3KSFA

Structure of frmsr of staphylococcus aureus (reduced form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
b'TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksfA00
3O5YA 2KLIA 1VHMA 5TJJA 5HSQA 2O9AA 2W3FA 5L8MA 2O99A 3NOTC 1F5MA 2ZMFA 3KSGA 3KSIA 5K5BA 5DFXA 2W3EA 2W1TB 2XSSA 3CI6A 4Q0HA 1STZA 2G7UA 1YSPA 2XROA 2K31A 4PAUA 1TF1A 5HL6A 4ETZA 4YOFA 3MMHA 1TD5A 3G6OA 3CITA 2IA2A 2K2NA 2W1RA 3NOPC 2LB9A 4YNRA 3KSFA 3D3OA 5AJGA 4BWIA 2OOLA 5DFYA 2M7UA 2Y79A 1YKDA 3OBFA 5I5LA 4G3VA 2W3GA 1YSQA 3EEAA 3TRCA 3K2NA 4LRYC 4IJGA 5C5KA 4IUHA 4Y5FA 4EUVA 2W3HA 4MCWA 2VKSA 4CQHA 4MN7A 3LFVA 2O0YA 4ME4A 2O9CA 4O01A 3S7OA 4R6LA 4E04A 1ZTUA 3W2ZA 3E0YA 2B18A 3RFBA 3DBAA 3S7QA 4QPRA 4EU0A 2VEAA 4Y2FA 3E98A 2GX5A 2HGVA 3MF0A 4ZRRA 3ZQ5A 2W1TA 4GLQA 4GW9A 4MDZA 3VV4A 5LBRA 4Y3IA 2QYBA 3NHQA 3IBJA 4O0PA 2XRNA 3NOUC 4R70A 2KOIA 3BJNA 2VZWA 4Z1WA 3S7NA 4G3KA 5HPIA 1MC0A 3S7PA 2W3DA 2Y8HA 2VJWA 1MKMA 4IUKA 4ETXA 4DMZA 3R4KA 3HCYA 4FOFA 4G3WA 3C2WA 4LRZE 4MMNA 4Q0JA 2M7VA 2O9BA 3OOVA 4Q0IA 4LRXC 4O8GA 2LB5A 5HPFA 3MQ0A 4RQ9A 3IBRA 4DN0A 3KSHA 3KO6A
chains in the Genus database with same CATH superfamily
2ZQCA 2X71A 2QWSA 3MKFA 5L8MA 3IF6A 3NOTC 1XFQA 2KX6A 4FH2A 3OC2A 4Q0HA 2Y2PA 1KDSA 2XH9A 2P9VA 4JGPA 2J7VA 3LYXA 2H28A 3VP0A 1A0KA 5AJGA 3TG9A 2OOLA 3VP4A 1ERMA 3DWKA 3HJKA 5A92A 1YSQA 3EEAA 5CHJA 2J8YA 5A93A 3FPWA 3S1YA 5C5KA 1MZUA 3FC7A 1UGUA 2VKSA 3W4PA 4H8RA 4NETA 3MFDA 4Z9QA 2O9CA 3PAEA 3W4QA 1PIOA 3W2ZA 5HAQA 2ZC7A 4L9GA 2G2UA 1E25A 3SH8A 4R0QA 4GLQA 5HDCA 4PHTA 5DKKA 4ZAMA 4B93A 2JBFA 4E3OA 3ZGAB 1SKOA 5DTKA 3UPPA 3PXPA 3NC8A 4UQIS 1ES3A 1KGEA 3BQ8A 5CGXA 4BQMA 1DP9A 2QMIA 3DAVA 2W3DA 2WADA 1GA9A 2IWBA 3UDIA 3BYDA 3ICYA 5FQ9A 2ZM2A 3UE0A 4K91A 2WGWA 1S66L 1JTDA 3HLCA 5FEFA 1KE0A 3ITBA 3P7NA 4JGRA 3KO6A 3B3XA 2ZL1A 3H9WA 2IWCA 5AVEA 1YLYA 3G2YA 5FSRA 4E3NA 5M18A 3VE4A 3MMHA 3ZCZA 1CQAA 4LCMA 3VOZA 1BUEA 2IA2A 1G68A 3Q81A 3WS0A 4HJ4A 2JKRI 2WKQA 4PM9A 4WMCD 3G32A 4X25A 2EA9A 4LGWA 3OBFA 3TRCA 5IT5A 4WUJA 3F1OA 3T50A 2WKEA 3UPNA 2PD7A 2HJEA 1MBLA 3QP2A 1DY6A 4HI4A 1C3BA 3NDGA 2GJ3A 4S2PA 5KSHA 1MKIA 2BG1A 2EX9A 3BY9A 3DBAA 2WYXA 4QPRA 5CTMA 2L0WA 1BYWA 5DKLA 3UMDA 4EU0A 4Y2FA 5FQMA 3CUEC 5GLBA 4EBPA 3NULA 3G34A 2Y2JA 2VGLM 5TBMA 1PRQA 1BT5A 2G2WA 3VP2A 4LLOB 3WS1A 3PTEA 5HPIA 5GHYA 2Y8HA 4JXWA 4X1MA 2Q9MA 4G3WA 3C2WA 5EVIA 2W27A 2M7VA 1MWUA 4YFMA 3WS4A 3DW0A 5TR7A 3LR3A 1T19A 3OCNA 3T4KA 2CC1A 3BEBA 5E2GA 3ZG8B 5L09A 4ZBEA 3E2KA 2B5RA 2QPNA 5FAQA 2W1TB 2XFSA 4LV3A 5GHZA 3N4IA 2JKRM 1I2WA 4K0XA 1K25A 1FILA 3UDXA 2OWHA 4M3KA 3MXRA 3GDIA 4YWZA 4HESA 5EM0A 4NXBA 1FIKA 1LSXA 4KZ6A 3V5MA 1LT0A 4X53A 1L0EA 1T1AA 4DKIA 2Y2MA 3C38A 5GLAA 3KX0X 1DJCA 4HP9A 5G4ZA 5DJTA 4OVDA 4UA6A 2HDSA 2O0YA 2Y59A 3LCEA 4EUZA 2WGIA 1O07A 3C4PA 4ZDXA 5MC7A 5L10A 3HL9A 4S2NC 2QKPA 1LHYA 3SS5A 2Y2OA 3UB9A 3NI9A 2PRFA 1PI4A 3PHYA 3DWZA 4OPZA 3VE3A 4PPRA 3BWLA 4Z1WA 5CEDA 1VB6A 4IVIA 2Q9NA 4EW7A 3O88A 2DMWA 4OQIA 2HDUA 2VJWA 4KZ9A 5JYOA 2XK1A 3QP8A 1JTGA 2JKTM 3A3FA 1GHPA 2ZBBA 4R23A 2JN7A 4IEDA 4IVKA 3OPHA 5HAIA 3ZG0A 4RQ9A 4WLAA 1FCMA 1LI0A 2VGKA 1IFQA 3O5YA 1CF0A 4KZBA 4D2OA 1GHIA 2I72A 5HWVA 2XGNA 1KOUA 3P09A 3S4XA 3CI6A 4EBLA 1YT4A 1S1YA 2ZQ7A 5EOEA 3QP5A 2XFTA 1X0OA 1D06A 3NOPC 2A24B 2LB9A 3ZYTA 3BW6A 4NEED 1M6KA 1IOUA 3LIAA 3HJIA 2VV6A 4BL3A 1W5DA 4WL9A 3NBLA 2CMNA 3E4OA 4CLCA 4RVAA 4X56A 3I7JA 5F82A 5KZHA 3N6IA 2VGLS 3WS2A 3OPLA 1CI9A 2B18A 3S7QA 1ESUA 1BULA 3IS2A 3D9YA 1RCJA 3T1SA 5DJUA 4OPYA 1FQGA 3LICA 5LBRA 2Y2GA 5FI7A 1TDLA 2H0YA 4R4RA 1XJ4A 4KQQA 4KZ7A 4ZJ3A 2K7SA 3PYPA 3AGDA 4JGOA 5U47A 5FEGA 1IEMA 2MJ6A 4KG2A 4B4ZA 3QP6A 4KENB 1OPXA 4PMAA 5D3OA 4JKTA 3HREA 3KYQA 2J9PA 4Y13A 3WRTA 4JGQA 3UE3A 1W8YA 3CHWP 2WZXA 3B33A 2LB5A 3E2LA 4KZ8A 2D01A 4KG6A 4S2MA 3MXSA 3E4QA 3Q1FA 3HUOA 1S4SA 3LY3A 4HBTA 3A3IA 5HFOA 4XUZA 2O9AA 1PNEA 3Q82A 4JF6A 4GD6A 3R7WB 4ZJ1A 3SH7A 3EQVA 1PWDA 1ONHA 3FKVA 5GLDA 3IH8A 4QU3A 1YLZA 2Y91A 3KYZA 5CERA 4OQ0A 2L4RA 5F1FA 2EFXA 3CPTB 5DFYA 2V8FA 3EWKA 4GKUA 3ZG5A 1SKFA 3A3JA 5EFWA 5FDSA 4P0MA 4MBKA 1XPBA 2GNXA 1I5QA 3BFEA 3A0RA 3NCKA 1KGGA 2ZMVA 1LSVA 2OWJA 3V3SA 3CZDA 3LR4A 4KQDA 3LIBA 1K57C 1ACFA 4GW9A 4CJNA 4BD1A 1OT6A 1FOFA 4KUOA 4Q8IA 4S2LA 1BSGA 4UA9A 3OZHA 3UPOA 3MKEA 3DTIA 1CEFA 3N7WA 3P98A 4I39A 3LO7A 4DMZA 3IF6C 1S67L 2C6WB 1BLSA 1XKZA 2PHYA 1XA1A 4WZ5A 4KZ4A 4Y15A 1ZG6A 3L9KA 2ZC4B 3CLOA 1ES4A 3D4FA 4ARZB 2HF6A 1V9YA 4DJ2A 4GB7A 3BQAA 2E8JA 4YOFA 3LIFA 1HTZA 5EM1A 4DJ3A 4LENA 3MBZA 3PBQA 4KZAA 3BY8A 4MN6A 4NXEA 3Q07A 1TVFA 4B4XA 1L0DA 3F1NB 4OLDA 3S22A 5CRFA 1D7EA 1JWZA 1WA9A 1MY8A 2A24A 2BTFP 4XT2A 3OCLA 3CMZA 3OPRA 1ODVA 4CPKA 