3KSHA

Structure of frmsr of staphylococcus aureus (oxidized form)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
b'TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Oxidoreductase
source organism Staphylococcus aureus
publication title Structure of fRMsr of Staphylococcus aureus
rcsb
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kshA00
5C5KA 3R4KA 2W3GA 4ME4A 2Y79A 3DBAA 3C2WA 4QPRA 3G6OA 2ZMFA 4R70A 2XROA 2O9BA 4MN7A 4Q0HA 3NOTC 1F5MA 3BJNA 4G3KA 3KSGA 4GLQA 4Y3IA 4IJGA 3RFBA 2HGVA 1TF1A 4EUVA 4IUHA 2O9CA 5DFXA 3TRCA 2K31A 3EEAA 2O0YA 5LBRA 3E0YA 4O01A 3IBRA 3S7OA 3CITA 5HL6A 1YSQA 2GX5A 2VEAA 3E98A 3KO6A 5AJGA 3OOVA 2G7UA 5L8MA 4RQ9A 4DN0A 3O5YA 4LRXC 4DMZA 3ZQ5A 3D3OA 1MKMA 2W1RA 4ETZA 3CI6A 2B18A 2KLIA 4CQHA 5HSQA 3K2NA 2W1TB 3MQ0A 3S7QA 4E04A 2XRNA 1TD5A 2VZWA 4FOFA 4ZRRA 4MMNA 4YOFA 1MC0A 3NHQA 3NOPC 4GW9A 4LRYC 2K2NA 4EU0A 4Q0IA 4Z1WA 2OOLA 2M7UA 3OBFA 2QYBA 2KOIA 4ETXA 4Y5FA 2O99A 2W3EA 1STZA 4MCWA 3W2ZA 2W3FA 3NOUC 4Q0JA 4YNRA 5HPFA 5K5BA 3VV4A 4O0PA 2XSSA 2Y8HA 3KSHA 3HCYA 4MDZA 4G3VA 2W3DA 5DFYA 3MF0A 4PAUA 3LFVA 1YSPA 4BWIA 5HPIA 3KSFA 2VJWA 3S7PA 2LB5A 1ZTUA 1YKDA 2W3HA 4LRZE 2O9AA 2LB9A 4G3WA 5I5LA 2M7VA 4IUKA 2VKSA 4R6LA 3KSIA 2W1TA 3MMHA 3S7NA 5TJJA 2IA2A 4Y2FA 3IBJA 1VHMA 4O8GA
chains in the Genus database with same CATH superfamily
5C5KA 2R9XA 3E4PA 3T1QB 3DAVA 2PYRA 1FR1A 4WM9A 3ZNTA 5CTNA 4HEFA 5CGXA 2XQZA 1GSXA 4Y7PA 3V3RA 4KZ4A 3ZYTA 4UHUA 1NRFA 1TF1A 1KGGA 3GR2A 3P09A 4LCMA 4PPRA 5FEGA 1S4SA 3E2LA 4HQAA 3PBSA 3RJUA 1W8YA 4OOLA 4ID4A 2QWSA 3AGEA 4GHIA 3ZDJA 4GD8A 3B47A 4KZBA 3A0RA 5L8MA 2VGJA 1A0KA 4B9OA 3D3OA 3CI6A 3NBLA 4KZAA 1PI4A 4KZ6A 1ODVA 3NCKA 1IKIA 2QHKA 3W4OA 4NXGA 1FSYA 3LYXA 1YLJA 1H8YA 4OH0A 2YKHA 2X71A 4ETXA 2O99A 4MCWA 3W2ZA 3QP4A 2G2UA 3T4QA 5GLCA 4PM6A 2XA7M 2ZM2A 4LV3A 4S2IA 5EOEA 1X0OA 1ZKJA 1FQGA 2Z6DA 4MDZA 5E2EA 5DJTA 2Y91A 4PHTA 4EBPA 4H6JA 1BYWA 2EFUA 1AWIA 4LRZE 3RXWA 5M18A 1PI5A 3V67A 4JLFA 2PDRA 3PBRA 5FAOA 4FH4A 2W3GA 3G34A 4WMCA 4HNBA 3NC8A 1K4EA 1LI9A 4X69A 4DE2A 5CEDA 3BJNA 3LIFA 1N4OA 2EFXA 3C4OA 5CRFA 3BEBA 2VGKA 5FAQA 1S67L 1XFNA 1XA1A 3R7WB 2J3TC 3PBOA 3IF6B 3SH7A 3DTIA 4EERA 1NWZA 3BFGA 3GTCA 3NDGA 1IYSA 3CLOA 1ES2A 5FI6A 5EM1A 1FCNA 4PMAA 1ONHA 1D1JA 3DTKA 1YLWA 5F5YA 4EQ1A 4MBKA 1Y4OA 5EUAA 4Y0UA 4EWFA 3WS2A 1MWRA 3DTMA 3EOIA 3GECA 4DRTA 2WKPA 2PBDP 4D2OA 1BTLA 4N1HA 4CLCA 1E3UD 3Q81A 3VFHA 3UDXA 5DKKA 4Q0JA 1V9ZA 4JXWA 1TS8A 3IWOA 1FCMA 5GLDA 2Y59A 5EVEA 5FQKA 2QKPA 5DTKA 1XJ3A 4UA7A 1CEFA 3LR3A 4R1GA 5MC7A 3C7VA 2O9AA 2HV1A 5I5LA 5DTTA 2PBYA 2W27A 2I9VA 3GMWA 5AVEA 1YT4A 1NY0A 3LUQA 1TDGA 2PRFA 1ES5A 3G6OA 5L07A 