3KSFA

Structure of frmsr of staphylococcus aureus (reduced form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksfA00
2O9CA 4Y2FA 3K2NA 1TD5A 4MMNA 4G3VA 4LRYC 4O01A 3VV4A 2W1TB 4IJGA 4ETZA 1YSPA 2W3GA 1YKDA 3KO6A 2ZMFA 5TJJA 4G3WA 1MKMA 2GX5A 4MN7A 5DFXA 3KSHA 2B18A 2W3DA 2VJWA 2KOIA 5K5BA 4E04A 3E0YA 2M7VA 4Q0JA 2Y8HA 3S7NA 4Q0IA 3R4KA 3KSFA 3IBRA 4QPRA 3IBJA 4R70A 5AJGA 3OBFA 4IUHA 3NHQA 3O5YA 3MF0A 4YNRA 2M7UA 3ZQ5A 4FOFA 2K31A 3DBAA 2O9BA 4GLQA 2VZWA 4GW9A 3G6OA 3W2ZA 2LB9A 3MQ0A 5LBRA 4CQHA 4ME4A 2W3FA 2XROA 4Q0HA 2QYBA 4IUKA 3RFBA 4MCWA 4PAUA 1ZTUA 2O0YA 2W3HA 5L8MA 3HCYA 2W1TA 2VEAA 4Y3IA 1YSQA 1VHMA 1MC0A 1STZA 4BWIA 4DN0A 3BJNA 4EUVA 2K2NA 4G3KA 3LFVA 2W1RA 2G7UA 3KSIA 1F5MA 3S7QA 3D3OA 4O8GA 3NOUC 2O99A 5HPFA 5DFYA 2W3EA 2Y79A 3NOPC 4ZRRA 5C5KA 4EU0A 5HPIA 4YOFA 2IA2A 2VKSA 5I5LA 2LB5A 3KSGA 3CI6A 4Z1WA 3NOTC 4LRXC 4ETXA 3S7PA 3MMHA 4DMZA 3OOVA 3S7OA 2OOLA 4MDZA 3TRCA 4Y5FA 2XSSA 3E98A 4O0PA 5HSQA 2HGVA 2O9AA 4LRZE 2KLIA 4RQ9A 1TF1A 3C2WA 3EEAA 4R6LA 3CITA 2XRNA 5HL6A
chains in the Genus database with same CATH superfamily
3B47A 5CERA 1CQAA 1YKDA 3BRMA 4GD8A 5TJJA 1PWGA 5KSHA 3RXXA 4WBGA 3IXBA 3K3CA 4OPZA 3Q1FA 3V39A 3IBRA 2JCHA 2A3UA 2R9XA 2EWVA 3MF0A 3A3JA 4DE1A 1BLCA 2JHEA 4B4XA 4FH2A 4CQHA 1LSVA 2V0UA 3RFBA 2P08A 3N8LA 1PWCA 5FI2A 3AGFA 3TJZC 3NULA 4EBPA 4F3LB 2H10A 5CGWA 4DE0A 3KSIA 2PBYA 3A3DA 4P85A 3E4QA 2W3EA 3NECA 2PDRA 1YLZA 4ZRRA 4E3LA 5HPIA 4WELA 3GECA 1YLWA 3MXSA 3G2ZA 2R9WA 1SDEA 3HLCA 5DKLA 4IBRA 5GLAA 5AQ9A 1ALQA 3OOVA 5L2FA 2JKTM 1K54A 2V20A 3MZDA 3ZG0A 4WN5A 3UE3A 5A8BA 2PD8A 4NKPA 1VB6A 5EVLA 1DRMA 3Q7VB 3LO7A 3ZG7B 1I5QA 5GLBA 1XJ4A 4LCLA 1KDWA 3G34A 3VP0A 5CX7A 3SZTA 1Y54A 4HIAA 3Q7ZA 3IH9A 4ID4A 1FQGA 4OOYA 4JXGA 4R70A 3CG5A 3RTYA 1L3LA 1Y28A 2M7UA 2W27A 3MSHA 3N7WA 4DJ3A 3QHYA 1SKOB 5EVIA 4KZ4A 1PRQA 4OP8A 1I2SA 3KYQA 2W1TA 3QP1A 1PW1A 2WGWB 1NLYA 3VP1A 1S66L 3UB7A 2L4RA 1LI9A 2HDQA 2G7UA 2OWJA 4LV0A 1D1JA 2UWXA 4GS9A 2M1CA 4YOFA 3T4JA 2INWA 4KG6A 4LGWA 1KGGA 1RGYA 3G35A 4UAAA 4S2KA 1N9NA 1O07A 4PM5A 3C2WA 2G2UA 1E4DA 1K25A 3V3SA 5FA7A 4BD1A 3K2NA 3LIFA 4EERA 3C30A 4NEED 4ETZA 3D9YA 2OLVA 2JKTI 1KE0A 1F9IA 4HQAA 5EPHA 2XK1A 4EQIA 5A90A 1K4EA 5J7EA 3LEQA 4RX2A 4MBKA 2VV7A 1IKIA 2EFXA 2ZM8A 1K6RA 3UB9A 2XH9A 4X68A 3UE1A 1DP8A 3VOYA 2OLUA 4HJ3A 4BENA 2XA7M 3LIEA 1XGJA 3C4PA 5HDDA 3UB6A 3CMZA 2X01A 1G6AA 2V9AA 1GA0A 1QMEA 1ODVA 3RH8B 5FI6A 5FQKA 1P0ZA 4UHUA 2VGKA 1TDLA 4FSFA 3LYXA 4LV3A 4NXFA 5FQIA 1XP4A 3GVBA 3SH7A 3HLEA 1BLPA 1EI5A 3CI6A 3IXHA 4WYYA 1BZAA 3OZHA 5HW3A 3WS0A 1VQQA 4K0XA 4GDNA 4BL3A 1GCEA 4KQDA 4C3QA 3N4IA 3QNCA 2XD1A 2XD5A 4F94A 2QJ5A 4Y15A 4KZAA 4HBTA 1JWZA 2OWHA 1PNEA 2WKPA 4GZBA 2ZC4B 4XUZA 1KGEA 3BY8A 5BOHA 2HPBA 4Y0TA 5FEGA 1NRJA 2WYXA 4NXEA 4E3MA 2XLNA 2OV5A 3LI8A 1SZVA 1OJ5A 3BLSA 4QPRA 2BLSA 5U47A 3LIAA 3UPPA 1X0OA 5CTMA 1XFNA 1HLUP 3NC8A 1T1AA 1TS6A 1BT5A 5FATA 4I38A 1CI9A 1VETB 3PYPA 3HLDA 5CGSA 4JF6A 2WGIA 4DXBA 3P98A 4HH3A 2IWCA 2K2NA 3H7WB 3IH8A 2D02A 3A0RA 2Y59A 2JKRM 1L0EA 1JTDA 3A3EA 2A49A 2P74A 3NCKA 1N9BA 4HY8A 1IYOA 2XR0A 4X6TA 3EOIA 5EVEA 4Z1WA 4KG2A 4H6JA 3MMHA 4GNUA 3WRTA 2OOLA 1S1ZA 4KZ5A 3SS4A 4Z9QA 5TGFA 1OT9A 1NRFA 3T1XA 1T1CA 1K54C 2JN7A 5J4EA 3BEBA 5F68A 4MN5A 2QKPA 3M2KA 1HZOA 2WGWA 3UN7A 4G3VA 1ACFA 2EX6A 2W3GA 3G4PA 1LI0A 3P7NA 2I9VA 3A3IA 1MKMA 3VOLA 1XGIA 4N92A 4UEYA 3D4FA 3GR2A 3HL9A 5EVIB 2HV1A 5E2GA 2BASA 4N9KA 4BD0A 1CEGA 5EV0A 1MWRA 1ZHHB 3IBJA 5EE8A 3BLMA 3BM6A 1BSGA 1WYBA 3TW8A 3IHBA 4PM8A 1AXBA 3ZQ5A 4DF6A 5CHJA 2X71A 4E3IA 3IF6B 3U2AA 2VZWA 3T4SA 4GDBA 3IS2B 5E2FA 5J8XA 2V8FA 1HD8A 2VGLM 3VSKA 5EVIC 5GHYA 3M6BA 3UDFA 3VSLA 3CAXA 2ZOHA 3HJIA 1UWPX 5AQAA 3PXPA 4KG5A 1D7EA 1ES5A 2YKFA 2XDMA 3IF6C 2H0YA 1FCOA 3BWLA 1O7EA 3T4LA 1FOFA 1V9ZA 5HPFA 3OC2A 4CJNA 4II7A 4D2OA 4M3KA 3T1QB 1IFQA 3S7OA 3PTEA 4QB8A 4OQ0A 1XJ3A 2AVXA 2JKRI 4MEZA 3HLWA 3ZVWA 2Y2KA 2DNSA 1ERQA 3FPWA 4GKUA 5KZHA 1ZC2A 3JPUA 3MQQA 1GSWA 1TDGA 2E8JA 3BY9A 4NETA 3B3XA 3W4QA 4ESPA 4R3JA 3ISGA 4WUJA 1OJGA 1OTIA 3MFXA 4ZJ3A 4GB7A 5F69A 4ZJ1A 4S2OA 1IYPA 5DVAA 3UMEA 1BULA 2I72A 4L9FA 5FQQA 2P7JA 5L10A 4KQRA 4JF5A 1GSXA 5FQMA 4Y0UA 4OPRA 5HL1A 3ULFA 3LR0A 2EA9A 2YKHA 1PZPA 1NZOA 3DAVA 5G4YA 4KUOA 2ZQ7A 4OLGA 4PM6A 3NJAA 2XFTA 2ZM2A 5FDSA 3PBOA 1STZA 5EM0A 5IT5A 4K91A 4E3NA 3UO9A 5HZHA 4E3KA 4RVAA 5M18A 4JBFA 5DJTA 2ZC7A 3PBQA 1VM1A 2XEPA 1K0KA 3D72A 1LL8A 2UV0E 1PI5A 5I5LA 2VV8A 3S7PA 4M4XA 1YPRA 1YM1A 5EUAA 3GQZA 3P09A 4X25A 1Q2QA 3SS3A 3TSGA 3O3VA 3TRCA 3HLBA 1VETA 3BYDA 4OP5A 1ZG6A 3UPOA 2HDRA 2Y2GA 5CECA 5CEDA 3F1PA 4ZJ2A 3CWFA 3ICYA 4CLCB 5JYOA 2A24B 2DMWA 3T50A 3LCEA 3H7WA 