5FDHA 2HP9A 4LV1A 4N9LA 1GSVA 3WRZA 3WWXA 1L0FA 3TW8A 2WKHA 4R3BA 1ZG4A 3U2AA 4NXFA 5TGFA 1NXYA 2EWVA 5GLCA 1K54A 3GVBA 2Y4AA 3LI9A 4HJ6A 2VK3A 4JXGA 4RYEA 3ISGA 1T18A 4HQAA 1IELA 4QWOA 1PW8A 3ZDJA 1F98A 4YINA 3FZCA 1FR6A 2XLNA 4DE0A 5L07A 3MQ0A 4RA7A 4MLLA 2J3WA 3UN7A 4JF4A 5DTSA 3IHBA 3HLDA 3K3DA 2PYPA 4JPMA 1KE3A 3AGEA 2WKRA 2W3EA 2XDMA 3VSKA 4GD8A 1K55A 1J9MA 2OAQ1 1P0ZA 1F9IA 2D02A 3SS4A 3MXQA 1LL8A 3F1PB 3BLMA 1K0KA 1H3QA 3ZNYA 1AWIA 5EVEA 3G30A 5F69A 5HX9A 1YKDA 2DNSA 4F94A 4P6ZM 3R7WA 2HJ9C 1TS6A 4IJGA 4Y5FA 3IF5A 2W3HA 1M40A 4JXVA 2QJ7A 3PAGA 4DDSA 1QMFA 4K0WA 4ME4A 1ZC2A 5J3WA 1ZTUA 4PKYG 4HEFA 3SH9A 4HP4A 4R3AA 2GDNA 2HGVA 4ZRRA 3ZNTA 5EVIC 2UV0E 5HZHA 1DJAA 2DRWA 3QHYA 2V1AA 4GZBA 2Y2IA 4G3KA 3BFGA 4ZTKA 3S7PA 2PBDP 3MS6A 2WKPA 2XD5A 1P97A 1PWGA 4KQRA 2EX2A 4LRZE 3OOVA 4EBNA 1XGIA 4EESA 3M6BA 4X69A 3UB6A 1NLYA 3NDEA 1DP8A 2XEPA 5AQBA 3CJMA 1QMEA 3Q7VA 2V1ZA 5J4EA 2ZOIA 3SS3A 1STZA 5CGSA 1YSPA 5KIZA 4PAUA 4A5RA 4MN5A 4PM7A 3G6OA 4LCLA 2K2NA 1FSYA 4YNRA 3KSFA 3RH8B 4LFUA 3QNCA 4E3JA 4O7DA 3GSGA 1CJFA 3T12B 5DF9A 3IWQA 4EUVA 4H6JA 1N9OA 3UO9A 3UY6A 4BD0A 2WAEA 4I3IA 4JBFA 5F6AA 2B95A 3MZEA 5KSCA 4UEYA 2PD8A 1MXOA 2GZAA 4GCZA 3JYIA 1TDGA 3F1NA 1E3UA 3JVUA 4WM9A 4X6TA 2AVXA 2QYBA 1WYBA 4Y0UA 2WK0A 1SHVA 5FA7A 1U60A 3A3DA 4E3KA 1MC0A 3B47A 1G6AA 3SZTA 3LEZA 1BLCA 2RL3A 2ZQDA 4FOFA 1PW1A 3UB5P 4MMNA 1RGYA 5HWWA 1F2KA 1ES5A 3C7UA 1NYMA 3UB8A 1PI5A 1NZOA 1HLUP 2HP5A 1RGZA 3FYZA 4QD4A 1W63M 3KSHA 4HH2A 2ZC5B 5TJJA 5HSQA 2V0WA 5KMWA 3IH9A 2Z2MB 1L3LA 5BOHA 1XFNA 4U0TA 1XXMA 1DRMA 5DF8A 2J3TC 2RCXA 5HL6A 4ETZA 4I3AA 4P6ZS 5AQ9A 3CG5A 2OSUA 1YM1A 4CLCC 1LSWA 1LLBA 1V9ZA 3GMWA 3HLFA 4S2JA 1HVBA 2INWA 3ZG9B 1BLPA 3EQUA 3UNWA 4E6XA 3Q7ZA 3LI8A 3BRMA 1K6SA 2HDRA 1UWNX 5L2FA 3OPPA 4EEPA 5FQQA 2VV8A 4CQHA 5EVID 3MZFA 5TFQA 4MN7A 4BBTA 4EQIA 1VETB 4QHCA 3OLOA 4F3LB 4E3IA 5E2EA 1XJ6A 4ZJ2A 2VV7A 2H0TA 1S6RA 1WYCA 2P9VB 2PR5A 3IBJA 1PYYA 4OQGA 2ZQAA 2Y2QA 2V1BA 1YPRA 1H8ZA 4ETXA 2JKGA 3ZFZA 3R4KA 3MJQA 5CTNA 1BZAA 4OOMA 3QP1A 4R3JA 2O9BA 5M19A 3EOIA 5A90A 3AGFA 2PU4A 1VHMA 1W79A 3IQAA 5AQ7A 4NG2A 2G7UA 2K31A 1TF1A 4M4XA 2VLGA 3BFCA 2EXAA 1TD5A 3HBRA 4KQOA 3CITA 3IX3A 1OTDA 1VM1A 3N8RA 1IYSA 2P7JA 4DE3A 4BWIA 3JVVA 2M1CA 2Y79A 1MPLA 1FCOA 2WZZA 4OQHA 4GS9B 5HL1A 2W3GA 5CXWA 1AXBA 3K2NA 3T1RA 2IWDA 5IHVA 1H5XA 1H8MA 4IBXA 3TE8A 3VFFA 3UDFA 2ZMAA 3V67A 1GSWA 1KVLA 2H10A 2HPBA 1N9BA 3V50A 2QJ5A 1OMEA 1W7FA 1YMXA 3MF0A 2W1TA 1S1ZA 4HIAA 3VSLA 2OLVA 4WZ5C 1VQQA 3NY4A 3BJNA 3VP1A 2L1MA 2BASA 1Q2PA 3H7WB 1NZUA 3UE1A 1UWPX 2Y2LA 1E4DA 5J7EA 4RX2A 2W0NA 3LIDA 4N92A 3MZDA 1L2SA 2B02A 1OTIA 2J3TD 5HD3A 2ZOHA 3LGOA 4CLCD 1JWPA 2JKFA 3FPVA 1PZPA 1S0WA 3IWOA 4EEUA 2KLIA 2ZD8A 4IBRA 3JPUA 2O99A 1F5MA 5K5BA 3TOIA 4HHDA 5FQJA 5TBMB 3O86A 4MNRA 2VA0A 3D3OA 4WYYA 3RXXA 5HW3A 3KYEA 1KDWA 3CWFA 3LUQA 5F68A 3T1QB 3T4SA 1J3WA 3G2ZA 5EVIB 1EROA 3IXDA 4HBUA 1ZKJA 2PR6A 5GL9A 4KZ3A 1K6RA 1K56A 1YMSA 4N1XA 4DE2A 2HZ5A 3PBSA 4DRTA 1NY0A 3E0YA 1YLJA 1K54C 3RFBA 4XUXA 1OT9A 1N9NA 1H8YA 4KG5A 2ZQ8A 2NUPC 4HY8A 2OV5A 2GX5A 4OONA 2ZC3B 2X02A 3IXGA 1T1CA 4BMWA 2V20A 1IKGA 1TS7A 2JE5A 4WMCA 3VOYA 3NOUC 5DVAA 3QNBA 1KE4A 1VETA 3S7NA 1XP4A 4F3LA 4P87A 4I5SA 4Y0OA 3BM6A 1GSXA 5DTTA 2R9XA 4EXOA 1KVMA 4U3TA 4Q0JA 3RXWA 1K55C 3SW1A 3EGXC 5EE8A 4GDBA 4AFIA 3ZVTA 3E4PA 5I94A 5HPFA 1GA0A 5G18A 3VFHA 1YLTA 2YKFA 2Z2LB 1TEMA 3KSGA 3KSIA 3B42A 4KZ5A 2UWXA 4B9OA 4OLGA 4PKYA 5FI2A 4Y0TA 4MBHA 5FAOA 1D1JA 4C3QA 4WZ4A 4DXBA 3PBOA 2M7UA 1CI8A 4N9KA 4GDNA 4G3VA 3O87A 4NK3A 4N1HA 4NKPA 1N9LA 4D60A 4LRYC 3N8SA 1I2SA 5F5YA 3RJUA 1XJ2A 2QZ6A 3NIAA 2VGJA 2HP6A 4XXRA 4I3JA 4OPQA 3NECA 4GS9A 3HLEA 2KDKA 3QP4A 3BECA 1K4FA 3BLSA 4LV2A 1JWVA 3VP3A 1YAXA 2A3UA 4FTXA 1PFLA 1IYQA 3EEHA 3ZVWA 1K56D 1K4EA 1EI5A 3CPTA 5CEBA 3IXHA 3T4JA 4X68A 4P85A 1S4RA 4X1LA 4DXCA 4O8GA 1FCNA 3C5AA 3LEQA 2OAP1 5EOOA 4CLCB 4P6BA 3H7WA 2ACGA 1NRFA 2JC7A 5HDSA 2WKIA 3IS2B 2W3FA 4WBGA 4DF6A 3FG8A 4S2KA 3RTYA 2WGVA 1YLPA 2Q0OA 3IWIA 2R78A 4MBFA 2FZ0A 4C6YA 4E3LA 3UE6A 5J8XA 4WELA 1RP5A 3EGDC 1YQSA 4Y7PA 5JYPA 5FAPA 3G4PA 1MWSA 5FQKA 4E6WA 4FSFA 5FL3A 3IX4A 4OPRA 2PBYA 3WS5A 1P9WA 2XD1A 2YKHA 3C30A 5FATA 4BBVA 3D72A 4ARZA 3LR0A 1TS0A 3LY4A 4GHIB 4L9FA 2V2FF 4HH3A 2V8CA 3ZG7B 2V9AA 2XR0A 1G5UA 3VV4A 1XX2A 2PYRA 3NHQA 2JKTI 4HJ3A 5CX7A 4OP8A 5E2FA 2KOIA 4LV0A 1SCWA 2VZWA 4EETB 1O7EA 2VX8A 1LI9A 4NXGA 4S2IA 3BFDA 1NJ4A 3PBNA 1IYOA 2PU2A 4UA7A 1Z6FA 1P9RA 3H82B 1K38A 3CUEA 3G35A 4QJGA 3G31A 4HNBA 1G6OA 4JXSA 2J9OA 1JVJA 5E43A 4PM5A 4EQ1A 2ZM0A 5IU1A 1ES2A 1ZHHB 2EFUA 3DTEA 4U0XA 2P08A 1FR1A 2Y2NA 1VEUB 4ID4A 3MR0A 2XSSA 3L7HA 4DDYA 2XROA 3GV9A 