2XDMA 2P04A 1JWZA 3VE3A 2ZM0A 1UGUA 1W8QA 4DE0A 4HJ6A 3NI9A 3W4QA 3LY4A 4FCFA 3JPUA 5TBMB 3O86A 2PD8A 2VGLM 5TBMA 4EUZA 1BSGA 1OTIA 4ESPA 1TS0A 1LSXA 1XX2A 4U3TA 2YKFA 4IEDA 3UPOA 5M19A 5DF7A 3D4FA 4HJ3A 3EEHA 4QY6A 5A90A 2JE5A 4OQIA 4ETZA 1VQQA 4JF4A 4CQHA 2ZOHA 4OQHA 5HSQA 2NUTC 4GHIB 5F1GA 5HDCA 1WYBA 2ZOIA 4MMNA 3HUMA 4CLCE 5AQAA 3UPNA 1P97A 1NLZA 3ITAA 2ZQ9A 2WKIA 4QHCA 4II7A 1YLPA 4C3QA 1RGYA 3AGFA 5IHVA 2BG1A 4HBUA 2A24B 3MXQA 4L9GA 3CUEC 3H7WB 1YLYA 5GLAA 2UWXA 2ZD8A 2EX8A 3FPVA 5HAPA 4HIAA 1LHYA 3BY9A 4JF5A 1VB6A 1KDSA 1JVJA 2FH5A 1VHMA 3V50A 5A93A 5L10A 2A49A 3B33A 3A0VA 3PAEA 3OZHA 3NJAA 4X1MA 3S1YA 1XGJA 3UB6A 3G4PA 4I5SA 1D06A 3LEQA 1NRJA 3GQZA 5CHJA 1IYOA 2P74A 1BZAA 2K7SA 4EUVA 1GHPA 4IUHA 5CTMA 3ZNYA 2WGVA 3A3EA 1WE4A 2Z6CA 5TR7A 4S2LA 4S2MA 2XA7S 3BM6A 4BD0A 4N9KA 1G5UA 3QP1A 4ZJ2A 5EVLA 4OLDA 1CQAA 1MWTA 3G35A 2JC7A 3IH8A 3K2NA 2XFTA 3S7QA 4WLAA 2INWA 2XRNA 2PR6A 1KOUA 2OSUA 3JYIA 4M4XA 1DY6A 4Y13A 2HZ5A 1UWNX 1STZA 4OQGA 1ZG6A 1XGIA 1NLYA 4OPQA 1VM1A 4Q8IA 3VP0A 5E43A 2VK3A 4O0PA 1K54A 2XF3A 4IVIA 4LV2A 1NZOA 3MKFA 3A0SA 4EW7A 5FQMA 1FILA 1L2SA 3L7HA 4BMWA 4EESA 4NXFA 4WZ4A 3B3XA 3FG8A 3IBJA 3DWZA 2XR0A 1RCJA 5EECA 4DJ3A 2P08A 1QMEA 4QU3A 2EX2A 2ZC5B 1E3UA 3C4PA 3FWLA 4C6YA 3KSGA 4GLQA 4IJGA 4U0XA 5JYPA 2ZQ8A 4S2JA 3PHYA 1L0EA 1H8ZA 2B5RA 2CC1A 1OTEA 2O0YA 2WZZA 4DKIA 4X68A 3UB8A 1H0MA 4RQ9A 2VV7A 4HHDA 2H28A 3V3SA 4EQIA 4X25A 1TS7A 1K25A 1IEMA 2OWHA 4QD4A 4ZRRA 1FOFA 3LICA 2RCXA 5FATA 2XGNA 3HLWA 3EGDC 1T1BA 3VFFA 3ZG0A 3C8CA 1ZHHB 3W8KA 3EWKA 4E3LA 1NJ4A 1C3BA 3RTYA 3HVFA 1EI5A 3MZFA 2LB5A 1FSWA 2ZBBA 4WF0A 4N1XA 1K6RA 3EQVA 2M7VA 3IXHA 4FH2A 1Y28A 4ZDXA 5A91A 5FQQA 2WK0A 1T1AA 3GV9A 3ZCZA 4BBVA 1SKOB 1K56D 3QP8A 4WYYA 4HP4A 1L3LA 3F1OA 1IFQA 4JGPA 3TOIA 4HY8A 3P98A 2OLVA 3E4OA 4UQIM 1F5MA 4NKPA 4XXRA 2HGVA 2QJ5A 1GHIA 1Q2PA 1N9OA 5DJUA 3A3IA 1OTDA 3E0YA 4MBFA 5HL1A 3F1PA 2FFFB 3F1NB 3FC7A 2DCFA 2GX5A 1CEGA 5AQ7A 3KO6A 3T4JA 2FZ0A 4JPMA 3F1OB 2B02A 2Y4AA 2J3WA 2XH9A 2L0WA 3PXPA 2HF6A 4HJ4A 3BYDA 2R78A 4ZBEA 3BFDA 4WZ5A 3NOPC 3MR0A 4GW9A 2K2NA 2V20A 2Y55A 5GLBA 2QYBA 3MSHA 5EVIB 1E4DA 1N9BA 2XD5A 3TG9A 1BLSA 5CHUA 5HPFA 4QJGA 2J7VA 3VP1A 2Q9NA 1EWZA 4OPZA 3IT9A 2EX9A 2W3HA 4LV0A 5D3OA 5KIZA 4R38A 3HLCA 1BULA 1LSWA 1Z09A 1DJAA 4UAAA 3N6IA 4IVKA 3GDIA 1XXMA 4E3MA 1K4FA 1KGEA 5EOOA 5FI7A 3SH8A 5AQBA 3IXGA 5I94A 4K0XA 3CZDA 3C2WA 3ZGAB 2WAFA 3SOIA 3G32A 3FV7A 3WS4A 3PR6A 5HZHA 2XROA 4KQDA 3OCNA 3SS5A 2XFSA 4OOMA 5HAIA 1JTDA 3WRTA 3MXSA 1LT0A 4P6ZS 1GA0A 2HDSA 4E6WA 2E8JA 4L9FA 2JKGA 1LL8A 2V1ZA 2H5SA 3N8RA 2G2WA 3IHAA 4S2PA 3NULA 5DTSA 3ZQ5A 2ZL1B 3EQUA 3D72A 1JWPA 3K3DA 2GZAA 