3SH8A 1H3QA 1YLJA 1JWPA 1NLZA 1DJBA 4G3WA 4IVKA 1ZKJA 4FTXA 4HJ4A 4BQMA 3NDEA 1MXOA 1XJ6A 1DP9A 4OQGA 1FSWA 1ESUA 4CLCC 3SS5A 3UMDA 1BLHA 3RJUA 2GJ3A 4B93A 4DDYA 3MQ0A 1E3UD 2E8IA 3PBSA 4IUKA 1H8MA 1PIOA 2XA7S 5AQ7A 5L8MA 4BL2A 1MZUA 5DKKA 3W8KA 2PD7A 1K57C 3LR4A 1MWSA 1IEMA 5FAOA 5G18A 3DTIA 4R3AA 5J3WA 4H6JB 4JGQA 1OTBA 1K38A 5HAQA 3F1NB 5EOEA 3VMAA 2V1AA 3IF6A 1YLPA 3CHWP 2IWBA 2Y4AA 3ZGAB 4ZTKA 2VLGA 3VOZA 3IS2A 4OLDA 1LHYA 4WEJA 2O9AA 3TOIA 2C5WB 1K4FA 1SKFA 5KMWA 4RQ9A 1KGFA 5L07A 2L1MA 4EUZA 4JPMA 4OVDA 5I94A 3MXRA 5HX9A 3V5MA 2Y91A 4QY5A 4LRYC 5FAQA 2PHYA 1LL9A 2J3TC 1H0MA 3KSHA 2PRFA 1FCMA 1PI4A 3ZDJA 4B9OA 2D01A 2ZM0A 4WZ5C 5FEFA 2W0NA 4R3BA 2WZXA 3KSFA 3PBNA 3LGOA 5DTSA 4QD4A 3T1RA 1GHMA 1ES3A 3E2LA 4LLOB 3BQ8A 3ZHHA 1L0GA 3PR6A 4BMWA 5MC7A 1D06A 2Y2HA 4A5RA 4Y0OA 1NXYA 4S2NC 1S6RA 2GDNA 2PYRA 3N8RA 2PT7A 2J3TD 5FAPA 3E2KA 3HLGA 1ZTUA 2L0WA 2Y55A 4IHQA 1GHPA 1EWZA 1OMEA 4E3JA 2BG1A 1JNUA 1H5XA 1HTZA 2JKGA 1YSQA 1LLBA 3FWLA 3I7JA 3QP5A 3O86A 4YWZA 4G3KA 1G28A 5GHXA 3BFFA 3L7HA 3UB5P 1YLYA 3NOUC 5E43A 3OCNA 4E6XA 1TVFA 3PAEA 4KZ3A 2VKSA 2ZQ9A 3ZFZA 3IT9A 2WUQA 4L0LA 4OH0A 4X55A 5F5YA 1S67L 3NIAA 4Y5FA 4LCMA 3G32A 2ZOIA 1VEUA 1EW0A 5TFQA 3MR0A 4LRZE 4OPQA 1MBLA 1ESIA 4I39A 4R6LA 1SHVA 3OPHA 1LT0A 1XXMA 4ARZA 2XRNA 4BJPA 2EX2A 1S0WA 5FI7A 1TD5A 3VV4A 4NXBA 1IKGA 3OPPA 3ZG8B 4UQIM 2ZMFA 5GLCA 3C4OA 2H5SA 2PYPA 4QWOA 4P6BA 3VP4A 2Y8HA 3SOIA 3WRZA 1RCJA 4OKPA 4S2JA 1G6OA 5TR7A 3PHYA 4FD8A 3FPVA 4PM9A 3MKFA 3DBAA 1L2SA 3E4PA 5JYPA 2ZL1B 1K56A 2B95A 3LY3A 2W3FA 4I3IA 1PWDA 3AGDA 2VX8A 1A0KA 3T1SA 4CLCA 4L9EA 2W3HA 2A24A 2VGLS 1WE4A 4R4RA 3WS1A 3JVVA 4EWFA 4B88A 3DW0A 2Z6DA 3B42A 3BFEA 3U4LP 1ES2A 1FSYA 3K3DA 1M6KA 4EETB 5HAIA 1GHIA 1W5DA 1L0DA 1K57A 2QWSA 2Y79A 3UDXA 1JTGA 3DWKA 2Y2PA 3BFGA 3C8CA 4WMCA 3V67A 2Z2MB 2EX9A 3DTKA 2QMIA 3F1PB 4DMZA 5D3OA 3MKEA 4HBUA 1TEMA 4MN6A 2XSSA 4KUKA 2QPNA 3A0VA 1DP6A 2R78A 3N6IA 4JLFA 4PKYG 4N1HA 4P87A 1IOUA 2JKFA 3GTCA 4OONA 4JXWA 2ZD8A 4IVIA 1WYCA 4Y2FA 1N4OA 2FFFB 4MMNA 2IWDA 4O01A 4JKTA 5HWTA 3DWZA 3BQAA 4MN7A 4LV2A 1MPLA 3LIDA 2B5RA 3F1NA 5TBMA 5K5BA 3VP2A 4PM7A 3KX0X 2XF3A 5DJUA 2OSUA 3UPNA 2EFUA 4IBXA 4ZBEA 3MJQA 5FL3A 5CRFA 3IXDA 4IUHA 3NHQA 4HOIA 2J9OA 2KDKA 4LPZA 3QP4A 2QHKA 2K31A 3IXGA 2PBDP 2ZQ8A 4WZ5A 4S2PA 1PYYA 3W2ZA 5HD5A 5M1AA 3SW1A 4OQIA 3LEZA 4MCWA 3FKVA 3TE8A 3HCYA 2VEAA 4S2NA 1F98A 1H8ZA 1W8YA 4GOGA 1W63M 3FYZA 4K0WA 3Q81A 4B4ZA 3MZFA 4JF4A 5E2EA 1F5MA 5FQ9A 5F1GA 5G4ZA 3IX8A 3Q07A 4S2MA 4OPYA 1CF0A 1S4SA 5IHVA 4EBNA 3FC7A 1MY8A 3KSGA 5CHUA 1FILA 1YMXA 4WM9A 1ERMA 3BFCA 2JBFA 1JVJA 2HGVA 4MLLA 3HUMA 4KQOA 3CJMA 4E6WA 3CITA 4XXRA 2MJ6A 4HP9A 2PU4A 5EVID 3VFHA 4IJGA 3AGEA 1W8QA 4KZ7A 2G2WA 3VFFA 2ZLYA 5DFXA 2B18A 3RXWA 1RGZA 2KOIA 2DCFA 2CMNA 2M7VA 2XFSA 4S2LA 4PHTA 3LR5A 4I3AA 4PMAA 5HD3A 1FIKA 2Y2JA 3EEHA 3EQUA 4QY6A 5EECA 2A2LA 3BFDA 1KDSA 2HJ9C 4DE3A 4KQQA 3EGDC 4X1MA 3OPRA 3IWOA 2LB9A 4Y17A 5LBRA 2QYBA 3N8SA 1XPBA 3FKWA 4PPRA 1W7FA 4HEFA 2EWWA 5CEBA 4DN0A 1EROA 4X69A 4C6YA 2XQZA 3BECA 4EXOA 1YLTA 4X56A 1VEUB 5EM1A 3W4OA 3NOPC 4EU0A 5HARA 1W79A 3MZEA 1NYYA 4LRXC 4ARZB 2PAVP 3V50A 1IELA 2ZL1A 1BTLA 4MDZA 1YAXA 1XFQA 1C3BA 3E98A 4O0PA 1F2KA 4I5SA 4MBFA 2WKHA 1T18A 3EGXC 1KE4A 3GRJA 2H0TA 3M2JA 3T4QA 4LFUA 1ONHA 1YQSA 1CJFA 2J80A 2WADA 5IU1A 1AWIA 4U0XA 3KO6A 5A92A 1TS8A 4KZ8A 3UDIA 2ZMAA 2FH5A 2W3DA 3M6HA 3HBRA 1LSXA 5DF8A 2K7SA 3WS2A 1DJCA 3C7VA 4JGRA 4R38A 1N9LA 4I3JA 3G31A 4X53A 2EXBA 2ZC3B 1N9OA 2NUPC 4GLQA 1YMSA 4P6ZM 1G5UA 3H9WA 3HJKA 4Q0HA 2VGJA 2BTFP 5L09A 3ZNTA 4N1XA 2EX8A 3O88A 4N9LA 4C75A 4S2IA 5DF7A 2FFYA 3VE4A 4EEPA 4P0MA 4O8GA 5AQBA 1KVLA 5DFYA 2Q9NA 3P01A 4WL9A 5C5KA 4KZ6A 3EWKA 4LENA 4XUXA 4HP4A 1MWTA 1P97A 1MWUA 1TS7A 2ZBBA 3OPLA 2HP6A 2RCXA 1K56D 1K55A 4DDSA 1TS0A 1CI8A 1ZG4A 3LICA 4CLCD 3R7WA 3FV7A 3UY6A 3JYIA 5F82A 3S1YA 5HAPA 2VA0A 1BUEA 5TBMB 4OOMA 3O87A 2B02A 3PAGA 5A93A 2HJEA 5F6AA 1FCNA 2GX5A 2V8CA 1WA9A 2QJ7A 4UQIS 1OPXA 2WAFA 2ACGA 2P04A 1UGUA 4WMCD 3S7NA 4Q0IA 3FZCA 3SH9A 4CPKA 5HWWA 2P9VB 1OTDA 3OBFA 1PFLA 3O5YA 3B33A 3QNBA 2O9BA 2Q0OA 5HDCA 5FSRA 2HDSA 4ME4A 4PKYA 4K08A 5EFWA 1GSVA 4HH2A 5FQJA 2PR5A 4KZ9A 4WF0A 5HFOA 4JXVA 4R0QA 4DE2A 1MKIA 1HVBA 3DTMA 2V1ZA 4HJ6A 3OCLA 4GJ4A 1M40A 4UA6A 4BBVA 2V0WA 1VHMA 4NK3A 5FDHA 4GHIB 1FR1A 3T12B 3IF5A 3LFVA 4DRTA 3WS5A 4JGPA 3IX3A 3MQOA 4XT2B 3S7QA 5GLDA 1T19A 3MFDA 4WEKA 4KZBA 4WLAA 3S22A 5HWVA 1Y4OA 5HDSA 5CXWA 3GMWA 3CUEA 3H82A 2OAP1 2Z2LB 5F1FA 2NUTC 4WZ4A 3G30A 3NBLA 5KIZA 5AVFA 1K6SA 1E25A 3UNWA 2ZMVA 1T1BA 3UB8A 1LL5A 4NG2A 1L0FA 4QJGA 1NYMA 3MXQA 1UWNX 4RX3A 4EW7A 2JC7A 1NWZA 2VJWA 3LY4A 4R1GA 1NY0A 