1DJBA 1BLHA 3IXBA 5E2HA 5HAPA 5FI6A 2WUQA 2X01A 1HZOA 3N8LA 4JF5A 1DP6A 1PWCA 4FH4A 3CAXA 2Y55A 2J80A 2Z6CA 3PBTA 3GECA 4IUHA 4EWFA 5HDDA 2DCFA 3T1XA 5CHMA 5EECA 1Y28A 1Y54A 5CGWA 4OOLA 1OJ5A 3FWLA 5F83A 2XA7M 1OTAA 5A8BA 1G28A 3HLGA 1EW0A 3BFFA 4WN5A 5EV0A 5F1GA 2VEAA 3V39A 2ZM8A 3HUMA 2EWWA 5CHUA 4R38A 2QHKA 4O0PA 5FQIA 3VMAA 3TSGA 4CLCE 3F1PA 4QB8A 1NYYA 4S2NA 1FSWA 2FFYA 2FH5A 4BLMA 4IUKA 1NRJA 4I38A 3IF6B 3C8CA 5HARA 2E8IA 1W63Q 1CK3A 3M2KA 1XA7A 4HOIA 3V3RA 3DTKA 4LRXC 5CECA 1MWTA 4S2OA 2C5WB 4XT2B 3PBRA 3IBRA 3UMEA 4X55A 2FFFB 4BENA 3GQZA 3A0SA 4OKPA 1Q2QA 3K3CA 3HUNA 2PAVP 3DTMA 2A49A 3IX8A 1E3UD 3T4TA 4UAAA 4WEJA 1MWRA 4FD8A 2H5SA 2W1RA 1PZOA 2P74A 5EUAA 5AVFA 4KUKA 4B88A 5FASA 3W4OA 3MFXA 5I5LA 2A2LA 4QY6A 2Z6DA 4WEKA 4EV4A 1WE4A 2OLUA 5HD5A 5DF7A 3P01A 1IKIA 4OP5A 2NUTC 3LFVA 1SKOB 4UHUA 1OTEA 1N4OA 3MSHA 4E04A 3O3VA 1ONGA 2P04A 1T1BA 5GHXA 1ERQA 3E98A 2JHEA 4II7A 5M1AA 1NWZA 3NJAA 2V0UA 2XQZA 3T4OA 4MDZA 2Y2KA 4Y3IA 2WGWB 1EWZA 4MEZA 5G4YA 3A3EA 4R70A 4C75A 5AQAA 4GNUA 2XF3A 3LR5A 3HVFA 3T4QA 4GHIA 2ZL1B 2EXBA 1L0GA 1MKMA 2EX8A 4Y17A 3HCYA 3GRJA 3FV7A 4OH0A 4UQIM 4L0LA 4RX3A 1HD8A 1OJGA 4Q0IA 3TJZC 1OTBA 4E3MA 2JCHA 1GCEA 2WAFA 4PM8A 1XJ3A 4BJPA 5IS1A 3HLBA 5A91A 1KGFA 4DN0A 3VOLA 3GR2A 1BTLA 2ZLYA 3H82A 4PM6A 2HDQA 2ZMFA 1CEGA 1LL9A 3M6HA 5DFXA 3A0VA 2ZJ9A 1NLZA 3F1OB 2PT7A 1JNUA 1ALQA 1SZVA 3W8KA 3HLWA 4GN2A 2PDRA 2Y2HA 2EX6A 5HWTA 4ESPA 1GHMA 2BLSA 2ZC6B 4FCFA 1VEUA 4BL2A 1ESIA 2XA7S 1SDNA 4K08A 4MCWA 4QY5A 4LPZA 3M2JA 1XGJA 3FKWA 3U4LP 4O01A 1SDEA 1LL5A 3S7OA 4R6LA 3UB7A 3PR6A 4WF0A 3MQOA 4GJ4A 4IHQA 3GTCA 4BBUA 3Q7VB 3C7VA 3ZQ5A 4OOYA 4FUWA 4R4SA 3ITAA 1H0MA 2I9VA 5EPHA 4R1GA 3C4OA 3IT9A 5EVLA 4DE1A 2XRNA 3IHAA 2R9WA 1Y4OA 4L9EA 3T4LA 2HV1A 3SOIA 3ZHHA 2ZQ9A 1W8QA 1IYPA 1K57A 1TS8A 4H6JB 3MQQA 4EERA 4GOGA 1YLWA 4JLFA 1Z09A 3ULFA 3LIEA
chains in the Genus database with same CATH topology
4HH2A 1S4SA 5HDSA 2QWSA 5TJJA 3IS2B 5HSQA 2V0WA 2O9AA 2W3FA 5L8MA 3NOTC 3FG8A 3R7WB 1XFQA 3RTYA 2KX6A 1XFNA 3EQVA 3OC2A 1DRMA 4Q0HA 2J3TC 5HL6A 4JGPA 4I3AA 4P6ZS 4ETZA 3LYXA 2R78A 2FZ0A 2H28A 4CLCC 1LSWA 3KYZA 3UE6A 1V9ZA 2L4RA 4WELA 5AJGA 2OOLA 5DFYA 3EGDC 3EWKA 3HJKA 2INWA 1YSQA 3EEAA 3EQUA 5EFWA 3FPWA 3LI8A 5C5KA 1UWNX 1MZUA 3FC7A 2GNXA 1UGUA 4FSFA 2VKSA 4EEPA 5FL3A 3A0RA 2VV8A 4CQHA 4MN7A 4BBTA 1P9WA 2O9CA 2ZMVA 2YKHA 3C30A 1LSVA 2OWJA 3W2ZA 4BBVA 3D72A 3OLOA 4ARZA 3LR0A 4L9GA 4F3LB 1TS0A 3LR4A 4GHIB 4L9FA 4KQDA 3LIBA 4HH3A 1XJ6A 2VV7A 2V9AA 4GLQA 5HDCA 4GW9A 4PHTA 5DKKA 3VV4A 2PYRA 3NHQA 2JKTI 2PR5A 1OT6A 4B93A 3IBJA 4HJ3A 5CX7A 3PXPA 4KUOA 4EETB 2KOIA 4UQIS 2VZWA 2VX8A 3BQ8A 4NXGA 2V1BA 3PBNA 1DP9A 2W3DA 1P9RA 3H82B 4I39A 3CUEA 4ETXA 4DMZA 3R4KA 3ICYA 1S67L 3MJQA 2PHYA 4HNBA 1G6OA 4OOMA 2O9BA 1S66L 3EOIA 4EQ1A 3P7NA 4JGRA 3CLOA 3KO6A 4ARZB 3H9WA 2HF6A 1V9YA 5IU1A 5AVEA 1VHMA 1ZHHB 2P08A 3MR0A 2XSSA 4DJ2A 3BQAA 2G7UA 2XROA 3VE4A 2K31A 1TF1A 4M4XA 4YOFA 3MMHA 2VLGA 3LIFA 1TD5A 4KQOA 3CITA 4DJ3A 2IA2A 1OTDA 3PBQA 4HJ4A 2JKRI 2WKQA 3BY8A 2P7JA 4MN6A 4NXEA 4BWIA 3JVVA 2M1CA 2Y79A 2EA9A 1DP6A 3OBFA 4GS9B 2W3GA 3TRCA 5IT5A 3CAXA 4WUJA 3K2NA 3F1OA 3T50A 2J80A 2Z6CA 3F1NB 3PBTA 3GECA 4IUHA 1D7EA 1H8MA 2PD7A 5HDDA 1WA9A 3TE8A 2HJEA 4HI4A 2A24A 3V67A 1Y28A 4XT2A 2GJ3A 1GSWA 4OOLA 1OJ5A 3OCLA 5KSHA 2XA7M 3BY9A 3DBAA 1OTAA 2QJ5A 1G28A 4QPRA 5A8BA 1EW0A 1ODVA 2L0WA 1BYWA 4WN5A 5DKLA 3UMDA 4EU0A 2VEAA 4Y2FA 3CUEC 3MF0A 1GSVA 2W1TA 1S1ZA 2EWWA 4HIAA 3TW8A 4R38A 2QHKA 2VGLM 5TBMA 4O0PA 4CLCE 3U2AA 3BJNA 3F1PA 4NXFA 2L1MA 2EWVA 2BASA 3H7WB 4LLOB 5HPIA 1UWPX 5J7EA 3LI9A 2FH5A 2Y8HA 4IUKA 4HJ6A 1NRJA 2W0NA 3LIDA 4I38A 3C8CA 1T18A 2B02A 4G3WA 4HQAA 1W63Q 3C2WA 2W27A 4HOIA 1OTIA 2M7VA 4LRXC 1F98A 2J3TD 5HD3A 2ZOHA 3LR3A 1T19A 3OCNA 4XT2B 3MQ0A 3PBRA 3IBRA 3T4KA 3UMEA 4CLCD 3FPVA 4EEUA 3A0SA 2J3WA 2KLIA 3K3CA 2O99A 3K3DA 1F5MA 2PYPA 5K5BA 2WKRA 2W3EA 2W1TB 2OAQ1 4HHDA 1P0ZA 3T4TA 4WEJA 2JKRM 1F9IA 5TBMB 2D02A 3MXQA 2W1RA 2VA0A 1LL8A 3F1PB 3D3OA 2OWHA 5AVFA 1H3QA 4KUKA 3GDIA 4YWZA 5F69A 4NXBA 3CWFA 1LSXA 1YKDA 3MFXA 5I5LA 3LUQA 2A2LA 4P6ZM 5F68A 3R7WA 1LT0A 3T4SA 1T1AA 2Z6DA 4WEKA 2HJ9C 3C38A 5HD5A 1TS6A 4IJGA 4Y5FA 3P01A 3KX0X 2W3HA 2QJ7A 4HP9A 5G4ZA 5DJTA 2PR6A 2NUTC 3LFVA 2O0YA 4ME4A 5J3WA 1OTEA 3PBSA 4E04A 1ZTUA 4PKYG 5MC7A 3E0YA 2P04A 3RFBA 1OT9A 1N9NA 2QKPA 1T1BA 2NUPC 4HY8A 4HP4A 4R3AA 3E98A 2GX5A 2JHEA 2HGVA 4ZRRA 4II7A 3UB9A 1NWZA 3NJAA 2V0UA 3T4OA 4MDZA 4Y3IA 1T1CA 4BMWA 3PHYA 5HZHA 1TS7A 2V1AA 5G4YA 3VE3A 3NOUC 4R70A 3BWLA 4Z1WA 3S7NA 3LR5A 1VB6A 4G3KA 4F3LA 3T4QA 4EW7A 4GHIA 2DMWA 4I5SA 3S7PA 1GSXA 1MKMA 2VJWA 3HCYA 4EXOA 2WKPA 1P97A 2JKTM 