4YWZA 2DRWA 5TGFA 3N7WA 3HLEA 3TJZC 2JKTM 5DF9A 4Z1WA 2OOLA 4P87A 1KDWA 3JVVA 4LCLA 5EVIC 3QNBA 5EVID 5BOHA 3OPLA 4YNRA 1OPXA 2XSSA 4KG6A 3E2KA 2ZL1A 3EGXC 4PAUA 1JTGA 2C5WB 3VP4A 1TVFA 5IT5A 2P9VB 3PBTA 3L9KA 2OWJA 4JXVA 2LB9A 3UB7A 3QP6A 4OLGA 2ZM8A 1K56A 3UE1A 4IUKA 4JKTA 2VKSA 1S66L 4QB8A 3HLGA 3FKWA 1L0FA 1XP4A 1BT5A 3N8LA 4ARZB 4QPRA 4ZJ3A 3C38A 1O07A 3IX4A 1PW1A 1ZG4A 1JNUA 1I5QA 1SKOA 5CX7A 1PZPA 4KUKA 4JGQA 3IS2A 1W63Q 3RFBA 2PU2A 4S2NA 4EXOA 5DFXA 4E3NA 3UB9A 5FSRA 1K0KA 1PW8A 1I2SA 4E3OA 4GZBA 5FQ9A 5J3WA 4OQ0A 4DF6A 4IBRA 3ZVTA 5GHYA 1DP8A 2UV0E 3NY4A 2OAP1 4PM8A 3ZG8B 4O7DA 4X1LA 3S22A 3T50A 4MN5A 3IF6A 2B18A 2EWVA 1S1YA 3KYEA 3ZG7B 3K3CA 4NG2A 5FAPA 1H3QA 5AVFA 5A92A 3MFDA 1WA9A 4HESA 3OBFA 2ZQAA 3PYPA 2HJEA 1K57C 3M2JA 1SDEA 2M1CA 3G31A 3KSHA 2BTFP 3HCYA 5HW3A 2A2LA 3F1PB 3T4SA 2V1AA 4NK3A 1G28A 2WYXA 2J8YA 3ITBA 1K38A 4N9LA 3UE3A 3ISGA 1D7EA 1HTZA 3IX8A 4GCZA 3MJQA 1CI8A 4R6LA 5J4EA 3MMHA 3S7NA 5TJJA 5CERA 3MQOA 4OOYA 3IWIA 3Q7VB 2ZLYA 4BLMA 4EBNA 2Y2GA 1PIOA 3DW0A 2X01A 3WWXA 2NUPC 2V2FF 4P6ZM 4E3JA 1XJ4A 4XT2B 1ES3A 4AFIA 3QP5A 4WEKA 4JXSA 1MXOA 5DF8A 4FSFA 5FQIA 2OAQ1 4N92A 4HOIA 1ONGA 2D02A 4GKUA 1LSVA 5KZHA 3LR4A 5E2HA 1YSQA 1XJ2A 3LR0A 3WS1A 1ES4A 1VEUB 2J9PA 4LV1A 4WZ5C 1ERQA 4I38A 2B95A 1ERMA 1MKMA 1ESUA 4PM5A 4GB7A 4HH3A 4LFUA 4ARZA 2IWBA 2Z2MB 1MBLA 1PYYA 1RP5A 2JBFA 1IELA 4R3AA 4WBGA 2W3FA 2A3UA 3AGDA 3UE0A 2GNXA 2HP6A 1OTAA 5F68A 1YPRA 2VJWA 3S7PA 1W63M 1XJ6A 3WS0A 1W7FA 2Z2LB 4NETA 2ACGA 3VSKA 1QMFA 4OP5A 4KZ9A 4XUZA 4BL3A 1J3WA 3PAGA 4BBTA 2Y2IA 1M6KA 4M3KA 3IQAA 3IS2B 4BD1A 2V8CA 4IBXA 1DP6A 2IWDA 3IXDA 2V1BA 4RX2A 4EEPA 5G4ZA 2QZ6A 1T18A 3H82A 3DWKA 1E25A 4Y3IA 2Y2LA 1MPLA 3WS5A 2H0TA 4KZ7A 1K55A 1HD8A 2H0YA 3LY3A 3T4LA 3A3DA 3VP2A 1BUEA 3VSLA 3CJMA 4X53A 2E8IA 3T1RA 5AJGA 3CWFA 1NYMA 3BWLA 3M6BA 1BLCA 1L0GA 4WL9A 1ZC2A 5M1AA 3DTEA 2QPNA 3CHWP 1DJBA 1MWUA 3IF5A 4GS9B 4DXBA 4KZ3A 1IYQA 5EV0A 1MWSA 4EU0A 5EVIA 3GVBA 2M7UA 2KOIA 4WUJA 3O3VA 2ZQCA 5KMWA 2HPBA 5KSHA 2X02A 3BRMA 4X6TA 1HLUP 2HP5A 4MLLA 4L9EA 4MEZA 5FDHA 5DVAA 4G3VA 1T1CA 3PTEA 3MFXA 1P9WA 2H10A 3H9WA 1YSPA 5F69A 3OPPA 3WRZA 1VEUA 2OV5A 3LIBA 3I7JA 4GNUA 4R0QA 3HLBA 3VMAA 3HLDA 4Z9QA 3CUEA 4JBFA 4DE3A 4GD6A 1TS6A 5CXWA 5HFOA 2FFYA 3CITA 3Q07A 2WADA 4P85A 1V9YA 2OLUA 3E4QA 3VOYA 1FIKA 4LENA 1PZOA 4R3BA 1P9RA 4MN7A 4Q0HA 4G3KA 4EETB 4UA9A 2O9CA 2KDKA 5G18A 3TRCA 3TE8A 1S0WA 5FQJA 3IBRA 1TDLA 3B42A 5HL6A 3Q7ZA 1YLTA 3BW6A 5F82A 1HZOA 5FDSA 1G6OA 2Y2MA 4HP9A 2Y2KA 3G30A 2V0UA 3O5YA 2WKQA 1XFQA 5FA7A 1RGZA 2W1RA 2JKRI 2Q9MA 4YINA 1OT6A 2WAEA 4E04A 4WEJA 3FKVA 1MKIA 1YM1A 1MC0A 4D60A 1OT9A 4OVDA 2JKRM 