DJTA 4X68A 1DP9A 2W3DA 4F3LB 3IX8A 3UO9A 4S2IA 3CLOA 3FPWA 4GS9B 3BM6A 1BTLA 4JPMA 3SH9A 2OWJA 4P6BA 5CERA 3HUNA 3SS4A 1N9NA 3C8CA 4O0PA 4X69A 3DTEA 3OZHA 1K54C 4R38A 2HGVA 3VE3A 2IWBA 4RX2A 3F1NA 2I72A 3EWKA 2FH5A 3HJIA 4F94A 1H0MA 5HDSA 4MEZA 1NZOA 2Y2IA 4EUVA 4MNRA 3VOYA 3MZFA 1NZUA 2Y91A 1J3WA 4X1LA 2XQZA 3ZNTA 4WELA 2W0NA 2EX8A 4IBXA 5CGWA 5J7EA 4R0QA 5JYPA 3ZCZA 4MBKA 1RP5A 3SS3A 1IOUA 2JBFA 1YKDA 4OP5A 2P08A 3G30A 4LV3A 4GJ4A 3WRZA 4O8GA 2QJ7A 1KE0A 3C38A 4P6ZS 1CF0A 4AFIA 4Z1WA 3UDXA 3G4PA 1BLSA 1BZAA 1F2KA 3G32A 1V9ZA 1S4SA 2XH9A 2Q0OA 1LSVA 3QNCA 3IHAA 3MXQA 1F9IA 4YINA 2G7UA 2ZQDA 3HCYA 3S7QA 5FEFA 1UWNX 3E2LA 2CC1A 3R4KA 2HPBA 4CPKA 1W5DA 2XF3A 3LIFA 3LR0A 2XA7M 2WZZA 1PW8A 3K3DA 2L0WA 4I3AA 3PYPA 1VEUA 3O5YA 2OLVA 1UWPX 1ZKJA 4KG5A 1TDLA 2ZBBA 2AVXA 2KOIA 5BOHA 4JLFA 2Z6DA 1DRMA 3WS4A 1XP4A 2HJ9C 2WAFA
chains in the Genus database with same CATH topology
3PBNA 2K31A 3NOUC 2B02A 3D72A 1W63M 2FZ0A 2B18A 2W1TB 3FG8A 3BQ8A 5F5YA 5AVFA 2NUPC 3RFBA 3C2WA 3KSHA 3OCNA 3PXPA 2A2LA 2DMWA 2PR6A 1DP6A 5K5BA 3SW1A 1YAXA 2VA0A 2CMNA 5FL3A 3A0VA 3E98A 2VX8A 2O0YA 5EFWA 3KYZA 3PBOA 3F1OB 3BW6A 1MKMA 5HL6A 1EW0A 1VB6A 3DBAA 3RTYA 2KDKA 4MDZA 3PBRA 1S1YA 3UE6A 3P01A 5AJGA 3NOTC 1G28A 4B93A 2GZAA 3MF0A 4HI4A 1T1BA 4NXGA 3EEHA 4HH3A 3KSIA 4FSFA 5HPIA 1X0OA 4NKPA 5HSQA 4BJPA 2QKPA 3EQUA 2VV6A 2PYPA 2L1MA 4MCWA 1IFQA 3MR0A 3PHYA 3F1PB 4LRYC 1XFNA 3TE8A 2W3FA 4LRZE 3VOLA 3W2ZA 3S7OA 4HH2A 2PYRA 5TBMB 1P0ZA 5HDDA 3LR5A 4I3IA 3BQAA 2R78A 3H9WA 1TS7A 2J3TC 1JNUA 3E0YA 1S1ZA 1P97A 3R7WB 2VKSA 3K3CA 2INWA 3F1OA 1YSQA 4WF0A 5HD5A 4EESA 3IS2B 3IBJA 1OTBA 1V9YA 3TJZC 2O9AA 3T4TA 4HJ3A 3F1PA 3MQOA 4MN7A 5AVEA 1Y28A 2M7VA 2VZWA 1OJGA 2OAQ1 1OPXA 5HDCA 4K08A 4EQ1A 2W3HA 3UB6A 2XSSA 4WEJA 3PBQA 4QPRA 3RH8B 3C30A 3S7PA 4G3WA 1UGUA 4HP9A 3T4KA 3UE3A 1TS8A 3LIEA 4YOFA 5DJUA 4KUOA 3OCLA 4Q0JA 1LT0A 4XT2B 2P7JA 4RQ9A 3JVUA 2EA9A 4EETB 1NLYA 1OJ5A 1OTDA 4OOMA 2XROA 3T4OA 1STZA 4JGOA 4HQAA 1ODVA 2J3WA 4IHQA 5TBMA 2PHYA 1GSWA 1MC0A 4HJ4A 4UQIS 3HJKA 3FC7A 3LI9A 4HOIA 4I5SA 4H6JA 1XFQA 3ULFA 4HY8A 4WUJA 5A8BA 3PR6A 4JGRA 1GSVA 2ZOIA 4BBTA 4BWIA 3R7WA 2I9VA 5L8MA 4YWZA 3CITA 1F5MA 4ME4A 1OT6A 1VHMA 3ICYA 2V1BA 1T1AA 3KX0X 2HV1A 2EWWA 2JKTI 2K2NA 3IS2A 3MFXA 5HD3A 1OT9A 3OLOA 4M4XA 2XA7S 4PAUA 3LICA 3BY9A 3CUEC 2PD8A 4B9OA 4R3AA 3JVVA 4LLOB 3T4SA 5G4ZA 5HZHA 5HWVA 2VJWA 3LUQA 4IUKA 4NXFA 4KQDA 3B42A 5DFXA 2KX6A 1YSPA 4IJGA 2VGLS 4R6LA 2M7UA 1N9OA 3OOVA 5TJJA 4KUKA 4P6ZM 3MMHA 3V67A 3MQ0A 3E4OA 4L0LA 1XJ6A 3E4PA 2W3EA 2WKRA 3ZYTA 1BYWA 4PKYA 1D7EA 3KSGA 4Y2FA 4I38A 5CX7A 2J80A 3F1NB 4DN0A 2V0WA 2NUTC 2YKFA 1OTAA 4EERA 5F68A 5C5KA 1P9RA 4CLCC 1S4RA 4EU0A 5IS1A 4YNRA 1OTEA 1H3QA 3CUEA 3T4JA 3TRCA 2V1AA 3H7WB 2V0UA 1GSXA 2OWHA 4WL9A 4L9GA 4Q0IA 4OOLA 4CLCE 4CLCB 4UQIM 4PKYG 2Y8HA 4BBUA 5DKKA 3MQQA 4HHDA 1MZUA 3T50A 3PBTA 4MN6A 1NRJA 2JKTM 3LR4A 4GW9A 4WN5A 4L9EA 1LSWA 3UMDA 4ETXA 3VE4A 5J4EA 3OBFA 4EEPA 2OAP1 4I39A 3LI8A 3UB8A 1N9LA 2JHEA 2HF6A 4G3VA 3E4QA 4ARZA 2L4RA 4E04A 3NJAA 2M1CA 3S7NA 4ETZA 4GLQA 4Y3IA 2WKPA 2IA2A 3H82A 3LR3A 3EGDC 3KO6A 1G6OA 2LB5A 2ZOHA 1ZTUA 4ARZB 4MN5A 1ZHHB 3ZQ5A 2W1TA 5DJTA 1DP9A 2W3DA 4HIAA 2W3GA 2A24A 2O9CA 3LIBA 3LIDA 4F3LB 2QYBA 4EW7A 2P04A 3BY8A 2PD7A 4NEED 3CLOA 2PDRA 4Y5FA 3FPWA 2PR5A 4GS9B 4O01A 1TS6A 3P7NA 3CAXA 2OWJA 2EWVA 3BWLA 5KIZA 