4UQIM 4L0LA 4LRZE 4Q0JA 1OJGA 3SW1A 3OOVA 4Q0IA 3TJZC 1OTBA 3EGXC 2ZBBA 4EESA 2JN7A 4AFIA 3E4PA 1XJ3A 4BJPA 5HPFA 3UB6A 4RQ9A 1NLYA 4WLAA 5IS1A 4DN0A 3VOLA 3O5YA 1IFQA 1DP8A 2YKFA 3H82A 5HWVA 1KOUA 2ZMFA 3KSGA 5J4EA 3KSIA 5DFXA 3A0VA 3B42A 3CI6A 2ZOIA 3F1OB 1NLZA 1S1YA 2PT7A 1STZA 1YSPA 5KIZA 4B9OA 4PAUA 4PKYA 1JNUA 1X0OA 4MN5A 3G6OA 2K2NA 1D06A 2PDRA 3NOPC 2A24B 2LB9A 4YNRA 3KSFA 3RH8B 3ZYTA 3BW6A 3PBOA 5HWTA 2M7UA 4NEED 1IOUA 4G3VA 3LIAA 3HJIA 2VV6A 2XA7S 4NKPA 1N9LA 4WL9A 4LRYC 5DF9A 4EUVA 4K08A 4H6JA 5F5YA 1N9OA 2CMNA 4MCWA 1XJ2A 3E4OA 4LPZA 4CLCA 4O01A 3S7OA 4R6LA 2VGLS 4I3IA 5F6AA 3UB7A 2B18A 3PR6A 4WF0A 3MQOA 4GJ4A 3S7QA 4UEYA 4I3JA 2PD8A 4IHQA 4GS9A 3IS2A 2KDKA 2GZAA 4GCZA 4BBUA 3ZQ5A 3F1NA 3JVUA 5DJUA 3LICA 2I9VA 5LBRA 2QYBA 1YAXA 1XJ4A 2K7SA 2XRNA 3PYPA 4JGOA 3EEHA 4L9EA 3T4LA 2HV1A 2MJ6A 1MC0A 1OPXA 3B47A 3T4JA 3KYQA 1S4RA 4FOFA 4JGQA 3UE3A 4MMNA 5HWWA 1TS8A 4H6JB 3MQQA 4EERA 3UB8A 4O8GA 3B33A 2LB5A 4CLCB 2OAP1 3ULFA 2D01A 3H7WA 3E4QA 3LIEA 1W63M 3KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Y A;  2KLI A;  1VHM A;  5TJJ A;  5HSQ A;  2O9A A;  2W3F A;  5L8M A;  2O99 A;  3NOT C;  1F5M A;  2ZMF A;  3KSG A;  3KSI A;  5K5B A;  5DFX A;  2W3E A;  2W1T B;  2XSS A;  3CI6 A;  4Q0H A;  1STZ A;  2G7U A;  1YSP A;  2XRO A;  2K31 A;  4PAU A;  1TF1 A;  5HL6 A;  4ETZ A;  4YOF A;  3MMH A;  1TD5 A;  3G6O A;  3CIT A;  2IA2 A;  2K2N A;  2W1R A;  3NOP C;  2LB9 A;  4YNR A;  3KSF A;  3D3O A;  5AJG A;  4BWI A;  2OOL A;  5DFY A;  2M7U A;  2Y79 A;  1YKD A;  3OBF A;  5I5L A;  4G3V A;  2W3G A;  1YSQ A;  3EEA A;  3TRC A;  3K2N A;  4LRY C;  4IJG A;  5C5K A;  4IUH A;  4Y5F A;  4EUV A;  2W3H A;  4MCW A;  2VKS A;  4CQH A;  4MN7 A;  3LFV A;  2O0Y A;  4ME4 A;  2O9C A;  4O01 A;  3S7O A;  4R6L A;  4E04 A;  1ZTU A;  3W2Z A;  3E0Y A;  2B18 A;  3RFB A;  3DBA A;  3S7Q A;  4QPR A;  4EU0 A;  2VEA A;  4Y2F A;  3E98 A;  2GX5 A;  2HGV A;  3MF0 A;  4ZRR A;  3ZQ5 A;  2W1T A;  4GLQ A;  4GW9 A;  4MDZ A;  3VV4 A;  5LBR A;  4Y3I A;  2QYB A;  3NHQ A;  3IBJ A;  4O0P A;  2XRN A;  3NOU C;  4R70 A;  2KOI A;  3BJN A;  2VZW A;  4Z1W A;  3S7N A;  4G3K A;  5HPI A;  1MC0 A;  3S7P A;  2W3D A;  2Y8H A;  2VJW A;  1MKM A;  4IUK A;  4ETX A;  4DMZ A;  3R4K A;  3HCY A;  4FOF A;  4G3W A;  3C2W A;  4LRZ E;  4MMN A;  4Q0J A;  2M7V A;  2O9B A;  3OOV A;  4Q0I A;  4LRX C;  4O8G A;  2LB5 A;  5HPF A;  3MQ0 A;  4RQ9 A;  3IBR A;  4DN0 A;  3KSH A;  3KO6 A; 
#chains in the Genus database with same CATH topology
 2ZQC A;  2X71 A;  2QWS A;  3MKF A;  5L8M A;  3IF6 A;  3NOT C;  1XFQ A;  2KX6 A;  4FH2 A;  3OC2 A;  4Q0H A;  2Y2P A;  1KDS A;  2XH9 A;  2P9V A;  4JGP A;  2J7V A;  3LYX A;  2H28 A;  3VP0 A;  1A0K A;  5AJG A;  3TG9 A;  2OOL A;  3VP4 A;  1ERM A;  3DWK A;  3HJK A;  5A92 A;  1YSQ A;  3EEA A;  5CHJ A;  2J8Y A;  5A93 A;  3FPW A;  3S1Y A;  5C5K A;  1MZU A;  3FC7 A;  1UGU A;  2VKS A;  3W4P A;  4H8R A;  4NET A;  3MFD A;  4Z9Q A;  2O9C A;  3PAE A;  3W4Q A;  1PIO A;  3W2Z A;  5HAQ A;  2ZC7 A;  4L9G A;  2G2U A;  1E25 A;  3SH8 A;  4R0Q A;  4GLQ A;  5HDC A;  4PHT A;  5DKK A;  4ZAM A;  4B93 A;  2JBF A;  4E3O A;  3ZGA B;  1SKO A;  5DTK A;  3UPP A;  3PXP A;  3NC8 A;  4UQI S;  1ES3 A;  1KGE A;  3BQ8 A;  5CGX A;  4BQM A;  1DP9 A;  2QMI A;  3DAV A;  2W3D A;  2WAD A;  1GA9 A;  2IWB A;  3UDI A;  3BYD A;  3ICY A;  5FQ9 A;  2ZM2 A;  3UE0 A;  4K91 A;  2WGW A;  1S66 L;  1JTD A;  3HLC A;  5FEF A;  1KE0 A;  3ITB A;  3P7N A;  4JGR A;  3KO6 A;  3B3X A;  2ZL1 A;  3H9W A;  2IWC A;  5AVE A;  1YLY A;  3G2Y A;  5FSR A;  4E3N A;  5M18 A;  3VE4 A;  3MMH A;  3ZCZ A;  1CQA A;  4LCM A;  3VOZ A;  1BUE A;  2IA2 A;  1G68 A;  3Q81 A;  3WS0 A;  4HJ4 A;  2JKR I;  2WKQ A;  4PM9 A;  4WMC D;  3G32 A;  4X25 A;  2EA9 A;  4LGW A;  3OBF A;  3TRC A;  5IT5 A;  4WUJ A;  3F1O A;  3T50 A;  2WKE A;  3UPN A;  2PD7 A;  2HJE A;  1MBL A;  3QP2 A;  1DY6 A;  4HI4 A;  1C3B A;  3NDG A;  2GJ3 A;  4S2P A;  5KSH A;  1MKI A;  2BG1 A;  2EX9 A;  3BY9 A;  3DBA A;  2WYX A;  4QPR A;  5CTM A;  2L0W A;  1BYW A;  5DKL A;  3UMD A;  4EU0 A;  4Y2F A;  5FQM A;  3CUE C;  5GLB A;  4EBP A;  3NUL A;  3G34 A;  2Y2J A;  2VGL M;  5TBM A;  1PRQ A;  1BT5 A;  2G2W A;  3VP2 A;  4LLO B;  3WS1 A;  3PTE A;  5HPI A;  5GHY A;  2Y8H A;  4JXW A;  4X1M A;  2Q9M A;  4G3W A;  3C2W A;  5EVI A;  2W27 A;  2M7V A;  1MWU A;  4YFM A;  3WS4 A;  3DW0 A;  5TR7 A;  3LR3 A;  1T19 A;  3OCN A;  3T4K A;  2CC1 A;  3BEB A;  5E2G A;  3ZG8 B;  5L09 A;  4ZBE A;  3E2K A;  2B5R A;  2QPN A;  5FAQ A;  2W1T B;  2XFS A;  4LV3 A;  5GHZ A;  3N4I A;  2JKR M;  1I2W A;  4K0X A;  1K25 A;  1FIL A;  3UDX A;  2OWH A;  4M3K A;  3MXR