4E04A 2J7VA 3E0YA 2C6WB 1XX2A 2Y2QA 2X02A 3C5AA 4ZDXA 1RP5A 5GL9A 2PU2A 3LUQA 3C38A 1CEFA 3C7UA 4YINA 3NI9A 2XGNA 3F1OB 4HI4A 3NDGA 1LSWA 2O0YA 5F83A 1S1YA 3CPTB 1J3WA 4Y3IA 3NY4A 4AFIA 1OTAA 2GZAA 1Z6FA 4BWIA 1MC0A 1DY6A 2V2FF 3Q82A 1DJAA 4MNRA 3WS4A 2W1RA 3CLOA 3A3FA 3LI9A 2HZ5A 2O99A 5A91A 1E3UA 4IEDA 3ITBA 1FR6A 4L9GA 4H8RA 2GNXA 4F3LA 3NOTC 3T4OA 4RA7A 3S4XA 3QP2A 5IS1A 3ZNYA 1PZOA 2KLIA 3T4TA 2DRWA 5DTKA 1YT4A 2JE5A 5HL6A 3ITAA 4RYEA 3IWIA 5E2HA 3E4OA 4R4SA 3OLOA 2J3WA 3DTEA 4EV4A 4ZAMA 2J9PA 2RL3A 2HP9A 1YSPA 2ZQCA 1NZUA 4X1LA 2WAEA 4HNBA 3KYEA 4YFMA 3UE6A 3Q7VA 3TG9A 4QU3A 1XA1A 2WKIA 1KOUA 3HREA 4Q0JA 4Y13A 4GD6A 1OTEA 1P9RA 4O7DA 5AJGA 3UE0A 1V9YA 2CC1A 2WKRA 3V3RA 4GW9A 3ZVTA 1OT6A 4U3TA 3HLFA 2Y2LA 2XROA 4U0TA 2Z6CA 2H28A 3KYZA 4MBHA 5CTNA 3IX4A 1SKOA 1ONGA 4GN2A 1U60A 2KX6A 3VE3A 3PBRA 4GCZA 3IWQA 5EOOA 1XKZA 5CGXA 2FZ0A 1NJ4A 2P9VA 2J8YA 2WKEA 3GDIA 2HDUA 4R23A 1SCWA 3R7WB 1Q2PA 4BBTA 4FUWA 4KENB 4BLMA 3A0SA 3T4KA 2HP5A 4DJ2A 4Q8IA 4EBLA 3L9KA 1P9WA 2VK3A 4HHDA 3QP6A 1KE3A 2V1BA 1K55C 5AVEA 3ZG9B 1SDNA 3W4PA 4EESA 1IYQA 2O9CA 4QHCA 4Y7PA 1H8YA 4GHIA 5DF9A 5GHZA 3CZDA 2W1TB 3HUNA 5M19A 2WKQA 1BYWA 4JXSA 4XT2A 4E3OA 2ZC5B 3GV9A 3EQVA 3GSGA 2WK0A 3G2YA 1JWVA 2Y2NA 2OAQ1 4FCFA 2HF6A 3MS6A 1PW8A 3R4KA 4UA9A 1KVMA 4GS9B 3PBTA 2Q9MA 3HUOA 5CHMA 2Y2OA 4YNRA 4FOFA 3ZYTA 1GA9A 3FG8A 3G6OA 3QP8A 2ZQDA 2QZ6A 1J9MA 1XJ2A 3ZG5A 4P6ZS 3VP3A 4UA7A 3LIBA 4PAUA 1QMFA 1S4RA 3WWXA 4EQ1A 2Y2IA 1W63Q 2ZJ9A 2ZQAA 4LV1A 4BBUA 4HESA 4EUVA 3BJNA 1I2WA 1Z09A 1IYSA 1ES4A 4OQHA 1G68A 3H82B 4DXCA 2EXAA 3D3OA 5FASA 4JGOA 2VV6A 1BLSA 4D60A 2IA2A 2LB5A 3LR3A 2WZZA 4ETXA 5KSCA 3MBZA 4EEUA 4OOLA 4FH4A 2Y2MA 3F1OA 3IQAA 4CLCE 1CK3A 5HSQA 5DTTA 3IHAA 3CUEC 2WGVA 1TF1A 3BW6A 3JVUA 4NXGA 3HVFA 3EEAA 2ZC6B 3ZCZA 4DKIA 3CPTA 2PR6A 1XA7A
chains in the Genus database with same CATH topology
2QKPA 3B47A 2B02A 1TD5A 4G3VA 3VV4A 2HJEA 5F6AA 4NXBA 2W3GA 1YKDA 3P7NA 4UQIM 2ZMFA 2I9VA 5TJJA 1MKMA 2GX5A 3VOLA 1WA9A 5KSHA 2QJ7A 4UEYA 4UQIS 1OPXA 2PYPA 2HV1A 3K3CA 2BASA 2P04A 1UGUA 2Y8HA 3S7NA 4Q0IA 3IBRA 5HWWA 1ZHHB 1OTDA 3IBJA 1G6OA 3OBFA 2EWVA 3TW8A 3O5YA 3PHYA 3B33A 3MF0A 3FPVA 3ZQ5A 3DBAA 3U2AA 2O9BA 3E4PA 5HDCA 2VZWA 3T4SA 2JHEA 4CQHA 4ME4A 2W3FA 4PKYA 3IS2B 4K08A 5EFWA 1GSVA 1LSVA 4HH2A 2PR5A 4WF0A 2V0UA 4I3IA 2VGLM 2VX8A 3RFBA 4CLCA 2P08A 4L9EA 2W3HA 2A24A 2VGLS 4HJ6A 3CAXA 3OCLA 4GJ4A 4BBVA 2V0WA 1VHMA 3JVVA 2ZOHA 3TJZC 3HJIA 1UWPX 4GHIB 2Z6DA 3B42A 4F3LB 3LFVA 3PXPA 3K3DA 1D7EA 2YKFA 4JGPA 3KSIA 3MQOA 4EETB 4XT2B 3BWLA 3S7QA 3T4LA 1V9ZA 3E4QA 5HPFA 2QWSA 2W3EA 3OC2A 1T19A 2Y79A 4WEKA 2PDRA 4ZRRA 5HPIA 4WLAA 4WELA 3GECA 4II7A 3C8CA 3V67A 5HWVA 5HDSA 3CUEA 1IFQA 3F1PB 5DKLA 4DMZA 3H82A 3OOVA 3S7OA 2JKTM 2OAP1 4MN6A 2NUTC 2XSSA 1XJ3A 4KUKA 3A0VA 1DP6A 4WN5A 3UE3A 2R78A 5A8BA 5KIZA 2JKRI 4PKYG 5AVFA 2PD8A 2ZMVA 4NKPA 1IOUA 1VB6A 1T1BA 3UB8A 3FPWA 1DRMA 3MQQA 4Y2FA 1GSWA 3BY9A 4MMNA 4O01A 1XJ4A 3MXQA 1UWNX 5HWTA 4EW7A 3BQAA 4MN7A 1NWZA 2VJWA 3LIDA 4WUJA 1OJGA 5CX7A 1OTIA 3F1NA 5TBMA 5K5BA 4E04A 3MFXA 3E0YA 3KX0X 4HIAA 5DJUA 3MJQA 5FL3A 4R70A 3RTYA 5F69A 4IUHA 3LUQA 3NHQA 4HOIA 1Y28A 2KDKA 4LPZA 2M7UA 3UMEA 2QHKA 2W27A 2K31A 3C38A 4L9FA 4DJ3A 2P7JA 3W2ZA 1GSXA 3F1OB 5HD5A 3SW1A 3ULFA 3LR0A 2EA9A 2YKHA 4HI4A 4MCWA 5G4YA 4KUOA 1LSWA 2O0YA 3TE8A 3HCYA 3KYQA 3NJAA 2W1TA 2VEAA 1S1YA 4Y3IA 4AFIA 1F98A 1OTAA 2GZAA 3PBOA 4BWIA 1MC0A 1STZA 5IT5A 1W63M 5HZHA 1NLYA 1S66L 3UB7A 2L4RA 5DJTA 2W1RA 2G7UA 3PBQA 3CLOA 2OWJA 1F5MA 3LI9A 3D72A 5G4ZA 1LL8A 2O99A 4GS9A 2M1CA 1S4SA 4L9GA 4YOFA 3T4JA 5I5LA 3FC7A 3KSGA 2GNXA 2VV8A 4F3LA 3NOTC 3T4OA 2INWA 3S7PA 4M4XA 5IS1A 3TRCA 1N9NA 2HGVA 4KQOA 2KLIA 3C2WA 3T4TA 3CITA 5HL6A 3F1PA 2MJ6A 3E4OA 3OLOA 2J3WA 3CWFA 3ICYA 3K2NA 4CLCB 2A24B 2DMWA 3LIFA 3T50A 3H7WA 4HP9A 4EERA 1H3QA 3C30A 4IJGA 4NEED 4ETZA 1YSPA 2JKTI 1NLZA 4G3WA 1F9IA 4HNBA 5DFXA 4HQAA 2B18A 5J7EA 2KOIA 3UE6A 2CMNA 2VV7A 4HJ4A 1KOUA 2M7VA 4Q0JA 4PHTA 3LR5A 4I3AA 1OTEA 1XJ6A 1P9RA 1DP9A 3UB9A 5HD3A 5AJGA 3EQUA 3EEHA 1V9YA 2A2LA 2WKRA 4CLCC 3UMDA 2HJ9C 2GJ3A 4GW9A 3EGDC 1OT6A 4B93A 1DP8A 2LB9A 3MQ0A 5LBRA 4HJ3A 2XROA 2XA7M 3LIEA 2QYBA 3PBSA 4IUKA 1H8MA 2Z6CA 2H28A 2XA7S 3KYZA 5HDDA 5L8MA 1MZUA 5DKKA 3UB6A 2PD7A 2V9AA 1ODVA 3RH8B 2EWWA 3LR4A 4DN0A 1P0ZA 2KX6A 3VE3A 3PBRA 4R3AA 4GCZA 5J3WA 4H6JB 4JGQA 4FSFA 4EXOA 1OTBA 3LYXA 2FZ0A 4NXFA 3NOPC 3GDIA 4EU0A 3F1NB 3R7WB 3CI6A 4BBTA 4LRXC 4ARZB 2V1AA 3A0SA 3T4KA 4MDZA 4DJ2A 1YAXA 1XFQA 2VLGA 3IS2A 3E98A 1P9WA 4O0PA 4I5SA 4WEJA 2O9AA 4HHDA 4KQDA 1T18A 3EGXC 4RQ9A 2L1MA 2V1BA 5AVEA 3T4QA 2QJ5A 4EESA 2O9CA 4GHIA 5DF9A 2J80A 4LRYC 2PHYA 