2PT7A 4WEKA 3A0RA 3GDIA 4I3JA 5HWWA 2JKRM 1N9NA 3C8CA 4O0PA 1P9WA 4EXOA 2J3TD 2VEAA 5DF9A 5DFYA 4R70A 3EEAA 3BJNA 3T4LA 4R38A 2HGVA 3PBSA 4GS9A 3VE3A 4DJ2A 4F3LA 2QWSA 2V9AA 3TW8A 4CLCA 3F1NA 1T19A 3EWKA 2FH5A 5F69A 5KSHA 3A0SA 5HWTA 3HJIA 3H7WA 4JGQA 3OC2A 5HDSA 4EUVA 1F98A 2A24B 2VLGA 5IU1A 4GCZA 1LL8A 4G3KA 4EEUA 4PHTA 3B47A 3GECA 4UEYA 3G6OA 4WELA 2W0NA 4DJ3A 2D02A 2WKQA 1LSXA 4CLCD 1XJ3A 5J7EA 2ZMVA 2GJ3A 4IUHA 4L9FA 1TS0A 2D01A 3VV4A 2W27A 1NLZA 4JGPA 2GNXA 3CI6A 4BBVA 1IOUA 4DMZA 1YKDA 3LYXA 2GX5A 3KSFA 4HJ6A 2XRNA 3UMEA 4CQHA 2MJ6A 3B33A 2O99A 1DP8A 2P08A 3UB9A 4HP4A 2O9BA 1TD5A 2HJEA 4GJ4A 2VGLM 1NWZA 2JKRI 4O8GA 2QJ7A 3C38A 4P6ZS 4LPZA 1TF1A 4XT2A 1S66L 2LB9A 4AFIA 4Z1WA 2QHKA 1W63Q 3CWFA 2Y79A 5IT5A 4BMWA 5J3WA 1V9ZA 3KYQA 2Z6CA 2JN7A 1S4SA 4H6JB 2ZMFA 4GHIA 1LSVA 1D06A 4WLAA 4ZRRA 2KLIA 2YKHA 3FPVA 2OOLA 3LFVA 1T1CA 3MJQA 3MXQA 1F9IA 3NHQA 2G7UA 3H82B 3HCYA 3NOPC 3EQVA 3S7QA 3UB7A 1UWNX 1XJ2A 1XJ4A 3R4KA 3EGXC 1S67L 5DKLA 3D3OA 1T18A 4LRXC 5I5LA 4NXBA 1KOUA 5LBRA 4HNBA 3LIFA 3EOIA 3LIAA 3LR0A 1H8MA 2XA7M 4II7A 2BASA 2H28A 3K3DA 4GHIB 4KQOA 5F6AA 3T4QA 4FOFA 2L0WA 4I3AA 4Q0HA 5MC7A 3PYPA 3O5YA 2QJ5A 2K7SA 4MMNA 3U2AA 5G4YA 1UWPX 2VV8A 2ZBBA 1WA9A 3IBRA 2KOIA 5HPFA 1OTIA 2Z6DA 1DRMA 2W1RA 2VV7A 2HJ9C 3K2NA 4NXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K31 A;  3G6O A;  3NOU C;  4YOF A;  4Q0J A;  4RQ9 A;  2B18 A;  2W1T B;  4GW9 A;  4ETX A;  3RFB A;  3C2W A;  2XRO A;  3KSH A;  1STZ A;  3OBF A;  4IUH A;  5K5B A;  3VV4 A;  3E98 A;  1MC0 A;  2O0Y A;  3CI6 A;  4G3V A;  4DMZ A;  1YKD A;  2GX5 A;  1MKM A;  3KSF A;  2XRN A;  4CQH A;  5HL6 A;  4E04 A;  3DBA A;  3S7N A;  2O99 A;  4ETZ A;  4GLQ A;  2O9B A;  4MDZ A;  4Y3I A;  1TD5 A;  5AJG A;  3NOT C;  2IA2 A;  4BWI A;  5L8M A;  4O8G A;  3CIT A;  3KO6 A;  3MF0 A;  1F5M A;  4ME4 A;  2LB5 A;  1VHM A;  3KSI A;  5HPI A;  1ZTU A;  1TF1 A;  5HSQ A;  2LB9 A;  3ZQ5 A;  2W1T A;  2K2N A;  4Z1W A;  4MCW A;  2W3D A;  2W3G A;  2O9C A;  4LRY C;  2Y79 A;  2W3F A;  2QYB A;  4LRZ E;  3W2Z A;  4PAU A;  3S7O A;  4Y5F A;  2ZMF A;  4O01 A;  4ZRR A;  2VJW A;  2KLI A;  4IUK A;  2OOL A;  3LFV A;  5DFX A;  1YSP A;  3NHQ A;  4IJG A;  4R6L A;  3E0Y A;  2M7U A;  2G7U A;  3OOV A;  5TJJ A;  2VKS A;  3MMH A;  3HCY A;  3NOP C;  3MQ0 A;  3S7Q A;  1YSQ A;  3R4K A;  2W3E A;  4O0P A;  3D3O A;  4LRX C;  5I5L A;  2VEA A;  3IBJ A;  3KSG A;  4Y2F A;  5DFY A;  5LBR A;  4R70 A;  3EEA A;  3BJN A;  2O9A A;  2HGV A;  4DN0 A;  4MN7 A;  5C5K A;  2M7V A;  2VZW A;  4FOF A;  4Q0H A;  4EU0 A;  3O5Y A;  4YNR A;  2W3H A;  3TRC A;  4MMN A;  2XSS A;  4EUV A;  4QPR A;  3IBR A;  4G3K A;  2KOI A;  4Q0I A;  3S7P A;  5HPF A;  4G3W A;  2W1R A;  2Y8H A;  3K2N A; 
#chains in the Genus database with same CATH topology
 3PBN A;  3BRM A;  5CXW A;  3PTE A;  1W63 M;  2G2W A;  2EX6 A;  5FI7 A;  3FG8 A;  4X53 A;  3BQ8 A;  2Z2L B;  3GV9 A;  3RFB A;  5FQQ A;  3KSH A;  3PXP A;  1YMX A;  2DMW A;  5K5B A;  5EOE A;  3G2Z A;  1Z09 A;  3E2K A;  2VA0 A;  2VX8 A;  5EFW A;  3BEC A;  3PBO A;  3F1O B;  3BW6 A;  4IVK A;  3V3R A;  5HL6 A;  1EW0 A;  2Q9N A;  3GMW A;  3DBA A;  4U0T A;  2ZD8 A;  5KSC A;  3PBR A;  1XA1 A;  3NOT C;  1G28 A;  2GZA A;  1KVM A;  4R4R A;  1HVB A;  3GTC A;  3DWK A;  5DTK A;  1X0O A;  4DRT A;  5HSQ A;  2QKP A;  3EQU A;  1HTZ A;  2PYP A;  2L1M