A;  3GDI A;  4YWZ A;  4HES A;  5EM0 A;  4NXB A;  1FIK A;  1LSX A;  4KZ6 A;  3V5M A;  1LT0 A;  4X53 A;  1L0E A;  1T1A A;  4DKI A;  2Y2M A;  3C38 A;  5GLA A;  3KX0 X;  1DJC A;  4HP9 A;  5G4Z A;  5DJT A;  4OVD A;  4UA6 A;  2HDS A;  2O0Y A;  2Y59 A;  3LCE A;  4EUZ A;  2WGI A;  1O07 A;  3C4P A;  4ZDX A;  5MC7 A;  5L10 A;  3HL9 A;  4S2N C;  2QKP A;  1LHY A;  3SS5 A;  2Y2O A;  3UB9 A;  3NI9 A;  2PRF A;  1PI4 A;  3PHY A;  3DWZ A;  4OPZ A;  3VE3 A;  4PPR A;  3BWL A;  4Z1W A;  5CED A;  1VB6 A;  4IVI A;  2Q9N A;  4EW7 A;  3O88 A;  2DMW A;  4OQI A;  2HDU A;  2VJW A;  4KZ9 A;  5JYO A;  2XK1 A;  3QP8 A;  1JTG A;  2JKT M;  3A3F A;  1GHP A;  2ZBB A;  4R23 A;  2JN7 A;  4IED A;  4IVK A;  3OPH A;  5HAI A;  3ZG0 A;  4RQ9 A;  4WLA A;  1FCM A;  1LI0 A;  2VGK A;  1IFQ A;  3O5Y A;  1CF0 A;  4KZB A;  4D2O A;  1GHI A;  2I72 A;  5HWV A;  2XGN A;  1KOU A;  3P09 A;  3S4X A;  3CI6 A;  4EBL A;  1YT4 A;  1S1Y A;  2ZQ7 A;  5EOE A;  3QP5 A;  2XFT A;  1X0O A;  1D06 A;  3NOP C;  2A24 B;  2LB9 A;  3ZYT A;  3BW6 A;  4NEE D;  1M6K A;  1IOU A;  3LIA A;  3HJI A;  2VV6 A;  4BL3 A;  1W5D A;  4WL9 A;  3NBL A;  2CMN A;  3E4O A;  4CLC A;  4RVA A;  4X56 A;  3I7J A;  5F82 A;  5KZH A;  3N6I A;  2VGL S;  3WS2 A;  3OPL A;  1CI9 A;  2B18 A;  3S7Q A;  1ESU A;  1BUL A;  3IS2 A;  3D9Y A;  1RCJ A;  3T1S A;  5DJU A;  4OPY A;  1FQG A;  3LIC A;  5LBR A;  2Y2G A;  5FI7 A;  1TDL A;  2H0Y A;  4R4R A;  1XJ4 A;  4KQQ A;  4KZ7 A;  4ZJ3 A;  2K7S A;  3PYP A;  3AGD A;  4JGO A;  5U47 A;  5FEG A;  1IEM A;  2MJ6 A;  4KG2 A;  4B4Z A;  3QP6 A;  4KEN B;  1OPX A;  4PMA A;  5D3O A;  4JKT A;  3HRE A;  3KYQ A;  2J9P A;  4Y13 A;  3WRT A;  4JGQ A;  3UE3 A;  1W8Y A;  3CHW P;  2WZX A;  3B33 A;  2LB5 A;  3E2L A;  4KZ8 A;  2D01 A;  4KG6 A;  4S2M A;  3MXS A;  3E4Q A;  3Q1F A;  3HUO A;  1S4S A;  3LY3 A;  4HBT A;  3A3I A;  5HFO A;  4XUZ A;  2O9A A;  1PNE A;  3Q82 A;  4JF6 A;  4GD6 A;  3R7W B;  4ZJ1 A;  3SH7 A;  3EQV A;  1PWD A;  1ONH A;  3FKV A;  5GLD A;  3IH8 A;  4QU3 A;  1YLZ A;  2Y91 A;  3KYZ A;  5CER A;  4OQ0 A;  2L4R A;  5F1F A;  2EFX A;  3CPT B;  5DFY A;  2V8F A;  3EWK A;  4GKU A;  3ZG5 A;  1SKF A;  3A3J A;  5EFW A;  5FDS A;  4P0M A;  4MBK A;  1XPB A;  2GNX A;  1I5Q A;  3BFE A;  3A0R A;  3NCK A;  1KGG A;  2ZMV A;  1LSV A;  2OWJ A;  3V3S A;  3CZD A;  3LR4 A;  4KQD A;  3LIB A;  1K57 C;  1ACF A;  4GW9 A;  4CJN A;  4BD1 A;  1OT6 A;  1FOF A;  4KUO A;  4Q8I A;  4S2L A;  1BSG A;  4UA9 A;  3OZH A;  3UPO A;  3MKE A;  3DTI A;  1CEF A;  3N7W A;  3P98 A;  4I39 A;  3LO7 A;  4DMZ A;  3IF6 C;  1S67 L;  2C6W B;  1BLS A;  1XKZ A;  2PHY A;  1XA1 A;  4WZ5 A;  4KZ4 A;  4Y15 A;  1ZG6 A;  3L9K A;  2ZC4 B;  3CLO A;  1ES4 A;  3D4F A;  4ARZ B;  2HF6 A;  1V9Y A;  4DJ2 A;  4GB7 A;  3BQA A;  2E8J A;  4YOF A;  3LIF A;  1HTZ A;  5EM1 A;  4DJ3 A;  4LEN A;  3MBZ A;  3PBQ A;  4KZA A;  3BY8 A;  4MN6 A;  4NXE A;  3Q07 A;  1TVF A;  4B4X A;  1L0D A;  3F1N B;  4OLD A;  3S22 A;  5CRF A;  1D7E A;  1JWZ A;  1WA9 A;  1MY8 A;  2A24 A;  2BTF P;  4XT2 A;  3OCL A;  3CMZ A;  3OPR A;  1ODV A;  4CPK A;  5FDH A;  2HP9 A;  4LV1 A;  4N9L A;  1GSV A;  3WRZ A;  3WWX A;  1L0F A;  3TW8 A;  2WKH A;  4R3B A;  1ZG4 A;  3U2A A;  4NXF A;  5TGF A;  1NXY A;  2EWV A;  5GLC A;  1K54 A;  3GVB A;  2Y4A A;  3LI9 A;  4HJ6 A;  2VK3 A;  4JXG A;  4RYE A;  3ISG A;  1T18 A;  4HQA A;  1IEL A;  4QWO A;  1PW8 A;  3ZDJ A;  1F98 A;  4YIN A;  3FZC A;  1FR6 A;  2XLN A;  4DE0 A;  5L07 A;  3MQ0 A;  4RA7 A;  4MLL A;  2J3W A;  3UN7 A;  4JF4 A;  5DTS A;  3IHB A;  3HLD A;  3K3D A;  2PYP A;  4JPM A;  1KE3 A;  3AGE A;  2WKR A;  2W3E A;  2XDM A;  3VSK A;  4GD8 A;  1K55 A;  1J9M A;  2OAQ 1;  1P0Z A;  1F9I A;  2D02 A;  3SS4 A;  3MXQ A;  1LL8 A;  3F1P B;  3BLM A;  1K0K A;  1H3Q A;  3ZNY A;  1AWI A;  5EVE A;  3G30 A;  5F69 A;  5HX9 A;  1YKD A;  2DNS A;  4F94 A;  4P6Z M;  3R7W A;  2HJ9 C;  1TS6 A;  4IJG A;  4Y5F A;  3IF5 A;  2W3H A;  1M40 A;  4JXV A;  2QJ7 A;  3PAG A;  4DDS A;  1QMF A;  4K0W A;  4ME4 A;  1ZC2 A;  5J3W A;  1ZTU A;  4PKY G;  4HEF A;  3SH9 A;  4HP4 A;  4R3A A;  2GDN A;  2HGV A;  4ZRR A;  3ZNT A;  5EVI C;  2UV0 E;  5HZH A;  1DJA A;  2DRW A;  3QHY A;  2V1A A;  4GZB A;  2Y2I A;  4G3K A;  3BFG A;  4ZTK A;  3S7P A;  2PBD P;  3MS6 A;  2WKP A;  2XD5 A;  1P97 A;  1PWG A;  4KQR A;  2EX2 A;  4LRZ E;  3OOV A;  4EBN A;  1XGI A;  4EES A;  3M6B A;  4X69 A;  3UB6 A;  1NLY A;  3NDE A;  1DP8 A;  2XEP A;  5AQB A;  3CJM A;  1QME A;  3Q7V A;  2V1Z A;  5J4E A;  2ZOI A;  3SS3 A;  1STZ A;  5CGS A;  1YSP A;  5KIZ A;  4PAU A;  4A5R A;  4MN5 A;  4PM7 A;  3G6O A;  4LCL A;  2K2N A;  1FSY A;  4YNR A;  3KSF A;  3RH8 B;  4LFU