2W1TB 2OWHA 5IU1A 2WKPA 3KO6A 2J3TC 2WKQA 1BYWA 4XT2A 3BY8A 1TS8A 3KSHA 2FH5A 2W3DA 3EQVA 1NRJA 4B9OA 2OAQ1 4NXEA 2D01A 1LSXA 2HF6A 2K7SA 2W0NA 3LI8A 3R4KA 4JGRA 3KSFA 3PBNA 4R38A 1OJ5A 4GS9B 4QPRA 3PBTA 1N9LA 4I3JA 4LLOB 3BQ8A 3LIAA 1X0OA 1XFNA 3PR6A 4YNRA 4BMWA 4FOFA 5MC7A 1D06A 1N9OA 1T1AA 2NUPC 4GLQA 3ZYTA 3FG8A 3G6OA 1TS6A 4P6ZM 3H9WA 3HJKA 2PYRA 1XJ2A 2PT7A 4Q0HA 4P6ZS 2J3TD 4I38A 3LIBA 4PAUA 3PYPA 1ZTUA 2L0WA 1S4RA 4IHQA 1JNUA 4EQ1A 1W63Q 4HH3A 4BBUA 1YSQA 4EUVA 3BJNA 2K2NA 4YWZA 4G3KA 1G28A 3H7WB 2D02A 3A0RA 2JKRM 3H82B 3VE4A 4EEPA 3D3OA 4O8GA 3NOUC 4JGOA 3OCNA 2VV6A 5DFYA 3P01A 4HY8A 4WL9A 5C5KA 3EWKA 2IA2A 2VKSA 4HP4A 3EOIA 2LB5A 1P97A 3LR3A 4Z1WA 1TS7A 2ZBBA 4ETXA 4H6JA 3MMHA 4L0LA 4OOLA 4EEUA 2OOLA 1S1ZA 5F5YA 1S67L 4Y5FA 3F1OA 2ZOIA 4CLCE 1TS0A 1OT9A 1EW0A 5HSQA 3MR0A 4LRZE 3LICA 3CUEC 4CLCD 1TF1A 3BW6A 3JVUA 1T1CA 4I39A 4NXGA 3R7WA 3EEAA 2JN7A 4R6LA 5J4EA 2VA0A 4ARZA 1LT0A 5F68A 2PR6A 2XRNA 4BJPA 4MN5A 5TBMB 4OOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9C A;  4Y2F A;  3K2N A;  1TD5 A;  4MMN A;  4G3V A;  4LRY C;  4O01 A;  3VV4 A;  2W1T B;  4IJG A;  4ETZ A;  1YSP A;  2W3G A;  1YKD A;  3KO6 A;  2ZMF A;  5TJJ A;  4G3W A;  1MKM A;  2GX5 A;  4MN7 A;  5DFX A;  3KSH A;  2B18 A;  2W3D A;  2VJW A;  2KOI A;  5K5B A;  4E04 A;  3E0Y A;  2M7V A;  4Q0J A;  2Y8H A;  3S7N A;  4Q0I A;  3R4K A;  3KSF A;  3IBR A;  4QPR A;  3IBJ A;  4R70 A;  5AJG A;  3OBF A;  4IUH A;  3NHQ A;  3O5Y A;  3MF0 A;  4YNR A;  2M7U A;  3ZQ5 A;  4FOF A;  2K31 A;  3DBA A;  2O9B A;  4GLQ A;  2VZW A;  4GW9 A;  3G6O A;  3W2Z A;  2LB9 A;  3MQ0 A;  5LBR A;  4CQH A;  4ME4 A;  2W3F A;  2XRO A;  4Q0H A;  2QYB A;  4IUK A;  3RFB A;  4MCW A;  4PAU A;  1ZTU A;  2O0Y A;  2W3H A;  5L8M A;  3HCY A;  2W1T A;  2VEA A;  4Y3I A;  1YSQ A;  1VHM A;  1MC0 A;  1STZ A;  4BWI A;  4DN0 A;  3BJN A;  4EUV A;  2K2N A;  4G3K A;  3LFV A;  2W1R A;  2G7U A;  3KSI A;  1F5M A;  3S7Q A;  3D3O A;  4O8G A;  3NOU C;  2O99 A;  5HPF A;  5DFY A;  2W3E A;  2Y79 A;  3NOP C;  4ZRR A;  5C5K A;  4EU0 A;  5HPI A;  4YOF A;  2IA2 A;  2VKS A;  5I5L A;  2LB5 A;  3KSG A;  3CI6 A;  4Z1W A;  3NOT C;  4LRX C;  4ETX A;  3S7P A;  3MMH A;  4DMZ A;  3OOV A;  3S7O A;  2OOL A;  4MDZ A;  3TRC A;  4Y5F A;  2XSS A;  3E98 A;  4O0P A;  5HSQ A;  2HGV A;  2O9A A;  4LRZ E;  2KLI A;  4RQ9 A;  1TF1 A;  3C2W A;  3EEA A;  4R6L A;  3CIT A;  2XRN A;  5HL6 A; 
#chains in the Genus database with same CATH topology
 3B47 A;  5CER A;  1CQA A;  1YKD A;  3BRM A;  4GD8 A;  5TJJ A;  1PWG A;  5KSH A;  3RXX A;  4WBG A;  3IXB A;  3K3C A;  4OPZ A;  3Q1F A;  3V39 A;  3IBR A;  2JCH A;  2A3U A;  2R9X A;  2EWV A;  3MF0 A;  3A3J A;  4DE1 A;  1BLC A;  2JHE A;  4B4X A;  4FH2 A;  4CQH A;  1LSV A;  2V0U A;  3RFB A;  2P08 A;  3N8L A;  1PWC A;  5FI2 A;  3AGF A;  3TJZ C;  3NUL A;  4EBP A;  4F3L B;  2H10 A;  5CGW A;  4DE0 A;  3KSI A;  2PBY A;  3A3D A;  4P85 A;  3E4Q A;  2W3E A;  3NEC A;  2PDR A;  1YLZ A;  4ZRR A;  4E3L A;  5HPI A;  4WEL A;  3GEC A;  1YLW A;  3MXS A;  3G2Z A;  2R9W A;  1SDE A;  3HLC A;  5DKL A;  4IBR A;  5GLA A;  5AQ9 A;  1ALQ A;  3OOV A;  5L2F A;  2JKT M;  1K54 A;  2V20 A;  3MZD A;  3ZG0 A;  4WN5 A;  3UE3 A;  5A8B A;  2PD8 A;  4NKP A;  1VB6 A;  5EVL A;  1DRM A;  3Q7V B;  3LO7 A;  3ZG7 B;  1I5Q A;  5GLB A;  1XJ4 A;  4LCL A;  1KDW A;  3G34 A;  3VP0 A;  5CX7 A;  3SZT A;  1Y54 A;  4HIA A;  3Q7Z A;  3IH9 A;  4ID4 A;  1FQG A;  4OOY A;  4JXG A;  4R70 A;  3CG5 A;  3RTY A;  1L3L A;  1Y28 A;  2M7U A;  2W27 A;  3MSH A;  3N7W A;  4DJ3 A;  3QHY A;  1SKO B;  5EVI A;  4KZ4 A;  1PRQ A;  4OP8 A;  1I2S A;  3KYQ A;  2W1T A;  3QP1 A;  1PW1 A;  2WGW B;  1NLY A;  3VP1 A;  1S66 L;  3UB7 A;  2L4R A;  1LI9 A;  2HDQ A;  2G7U A;  2OWJ A;  4LV0 A;  1D1J A;  2UWX A;  4GS9 A;  2M1C A;  4YOF A;  3T4J A;  2INW A;  4KG6 A;  4LGW A;  1KGG A;  1RGY A;  3G35 A;  4UAA A;  4S2K A;  1N9N A;  1O07 A;  4PM5 A;  3C2W A;  2G2U A;  1E4D A;  1K25 A;  3V3S A;  5FA7 A;  4BD1 A;  3K2N A;  3LIF A;  4EER A;  3C30 A;  4NEE D;  4ETZ A;  3D9Y A;  2OLV A;  2JKT I;  1KE0 A;  1F9I A;  4HQA A;  5EPH A;  2XK1 A;  4EQI A;  5A90 A;  1K4E A;  5J7E A;  3LEQ A;  4RX2 A;  4MBK A;  2VV7 A;  1IKI A;  2EFX A;  2ZM8 A;  1K6R A;  3UB9 A;  2XH9 A;  4X68 A;  3UE1 A;  1DP8 A;  3VOY A;  2OLU A;  4HJ3 A;  4BEN A;  2XA7 M;  3LIE A;  1XGJ A;  3C4P A;  5HDD A;  3UB6 A;  3CMZ A;  2X01 A;  1G6A A;  2V9A A;  1GA0 A;  1QME A;  1ODV A;  3RH8 B;  5FI6 A;  5FQK A;  1P0Z A;  4UHU A;  2VGK A;  1TDL A;  4FSF A;  3LYX A;  4LV3 A;  4NXF A;  5FQI A;  1XP4 A;  3GVB A;  3SH7 A;  3HLE A;  1BLP A;  1EI5 A;  3CI6 A;  3IXH A;  4WYY