A;  3C4O A;  1I2W A;  1PFL A;  2B5R A;  2W3F A;  4LRZ E;  3VOL A;  1YLW A;  4WZ5 A;  4DDY A;  3C5A A;  1TS7 A;  1K4F A;  2J3T C;  3E0Y A;  3ZG5 A;  1FIL A;  1BLH A;  1P97 A;  1HZO A;  2Y2G A;  2VKS A;  3LY4 A;  3F1O A;  1YSQ A;  4BL2 A;  1YQS A;  4WMC D;  3DAV A;  3QHY A;  3TJZ C;  4MN7 A;  3BFE A;  2VZW A;  1OJG A;  5HDC A;  3UB6 A;  3ZFZ A;  1GCE A;  4DXC A;  3ITB A;  3RH8 B;  3C30 A;  3S7P A;  2XFT A;  4G3W A;  2WYX A;  1UGU A;  4OPR A;  1SZV A;  4Y7P A;  3UE3 A;  2UV0 E;  1VQQ A;  2DRW A;  3CMZ A;  4Q0J A;  1E3U A;  4RQ9 A;  2EA9 A;  1M40 A;  1NLY A;  2B95 A;  5M19 A;  2HP9 A;  1OJ5 A;  3IX4 A;  1STZ A;  3SH7 A;  4IHQ A;  1PWD A;  1MC0 A;  2HDS A;  4HJ4 A;  4UQI S;  3HJK A;  3LI9 A;  4HOI A;  3ULF A;  2OLU A;  1ERQ A;  1GSV A;  2ZOI A;  3GRJ A;  5FAT A;  1A0K A;  4X1M A;  3R7W A;  1SDE A;  3DTK A;  3CIT A;  1F5M A;  1VHM A;  1L3L A;  4RVA A;  4BEN A;  3N4I A;  1T1A A;  2HV1 A;  2JKF A;  1DJB A;  5I94 A;  3OLO A;  3S4X A;  3V5M A;  2XA7 S;  4B9O A;  1KGF A;  3QP5 A;  3JVV A;  4LLO B;  3T4S A;  2ZC3 B;  3UB5 P;  1YMS A;  2PRF A;  5EVI A;  3GVB A;  1L0G A;  3WRT A;  4IJG A;  4R6L A;  1Y4O A;  1N9O A;  3OOV A;  1BSG A;  3MQ0 A;  1XJ6 A;  3E4P A;  4LV1 A;  4QWO A;  5AQ9 A;  5KMW A;  1FCO A;  4E3L A;  3LO7 A;  5CX7 A;  3IF5 A;  2V1Z A;  2YKF A;  4EER A;  5IS1 A;  1MBL A;  4YNR A;  1Z6F A;  1MWU A;  4N9L A;  1YLP A;  3H7W B;  1SDN A;  1JTG A;  3T1X A;  4WL9 A;  4L9G A;  3VFH A;  4NG2 A;  4Q0I A;  4BBU A;  4YFM A;  1MZU A;  3T50 A;  2HDU A;  3IT9 A;  5EPH A;  3RJU A;  4X56 A;  4CJN A;  1LHY A;  3MSH A;  5J4E A;  3A3F A;  1IYS A;  1VEU B;  4I39 A;  1IYQ A;  4GD8 A;  3LI8 A;  2XR0 A;  1K38 A;  4IED A;  4ARZ A;  2L4R A;  4UA6 A;  1GHP A;  4E04 A;  4D2O A;  5HAP A;  2M1C A;  3S7N A;  1BLP A;  1NY0 A;  1PZO A;  2PU4 A;  1ZTU A;  3ZQ5 A;  3VP4 A;  4H8R A;  4HIA A;  3W4Q A;  3LID A;  4JF6 A;  3WS5 A;  1E4D A;  2QYB A;  1SKO B;  2P04 A;  4ID4 A;  3A3J A;  2PD7 A;  1Y54 A;  4OPQ A;  3DW0 A;  3TSG A;  3UE0 A;  5AQB A;  1IYO A;  3P7N A;  2EWV A;  5KIZ A;  1MWR A;  1PIO A;  4RA7 A;  2PBY A;  2PT7 A;  3GDI A;  5HWW A;  1P9W A;  4NET A;  1K25 A;  1NYM A;  2VEA A;  3BEB A;  2FFF B;  5DFY A;  3BJN A;  2Y2L A;  4OQI A;  3TW8 A;  4CLC A;  1RGY A;  2Y2N A;  4S2O A;  1T19 A;  3U4L P;  5F69 A;  5FDS A;  1CI8 A;  3H7W A;  4JGQ A;  3OC2 A;  1EWZ A;  4LEN A;  4D60 A;  3OPR A;  4O7D A;  1VET A;  3ZVT A;  3D9Y A;  4EEU A;  2X71 A;  5F82 A;  4UEY A;  2D02 A;  2Y59 A;  1IYP A;  4KZ4 A;  2ZQ8 A;  2ZMV A;  4ZJ3 A;  2GJ3 A;  4IUH A;  4L9F A;  2PAV P;  4JGP A;  3CI6 A;  4DMZ A;  3LYX A;  4HJ6 A;  5L09 A;  4ESP A;  4XXR A;  2VGK A;  2MJ6 A;  2XD1 A;  5HL1 A;  3B33 A;  1DP8 A;  5CHJ A;  4HP4 A;  1YLJ A;  1TD5 A;  3A3D A;  2JKR I;  1BUL A;  4LPZ A;  1TF1 A;  4KZB A;  1S66 L;  4DE1 A;  3AGD A;  1ALQ A;  1PWG A;  5IT5 A;  4PM9 A;  5J3W A;  2JN7 A;  2ZC4 B;  4E3K A;  4ZTK A;  3T12 B;  1D06 A;  1PI5 A;  4WLA A;  1GHM A;  2YKH A;  2OOL A;  3LFV A;  3ITA A;  3NHQ A;  1W8Y A;  5EVI B;  4PMA A;  3UB7 A;  4Y0O A;  4WMC A;  1BLC A;  1XJ2 A;  1S67 L;  3D3O A;  4FUW A;  4NXB A;  2BG1 A;  2QMI A;  3VSK A;  5GLD A;  3EOI A;  3IX3 A;  4DDS A;  4QJG A;  4HBU A;  4IVI A;  3BLS A;  4FOF A;  1FOF A;  2K7S A;  1Q2Q A;  3IXG A;  4MMN A;  2VV8 A;  3G35 A;  4HBT A;  1IKG A;  3IBR A;  1ES2 A;  4LGW