3V39A 2C6WB 3UDFA 4X55A 1S4RA 3UMDA 4PKYA 2JKFA 2ZC7A 4I3JA 2ZMVA 5EPHA 3NOUC 2V0WA 5EE8A 3UPPA 3OPRA 4LGWA 3UE6A 4IHQA 2I72A 4DJ2A 3ZG5A 5HPIA 4I3AA 1W5DA 2W0NA 1YKDA 2D01A 3UY6A 4OPRA 2EA9A 2XK1A 2P9VA 4R4RA 2EX6A 5J7EA 5E2GA 4GOGA 2W1TA 3UO9A 3IF6C 4U0TA 1H8MA 3MZDA 1KE4A 4ME4A 2V9AA 4S2OA 4R70A 1O7EA 2DMWA 2JN7A 4NXEA 3O88A 3NIAA 4A5RA 3HREA 1S6RA 4K91A 4WN5A 4K08A 2KX6A 4ZJ1A 1SCWA 4S2NC 1PNEA 4B88A 3HUNA 3H82B 1H5XA 2XD1A 4R3JA 4NXBA 3G2YA 3OOVA 4DN0A 3R7WA 1S1ZA 4BJPA 1Q2QA 3LEZA 3ZVWA 5F83A 1K57A 2PAVP 2QJ7A 1TD5A 2JHEA 1SKFA 5HD3A 1FR6A 1VETA 1GHMA 1OJGA 5CECA 1TEMA 4Q0IA 2VA0A 2Y2QA 2W3EA 4HH2A 5F1FA 1BLHA 2WKHA 3QP2A 1G6AA 3OCLA 3OPHA 2VX8A 3MZEA 1GSVA 2Y8HA 5E2FA 4XT2A 3TSGA 2CMNA 3KSFA 4QY5A 3PBNA 1GA9A 3C7UA 3G2ZA 1VETB 4JF6A 4QWOA 2XEPA 3KYZA 5CHMA 2VV8A 3W4PA 5HDDA 2HDRA 4OKPA 4Y17A 2PYPA 5L2FA 3HL9A 2IA2A 4Y2FA 3P7NA 4GDNA 3T1XA 4H8RA 3BECA 3ULFA 1YMXA 1HVBA 4I39A 3RXXA 1DP9A 4YFMA 3UDIA 3IWQA 3NOTC 1DRMA 2WKRA 3D9YA 4B4XA 3CPTA 4C75A 4R4SA 5U47A 3SS3A 2VV6A 5LBRA 3UMEA 5HWVA 3MKEA 4FD8A 4FUWA 3U2AA 4E3KA 2XLNA 3MBZA 2MJ6A 1EROA 1SHVA 2WUQA 2EWWA 4KG2A 4B4ZA 4BENA 2HDQA 1CI9A 2ZC6B 1N9NA 5GHZA 3HUOA 4FTXA 1YAXA 3SS4A 1K54C 4YOFA 4EBLA 3NHQA 2EXBA 4LRYC 4F3LA 4R23A 1N9LA 3C30A 5FI2A 4Y5FA 3N8SA 1FCOA 4LPZA 1NYYA 1MZUA 3UN7A 2BASA 5GHXA 2ZQDA 2IWCA 1GCEA 3ICYA 4Y15A 5DFYA 1I2WA 1SDNA 3BY8A 5DKLA 3CG5A 2ZMAA 3LCEA 4MN6A 1ZTUA 5CEBA 1BLPA 2A24A 4XUXA 3VE4A 1ESIA 4GJ4A 3IH9A 4JGRA 1DJCA 3LR5A 3T4OA 3SH9A 3Q82A 5HWTA 2QMIA 2V8FA 5AQ9A 4OPYA 2HJ9C 3DBAA 1P0ZA 2WKEA 4KUOA 4DDYA 5L09A 4LLOB 3VOZA 5HAQA 5HX9A 2WGIA 2VGLS 1Y54A 1PRQA 2PD7A 3EEAA 2J3TD 4P0MA 2L4RA 4B93A 4DXCA 1KVMA 3SZTA 2VEAA 1OJ5A 1ALQA 1F9IA 3FYZA 4UEYA 5HARA 1MY8A 2G7UA 2Y2NA 1KGFA 5HDSA 4LRXC 1T19A 4PM9A 4RA7A 1LL5A 2GJ3A 4KG5A 5F6AA 3QNCA 4KQQA 1K55C 2KLIA 1W79A 3JVUA 2W1TB 2VZWA 1PFLA 4FOFA 3A3JA 1WYCA 2JCHA 4PKYG 1YLZA 4GDBA 3NECA 3S4XA 4F94A 4E6XA 4GS9A 3C5AA 3OC2A 1CJFA 4KQOA 3O87A 3BLMA 1OMEA 4JXGA 4CJNA 3VV4A 5KSCA 4BBUA 3T1SA 3UB5P 4P6BA 4BWIA 2Y2JA 2Y2OA 2WZXA 4E3IA 5JYOA 3RH8B 1AXBA 3HJKA 5HD5A 1XA7A 2ZJ9A 3KSIA 3CMZA 4KZ8A 4NEED 4UA6A 2DNSA 1F2KA 1KVLA 4CLCD 1JWVA 2O9BA 1YQSA 4OONA 5A8BA 4RVAA 2PT7A 3Q7VA 3NDEA 2EXAA 4OP8A 4O01A 5G4YA 3S7OA 3GRJA 3M2KA 3E98A 3T4TA 4BL2A 1IOUA 2Y2PA 1KE0A 3BFCA 2R9WA 3ZFZA 4F3LB 1G68A 4Y0OA 1PWCA 1SZVA 4X56A 3KYQA 3BQAA 4UQIS 2PHYA 3PBQA 4KZ5A 3P01A 1ACFA 4HI4A 3BFFA 5CGSA 3FPWA 3LI8A 3MS6A 5FASA 5EFWA 4WMCD 1LL9A 1EW0A 2AVXA 4K0WA 3IXBA 4H6JB 4BQMA 3ZHHA 2PU4A 3KX0X 3CPTB 3CAXA 3H7WA 2RL3A 3V5MA 3MF0A 2HP9A 4DE1A 5GL9A 1PWDA 1UWPX 3LGOA 1XKZA 1GSWA 1LI0A 5EM0A 4G3WA 3HBRA 