A;  1BZA A;  3OZH A;  5HW3 A;  3WS0 A;  1VQQ A;  4K0X A;  4GDN A;  4BL3 A;  1GCE A;  4KQD A;  4C3Q A;  3N4I A;  3QNC A;  2XD1 A;  2XD5 A;  4F94 A;  2QJ5 A;  4Y15 A;  4KZA A;  4HBT A;  1JWZ A;  2OWH A;  1PNE A;  2WKP A;  4GZB A;  2ZC4 B;  4XUZ A;  1KGE A;  3BY8 A;  5BOH A;  2HPB A;  4Y0T A;  5FEG A;  1NRJ A;  2WYX A;  4NXE A;  4E3M A;  2XLN A;  2OV5 A;  3LI8 A;  1SZV A;  1OJ5 A;  3BLS A;  4QPR A;  2BLS A;  5U47 A;  3LIA A;  3UPP A;  1X0O A;  5CTM A;  1XFN A;  1HLU P;  3NC8 A;  1T1A A;  1TS6 A;  1BT5 A;  5FAT A;  4I38 A;  1CI9 A;  1VET B;  3PYP A;  3HLD A;  5CGS A;  4JF6 A;  2WGI A;  4DXB A;  3P98 A;  4HH3 A;  2IWC A;  2K2N A;  3H7W B;  3IH8 A;  2D02 A;  3A0R A;  2Y59 A;  2JKR M;  1L0E A;  1JTD A;  3A3E A;  2A49 A;  2P74 A;  3NCK A;  1N9B A;  4HY8 A;  1IYO A;  2XR0 A;  4X6T A;  3EOI A;  5EVE A;  4Z1W A;  4KG2 A;  4H6J A;  3MMH A;  4GNU A;  3WRT A;  2OOL A;  1S1Z A;  4KZ5 A;  3SS4 A;  4Z9Q A;  5TGF A;  1OT9 A;  1NRF A;  3T1X A;  1T1C A;  1K54 C;  2JN7 A;  5J4E A;  3BEB A;  5F68 A;  4MN5 A;  2QKP A;  3M2K A;  1HZO A;  2WGW A;  3UN7 A;  4G3V A;  1ACF A;  2EX6 A;  2W3G A;  3G4P A;  1LI0 A;  3P7N A;  2I9V A;  3A3I A;  1MKM A;  3VOL A;  1XGI A;  4N92 A;  4UEY A;  3D4F A;  3GR2 A;  3HL9 A;  5EVI B;  2HV1 A;  5E2G A;  2BAS A;  4N9K A;  4BD0 A;  1CEG A;  5EV0 A;  1MWR A;  1ZHH B;  3IBJ A;  5EE8 A;  3BLM A;  3BM6 A;  1BSG A;  1WYB A;  3TW8 A;  3IHB A;  4PM8 A;  1AXB A;  3ZQ5 A;  4DF6 A;  5CHJ A;  2X71 A;  4E3I A;  3IF6 B;  3U2A A;  2VZW A;  3T4S A;  4GDB A;  3IS2 B;  5E2F A;  5J8X A;  2V8F A;  1HD8 A;  2VGL M;  3VSK A;  5EVI C;  5GHY A;  3M6B A;  3UDF A;  3VSL A;  3CAX A;  2ZOH A;  3HJI A;  1UWP X;  5AQA A;  3PXP A;  4KG5 A;  1D7E A;  1ES5 A;  2YKF A;  2XDM A;  3IF6 C;  2H0Y A;  1FCO A;  3BWL A;  1O7E A;  3T4L A;  1FOF A;  1V9Z A;  5HPF A;  3OC2 A;  4CJN A;  4II7 A;  4D2O A;  4M3K A;  3T1Q B;  1IFQ A;  3S7O A;  3PTE A;  4QB8 A;  4OQ0 A;  1XJ3 A;  2AVX A;  2JKR I;  4MEZ A;  3HLW A;  3ZVW A;  2Y2K A;  2DNS A;  1ERQ A;  3FPW A;  4GKU A;  5KZH A;  1ZC2 A;  3JPU A;  3MQQ A;  1GSW A;  1TDG A;  2E8J A;  3BY9 A;  4NET A;  3B3X A;  3W4Q A;  4ESP A;  4R3J A;  3ISG A;  4WUJ A;  1OJG A;  1OTI A;  3MFX A;  4ZJ3 A;  4GB7 A;  5F69 A;  4ZJ1 A;  4S2O A;  1IYP A;  5DVA A;  3UME A;  1BUL A;  2I72 A;  4L9F A;  5FQQ A;  2P7J A;  5L10 A;  4KQR A;  4JF5 A;  1GSX A;  5FQM A;  4Y0U A;  4OPR A;  5HL1 A;  3ULF A;  3LR0 A;  2EA9 A;  2YKH A;  1PZP A;  1NZO A;  3DAV A;  5G4Y A;  4KUO A;  2ZQ7 A;  4OLG A;  4PM6 A;  3NJA A;  2XFT A;  2ZM2 A;  5FDS A;  3PBO A;  1STZ A;  5EM0 A;  5IT5 A;  4K91 A;  4E3N A;  3UO9 A;  5HZH A;  4E3K A;  4RVA A;  5M18 A;  4JBF A;  5DJT A;  2ZC7 A;  3PBQ A;  1VM1 A;  2XEP A;  1K0K A;  3D72 A;  1LL8 A;  2UV0 E;  1PI5 A;  5I5L A;  2VV8 A;  3S7P A;  4M4X A;  1YPR A;  1YM1 A;  5EUA A;  3GQZ A;  3P09 A;  4X25 A;  1Q2Q A;  3SS3 A;  3TSG A;  3O3V A;  3TRC A;  3HLB A;  1VET A;  3BYD A;  4OP5 A;  1ZG6 A;  3UPO A;  2HDR A;  2Y2G A;  5CEC A;  5CED A;  3F1P A;  4ZJ2 A;  3CWF A;  3ICY A;  4CLC B;  5JYO A;  2A24 B;  2DMW A;  3T50 A;  3LCE A;  3H7W A;  3SH8 A;  1H3Q A;  1YLJ A;  1JWP A;  1NLZ A;  1DJB A;  4G3W A;  4IVK A;  1ZKJ A;  4FTX A;  4HJ4 A;  4BQM A;  3NDE A;  1MXO A;  1XJ6 A;  1DP9 A;  4OQG A;  1FSW A;  1ESU A;  4CLC C;  3SS5 A;  3UMD A;  1BLH A;  3RJU A;  2GJ3 A;  4B93 A;  4DDY A;  3MQ0 A;  1E3U D;  2E8I A;  3PBS A;  4IUK A;  1H8M A;  1PIO A;  2XA7 S;  5AQ7 A;  5L8M A;  4BL2 A;  1MZU A;  5DKK A;  3W8K A;  2PD7 A;  1K57 C;  3LR4 A;  1MWS A;  1IEM A;  5FAO A;  5G18 A;  3DTI A;  4R3A A;  5J3W A;  4H6J B;  4JGQ A;  1OTB A;  1K38 A;  5HAQ A;  3F1N B;  5EOE A;  3VMA A;  2V1A A;  3IF6 A;  1YLP A;  3CHW P;  2IWB A;  2Y4A A;  3ZGA B;  4ZTK A;  2VLG A;  3VOZ A;  3IS2 A;  4OLD A;  1LHY A;  4WEJ A;  2O9A A;  3TOI A;  2C5W B;  1K4F A;  1SKF A;  5KMW A;  4RQ9 A;  1KGF A;  5L07 A;  2L1M A;  4EUZ A;  4JPM A;  4OVD A;  5I94 A;  3MXR A;  5HX9 A;  3V5M A;  2Y91 A;  4QY5 A;  4LRY C;  5FAQ A;  2PHY A;  1LL9 A;  2J3T C;  1H0M A;  3KSH A;  2PRF A;  1FCM A;  1PI4 A;  3ZDJ A;  4B9O A;  2D01 A;  2ZM0 A;  4WZ5 C;  5FEF A;  2W0N A;  4R3B A;  2WZX A;  3KSF A;  3PBN A;  3LGO A;  5DTS A;  4QD4 A;  3T1R A;  1GHM A;  1ES3 A;  3E2L A;  4LLO B;  3BQ8 A;  3ZHH A;  1L0G A;  3PR6 A;  4BMW A;  5MC7 A;  1D06 A;  2Y2H A;  4A5R A;  4Y0O A;  1NXY A;  4S2N C;  1S6R A;  2GDN A;  2PYR A;  3N8R A;  2PT7 A;  2J3T D;  5FAP A;  3E2K A;  3HLG A;  1ZTU A;  2L0W A;  2Y55 A;  4IHQ A;  1GHP A;  1EWZ A;  1OME A;  4E3J A;  2BG1 A;  1JNU A;  1H5X A;  1HTZ A;  2JKG A;  1YSQ A;  1LLB A;  3FWL A;  3I7J A;  3QP5 A;  