A;  1BUE A;  1K56 D;  2VV7 A;  1W7F A;  1G5U A;  1G6A A;  4NXE A;  4GNU A;  2K31 A;  2B02 A;  2FZ0 A;  2W1T B;  1H8Y A;  3C2W A;  4GDB A;  3IXH A;  1KDS A;  1HLU P;  3RXX A;  3ZNY A;  1CI9 A;  3KYZ A;  2GDN A;  3FWL A;  1YLT A;  1VB6 A;  2G2U A;  3V39 A;  3Q07 A;  4LCM A;  4MDZ A;  3SS5 A;  3CHW P;  4Y0U A;  1T1B A;  3EEH A;  1ZG4 A;  2EXB A;  3B3X A;  2BLS A;  5EM1 A;  1JVJ A;  4MCW A;  4M3K A;  4XUX A;  4JXS A;  3FZC A;  3LEZ A;  3W2Z A;  4WM9 A;  4WBG A;  2PYR A;  1CEF A;  5HDD A;  2R78 A;  3HLW A;  2ZM2 A;  4N92 A;  1WYC A;  1LI0 A;  5E2H A;  4PM5 A;  4DE2 A;  4KG2 A;  3K3C A;  3LY3 A;  3IWO A;  5FAS A;  5HD5 A;  2ZC5 B;  3IS2 B;  3IBJ A;  1V9Y A;  3DTI A;  2O9A A;  5AVE A;  1Y28 A;  4PPR A;  1OPX A;  1PYY A;  4U3T A;  3Q7V B;  1L2S A;  3LEQ A;  3HLC A;  5EVL A;  2XDM A;  1ESI A;  5FQJ A;  1AWI A;  1XX2 A;  1TS8 A;  3W4O A;  4R1G A;  2VK3 A;  3OCL A;  4FH4 A;  3JVU A;  4EET B;  1OTD A;  4ZBE A;  2WGI A;  1K4E A;  3DWZ A;  4ZAM A;  2BTF P;  3MZE A;  2Z2M B;  3FC7 A;  4BD1 A;  4KQQ A;  4I5S A;  1XFQ A;  4HY8 A;  4WUJ A;  2ZQ7 A;  3Q82 A;  3PR6 A;  2WKI A;  1FQG A;  3G34 A;  5CRF A;  4YWZ A;  1MXO A;  4WZ4 A;  3ZHH A;  4QB8 A;  3S1Y A;  3ICY A;  3VFF A;  3KX0 X;  2JKT I;  1CQA A;  2EWW A;  4P87 A;  5HAI A;  2EX9 A;  1GHI A;  1KDW A;  4PAU A;  5EVE A;  3MKE A;  2Y2K A;  3CUE C;  2PD8 A;  4WYY A;  3UY6 A;  3OPP A;  5F1F A;  4E3N A;  5HZH A;  3CPT B;  4K91 A;  3HLE A;  4NXF A;  3QNB A;  5DFX A;  1YSP A;  1IEL A;  2M7U A;  4KZ5 A;  3Q81 A;  5TGF A;  5TJJ A;  4KUK A;  1CJF A;  3MMH A;  1O7E A;  3V67 A;  2ZQ9 A;  2WKR A;  3KSG A;  1N4O A;  5GL9 A;  3UDI A;  1HD8 A;  4I38 A;  3A3E A;  2J80 A;  4DN0 A;  5E2G A;  3JPU A;  1S0W A;  2NUT C;  3VP0 A;  5F68 A;  1WYB A;  4EU0 A;  1OTE A;  3PAE A;  3UN7 A;  3NDG A;  1GSX A;  2ZC7 A;  3DTM A;  4CLC B;  1L0E A;  4HEF A;  3MQQ A;  4HHD A;  3MFD A;  3BYD A;  4MN6 A;  1NRJ A;  5HW3 A;  1MWT A;  4GW9 A;  4WN5 A;  3MZD A;  4MBH A;  1TVF A;  1W79 A;  2V8C A;  1I5Q A;  4FH2 A;  1SKF A;  4EEP A;  3C4P A;  4BQM A;  1ONG A;  3GR2 A;  3N8L A;  4X55 A;  3UB8 A;  3O87 A;  3E4Q A;  5FA7 A;  1PNE A;  2EFU A;  2R9X A;  4GLQ A;  2V8F A;  4DE0 A;  1NJ4 A;  2IA2 A;  3H82 A;  3EGD C;  1KE3 A;  5GLC A;  4KZ8 A;  2LB5 A;  4P85 A;  4B88 A;  2ZOH A;  1K0K A;  3M6B A;  4MN5 A;  4X25 A;  1YT4 A;  2W3G A;  3LIB A;  4EW7 A;  4S2P A;  2HP6 A;  1JWV A;  1YLZ A;  3HLB A;  4KEN B;  1K56 A;  3BY8 A;  3T1R A;  4NEE D;  1XKZ A;  4Y5F A;  1LL9 A;  2PR5 A;  4Y17 A;  3VOZ A;  4JXV A;  2PBD P;  3M6H A;  2Y2P A;  4KQR A;  1ES4 A;  3BWL A;  2R9W A;  1FCN A;  4JKT A;  3A0R A;  1YLY A;  1K6R A;  2JKR M;  1K55 C;  3MXR A;  3L9K A;  4OH0 A;  2J3T D;  4FTX A;  4GZB A;  3NIA A;  3T4L A;  1CK3 A;  4GS9 A;  4F3L A;  2V9A A;  1IEM A;  2Y2J A;  3A0S A;  3JYI A;  4MLL A;  3NBL A;  1F98 A;  2VLG A;  2QPN A;  5IU1 A;  4Y0T A;  4KZA A;  4G3K A;  5CED A;  2PU2 A;  4JXW A;  4PHT A;  4LV2 A;  3G6O A;  1N9B A;  4DJ3 A;  3BLM A;  2WKQ A;  1LSX A;  4OQ0 A;  4CLC D;  1XJ3 A;  3VP3 A;  3FKW A;  4GD6 A;  1WE4 A;  4K0X A;  3CG5 A;  1TS0 A;  5EVI D;  3IXB A;  2W27 A;  2HDR A;  3BFF A;  3MKF A;  3OPH A;  3NEC A;  3KSF A;  3UME A;  1H8Z A;  1FR1 A;  2O99 A;  5CEC A;  2HJE A;  4OLG A;  1NWZ A;  1MKI A;  1QME A;  4XT2 A;  4A5R A;  1KE4 A;  2WAD A;  2QHK A;  2HDQ A;  1W63 