2GDNA 3M6HA 1CF0A 3IX3A 3LIEA 4Y0TA 1NXYA 4O8GA 3R4KA 2Y79A 4PM7A 5FEFA 2ZMFA 4CLCB 3TW8A 2HDUA 3F1NA 4I3IA 3BFEA 3N4IA 3MXRA 3LI9A 4GN2A 5IS1A 4WELA 4EV4A 1M40A 1J9MA 3LIDA 4RYEA 2K31A 3BLSA 1CK3A 3FZCA 4ZAMA 4KQRA 2J80A 3Q1FA 3HJIA 5FL3A 2PR5A 5HWWA 3LO7A 4L0LA 3LIAA 2ZC3B 1K6SA 3ZG9B 1XPBA 2BLSA 4DMZA 4EEUA 2Y2HA 4JGOA 3OLOA 1PWGA 4HBTA 3MQ0A 1LLBA 5J8XA 3VP3A 2ZC4B 4MNRA 2P7JA 3T4KA 1L0DA 1Z6FA 2JKTI 4CLCC 2ZQ7A 1NZUA 3A3FA 2VLGA 3IHBA 4CPKA 5K5BA 3HLFA 2L1MA 2Q0OA 4S2KA 4ZTKA 1U60A 2J9OA 1OTBA 2W3DA 5IU1A 5TFQA 1IYPA 1F98A 3LFVA 3QHYA 4MBHA 3VOLA 3GSGA 4KENB 3U4LP 1YMSA 2WGWA 4DDSA 3UNWA 3T12B 2WGWB 4RX3A 3BQ8A 3SW1A 3MQQA 1IKGA 1KE3A 5CGWA
chains in the Genus database with same CATH topology
5C5KA 3E4PA 4DJ3A 3ULFA 2P08A 2PYRA 2NUPC 4I39A 4P6ZM 1DP9A 1XJ4A 4XT2B 3NOTC 4AFIA 1GSXA 3KSGA 4GLQA 4WEKA 4IJGA 1DRMA 3ZYTA 2WKRA 1TF1A 3PHYA 4FSFA 2OAQ1 1OTEA 2VV6A 4HOIA 2O0YA 5LBRA 1S4SA 4HQAA 2D02A 3PBSA 3UMEA 5HWVA 1LSVA 3U2AA 3LR4A 4OOLA 1YSQA 2QWSA 2MJ6A 4GHIA 3UB8A 1XJ2A 3LR0A 2EWWA 3B47A 3A0RA 5L8MA 4RQ9A 2VV7A 4HHDA 4B9OA 4I38A 2H28A 3D3OA 1MKMA 3CI6A 1TS7A 1N9NA 1ODVA 2QHKA 2OWHA 1YAXA 4HH3A 4NXGA 4ZRRA 4YOFA 4ARZA 3LYXA 3NHQA 3LICA 4F3LA 4LRYC 2YKHA 1N9LA 3C30A 4ETXA 4Y5FA 2O99A 4LPZA 1MZUA 4R3AA 4MCWA 3W2ZA 3T4QA 2W3FA 3EGDC 2XA7M 2BASA 1T1BA 2GNXA 1X0OA 3C8CA 1ZHHB 2Z6DA 3ICYA 3EWKA 1OTAA 4MDZA 5DFYA 5F68A 3RTYA 3BY8A 5DJTA 5DKLA 4PHTA 2VJWA 3S7PA 4H6JA 2LB5A 1W63M 1BYWA 1ZTUA 4MN6A 1XJ6A 2ZBBA 4LRZE 2A24A 3VE4A 4WF0A 4GJ4A 3EQVA 2M7VA 1Y28A 3V67A 2PDRA 3PBRA 1T1AA 4JGRA 4BBVA 3LR5A 3T4OA 4BBTA 3IS2B 5HWTA 2W3GA 2HJ9C 4HP4A 3F1OA 1DP6A 3DBAA 1IFQA 2V1BA 4HNBA 4JGPA 1P0ZA 4HY8A 4KUOA 4EEPA 5G4ZA 1T18A 4LLOB 3H82A 3E4OA 4UQIM 2VGLS 1F5MA 3BJNA 4NKPA 3LIFA 4Y3IA 2HGVA 2QJ5A 2PD7A 1N9OA 5DJUA 1S67L 3EEAA 1OTDA 1XFNA 2J3TD 3E0YA 3R7WB 3T4LA 2J3TC 2L4RA 4B93A 3F1PA 3PBOA 3F1NB 3FC7A 2VEAA 2GX5A 1OJ5A 1F9IA 4UEYA 4EERA 1NWZA 3KO6A 3T4JA 5AJGA 3CWFA 2FZ0A 3BWLA 2G7UA 3F1OB 5HDSA 4LRXC 2B02A 1T19A 2J3WA 3CLOA 2GJ3A 4WL9A 2L0WA 5F6AA 3PXPA 2HF6A 2KLIA 4HJ4A 3JVUA 2W1TB 2R78A 5F5YA 4EQ1A 2VZWA 4FOFA 4GS9B 4PKYG 3NOPC 3MR0A 4GW9A 3EOIA 3GECA 4GS9A 2K2NA 2WKPA 4EU0A 2M7UA 3OC2A 2QYBA 2KOIA 4WUJA 4CLCA 4KQOA 5KSHA 5DKKA 4Q0JA 5HPFA 1V9ZA 4L9EA 3VV4A 4BBUA 1TS8A 4G3VA 1T1CA 3MFXA 1P9WA 3H9WA 1YSPA 5F69A 4BWIA 2QKPA 3P7NA 1XJ3A 3LIBA 2W3HA 3LR3A 5MC7A 2O9AA 2HV1A 5KIZA 4R38A 5I5LA 1LSWA 3RH8B 3HJKA 3CUEA 5HD5A 1TS6A 3KSIA 3GDIA 2W27A 4NEED 3CITA 2I9VA 5AVEA 1V9YA 3LUQA 4CLCD 3E4QA 3C2WA 3G6OA 2P04A 3PR6A 5HZHA 2XROA 2O9BA 3VE3A 1UGUA 1P9RA 4MN7A 4HJ6A 4Q0HA 5A8BA 4G3KA 4KQDA 2PT7A 3OCNA 4OOMA 4EETB 