3O86 A;  4YWZ A;  4G3K A;  1G28 A;  5GHX A;  3BFF A;  3L7H A;  3UB5 P;  1YLY A;  3NOU C;  5E43 A;  3OCN A;  4E6X A;  1TVF A;  3PAE A;  4KZ3 A;  2VKS A;  2ZQ9 A;  3ZFZ A;  3IT9 A;  2WUQ A;  4L0L A;  4OH0 A;  4X55 A;  5F5Y A;  1S67 L;  3NIA A;  4Y5F A;  4LCM A;  3G32 A;  2ZOI A;  1VEU A;  1EW0 A;  5TFQ A;  3MR0 A;  4LRZ E;  4OPQ A;  1MBL A;  1ESI A;  4I39 A;  4R6L A;  1SHV A;  3OPH A;  1LT0 A;  1XXM A;  4ARZ A;  2XRN A;  4BJP A;  2EX2 A;  1S0W A;  5FI7 A;  1TD5 A;  3VV4 A;  4NXB A;  1IKG A;  3OPP A;  3ZG8 B;  4UQI M;  2ZMF A;  5GLC A;  3C4O A;  2H5S A;  2PYP A;  4QWO A;  4P6B A;  3VP4 A;  2Y8H A;  3SOI A;  3WRZ A;  1RCJ A;  4OKP A;  4S2J A;  1G6O A;  5TR7 A;  3PHY A;  4FD8 A;  3FPV A;  4PM9 A;  3MKF A;  3DBA A;  1L2S A;  3E4P A;  5JYP A;  2ZL1 B;  1K56 A;  2B95 A;  3LY3 A;  2W3F A;  4I3I A;  1PWD A;  3AGD A;  2VX8 A;  1A0K A;  3T1S A;  4CLC A;  4L9E A;  2W3H A;  2A24 A;  2VGL S;  1WE4 A;  4R4R A;  3WS1 A;  3JVV A;  4EWF A;  4B88 A;  3DW0 A;  2Z6D A;  3B42 A;  3BFE A;  3U4L P;  1ES2 A;  1FSY A;  3K3D A;  1M6K A;  4EET B;  5HAI A;  1GHI A;  1W5D A;  1L0D A;  1K57 A;  2QWS A;  2Y79 A;  3UDX A;  1JTG A;  3DWK A;  2Y2P A;  3BFG A;  3C8C A;  4WMC A;  3V67 A;  2Z2M B;  2EX9 A;  3DTK A;  2QMI A;  3F1P B;  4DMZ A;  5D3O A;  3MKE A;  4HBU A;  1TEM A;  4MN6 A;  2XSS A;  4KUK A;  2QPN A;  3A0V A;  1DP6 A;  2R78 A;  3N6I A;  4JLF A;  4PKY G;  4N1H A;  4P87 A;  1IOU A;  2JKF A;  3GTC A;  4OON A;  4JXW A;  2ZD8 A;  4IVI A;  1WYC A;  4Y2F A;  1N4O A;  2FFF B;  4MMN A;  2IWD A;  4O01 A;  4JKT A;  5HWT A;  3DWZ A;  3BQA A;  4MN7 A;  4LV2 A;  1MPL A;  3LID A;  2B5R A;  3F1N A;  5TBM A;  5K5B A;  3VP2 A;  4PM7 A;  3KX0 X;  2XF3 A;  5DJU A;  2OSU A;  3UPN A;  2EFU A;  4IBX A;  4ZBE A;  3MJQ A;  5FL3 A;  5CRF A;  3IXD A;  4IUH A;  3NHQ A;  4HOI A;  2J9O A;  2KDK A;  4LPZ A;  3QP4 A;  2QHK A;  2K31 A;  3IXG A;  2PBD P;  2ZQ8 A;  4WZ5 A;  4S2P A;  1PYY A;  3W2Z A;  5HD5 A;  5M1A A;  3SW1 A;  4OQI A;  3LEZ A;  4MCW A;  3FKV A;  3TE8 A;  3HCY A;  2VEA A;  4S2N A;  1F98 A;  1H8Z A;  1W8Y A;  4GOG A;  1W63 M;  3FYZ A;  4K0W A;  3Q81 A;  4B4Z A;  3MZF A;  4JF4 A;  5E2E A;  1F5M A;  5FQ9 A;  5F1G A;  5G4Z A;  3IX8 A;  3Q07 A;  4S2M A;  4OPY A;  1CF0 A;  1S4S A;  5IHV A;  4EBN A;  3FC7 A;  1MY8 A;  3KSG A;  5CHU A;  1FIL A;  1YMX A;  4WM9 A;  1ERM A;  3BFC A;  2JBF A;  1JVJ A;  2HGV A;  4MLL A;  3HUM A;  4KQO A;  3CJM A;  4E6W A;  3CIT A;  4XXR A;  2MJ6 A;  4HP9 A;  2PU4 A;  5EVI D;  3VFH A;  4IJG A;  3AGE A;  1W8Q A;  4KZ7 A;  2G2W A;  3VFF A;  2ZLY A;  5DFX A;  2B18 A;  3RXW A;  1RGZ A;  2KOI A;  2DCF A;  2CMN A;  2M7V A;  2XFS A;  4S2L A;  4PHT A;  3LR5 A;  4I3A A;  4PMA A;  5HD3 A;  1FIK A;  2Y2J A;  3EEH A;  3EQU A;  4QY6 A;  5EEC A;  2A2L A;  3BFD A;  1KDS A;  2HJ9 C;  4DE3 A;  4KQQ A;  3EGD C;  4X1M A;  3OPR A;  3IWO A;  2LB9 A;  4Y17 A;  5LBR A;  2QYB A;  3N8S A;  1XPB A;  3FKW A;  4PPR A;  1W7F A;  4HEF A;  2EWW A;  5CEB A;  4DN0 A;  1ERO A;  4X69 A;  4C6Y A;  2XQZ A;  3BEC A;  4EXO A;  1YLT A;  4X56 A;  1VEU B;  5EM1 A;  3W4O A;  3NOP C;  4EU0 A;  5HAR A;  1W79 A;  3MZE A;  1NYY A;  4LRX C;  4ARZ B;  2PAV P;  3V50 A;  1IEL A;  2ZL1 A;  1BTL A;  4MDZ A;  1YAX A;  1XFQ A;  1C3B A;  3E98 A;  4O0P A;  1F2K A;  4I5S A;  4MBF A;  2WKH A;  1T18 A;  3EGX C;  1KE4 A;  3GRJ A;  2H0T A;  3M2J A;  3T4Q A;  4LFU A;  1ONH A;  1YQS A;  1CJF A;  2J80 A;  2WAD A;  5IU1 A;  1AWI A;  4U0X A;  3KO6 A;  5A92 A;  1TS8 A;  4KZ8 A;  3UDI A;  2ZMA A;  2FH5 A;  2W3D A;  3M6H A;  3HBR A;  1LSX A;  5DF8 A;  2K7S A;  3WS2 A;  1DJC A;  3C7V A;  4JGR A;  4R38 A;  1N9L A;  4I3J A;  3G31 A;  4X53 A;  2EXB A;  2ZC3 B;  1N9O A;  2NUP C;  4GLQ A;  1YMS A;  4P6Z M;  1G5U A;  3H9W A;  3HJK A;  4Q0H A;  2VGJ A;  2BTF P;  5L09 A;  3ZNT A;  4N1X A;  2EX8 A;  3O88 A;  4N9L A;  4C75 A;  4S2I A;  5DF7 A;  2FFY A;  3VE4 A;  4EEP A;  4P0M A;  4O8G A;  5AQB A;  1KVL A;  5DFY A;  2Q9N A;  3P01 A;  4WL9 A;  5C5K A;  4KZ6 A;  3EWK A;  4LEN A;  4XUX A;  4HP4 A;  1MWT A;  1P97 A;  1MWU A;  1TS7 A;  2ZBB A;  3OPL A;  2HP6 A;  2RCX A;  1K56 D;  1K55 A;  4DDS A;  1TS0 A;  1CI8 A;  1ZG4 A;  3LIC A;  4CLC D;  3R7W A;  3FV7 A;  3UY6 A;  3JYI A;  5F82 A;  3S1Y A;  5HAP A;  2VA0 A;  1BUE A;  5TBM B;  4OOM A;  3O87 A;  2B02 A;  3PAG A;  5A93 A;  2HJE A;  5F6A A;  1FCN A;  2GX5 A;  2V8C A;  1WA9 A;  2QJ7 A;  4UQI S;  1OPX A;  2WAF A;  2ACG A;  2P04 A;  1UGU A;  4WMC D;  3S7N A;  4Q0I A;  3FZC A;  3SH9 A;  4CPK A;  5HWW A;  2P9V B;  1OTD A;  3OBF A;  1PFL A;  3O5Y A;  3B33 A;  3QNB A;  2O9B A;  2Q0O A;  5HDC A;  