Q;  2XGN A;  1ERM A;  1XGI A;  2Y79 A;  3G2Y A;  5FQK A;  5L07 A;  3SH8 A;  1FIK A;  3KYQ A;  2XFS A;  2ACG A;  4H6J B;  4UAA A;  3HUM A;  2ZMF A;  1ESU A;  5A92 A;  4EBN A;  3UE1 A;  3FPV A;  4S2N A;  1NRF A;  1SHV A;  3EQV A;  3Q7Z A;  3IH9 A;  1ONH A;  1XJ4 A;  2WZX A;  3EGX C;  5G18 A;  1T18 A;  3Q7V A;  4MBF A;  5I5L A;  4JF5 A;  1KOU A;  3HRE A;  5LBR A;  3ZG8 B;  1JTD A;  3W8K A;  2XK1 A;  5EM0 A;  1TDG A;  3LIA A;  4OLD A;  5FI6 A;  4B4X A;  2H28 A;  4GHI B;  3AGF A;  4Q0H A;  5M18 A;  2ZL1 B;  1MPL A;  4BD0 A;  3U2A A;  3VMA A;  1PWC A;  3KYE A;  3UPP A;  4NK3 A;  5EE8 A;  1NXY A;  2ZQC A;  3K2N A;  3GQZ A;  3NOU C;  3UPO A;  2J9P A;  5M1A A;  3QP6 A;  4E3M A;  2P74 A;  2WKH A;  2A2L A;  2DCF A;  1JWP A;  3SW1 A;  1YAX A;  2CMN A;  5FL3 A;  3A0V A;  3E98 A;  4QD4 A;  1GA9 A;  2O0Y A;  2ZC6 B;  5AQA A;  3ZG0 A;  3IHB A;  1MY8 A;  4EQI A;  3RTY A;  2EX2 A;  3QP1 A;  3UE6 A;  5AJG A;  2J8Y A;  5HX9 A;  2E8J A;  5FAQ A;  4NXG A;  4HI4 A;  2Y55 A;  4NKP A;  3CZD A;  2VV6 A;  5FQM A;  1ES3 A;  1U60 A;  3PHY A;  4LRY C;  3TE8 A;  1SCW A;  4ZJ2 A;  1LLB A;  1EI5 A;  4HH2 A;  4E6X A;  1P0Z A;  1Q2P A;  1K55 A;  1FSY A;  4I3I A;  2DNS A;  2ZL1 A;  2RL3 A;  4Y15 A;  3H9W A;  5D3O A;  5KZH A;  2JCH A;  2EXA A;  4KZ6 A;  3HL9 A;  4WF0 A;  2A3U A;  5E2E A;  2Y2M A;  4EES A;  1OTB A;  3N8R A;  4UA9 A;  4KZ3 A;  1ZC2 A;  5FSR A;  3MQO A;  2M7V A;  2WGW B;  4K08 A;  4LFU A;  2W3H A;  2XSS A;  2ZQA A;  4WEJ A;  4JBF A;  3PBQ A;  4QPR A;  3NY4 A;  1IKI A;  4JF4 A;  3TG9 A;  4HP9 A;  4Z9Q A;  3LIE A;  3MXS A;  4YOF A;  5DJU A;  4KUO A;  2IWD A;  1LT0 A;  3N7W A;  1VET B;  2Y2Q A;  2XRO A;  5GLB A;  5A90 A;  4JGO A;  5FAO A;  1ODV A;  2J3W A;  5IHV A;  4EV4 A;  3NUL A;  3Q1F A;  5GHY A;  4GN2 A;  4JGR A;  5L8M A;  5F1G A;  4KZ9 A;  2Y2O A;  2V1B A;  3IS2 A;  3MFX A;  3SOI A;  4S2N C;  2HZ5 A;  3IH8 A;  1ZG6 A;  5TFQ A;  3IF6 B;  3ISG A;  4B4Z A;  3LIC A;  1OME A;  1K54 A;  5EEC A;  4RX3 A;  5G4Z A;  5HWV A;  2VJW A;  4IUK A;  5FDH A;  2ZMA A;  4KQD A;  3B42 A;  2VGL S;  3T1Q B;  4P6Z M;  5DVA A;  2P9V A;  2C6W B;  3ZYT A;  1DY6 A;  4PKY A;  5J8X A;  2XD5 A;  1OTA A;  1XXM A;  5C5K A;  1P9R A;  5A91 A;  1S4R A;  5A93 A;  2C5W B;  1H3Q A;  4S2M A;  2UWX A;  3N6I A;  5F83 A;  1KGG A;  2V0U A;  3IWI A;  2OWH A;  1YM1 A;  4JXG A;  4CLC E;  3GSG A;  2Y8H A;  4DF6 A;  1XPB A;  4E3I A;  3WWX A;  5AQ7 A;  3FYZ A;  2JKT M;  3A3I A;  4EUZ A;  3P98 A;  4R4S A;  4L9E A;  4ETX A;  4S2L A;  2EFX A;  5HAR A;  3UNW A;  4C75 A;  3BFG A;  4BL3 A;  4G3V A;  2Y4A A;  5FQ9 A;  3D4F A;  3NJA A;  3CJM A;  4U0X A;  3HLG A;  2WKP A;  4OQG A;  4OOY A;  3IWQ A;  1G6O A;  4LCL A;  3VP1 A;  3IXD A;  2A24 A;  2O9C A;  3OPL A;  3WS2 A;  5EOO A;  5FI2 A;  5EV0 A;  2PDR A;  3O3V A;  4RYE A;  3PAG A;  1PW1 A;  4O01 A;  4UA7 A;  1JWZ A;  1TS6 A;  3CAX A;  4OON A;  4GOG A;  1VM1 A;  4WEK A;  5FQI A;  4I3J A;  1M6K A;  4FCF A;  5DTT A;  3LGO A;  4EXO A;  5DF9 A;  4R70 A;  3EEA A;  4OPZ A;  3PBS A;  4DJ2 A;  2QWS A;  5TR7 A;  2E8I A;  1E3U D;  3T1S A;  5KSH A;  5HWT A;  4N9K A;  2WUQ A;  3NI9 A;  2A24 B;  3HLD A;  1FCM A;  2OV5 A;  4GCZ A;  1LL8 A;  4PM6 A;  2JC7 A;  2ZJ9 A;  3B47 A;  3GEC A;  4FD8 A;  1L0F A;  1DJC A;  5FEG A;  5CTN A;  1KGE A;  4R23 A;  1FR6 A;  2D01 A;  3VV4 A;  3WS0 