A;  3QNC A;  4E3J A;  4O7D A;  3GSG A;  1CJF A;  3T12 B;  5DF9 A;  3IWQ A;  4EUV A;  4H6J A;  1N9O A;  3UO9 A;  3UY6 A;  4BD0 A;  2WAE A;  4I3I A;  4JBF A;  5F6A A;  2B95 A;  3MZE A;  5KSC A;  4UEY A;  2PD8 A;  1MXO A;  2GZA A;  4GCZ A;  3JYI A;  1TDG A;  3F1N A;  1E3U A;  3JVU A;  4WM9 A;  4X6T A;  2AVX A;  2QYB A;  1WYB A;  4Y0U A;  2WK0 A;  1SHV A;  5FA7 A;  1U60 A;  3A3D A;  4E3K A;  1MC0 A;  3B47 A;  1G6A A;  3SZT A;  3LEZ A;  1BLC A;  2RL3 A;  2ZQD A;  4FOF A;  1PW1 A;  3UB5 P;  4MMN A;  1RGY A;  5HWW A;  1F2K A;  1ES5 A;  3C7U A;  1NYM A;  3UB8 A;  1PI5 A;  1NZO A;  1HLU P;  2HP5 A;  1RGZ A;  3FYZ A;  4QD4 A;  1W63 M;  3KSH A;  4HH2 A;  2ZC5 B;  5TJJ A;  5HSQ A;  2V0W A;  5KMW A;  3IH9 A;  2Z2M B;  1L3L A;  5BOH A;  1XFN A;  4U0T A;  1XXM A;  1DRM A;  5DF8 A;  2J3T C;  2RCX A;  5HL6 A;  4ETZ A;  4I3A A;  4P6Z S;  5AQ9 A;  3CG5 A;  2OSU A;  1YM1 A;  4CLC C;  1LSW A;  1LLB A;  1V9Z A;  3GMW A;  3HLF A;  4S2J A;  1HVB A;  2INW A;  3ZG9 B;  1BLP A;  3EQU A;  3UNW A;  4E6X A;  3Q7Z A;  3LI8 A;  3BRM A;  1K6S A;  2HDR A;  1UWN X;  5L2F A;  3OPP A;  4EEP A;  5FQQ A;  2VV8 A;  4CQH A;  5EVI D;  3MZF A;  5TFQ A;  4MN7 A;  4BBT A;  4EQI A;  1VET B;  4QHC A;  3OLO A;  4F3L B;  4E3I A;  5E2E A;  1XJ6 A;  4ZJ2 A;  2VV7 A;  2H0T A;  1S6R A;  1WYC A;  2P9V B;  2PR5 A;  3IBJ A;  1PYY A;  4OQG A;  2ZQA A;  2Y2Q A;  2V1B A;  1YPR A;  1H8Z A;  4ETX A;  2JKG A;  3ZFZ A;  3R4K A;  3MJQ A;  5CTN A;  1BZA A;  4OOM A;  3QP1 A;  4R3J A;  2O9B A;  5M19 A;  3EOI A;  5A90 A;  3AGF A;  2PU4 A;  1VHM A;  1W79 A;  3IQA A;  5AQ7 A;  4NG2 A;  2G7U A;  2K31 A;  1TF1 A;  4M4X A;  2VLG A;  3BFC A;  2EXA A;  1TD5 A;  3HBR A;  4KQO A;  3CIT A;  3IX3 A;  1OTD A;  1VM1 A;  3N8R A;  1IYS A;  2P7J A;  4DE3 A;  4BWI A;  3JVV A;  2M1C A;  2Y79 A;  1MPL A;  1FCO A;  2WZZ A;  4OQH A;  4GS9 B;  5HL1 A;  2W3G A;  5CXW A;  1AXB A;  3K2N A;  3T1R A;  2IWD A;  5IHV A;  1H5X A;  1H8M A;  4IBX A;  3TE8 A;  3VFF A;  3UDF A;  2ZMA A;  3V67 A;  1GSW A;  1KVL A;  2H10 A;  2HPB A;  1N9B A;  3V50 A;  2QJ5 A;  1OME A;  1W7F A;  1YMX A;  3MF0 A;  2W1T A;  1S1Z A;  4HIA A;  3VSL A;  2OLV A;  4WZ5 C;  1VQQ A;  3NY4 A;  3BJN A;  3VP1 A;  2L1M A;  2BAS A;  1Q2P A;  3H7W B;  1NZU A;  3UE1 A;  1UWP X;  2Y2L A;  1E4D A;  5J7E A;  4RX2 A;  2W0N A;  3LID A;  4N92 A;  3MZD A;  1L2S A;  2B02 A;  1OTI A;  2J3T D;  5HD3 A;  2ZOH A;  3LGO A;  4CLC D;  1JWP A;  2JKF A;  3FPV A;  1PZP A;  1S0W A;  3IWO A;  4EEU A;  2KLI A;  2ZD8 A;  4IBR A;  3JPU A;  2O99 A;  1F5M A;  5K5B A;  3TOI A;  4HHD A;  5FQJ A;  5TBM B;  3O86 A;  4MNR A;  2VA0 A;  3D3O A;  4WYY A;  3RXX A;  5HW3 A;  3KYE A;  1KDW A;  3CWF A;  3LUQ A;  5F68 A;  3T1Q B;  3T4S A;  1J3W A;  3G2Z A;  5EVI B;  1ERO A;  3IXD A;  4HBU A;  1ZKJ A;  2PR6 A;  5GL9 A;  4KZ3 A;  1K6R A;  1K56 A;  1YMS A;  4N1X A;  4DE2 A;  2HZ5 A;  3PBS A;  4DRT A;  1NY0 A;  3E0Y A;  1YLJ A;  1K54 C;  3RFB A;  4XUX A;  1OT9 A;  1N9N A;  1H8Y A;  4KG5 A;  2ZQ8 A;  2NUP C;  4HY8 A;  2OV5 A;  2GX5 A;  4OON A;  2ZC3 B;  2X02 A;  3IXG A;  1T1C A;  4BMW A;  2V20 A;  1IKG A;  1TS7 A;  2JE5 A;  4WMC A;  3VOY A;  3NOU C;  5DVA A;  3QNB A;  1KE4 A;  1VET A;  3S7N A;  1XP4 A;  4F3L A;  4P87 A;  4I5S A;  4Y0O A;  3BM6 A;  1GSX A;  5DTT A;  2R9X A;  4EXO A;  1KVM A;  4U3T A;  4Q0J A;  3RXW A;  1K55 C;  3SW1 A;  3EGX C;  5EE8 A;  4GDB A;  4AFI A;  3ZVT A;  3E4P A;  5I94 A;  5HPF A;  1GA0 A;  5G18 A;  3VFH A;  1YLT A;  2YKF A;  2Z2L B;  1TEM A;  3KSG A;  3KSI A;  3B42 A;  4KZ5 A;  2UWX A;  4B9O A;  4OLG A;  4PKY A;  5FI2 A;  4Y0T A;  4MBH A;  5FAO A;  1D1J A;  4C3Q A;  4WZ4 A;  4DXB A;  3PBO A;  2M7U A;  1CI8 A;  4N9K A;  4GDN A;  4G3V A;  3O87 A;  4NK3 A;  4N1H A;  4NKP A;  1N9L A;  4D60 A;  4LRY C;  3N8S A;  1I2S A;  5F5Y A;  3RJU A;  1XJ2 A;  2QZ6 A;  3NIA A;  2VGJ A;  2HP6 A;  4XXR A;  4I3J A;  4OPQ A;  3NEC A;  4GS9 A;  3HLE A;  2KDK A;  3QP4 A;  3BEC A;  1K4F A;  3BLS A;  4LV2 A;  1JWV A;  3VP3 A;  1YAX A;  2A3U A;  4FTX A;  1PFL A;  1IYQ A;  3EEH A;  3ZVW A;  1K56 D;  1K4E A;  1EI5 A;  3CPT A;  5CEB A;  3IXH A;  3T4J A;  4X68 A;  4P85 A;  1S4R A;  4X1L A;  4DXC A;  4O8G A;  1FCN A;  3C5A A;  3LEQ A;  2OAP 1;  5EOO A;  4CLC B;  4P6B A;  3H7W A;  2ACG A;  1NRF A;  2JC7 A;  5HDS A;  2WKI A;  3IS2 B;  2W3F A;  4WBG A;  4DF6 A;  3FG8 A;  4S2K A;  3RTY A;  2WGV A;  1YLP A;  2Q0O A;  3IWI A;  2R78 A;  4MBF A;  2FZ0 A;  4C6Y A;  4E3L A;  3UE6 A;  5J8X A;  4WEL A;  1RP5 A;  3EGD C;  1YQS A;  4Y7P A;  5JYP A;  5FAP A;  3G4P A;  1MWS A;  5FQK A;  4E6W A;  4FSF A;  5FL3 A;  3IX4 A;  4OPR A;  2PBY