5FSR A;  2HDS A;  4ME4 A;  4PKY A;  4K08 A;  5EFW A;  1GSV A;  4HH2 A;  5FQJ A;  2PR5 A;  4KZ9 A;  4WF0 A;  5HFO A;  4JXV A;  4R0Q A;  4DE2 A;  1MKI A;  1HVB A;  3DTM A;  2V1Z A;  4HJ6 A;  3OCL A;  4GJ4 A;  1M40 A;  4UA6 A;  4BBV A;  2V0W A;  1VHM A;  4NK3 A;  5FDH A;  4GHI B;  1FR1 A;  3T12 B;  3IF5 A;  3LFV A;  4DRT A;  3WS5 A;  4JGP A;  3IX3 A;  3MQO A;  4XT2 B;  3S7Q A;  5GLD A;  1T19 A;  3MFD A;  4WEK A;  4KZB A;  4WLA A;  3S22 A;  5HWV A;  1Y4O A;  5HDS A;  5CXW A;  3GMW A;  3CUE A;  3H82 A;  2OAP 1;  2Z2L B;  5F1F A;  2NUT C;  4WZ4 A;  3G30 A;  3NBL A;  5KIZ A;  5AVF A;  1K6S A;  1E25 A;  3UNW A;  2ZMV A;  1T1B A;  3UB8 A;  1LL5 A;  4NG2 A;  1L0F A;  4QJG A;  1NYM A;  3MXQ A;  1UWN X;  4RX3 A;  4EW7 A;  2JC7 A;  1NWZ A;  2VJW A;  3LY4 A;  4R1G A;  1NY0 A;  4E04 A;  2J7V A;  3E0Y A;  2C6W B;  1XX2 A;  2Y2Q A;  2X02 A;  3C5A A;  4ZDX A;  1RP5 A;  5GL9 A;  2PU2 A;  3LUQ A;  3C38 A;  1CEF A;  3C7U A;  4YIN A;  3NI9 A;  2XGN A;  3F1O B;  4HI4 A;  3NDG A;  1LSW A;  2O0Y A;  5F83 A;  1S1Y A;  3CPT B;  1J3W A;  4Y3I A;  3NY4 A;  4AFI A;  1OTA A;  2GZA A;  1Z6F A;  4BWI A;  1MC0 A;  1DY6 A;  2V2F F;  3Q82 A;  1DJA A;  4MNR A;  3WS4 A;  2W1R A;  3CLO A;  3A3F A;  3LI9 A;  2HZ5 A;  2O99 A;  5A91 A;  1E3U A;  4IED A;  3ITB A;  1FR6 A;  4L9G A;  4H8R A;  2GNX A;  4F3L A;  3NOT C;  3T4O A;  4RA7 A;  3S4X A;  3QP2 A;  5IS1 A;  3ZNY A;  1PZO A;  2KLI A;  3T4T A;  2DRW A;  5DTK A;  1YT4 A;  2JE5 A;  5HL6 A;  3ITA A;  4RYE A;  3IWI A;  5E2H A;  3E4O A;  4R4S A;  3OLO A;  2J3W A;  3DTE A;  4EV4 A;  4ZAM A;  2J9P A;  2RL3 A;  2HP9 A;  1YSP A;  2ZQC A;  1NZU A;  4X1L A;  2WAE A;  4HNB A;  3KYE A;  4YFM A;  3UE6 A;  3Q7V A;  3TG9 A;  4QU3 A;  1XA1 A;  2WKI A;  1KOU A;  3HRE A;  4Q0J A;  4Y13 A;  4GD6 A;  1OTE A;  1P9R A;  4O7D A;  5AJG A;  3UE0 A;  1V9Y A;  2CC1 A;  2WKR A;  3V3R A;  4GW9 A;  3ZVT A;  1OT6 A;  4U3T A;  3HLF A;  2Y2L A;  2XRO A;  4U0T A;  2Z6C A;  2H28 A;  3KYZ A;  4MBH A;  5CTN A;  3IX4 A;  1SKO A;  1ONG A;  4GN2 A;  1U60 A;  2KX6 A;  3VE3 A;  3PBR A;  4GCZ A;  3IWQ A;  5EOO A;  1XKZ A;  5CGX A;  2FZ0 A;  1NJ4 A;  2P9V A;  2J8Y A;  2WKE A;  3GDI A;  2HDU A;  4R23 A;  1SCW A;  3R7W B;  1Q2P A;  4BBT A;  4FUW A;  4KEN B;  4BLM A;  3A0S A;  3T4K A;  2HP5 A;  4DJ2 A;  4Q8I A;  4EBL A;  3L9K A;  1P9W A;  2VK3 A;  4HHD A;  3QP6 A;  1KE3 A;  2V1B A;  1K55 C;  5AVE A;  3ZG9 B;  1SDN A;  3W4P A;  4EES A;  1IYQ A;  2O9C A;  4QHC A;  4Y7P A;  1H8Y A;  4GHI A;  5DF9 A;  5GHZ A;  3CZD A;  2W1T B;  3HUN A;  5M19 A;  2WKQ A;  1BYW A;  4JXS A;  4XT2 A;  4E3O A;  2ZC5 B;  3GV9 A;  3EQV A;  3GSG A;  2WK0 A;  3G2Y A;  1JWV A;  2Y2N A;  2OAQ 1;  4FCF A;  2HF6 A;  3MS6 A;  1PW8 A;  3R4K A;  4UA9 A;  1KVM A;  4GS9 B;  3PBT A;  2Q9M A;  3HUO A;  5CHM A;  2Y2O A;  4YNR A;  4FOF A;  3ZYT A;  1GA9 A;  3FG8 A;  3G6O A;  3QP8 A;  2ZQD A;  2QZ6 A;  1J9M A;  1XJ2 A;  3ZG5 A;  4P6Z S;  3VP3 A;  4UA7 A;  3LIB A;  4PAU A;  1QMF A;  1S4R A;  3WWX A;  4EQ1 A;  2Y2I A;  1W63 Q;  2ZJ9 A;  2ZQA A;  4LV1 A;  4BBU A;  4HES A;  4EUV A;  3BJN A;  1I2W A;  1Z09 A;  1IYS A;  1ES4 A;  4OQH A;  1G68 A;  3H82 B;  4DXC A;  2EXA A;  3D3O A;  5FAS A;  4JGO A;  2VV6 A;  1BLS A;  4D60 A;  2IA2 A;  2LB5 A;  3LR3 A;  2WZZ A;  4ETX A;  5KSC A;  3MBZ A;  4EEU A;  4OOL A;  4FH4 A;  2Y2M A;  3F1O A;  3IQA A;  4CLC E;  1CK3 A;  5HSQ A;  5DTT A;  3IHA A;  3CUE C;  2WGV A;  1TF1 A;  3BW6 A;  3JVU A;  4NXG A;  3HVF A;  3EEA A;  2ZC6 B;  3ZCZ A;  4DKI A;  3CPT A;  2PR6 A;  1XA7 A; 
#chains in the Genus database with same CATH homology
 2QKP A;  3B47 A;  2B02 A;  1TD5 A;  4G3V A;  3VV4 A;  2HJE A;  5F6A A;  4NXB A;  2W3G A;  1YKD A;  3P7N A;  4UQI M;  2ZMF A;  2I9V A;  5TJJ A;  1MKM A;  2GX5 A;  3VOL A;  1WA9 A;  5KSH A;  2QJ7 A;  4UEY A;  4UQI S;  1OPX A;  2PYP A;  2HV1 A;  3K3C A;  2BAS A;  2P04 A;  1UGU A;  2Y8H A;  3S7N A;  4Q0I A;  3IBR A;  5HWW A;  1ZHH B;  1OTD A;  3IBJ A;  1G6O A;  3OBF A;  2EWV A;  3TW8 A;  3O5Y A;  3PHY A;  3B33 A;  3MF0 A;  3FPV A;  3ZQ5 A;  3DBA A;  3U2A A;  2O9B A;  3E4P A;  5HDC A;  2VZW A;  3T4S A;  2JHE A;  4CQH A;  4ME4 A;  2W3F A;  4PKY A;  3IS2 B;  4K08 A;  5EFW A;  1GSV A;  1LSV A;  4HH2 A;  2PR5 A;  4WF0 A;  2V0U A;  4I3I A;  2VGL M;  2VX8 A;  3RFB A;  4CLC A;  2P08 A;  4L9E A;  2W3H A;  2A24 A;  2VGL S;  4HJ6 A;  3CAX A;  3OCL A;  4GJ4 A;  4BBV A;  2V0W A;  1VHM A;  3JVV A;  2ZOH A;  3TJZ C;  3HJI A;  1UWP X;  4GHI B;  2Z6D A;  3B42 A;  4F3L B;  3LFV A;  3PXP A;  3K3D A;  1D7E A;  2YKF A;  4JGP A;  3KSI A;  3MQO A;  4EET B;  4XT2 B;  3BWL A;  3S7Q A;  