A;  1NLZ A;  1S6R A;  4C6Y A;  1AXB A;  2GNX A;  4BBV A;  3SZT A;  3HUO A;  5FAP A;  1RCJ A;  2GX5 A;  2VGJ A;  4CQH A;  2XRN A;  3NCK A;  1I2S A;  1J9M A;  4QY6 A;  1PI4 A;  4N1X A;  2WAE A;  3UB9 A;  2O9B A;  2HP5 A;  2VGL M;  4DXB A;  3QP2 A;  1C3B A;  2LB9 A;  5CTM A;  3CWF A;  4BMW A;  5HFO A;  2JE5 A;  3ZG7 B;  2RCX A;  2V2F F;  2Z6C A;  4GHI A;  5DF7 A;  4E6W A;  4ZRR A;  4GB7 A;  2KLI A;  5E43 A;  1T1C A;  2WGW A;  3MJQ A;  3M2J A;  3N8S A;  4LV0 A;  5DF8 A;  2XEP A;  3H82 B;  3NOP C;  3W4P A;  4KZ7 A;  5DKL A;  3G31 A;  4LRX C;  2XLN A;  3FKV A;  3O86 A;  4IBR A;  3IF6 A;  4HNB A;  1NYY A;  5EVI C;  4S2K A;  5GLA A;  1H8M A;  4II7 A;  2BAS A;  5F6A A;  4KQO A;  3T4Q A;  5MC7 A;  2QJ5 A;  5G4Y A;  2IWC A;  1WA9 A;  5HPF A;  1OTI A;  1K57 C;  4EWF A;  2W1R A;  3S22 A;  3WS1 A;  2H10 A;  3D72 A;  1GA0 A;  3BFD A;  2B18 A;  5F5Y A;  2FFY A;  5AVF A;  2NUP C;  3OCN A;  3IF6 C;  2PR6 A;  1DP6 A;  2A49 A;  1O07 A;  1YPR A;  2WKE A;  1ACF A;  2ZLY A;  3HLF A;  2J7V A;  1MKM A;  3RXW A;  5HAQ A;  2KDK A;  1S1Y A;  3P01 A;  4B93 A;  3HVF A;  3MF0 A;  4HH3 A;  2WGV A;  3LCE A;  3KSI A;  4FSF A;  4K0W A;  5HPI A;  4BJP A;  1IFQ A;  3MR0 A;  1FSW A;  3F1P B;  5L2F A;  1XFN A;  1H5X A;  4BLM A;  4GDN A;  3S7O A;  5TBM B;  2Y2H A;  4R3J A;  4WZ5 C;  3LR5 A;  4HES A;  3BQA A;  1XGJ A;  4QHC A;  1ES5 A;  1KVL A;  1JNU A;  3ZDJ A;  1S1Z A;  5L10 A;  4ZJ1 A;  3R7W B;  2INW A;  4Q8I A;  1W8Q A;  4E3J A;  4EBP A;  3T4T A;  5GHX A;  4HJ3 A;  3C7U A;  3F1P A;  1PZP A;  3MS6 A;  3V3S A;  5GHZ A;  3M2K A;  2OAQ 1;  4C3Q A;  3NC8 A;  4EQ1 A;  5EUA A;  3ZVW A;  4DKI A;  4XUZ A;  4OP8 A;  2V20 A;  1QMF A;  3T4K A;  3FV7 A;  1DJA A;  3C7V A;  4GKU A;  4XT2 B;  2P7J A;  3I7J A;  4OOM A;  3T4O A;  3V50 A;  2ZM8 A;  4HQA A;  2OSU A;  5TBM A;  2PHY A;  4S2J A;  1GSW A;  1K57 A;  3O88 A;  4ZDX A;  2X01 A;  4PM8 A;  4QU3 A;  2ZM0 A;  1LI9 A;  1E25 A;  4N1H A;  4H6J A;  4E3O A;  4PM7 A;  5A8B A;  1XA7 A;  4OKP A;  1RGZ A;  4BBT A;  4BWI A;  2I9V A;  5DTS A;  4ME4 A;  2H0Y A;  1OT6 A;  2WK0 A;  3HBR A;  2K2N A;  3VP2 A;  1D1J A;  5HD3 A;  4Y13 A;  1LL5 A;  1OT9 A;  4M4X A;  3AGE A;  5CEB A;  1PRQ A;  3BY9 A;  2H0T A;  1G68 A;  4X6T A;  4R3A A;  2P9V B;  5JYO A;  3BFC A;  5CGX A;  3LUQ A;  4R3B A;  2KX6 A;  1SKO A;  5CGS A;  3E4O A;  5U47 A;  3QP8 A;  4L0L A;  2W3E A;  3ZGA B;  4OQH A;  1BYW A;  1L0D A;  1D7E A;  4Y2F A;  1TEM A;  3F1N B;  3IQA A;  3CPT A;  1CEG A;  5CHM A;  2V0W A;  1BT5 A;  4CLC C;  2Q9M A;  3UDF A;  3CUE A;  3T4J A;  3TRC A;  4EBL A;  2V1A A;  4OOL A;  4UQI M;  3ZG9 B;  2H5S A;  4PKY G;  5DKK A;  4UHU A;  1MWS A;  3UPN A;  3VSL A;  4P0M A;  3PBT A;  3LR4 A;  4KG6 A;  3L7H A;  1LSW A;  3UMD A;  3VE4 A;  3OBF A;  2J9O A;  3MBZ A;  4DE3 A;  2OAP 1;  3P09 A;  1N9L A;  2JHE A;  2HF6 A;  5CHU A;  2JKG A;  4OVD A;  1ERO A;  4QY5 A;  1K6S A;  4ETZ A;  4Y3I A;  2X02 A;  5E2F A;  3LR3 A;  4OPY A;  2QZ6 A;  3KO6 A;  3QP4 A;  4ARZ B;  1ZHH B;  3TOI A;  3NDE A;  2W1T A;  5DJT A;  4X68 A;  1DP9 A;  2W3D A;  4F3L B;  3IX8 A;  3UO9 A;  4S2I A;  3CLO A;  3FPW A;  4GS9 B;  3BM6 A;  1BTL A;  4JPM A;  3SH9 A;  2OWJ A;  4P6B A;  5CER A;  3HUN A;  3SS4 A;  1N9N A;  3C8C A;  4O0P A;  4X69 A;  3DTE A;  3OZH A;  1K54 C;  4R38 A;  2HGV A;  3VE3 A;  2IWB A;  4RX2 A;  3F1N