A;  3WS5 A;  1P9W A;  2XD1 A;  2YKH A;  3C30 A;  5FAT A;  4BBV A;  3D72 A;  4ARZ A;  3LR0 A;  1TS0 A;  3LY4 A;  4GHI B;  4L9F A;  2V2F F;  4HH3 A;  2V8C A;  3ZG7 B;  2V9A A;  2XR0 A;  1G5U A;  3VV4 A;  1XX2 A;  2PYR A;  3NHQ A;  2JKT I;  4HJ3 A;  5CX7 A;  4OP8 A;  5E2F A;  2KOI A;  4LV0 A;  1SCW A;  2VZW A;  4EET B;  1O7E A;  2VX8 A;  1LI9 A;  4NXG A;  4S2I A;  3BFD A;  1NJ4 A;  3PBN A;  1IYO A;  2PU2 A;  4UA7 A;  1Z6F A;  1P9R A;  3H82 B;  1K38 A;  3CUE A;  3G35 A;  4QJG A;  3G31 A;  4HNB A;  1G6O A;  4JXS A;  2J9O A;  1JVJ A;  5E43 A;  4PM5 A;  4EQ1 A;  2ZM0 A;  5IU1 A;  1ES2 A;  1ZHH B;  2EFU A;  3DTE A;  4U0X A;  2P08 A;  1FR1 A;  2Y2N A;  1VEU B;  4ID4 A;  3MR0 A;  2XSS A;  3L7H A;  4DDY A;  2XRO A;  3GV9 A;  1DJB A;  1BLH A;  3IXB A;  5E2H A;  5HAP A;  5FI6 A;  2WUQ A;  2X01 A;  1HZO A;  3N8L A;  4JF5 A;  1DP6 A;  1PWC A;  4FH4 A;  3CAX A;  2Y55 A;  2J80 A;  2Z6C A;  3PBT A;  3GEC A;  4IUH A;  4EWF A;  5HDD A;  2DCF A;  3T1X A;  5CHM A;  5EEC A;  1Y28 A;  1Y54 A;  5CGW A;  4OOL A;  1OJ5 A;  3FWL A;  5F83 A;  2XA7 M;  1OTA A;  5A8B A;  1G28 A;  3HLG A;  1EW0 A;  3BFF A;  4WN5 A;  5EV0 A;  5F1G A;  2VEA A;  3V39 A;  2ZM8 A;  3HUM A;  2EWW A;  5CHU A;  4R38 A;  2QHK A;  4O0P A;  5FQI A;  3VMA A;  3TSG A;  4CLC E;  3F1P A;  4QB8 A;  1NYY A;  4S2N A;  1FSW A;  2FFY A;  2FH5 A;  4BLM A;  4IUK A;  1NRJ A;  4I38 A;  3IF6 B;  3C8C A;  5HAR A;  2E8I A;  1W63 Q;  1CK3 A;  3M2K A;  1XA7 A;  4HOI A;  3V3R A;  3DTK A;  4LRX C;  5CEC A;  1MWT A;  4S2O A;  2C5W B;  4XT2 B;  3PBR A;  3IBR A;  3UME A;  4X55 A;  2FFF B;  4BEN A;  3GQZ A;  3A0S A;  4OKP A;  1Q2Q A;  3K3C A;  3HUN A;  2PAV P;  3DTM A;  2A49 A;  3IX8 A;  1E3U D;  3T4T A;  4UAA A;  4WEJ A;  1MWR A;  4FD8 A;  2H5S A;  2W1R A;  1PZO A;  2P74 A;  5EUA A;  5AVF A;  4KUK A;  4B88 A;  5FAS A;  3W4O A;  3MFX A;  5I5L A;  2A2L A;  4QY6 A;  2Z6D A;  4WEK A;  4EV4 A;  1WE4 A;  2OLU A;  5HD5 A;  5DF7 A;  3P01 A;  1IKI A;  4OP5 A;  2NUT C;  3LFV A;  1SKO B;  4UHU A;  1OTE A;  1N4O A;  3MSH A;  4E04 A;  3O3V A;  1ONG A;  2P04 A;  1T1B A;  5GHX A;  1ERQ A;  3E98 A;  2JHE A;  4II7 A;  5M1A A;  1NWZ A;  3NJA A;  2V0U A;  2XQZ A;  3T4O A;  4MDZ A;  2Y2K A;  4Y3I A;  2WGW B;  1EWZ A;  4MEZ A;  5G4Y A;  3A3E A;  4R70 A;  4C75 A;  5AQA A;  4GNU A;  2XF3 A;  3LR5 A;  3HVF A;  3T4Q A;  4GHI A;  2ZL1 B;  2EXB A;  1L0G A;  1MKM A;  2EX8 A;  4Y17 A;  3HCY A;  3GRJ A;  3FV7 A;  4OH0 A;  4UQI M;  4L0L A;  4RX3 A;  1HD8 A;  1OJG A;  4Q0I A;  3TJZ C;  1OTB A;  4E3M A;  2JCH A;  1GCE A;  2WAF A;  4PM8 A;  1XJ3 A;  4BJP A;  5IS1 A;  3HLB A;  5A91 A;  1KGF A;  4DN0 A;  3VOL A;  3GR2 A;  1BTL A;  2ZLY A;  3H82 A;  4PM6 A;  2HDQ A;  2ZMF A;  1CEG A;  1LL9 A;  3M6H A;  5DFX A;  3A0V A;  2ZJ9 A;  1NLZ A;  3F1O B;  2PT7 A;  1JNU A;  1ALQ A;  1SZV A;  3W8K A;  3HLW A;  4GN2 A;  2PDR A;  2Y2H A;  2EX6 A;  5HWT A;  4ESP A;  1GHM A;  2BLS A;  2ZC6 B;  4FCF A;  1VEU A;  4BL2 A;  1ESI A;  2XA7 S;  1SDN A;  4K08 A;  4MCW A;  4QY5 A;  4LPZ A;  3M2J A;  1XGJ A;  3FKW A;  3U4L P;  4O01 A;  1SDE A;  1LL5 A;  3S7O A;  4R6L A;  3UB7 A;  3PR6 A;  4WF0 A;  3MQO A;  4GJ4 A;  4IHQ A;  3GTC A;  4BBU A;  3Q7V B;  3C7V A;  3ZQ5 A;  4OOY A;  4FUW A;  4R4S A;  3ITA A;  1H0M A;  2I9V A;  5EPH A;  4R1G A;  3C4O A;  3IT9 A;  5EVL A;  4DE1 A;  2XRN A;  3IHA A;  2R9W A;  1Y4O A;  4L9E A;  3T4L A;  2HV1 A;  3SOI A;  3ZHH A;  2ZQ9 A;  1W8Q A;  1IYP A;  1K57 A;  1TS8 A;  4H6J B;  3MQQ A;  4EER A;  4GOG A;  1YLW A;  4JLF A;  1Z09 A;  3ULF A;  3LIE A; 
#chains in the Genus database with same CATH homology
 4HH2 A;  1S4S A;  5HDS A;  2QWS A;  5TJJ A;  3IS2 B;  5HSQ A;  2V0W A;  2O9A A;  2W3F A;  5L8M A;  3NOT C;  3FG8 A;  3R7W B;  1XFQ A;  3RTY A;  2KX6 A;  1XFN A;  3EQV A;  3OC2 A;  1DRM A;  4Q0H A;  2J3T C;  5HL6 A;  4JGP A;  4I3A A;  4P6Z S;  4ETZ A;  3LYX A;  2R78 A;  2FZ0 A;  2H28 A;  4CLC C;  1LSW A;  3KYZ A;  3UE6 A;  1V9Z A;  2L4R A;  4WEL A;  5AJG A;  2OOL A;  5DFY A;  3EGD C;  3EWK A;  3HJK A;  2INW A;  1YSQ A;  3EEA A;  3EQU A;  5EFW A;  3FPW A;  3LI8 A;  5C5K A;  1UWN X;  1MZU A;  3FC7 A;  2GNX A;  1UGU A;  4FSF A;  2VKS A;  4EEP A;  5FL3 A;  3A0R A;  2VV8 A;  4CQH A;  4MN7 A;  4BBT A;  1P9W A;  2O9C A;  2ZMV A;  2YKH A;  3C30 A;  1LSV A;  2OWJ A;  3W2Z A;  4BBV A;  3D72 A;  3OLO A;  4ARZ A;  3LR0 A;  4L9G A;  4F3L B;  1TS0 A;  3LR4 A;  4GHI B;  4L9F A;  4KQD A;  3LIB A;  4HH3 A;  1XJ6 A;  2VV7 A;  2V9A A;  4GLQ A;  5HDC A;  4GW9 A;  4PHT A;  5DKK A;  3VV4 A;  2PYR A;  3NHQ A;  2JKT I;  2PR5 A;  1OT6 A;  4B93 A;  3IBJ A;  4HJ3 A;  5CX7 A;  3PXP