3T4L A;  1V9Z A;  3E4Q A;  5HPF A;  2QWS A;  2W3E A;  3OC2 A;  1T19 A;  2Y79 A;  4WEK A;  2PDR A;  4ZRR A;  5HPI A;  4WLA A;  4WEL A;  3GEC A;  4II7 A;  3C8C A;  3V67 A;  5HWV A;  5HDS A;  3CUE A;  1IFQ A;  3F1P B;  5DKL A;  4DMZ A;  3H82 A;  3OOV A;  3S7O A;  2JKT M;  2OAP 1;  4MN6 A;  2NUT C;  2XSS A;  1XJ3 A;  4KUK A;  3A0V A;  1DP6 A;  4WN5 A;  3UE3 A;  2R78 A;  5A8B A;  5KIZ A;  2JKR I;  4PKY G;  5AVF A;  2PD8 A;  2ZMV A;  4NKP A;  1IOU A;  1VB6 A;  1T1B A;  3UB8 A;  3FPW A;  1DRM A;  3MQQ A;  4Y2F A;  1GSW A;  3BY9 A;  4MMN A;  4O01 A;  1XJ4 A;  3MXQ A;  1UWN X;  5HWT A;  4EW7 A;  3BQA A;  4MN7 A;  1NWZ A;  2VJW A;  3LID A;  4WUJ A;  1OJG A;  5CX7 A;  1OTI A;  3F1N A;  5TBM A;  5K5B A;  4E04 A;  3MFX A;  3E0Y A;  3KX0 X;  4HIA A;  5DJU A;  3MJQ A;  5FL3 A;  4R70 A;  3RTY A;  5F69 A;  4IUH A;  3LUQ A;  3NHQ A;  4HOI A;  1Y28 A;  2KDK A;  4LPZ A;  2M7U A;  3UME A;  2QHK A;  2W27 A;  2K31 A;  3C38 A;  4L9F A;  4DJ3 A;  2P7J A;  3W2Z A;  1GSX A;  3F1O B;  5HD5 A;  3SW1 A;  3ULF A;  3LR0 A;  2EA9 A;  2YKH A;  4HI4 A;  4MCW A;  5G4Y A;  4KUO A;  1LSW A;  2O0Y A;  3TE8 A;  3HCY A;  3KYQ A;  3NJA A;  2W1T A;  2VEA A;  1S1Y A;  4Y3I A;  4AFI A;  1F98 A;  1OTA A;  2GZA A;  3PBO A;  4BWI A;  1MC0 A;  1STZ A;  5IT5 A;  1W63 M;  5HZH A;  1NLY A;  1S66 L;  3UB7 A;  2L4R A;  5DJT A;  2W1R A;  2G7U A;  3PBQ A;  3CLO A;  2OWJ A;  1F5M A;  3LI9 A;  3D72 A;  5G4Z A;  1LL8 A;  2O99 A;  4GS9 A;  2M1C A;  1S4S A;  4L9G A;  4YOF A;  3T4J A;  5I5L A;  3FC7 A;  3KSG A;  2GNX A;  2VV8 A;  4F3L A;  3NOT C;  3T4O A;  2INW A;  3S7P A;  4M4X A;  5IS1 A;  3TRC A;  1N9N A;  2HGV A;  4KQO A;  2KLI A;  3C2W A;  3T4T A;  3CIT A;  5HL6 A;  3F1P A;  2MJ6 A;  3E4O A;  3OLO A;  2J3W A;  3CWF A;  3ICY A;  3K2N A;  4CLC B;  2A24 B;  2DMW A;  3LIF A;  3T50 A;  3H7W A;  4HP9 A;  4EER A;  1H3Q A;  3C30 A;  4IJG A;  4NEE D;  4ETZ A;  1YSP A;  2JKT I;  1NLZ A;  4G3W A;  1F9I A;  4HNB A;  5DFX A;  4HQA A;  2B18 A;  5J7E A;  2KOI A;  3UE6 A;  2CMN A;  2VV7 A;  4HJ4 A;  1KOU A;  2M7V A;  4Q0J A;  4PHT A;  3LR5 A;  4I3A A;  1OTE A;  1XJ6 A;  1P9R A;  1DP9 A;  3UB9 A;  5HD3 A;  5AJG A;  3EQU A;  3EEH A;  1V9Y A;  2A2L A;  2WKR A;  4CLC C;  3UMD A;  2HJ9 C;  2GJ3 A;  4GW9 A;  3EGD C;  1OT6 A;  4B93 A;  1DP8 A;  2LB9 A;  3MQ0 A;  5LBR A;  4HJ3 A;  2XRO A;  2XA7 M;  3LIE A;  2QYB A;  3PBS A;  4IUK A;  1H8M A;  2Z6C A;  2H28 A;  2XA7 S;  3KYZ A;  5HDD A;  5L8M A;  1MZU A;  5DKK A;  3UB6 A;  2PD7 A;  2V9A A;  1ODV A;  3RH8 B;  2EWW A;  3LR4 A;  4DN0 A;  1P0Z A;  2KX6 A;  3VE3 A;  3PBR A;  4R3A A;  4GCZ A;  5J3W A;  4H6J B;  4JGQ A;  4FSF A;  4EXO A;  1OTB A;  3LYX A;  2FZ0 A;  4NXF A;  3NOP C;  3GDI A;  4EU0 A;  3F1N B;  3R7W B;  3CI6 A;  4BBT A;  4LRX C;  4ARZ B;  2V1A A;  3A0S A;  3T4K A;  4MDZ A;  4DJ2 A;  1YAX A;  1XFQ A;  2VLG A;  3IS2 A;  3E98 A;  1P9W A;  4O0P A;  4I5S A;  4WEJ A;  2O9A A;  4HHD A;  4KQD A;  1T18 A;  3EGX C;  4RQ9 A;  2L1M A;  2V1B A;  5AVE A;  3T4Q A;  2QJ5 A;  4EES A;  2O9C A;  4GHI A;  5DF9 A;  2J80 A;  4LRY C;  2PHY A;  2W1T B;  2OWH A;  5IU1 A;  2WKP A;  3KO6 A;  2J3T C;  2WKQ A;  1BYW A;  4XT2 A;  3BY8 A;  1TS8 A;  3KSH A;  2FH5 A;  2W3D A;  3EQV A;  1NRJ A;  4B9O A;  2OAQ 1;  4NXE A;  2D01 A;  1LSX A;  2HF6 A;  2K7S A;  2W0N A;  3LI8 A;  3R4K A;  4JGR A;  3KSF A;  3PBN A;  4R38 A;  1OJ5 A;  4GS9 B;  4QPR A;  3PBT A;  1N9L A;  4I3J A;  4LLO B;  3BQ8 A;  3LIA A;  1X0O A;  1XFN A;  3PR6 A;  4YNR A;  4BMW A;  4FOF A;  5MC7 A;  1D06 A;  1N9O A;  1T1A A;  2NUP C;  4GLQ A;  3ZYT A;  3FG8 A;  3G6O A;  1TS6 A;  4P6Z M;  3H9W A;  3HJK A;  2PYR A;  1XJ2 A;  2PT7 A;  4Q0H A;  4P6Z S;  2J3T D;  4I38 A;  3LIB A;  4PAU A;  3PYP A;  1ZTU A;  2L0W A;  1S4R A;  4IHQ A;  1JNU A;  4EQ1 A;  1W63 Q;  4HH3 A;  4BBU A;  1YSQ A;  4EUV A;  3BJN A;  2K2N A;  4YWZ A;  4G3K A;  1G28 A;  3H7W B;  2D02 A;  3A0R A;  2JKR M;  3H82 B;  3VE4 A;  4EEP A;  3D3O A;  4O8G A;  3NOU C;  4JGO A;  3OCN A;  2VV6 A;  5DFY A;  3P01 A;  4HY8 A;  4WL9 A;  5C5K A;  3EWK A;  2IA2 A;  2VKS A;  4HP4 A;  3EOI A;  2LB5 A;  1P97 A;  3LR3 A;  4Z1W A;  1TS7 A;  2ZBB A;  4ETX A;  4H6J A;  3MMH A;  4L0L A;  4OOL A;  4EEU A;  2OOL A;  1S1Z A;  5F5Y A;  1S67 L;  4Y5F A;  3F1O A;  2ZOI A;  4CLC E;  1TS0 A;  1OT9 A;  1EW0 A;  5HSQ A;  3MR0 A;  4LRZ E;  3LIC A;  3CUE C;  4CLC D;  1TF1 A;  3BW6 A;  3JVU A;  1T1C A;  4I39 A;  4NXG A;  3R7W A;  3EEA A;  2JN7 A;  4R6L A;  5J4E A;  2VA0 A;  4ARZ A;  1LT0 A;  5F68 A;  2PR6 A;  2XRN A;  4BJP A;  4MN5 A;  5TBM B;  4OOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...