2O9CA 1LT0A 2KDKA 4P6ZS 3TRCA 3TE8A 5TBMB 2PD8A 2VGLM 4O01A 3IBRA 5G4YA 5TBMA 3S7OA 3B42A 5HL6A 1OTIA 4L9FA 3BW6A 1G6OA 1TS0A 1LSXA 3E98A 1LL8A 2YKFA 3T4TA 4HP9A 1IOUA 2V0UA 3O5YA 2WKQA 4HJ3A 1XFQA 4F3LB 3EEHA 3ZQ5A 3EQUA 3D72A 3K3DA 2GZAA 2W1RA 4YWZA 4ETZA 4CQHA 2JKRI 2ZOHA 3TJZC 5HSQA 2NUTC 4GHIB 3KYQA 3BQAA 1OT6A 4UQIS 4E04A 2PHYA 4WEJA 5HDCA 2ZOIA 3PBQA 2JKTM 4MMNA 4CLCE 5DF9A 1MC0A 3P01A 1P97A 1OT9A 1NLZA 4HI4A 3FPWA 3LI8A 4Z1WA 2OOLA 2JKRM 5EFWA 3JVVA 1S4RA 3UMDA 4II7A 1EW0A 4I3JA 4PKYA 2ZMVA 4H6JB 3NOUC 4YNRA 3KX0X 2A24B 2V0WA 1OPXA 3CAXA 3H7WA 2XSSA 3MXQA 4L9GA 3UE6A 3CUEC 3EGXC 3H7WB 3MF0A 4PAUA 4IHQA 4DJ2A 5IT5A 5HPIA 4I3AA 2W0NA 1UWPX 1YKDA 2D01A 3PBTA 3FPVA 1GSWA 2EA9A 2OWJA 2LB9A 4G3WA 3UB7A 5J7EA 4HIAA 3BY9A 4IUKA 1VB6A 2VKSA 1S66L 2W1TA 2FH5A 3LIEA 1VHMA 1H8MA 4O8GA 3R4KA 4ME4A 2V9AA 2Y79A 3B33A 3A0VA 4ARZB 3NJAA 4QPRA 3C38A 2ZMFA 4R70A 4CLCB 3UB6A 3TW8A 2DMWA 2JN7A 4I5SA 4NXEA 1JNUA 3F1NA 1D06A 4I3IA 5CX7A 4KUKA 1NRJA 4JGQA 3IS2A 1W63Q 3LI9A 5IS1A 3RFBA 4WELA 2K7SA 4EUVA 4IUHA 5DFXA 4EXOA 4WN5A 4K08A 3UB9A 3LIDA 2K31A 2KX6A 2J80A 2Z6CA 3HJIA 5FL3A 3H82B 2PR5A 5HWWA 2XA7S 4L0LA 3LIAA 5J3WA 1DP8A 4NXBA 2OAP1 3OOVA 4DN0A 4DMZA 3R7WA 3T50A 4EEUA 4MN5A 1S1ZA 4BJPA 4JGOA 3OLOA 2B18A 3K2NA 3MQ0A 3S7QA 4WLAA 2INWA 2QJ7A 2XRNA 1TD5A 2EWVA 1S1YA 2JHEA 2PR6A 1KOUA 3K3CA 5HD3A 2P7JA 1OJGA 3T4KA 1H3QA 2JKTI 4M4XA 4CLCC 5AVFA 4Q0IA 1WA9A 3OBFA 2VA0A 1UWNX 1STZA 2W3EA 4HH2A 3PYPA 2HJEA 2VLGA 1NLYA 3OCLA 5K5BA 2VX8A 2L1MA 1GSVA 2M1CA 4O0PA 2Y8HA 3KSHA 3HCYA 1OTBA 2W3DA 5IU1A 1F98A 2A2LA 3A0SA 3LFVA 4XT2A 4EW7A 3F1PB 2CMNA 3T4SA 3KSFA 2V1AA 3VOLA 3PBNA 1G28A 4BMWA 3UE3A 4EESA 3KYZA 1D7EA 4GCZA 4NXFA 2VV8A 3MJQA 5HDDA 3BQ8A 4R6LA 5J4EA 3SW1A 2PYPA 3MMHA 3S7NA 3MQQA 5TJJA 3FG8A 3MQOA 2IA2A 4Y2FA 3IBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5K A;  3R4K A;  2W3G A;  4ME4 A;  2Y79 A;  3DBA A;  3C2W A;  4QPR A;  3G6O A;  2ZMF A;  4R70 A;  2XRO A;  2O9B A;  4MN7 A;  4Q0H A;  3NOT C;  1F5M A;  3BJN A;  4G3K A;  3KSG A;  4GLQ A;  4Y3I A;  4IJG A;  3RFB A;  2HGV A;  1TF1 A;  4EUV A;  4IUH A;  2O9C A;  5DFX A;  3TRC A;  2K31 A;  3EEA A;  2O0Y A;  5LBR A;  3E0Y A;  4O01 A;  3IBR A;  3S7O A;  3CIT A;  5HL6 A;  1YSQ A;  2GX5 A;  2VEA A;  3E98 A;  3KO6 A;  5AJG A;  3OOV A;  2G7U A;  5L8M A;  4RQ9 A;  4DN0 A;  3O5Y A;  4LRX C;  4DMZ A;  3ZQ5 A;  3D3O A;  1MKM A;  2W1R A;  4ETZ A;  3CI6 A;  2B18 A;  2KLI A;  4CQH A;  5HSQ A;  3K2N A;  2W1T B;  3MQ0 A;  3S7Q A;  4E04 A;  2XRN A;  1TD5 A;  2VZW A;  4FOF A;  4ZRR A;  4MMN A;  4YOF A;  1MC0 A;  3NHQ A;  3NOP C;  4GW9 A;  4LRY C;  2K2N A;  4EU0 A;  