A;  4KUO A;  4EET B;  2KOI A;  4UQI S;  2VZW A;  2VX8 A;  3BQ8 A;  4NXG A;  2V1B A;  3PBN A;  1DP9 A;  2W3D A;  1P9R A;  3H82 B;  4I39 A;  3CUE A;  4ETX A;  4DMZ A;  3R4K A;  3ICY A;  1S67 L;  3MJQ A;  2PHY A;  4HNB A;  1G6O A;  4OOM A;  2O9B A;  1S66 L;  3EOI A;  4EQ1 A;  3P7N A;  4JGR A;  3CLO A;  3KO6 A;  4ARZ B;  3H9W A;  2HF6 A;  1V9Y A;  5IU1 A;  5AVE A;  1VHM A;  1ZHH B;  2P08 A;  3MR0 A;  2XSS A;  4DJ2 A;  3BQA A;  2G7U A;  2XRO A;  3VE4 A;  2K31 A;  1TF1 A;  4M4X A;  4YOF A;  3MMH A;  2VLG A;  3LIF A;  1TD5 A;  4KQO A;  3CIT A;  4DJ3 A;  2IA2 A;  1OTD A;  3PBQ A;  4HJ4 A;  2JKR I;  2WKQ A;  3BY8 A;  2P7J A;  4MN6 A;  4NXE A;  4BWI A;  3JVV A;  2M1C A;  2Y79 A;  2EA9 A;  1DP6 A;  3OBF A;  4GS9 B;  2W3G A;  3TRC A;  5IT5 A;  3CAX A;  4WUJ A;  3K2N A;  3F1O A;  3T50 A;  2J80 A;  2Z6C A;  3F1N B;  3PBT A;  3GEC A;  4IUH A;  1D7E A;  1H8M A;  2PD7 A;  5HDD A;  1WA9 A;  3TE8 A;  2HJE A;  4HI4 A;  2A24 A;  3V67 A;  1Y28 A;  4XT2 A;  2GJ3 A;  1GSW A;  4OOL A;  1OJ5 A;  3OCL A;  5KSH A;  2XA7 M;  3BY9 A;  3DBA A;  1OTA A;  2QJ5 A;  1G28 A;  4QPR A;  5A8B A;  1EW0 A;  1ODV A;  2L0W A;  1BYW A;  4WN5 A;  5DKL A;  3UMD A;  4EU0 A;  2VEA A;  4Y2F A;  3CUE C;  3MF0 A;  1GSV A;  2W1T A;  1S1Z A;  2EWW A;  4HIA A;  3TW8 A;  4R38 A;  2QHK A;  2VGL M;  5TBM A;  4O0P A;  4CLC E;  3U2A A;  3BJN A;  3F1P A;  4NXF A;  2L1M A;  2EWV A;  2BAS A;  3H7W B;  4LLO B;  5HPI A;  1UWP X;  5J7E A;  3LI9 A;  2FH5 A;  2Y8H A;  4IUK A;  4HJ6 A;  1NRJ A;  2W0N A;  3LID A;  4I38 A;  3C8C A;  1T18 A;  2B02 A;  4G3W A;  4HQA A;  1W63 Q;  3C2W A;  2W27 A;  4HOI A;  1OTI A;  2M7V A;  4LRX C;  1F98 A;  2J3T D;  5HD3 A;  2ZOH A;  3LR3 A;  1T19 A;  3OCN A;  4XT2 B;  3MQ0 A;  3PBR A;  3IBR A;  3T4K A;  3UME A;  4CLC D;  3FPV A;  4EEU A;  3A0S A;  2J3W A;  2KLI A;  3K3C A;  2O99 A;  3K3D A;  1F5M A;  2PYP A;  5K5B A;  2WKR A;  2W3E A;  2W1T B;  2OAQ 1;  4HHD A;  1P0Z A;  3T4T A;  4WEJ A;  2JKR M;  1F9I A;  5TBM B;  2D02 A;  3MXQ A;  2W1R A;  2VA0 A;  1LL8 A;  3F1P B;  3D3O A;  2OWH A;  5AVF A;  1H3Q A;  4KUK A;  3GDI A;  4YWZ A;  5F69 A;  4NXB A;  3CWF A;  1LSX A;  1YKD A;  3MFX A;  5I5L A;  3LUQ A;  2A2L A;  4P6Z M;  5F68 A;  3R7W A;  1LT0 A;  3T4S A;  1T1A A;  2Z6D A;  4WEK A;  2HJ9 C;  3C38 A;  5HD5 A;  1TS6 A;  4IJG A;  4Y5F A;  3P01 A;  3KX0 X;  2W3H A;  2QJ7 A;  4HP9 A;  5G4Z A;  5DJT A;  2PR6 A;  2NUT C;  3LFV A;  2O0Y A;  4ME4 A;  5J3W A;  1OTE A;  3PBS A;  4E04 A;  1ZTU A;  4PKY G;  5MC7 A;  3E0Y A;  2P04 A;  3RFB A;  1OT9 A;  1N9N A;  2QKP A;  1T1B A;  2NUP C;  4HY8 A;  4HP4 A;  4R3A A;  3E98 A;  2GX5 A;  2JHE A;  2HGV A;  4ZRR A;  4II7 A;  3UB9 A;  1NWZ A;  3NJA A;  2V0U A;  3T4O A;  4MDZ A;  4Y3I A;  1T1C A;  4BMW A;  3PHY A;  5HZH A;  1TS7 A;  2V1A A;  5G4Y A;  3VE3 A;  3NOU C;  4R70 A;  3BWL A;  4Z1W A;  3S7N A;  3LR5 A;  1VB6 A;  4G3K A;  4F3L A;  3T4Q A;  4EW7 A;  4GHI A;  2DMW A;  4I5S A;  3S7P A;  1GSX A;  1MKM A;  2VJW A;  3HCY A;  4EXO A;  2WKP A;  1P97 A;  2JKT M;  4UQI M;  4L0L A;  4LRZ E;  4Q0J A;  1OJG A;  3SW1 A;  3OOV A;  4Q0I A;  3TJZ C;  1OTB A;  3EGX C;  2ZBB A;  4EES A;  2JN7 A;  4AFI A;  3E4P A;  1XJ3 A;  4BJP A;  5HPF A;  3UB6 A;  4RQ9 A;  1NLY A;  4WLA A;  5IS1 A;  4DN0 A;  3VOL A;  3O5Y A;  1IFQ A;  1DP8 A;  2YKF A;  3H82 A;  5HWV A;  1KOU A;  2ZMF A;  3KSG A;  5J4E A;  3KSI A;  5DFX A;  3A0V A;  3B42 A;  3CI6 A;  2ZOI A;  3F1O B;  1NLZ A;  1S1Y A;  2PT7 A;  1STZ A;  1YSP A;  5KIZ A;  4B9O A;  4PAU A;  4PKY A;  1JNU A;  1X0O A;  4MN5 A;  3G6O A;  2K2N A;  1D06 A;  2PDR A;  3NOP C;  2A24 B;  2LB9 A;  4YNR A;  3KSF A;  3RH8 B;  3ZYT A;  3BW6 A;  3PBO A;  5HWT A;  2M7U A;  4NEE D;  1IOU A;  4G3V A;  3LIA A;  3HJI A;  2VV6 A;  2XA7 S;  4NKP A;  1N9L A;  4WL9 A;  4LRY C;  5DF9 A;  4EUV A;  4K08 A;  4H6J A;  5F5Y A;  1N9O A;  2CMN A;  4MCW A;  1XJ2 A;  3E4O A;  4LPZ A;  4CLC A;  4O01 A;  3S7O A;  4R6L A;  2VGL S;  4I3I A;  5F6A A;  3UB7 A;  2B18 A;  3PR6 A;  4WF0 A;  3MQO A;  4GJ4 A;  3S7Q A;  4UEY A;  4I3J A;  2PD8 A;  4IHQ A;  4GS9 A;  3IS2 A;  2KDK A;  2GZA A;  4GCZ A;  4BBU A;  3ZQ5 A;  3F1N A;  3JVU A;  5DJU A;  3LIC A;  2I9V A;  5LBR A;  2QYB A;  1YAX A;  1XJ4 A;  2K7S A;  2XRN A;  3PYP A;  4JGO A;  3EEH A;  4L9E A;  3T4L A;  2HV1 A;  2MJ6 A;  1MC0 A;  1OPX A;  3B47 A;  3T4J A;  3KYQ A;  1S4R A;  4FOF A;  4JGQ A;  3UE3 A;  4MMN A;  5HWW A;  1TS8 A;  4H6J B;  3MQQ A;  4EER A;  3UB8 A;  4O8G A;  3B33 A;  2LB5 A;  4CLC B;  2OAP 1;  3ULF A;  2D01 A;  3H7W A;  3E4Q A;  3LIE A;  1W63 M;  3KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...