A;  2I72 A;  3EWK A;  2FH5 A;  3HJI A;  4F94 A;  1H0M A;  5HDS A;  4MEZ A;  1NZO A;  2Y2I A;  4EUV A;  4MNR A;  3VOY A;  3MZF A;  1NZU A;  2Y91 A;  1J3W A;  4X1L A;  2XQZ A;  3ZNT A;  4WEL A;  2W0N A;  2EX8 A;  4IBX A;  5CGW A;  5J7E A;  4R0Q A;  5JYP A;  3ZCZ A;  4MBK A;  1RP5 A;  3SS3 A;  1IOU A;  2JBF A;  1YKD A;  4OP5 A;  2P08 A;  3G30 A;  4LV3 A;  4GJ4 A;  3WRZ A;  4O8G A;  2QJ7 A;  1KE0 A;  3C38 A;  4P6Z S;  1CF0 A;  4AFI A;  4Z1W A;  3UDX A;  3G4P A;  1BLS A;  1BZA A;  1F2K A;  3G32 A;  1V9Z A;  1S4S A;  2XH9 A;  2Q0O A;  1LSV A;  3QNC A;  3IHA A;  3MXQ A;  1F9I A;  4YIN A;  2G7U A;  2ZQD A;  3HCY A;  3S7Q A;  5FEF A;  1UWN X;  3E2L A;  2CC1 A;  3R4K A;  2HPB A;  4CPK A;  1W5D A;  2XF3 A;  3LIF A;  3LR0 A;  2XA7 M;  2WZZ A;  1PW8 A;  3K3D A;  2L0W A;  4I3A A;  3PYP A;  1VEU A;  3O5Y A;  2OLV A;  1UWP X;  1ZKJ A;  4KG5 A;  1TDL A;  2ZBB A;  2AVX A;  2KOI A;  5BOH A;  4JLF A;  2Z6D A;  1DRM A;  3WS4 A;  1XP4 A;  2HJ9 C;  2WAF A; 
#chains in the Genus database with same CATH homology
 3PBN A;  2K31 A;  3NOU C;  2B02 A;  3D72 A;  1W63 M;  2FZ0 A;  2B18 A;  2W1T B;  3FG8 A;  3BQ8 A;  5F5Y A;  5AVF A;  2NUP C;  3RFB A;  3C2W A;  3KSH A;  3OCN A;  3PXP A;  2A2L A;  2DMW A;  2PR6 A;  1DP6 A;  5K5B A;  3SW1 A;  1YAX A;  2VA0 A;  2CMN A;  5FL3 A;  3A0V A;  3E98 A;  2VX8 A;  2O0Y A;  5EFW A;  3KYZ A;  3PBO A;  3F1O B;  3BW6 A;  1MKM A;  5HL6 A;  1EW0 A;  1VB6 A;  3DBA A;  3RTY A;  2KDK A;  4MDZ A;  3PBR A;  1S1Y A;  3UE6 A;  3P01 A;  5AJG A;  3NOT C;  1G28 A;  4B93 A;  2GZA A;  3MF0 A;  4HI4 A;  1T1B A;  4NXG A;  3EEH A;  4HH3 A;  3KSI A;  4FSF A;  5HPI A;  1X0O A;  4NKP A;  5HSQ A;  4BJP A;  2QKP A;  3EQU A;  2VV6 A;  2PYP A;  2L1M A;  4MCW A;  1IFQ A;  3MR0 A;  3PHY A;  3F1P B;  4LRY C;  1XFN A;  3TE8 A;  2W3F A;  4LRZ E;  3VOL A;  3W2Z A;  3S7O A;  4HH2 A;  2PYR A;  5TBM B;  1P0Z A;  5HDD A;  3LR5 A;  4I3I A;  3BQA A;  2R78 A;  3H9W A;  1TS7 A;  2J3T C;  1JNU A;  3E0Y A;  1S1Z A;  1P97 A;  3R7W B;  2VKS A;  3K3C A;  2INW A;  3F1O A;  1YSQ A;  4WF0 A;  5HD5 A;  4EES A;  3IS2 B;  3IBJ A;  1OTB A;  1V9Y A;  3TJZ C;  2O9A A;  3T4T A;  4HJ3 A;  3F1P A;  3MQO A;  4MN7 A;  5AVE A;  1Y28 A;  2M7V A;  2VZW A;  1OJG A;  2OAQ 1;  1OPX A;  5HDC A;  4K08 A;  4EQ1 A;  2W3H A;  3UB6 A;  2XSS A;  4WEJ A;  3PBQ A;  4QPR A;  3RH8 B;  3C30 A;  3S7P A;  4G3W A;  1UGU A;  4HP9 A;  3T4K A;  3UE3 A;  1TS8 A;  3LIE A;  4YOF A;  5DJU A;  4KUO A;  3OCL A;  4Q0J A;  1LT0 A;  4XT2 B;  2P7J A;  4RQ9 A;  3JVU A;  2EA9 A;  4EET B;  1NLY A;  1OJ5 A;  1OTD A;  4OOM A;  2XRO A;  3T4O A;  1STZ A;  4JGO A;  4HQA A;  1ODV A;  2J3W A;  4IHQ A;  5TBM A;  2PHY A;  1GSW A;  1MC0 A;  4HJ4 A;  4UQI S;  3HJK A;  3FC7 A;  3LI9 A;  4HOI A;  4I5S A;  4H6J A;  1XFQ A;  3ULF A;  4HY8 A;  4WUJ A;  5A8B A;  3PR6 A;  4JGR A;  1GSV A;  2ZOI A;  4BBT A;  4BWI A;  3R7W A;  2I9V A;  5L8M A;  4YWZ A;  3CIT A;  1F5M A;  4ME4 A;  1OT6 A;  1VHM A;  3ICY A;  2V1B A;  1T1A A;  3KX0 X;  2HV1 A;  2EWW A;  2JKT I;  2K2N A;  3IS2 A;  3MFX A;  5HD3 A;  1OT9 A;  3OLO A;  4M4X A;  2XA7 S;  4PAU A;  3LIC A;  3BY9 A;  3CUE C;  2PD8 A;  4B9O A;  4R3A A;  3JVV A;  4LLO B;  3T4S A;  5G4Z A;  5HZH A;  5HWV A;  2VJW A;  3LUQ A;  4IUK A;  4NXF A;  4KQD A;  3B42 A;  5DFX A;  2KX6 A;  1YSP A;  4IJG A;  2VGL S;  4R6L