4Q0I A;  4Z1W A;  2OOL A;  2M7U A;  3OBF A;  2QYB A;  2KOI A;  4ETX A;  4Y5F A;  2O99 A;  2W3E A;  1STZ A;  4MCW A;  3W2Z A;  2W3F A;  3NOU C;  4Q0J A;  4YNR A;  5HPF A;  5K5B A;  3VV4 A;  4O0P A;  2XSS A;  2Y8H A;  3KSH A;  3HCY A;  4MDZ A;  4G3V A;  2W3D A;  5DFY A;  3MF0 A;  4PAU A;  3LFV A;  1YSP A;  4BWI A;  5HPI A;  3KSF A;  2VJW A;  3S7P A;  2LB5 A;  1ZTU A;  1YKD A;  2W3H A;  4LRZ E;  2O9A A;  2LB9 A;  4G3W A;  5I5L A;  2M7V A;  4IUK A;  2VKS A;  4R6L A;  3KSI A;  2W1T A;  3MMH A;  3S7N A;  5TJJ A;  2IA2 A;  4Y2F A;  3IBJ A;  1VHM A;  4O8G A; 
#chains in the Genus database with same CATH topology
 5C5K A;  2R9X A;  3E4P A;  3T1Q B;  3DAV A;  2PYR A;  1FR1 A;  4WM9 A;  3ZNT A;  5CTN A;  4HEF A;  5CGX A;  2XQZ A;  1GSX A;  4Y7P A;  3V3R A;  4KZ4 A;  3ZYT A;  4UHU A;  1NRF A;  1TF1 A;  1KGG A;  3GR2 A;  3P09 A;  4LCM A;  4PPR A;  5FEG A;  1S4S A;  3E2L A;  4HQA A;  3PBS A;  3RJU A;  1W8Y A;  4OOL A;  4ID4 A;  2QWS A;  3AGE A;  4GHI A;  3ZDJ A;  4GD8 A;  3B47 A;  4KZB A;  3A0R A;  5L8M A;  2VGJ A;  1A0K A;  4B9O A;  3D3O A;  3CI6 A;  3NBL A;  4KZA A;  1PI4 A;  4KZ6 A;  1ODV A;  3NCK A;  1IKI A;  2QHK A;  3W4O A;  4NXG A;  1FSY A;  3LYX A;  1YLJ A;  1H8Y A;  4OH0 A;  2YKH A;  2X71 A;  4ETX A;  2O99 A;  4MCW A;  3W2Z A;  3QP4 A;  2G2U A;  3T4Q A;  5GLC A;  4PM6 A;  2XA7 M;  2ZM2 A;  4LV3 A;  4S2I A;  5EOE A;  1X0O A;  1ZKJ A;  1FQG A;  2Z6D A;  4MDZ A;  5E2E A;  5DJT A;  2Y91 A;  4PHT A;  4EBP A;  4H6J A;  1BYW A;  2EFU A;  1AWI A;  4LRZ E;  3RXW A;  5M18 A;  1PI5 A;  3V67 A;  4JLF A;  2PDR A;  3PBR A;  5FAO A;  4FH4 A;  2W3G A;  3G34 A;  4WMC A;  4HNB A;  3NC8 A;  1K4E A;  1LI9 A;  4X69 A;  4DE2 A;  5CED A;  3BJN A;  3LIF A;  1N4O A;  2EFX A;  3C4O A;  5CRF A;  3BEB A;  2VGK A;  5FAQ A;  1S67 L;  1XFN A;  1XA1 A;  3R7W B;  2J3T C;  3PBO A;  3IF6 B;  3SH7 A;  3DTI A;  4EER A;  1NWZ A;  3BFG A;  3GTC A;  3NDG A;  1IYS A;  3CLO A;  1ES2 A;  5FI6 A;  5EM1 A;  1FCN A;  4PMA A;  1ONH A;  1D1J A;  3DTK A;  1YLW A;  5F5Y A;  4EQ1 A;  4MBK A;  1Y4O A;  5EUA A;  4Y0U A;  4EWF A;  3WS2 A;  1MWR A;  3DTM A;  3EOI A;  3GEC A;  4DRT A;  2WKP A;  2PBD P;  4D2O A;  1BTL A;  4N1H A;  4CLC A;  1E3U D;  3Q81 A;  3VFH A;  3UDX A;  5DKK A;  4Q0J A;  1V9Z A;  4JXW A;  1TS8 A;  3IWO A;  1FCM A;  5GLD A;  2Y59 A;  5EVE A;  5FQK A;  2QKP A;  5DTK A;  1XJ3 A;  4UA7 A;  1CEF A;  3LR3 A;  4R1G A;  5MC7 A;  3C7V A;  2O9A A;  2HV1 A;  5I5L A;  5DTT A;  2PBY A;  2W27 A;  2I9V A;  3GMW A;  5AVE A;  1YT4 A;  1NY0 A;  3LUQ A;  1TDG A;  2PRF A;  1ES5 A;  3G6O A;  5L07 A;  2XDM A;  2P04 A;  1JWZ A;  3VE3 A;  2ZM0 A;  1UGU A;  