A;  2M7U A;  1N9O A;  3OOV A;  5TJJ A;  4KUK A;  4P6Z M;  3MMH A;  3V67 A;  3MQ0 A;  3E4O A;  4L0L A;  1XJ6 A;  3E4P A;  2W3E A;  2WKR A;  3ZYT A;  1BYW A;  4PKY A;  1D7E A;  3KSG A;  4Y2F A;  4I38 A;  5CX7 A;  2J80 A;  3F1N B;  4DN0 A;  2V0W A;  2NUT C;  2YKF A;  1OTA A;  4EER A;  5F68 A;  5C5K A;  1P9R A;  4CLC C;  1S4R A;  4EU0 A;  5IS1 A;  4YNR A;  1OTE A;  1H3Q A;  3CUE A;  3T4J A;  3TRC A;  2V1A A;  3H7W B;  2V0U A;  1GSX A;  2OWH A;  4WL9 A;  4L9G A;  4Q0I A;  4OOL A;  4CLC E;  4CLC B;  4UQI M;  4PKY G;  2Y8H A;  4BBU A;  5DKK A;  3MQQ A;  4HHD A;  1MZU A;  3T50 A;  3PBT A;  4MN6 A;  1NRJ A;  2JKT M;  3LR4 A;  4GW9 A;  4WN5 A;  4L9E A;  1LSW A;  3UMD A;  4ETX A;  3VE4 A;  5J4E A;  3OBF A;  4EEP A;  2OAP 1;  4I39 A;  3LI8 A;  3UB8 A;  1N9L A;  2JHE A;  2HF6 A;  4G3V A;  3E4Q A;  4ARZ A;  2L4R A;  4E04 A;  3NJA A;  2M1C A;  3S7N A;  4ETZ A;  4GLQ A;  4Y3I A;  2WKP A;  2IA2 A;  3H82 A;  3LR3 A;  3EGD C;  3KO6 A;  1G6O A;  2LB5 A;  2ZOH A;  1ZTU A;  4ARZ B;  4MN5 A;  1ZHH B;  3ZQ5 A;  2W1T A;  5DJT A;  1DP9 A;  2W3D A;  4HIA A;  2W3G A;  2A24 A;  2O9C A;  3LIB A;  3LID A;  4F3L B;  2QYB A;  4EW7 A;  2P04 A;  3BY8 A;  2PD7 A;  4NEE D;  3CLO A;  2PDR A;  4Y5F A;  3FPW A;  2PR5 A;  4GS9 B;  4O01 A;  1TS6 A;  3P7N A;  3CAX A;  2OWJ A;  2EWV A;  3BWL A;  5KIZ A;  2PT7 A;  4WEK A;  3A0R A;  3GDI A;  4I3J A;  5HWW A;  2JKR M;  1N9N A;  3C8C A;  4O0P A;  1P9W A;  4EXO A;  2J3T D;  2VEA A;  5DF9 A;  5DFY A;  4R70 A;  3EEA A;  3BJN A;  3T4L A;  4R38 A;  2HGV A;  3PBS A;  4GS9 A;  3VE3 A;  4DJ2 A;  4F3L A;  2QWS A;  2V9A A;  3TW8 A;  4CLC A;  3F1N A;  1T19 A;  3EWK A;  2FH5 A;  5F69 A;  5KSH A;  3A0S A;  5HWT A;  3HJI A;  3H7W A;  4JGQ A;  3OC2 A;  5HDS A;  4EUV A;  1F98 A;  2A24 B;  2VLG A;  5IU1 A;  4GCZ A;  1LL8 A;  4G3K A;  4EEU A;  4PHT A;  3B47 A;  3GEC A;  4UEY A;  3G6O A;  4WEL A;  2W0N A;  4DJ3 A;  2D02 A;  2WKQ A;  1LSX A;  4CLC D;  1XJ3 A;  5J7E A;  2ZMV A;  2GJ3 A;  4IUH A;  4L9F A;  1TS0 A;  2D01 A;  3VV4 A;  2W27 A;  1NLZ A;  4JGP A;  2GNX A;  3CI6 A;  4BBV A;  1IOU A;  4DMZ A;  1YKD A;  3LYX A;  2GX5 A;  3KSF A;  4HJ6 A;  2XRN A;  3UME A;  4CQH A;  2MJ6 A;  3B33 A;  2O99 A;  1DP8 A;  2P08 A;  3UB9 A;  4HP4 A;  2O9B A;  1TD5 A;  2HJE A;  4GJ4 A;  2VGL M;  1NWZ A;  2JKR I;  4O8G A;  2QJ7 A;  3C38 A;  4P6Z S;  4LPZ A;  1TF1 A;  4XT2 A;  1S66 L;  2LB9 A;  4AFI A;  4Z1W A;  2QHK A;  1W63 Q;  3CWF A;  2Y79 A;  5IT5 A;  4BMW A;  5J3W A;  1V9Z A;  3KYQ A;  2Z6C A;  2JN7 A;  1S4S A;  4H6J B;  2ZMF A;  4GHI A;  1LSV A;  1D06 A;  4WLA A;  4ZRR A;  2KLI A;  2YKH A;  3FPV A;  2OOL A;  3LFV A;  1T1C A;  3MJQ A;  3MXQ A;  1F9I A;  3NHQ A;  2G7U A;  3H82 B;  3HCY A;  3NOP C;  3EQV A;  3S7Q A;  3UB7 A;  1UWN X;  1XJ2 A;  1XJ4 A;  3R4K A;  3EGX C;  1S67 L;  5DKL A;  3D3O A;  1T18 A;  4LRX C;  5I5L A;  4NXB A;  1KOU A;  5LBR A;  4HNB A;  3LIF A;  3EOI A;  3LIA A;  3LR0 A;  1H8M A;  2XA7 M;  4II7 A;  2BAS A;  2H28 A;  3K3D A;  4GHI B;  4KQO A;  5F6A A;  3T4Q A;  4FOF A;  2L0W A;  4I3A A;  4Q0H A;  5MC7 A;  3PYP A;  3O5Y A;  2QJ5 A;  2K7S A;  4MMN A;  3U2A A;  5G4Y A;  1UWP X;  2VV8 A;  2ZBB A;  1WA9 A;  3IBR A;  2KOI A;  5HPF A;  1OTI A;  2Z6D A;  1DRM A;  2W1R A;  2VV7 A;  2HJ9 C;  3K2N A;  4NXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...