1W8Q A;  4DE0 A;  4HJ6 A;  3NI9 A;  3W4Q A;  3LY4 A;  4FCF A;  3JPU A;  5TBM B;  3O86 A;  2PD8 A;  2VGL M;  5TBM A;  4EUZ A;  1BSG A;  1OTI A;  4ESP A;  1TS0 A;  1LSX A;  1XX2 A;  4U3T A;  2YKF A;  4IED A;  3UPO A;  5M19 A;  5DF7 A;  3D4F A;  4HJ3 A;  3EEH A;  4QY6 A;  5A90 A;  2JE5 A;  4OQI A;  4ETZ A;  1VQQ A;  4JF4 A;  4CQH A;  2ZOH A;  4OQH A;  5HSQ A;  2NUT C;  4GHI B;  5F1G A;  5HDC A;  1WYB A;  2ZOI A;  4MMN A;  3HUM A;  4CLC E;  5AQA A;  3UPN A;  1P97 A;  1NLZ A;  3ITA A;  2ZQ9 A;  2WKI A;  4QHC A;  4II7 A;  1YLP A;  4C3Q A;  1RGY A;  3AGF A;  5IHV A;  2BG1 A;  4HBU A;  2A24 B;  3MXQ A;  4L9G A;  3CUE C;  3H7W B;  1YLY A;  5GLA A;  2UWX A;  2ZD8 A;  2EX8 A;  3FPV A;  5HAP A;  4HIA A;  1LHY A;  3BY9 A;  4JF5 A;  1VB6 A;  1KDS A;  1JVJ A;  2FH5 A;  1VHM A;  3V50 A;  5A93 A;  5L10 A;  2A49 A;  3B33 A;  3A0V A;  3PAE A;  3OZH A;  3NJA A;  4X1M A;  3S1Y A;  1XGJ A;  3UB6 A;  3G4P A;  4I5S A;  1D06 A;  3LEQ A;  1NRJ A;  3GQZ A;  5CHJ A;  1IYO A;  2P74 A;  1BZA A;  2K7S A;  4EUV A;  1GHP A;  4IUH A;  5CTM A;  3ZNY A;  2WGV A;  3A3E A;  1WE4 A;  2Z6C A;  5TR7 A;  4S2L A;  4S2M A;  2XA7 S;  3BM6 A;  4BD0 A;  4N9K A;  1G5U A;  3QP1 A;  4ZJ2 A;  5EVL A;  4OLD A;  1CQA A;  1MWT A;  3G35 A;  2JC7 A;  3IH8 A;  3K2N A;  2XFT A;  3S7Q A;  4WLA A;  2INW A;  2XRN A;  2PR6 A;  1KOU A;  2OSU A;  3JYI A;  4M4X A;  1DY6 A;  4Y13 A;  2HZ5 A;  1UWN X;  1STZ A;  4OQG A;  1ZG6 A;  1XGI A;  1NLY A;  4OPQ A;  1VM1 A;  4Q8I A;  3VP0 A;  5E43 A;  2VK3 A;  4O0P A;  1K54 A;  2XF3 A;  4IVI A;  4LV2 A;  1NZO A;  3MKF A;  3A0S A;  4EW7 A;  5FQM A;  1FIL A;  1L2S A;  3L7H A;  4BMW A;  4EES A;  4NXF A;  4WZ4 A;  3B3X A;  3FG8 A;  3IBJ A;  3DWZ A;  2XR0 A;  1RCJ A;  5EEC A;  4DJ3 A;  2P08 A;  1QME A;  4QU3 A;  2EX2 A;  2ZC5 B;  1E3U A;  3C4P A;  3FWL A;  4C6Y A;  3KSG A;  4GLQ A;  4IJG A;  4U0X A;  5JYP A;  2ZQ8 A;  4S2J A;  3PHY A;  1L0E A;  1H8Z A;  2B5R A;  2CC1 A;  1OTE A;  2O0Y A;  2WZZ A;  4DKI A;  4X68 A;  3UB8 A;  1H0M A;  4RQ9 A;  2VV7 A;  4HHD A;  2H28 A;  3V3S A;  4EQI A;  4X25 A;  1TS7 A;  1K25 A;  1IEM A;  2OWH A;  4QD4 A;  4ZRR A;  1FOF A;  3LIC A;  2RCX A;  5FAT A;  2XGN A;  3HLW A;  3EGD C;  1T1B A;  3VFF A;  3ZG0 A;  3C8C A;  1ZHH B;  3W8K A;  3EWK A;  4E3L A;  1NJ4 A;  1C3B A;  3RTY A;  3HVF A;  1EI5 A;  3MZF A;  2LB5 A;  1FSW A;  2ZBB A;  4WF0 A;  4N1X A;  1K6R A;  3EQV A;  2M7V A;  3IXH A;  4FH2 A;  1Y28 A;  4ZDX A;  5A91 A;  5FQQ A;  2WK0 A;  1T1A A;  3GV9 A;  3ZCZ A;  4BBV A;  1SKO B;  1K56 D;  3QP8 A;  4WYY A;  4HP4 A;  1L3L A;  3F1O A;  1IFQ A;  4JGP A;  3TOI A;  4HY8 A;  3P98 A;  2OLV A;  3E4O A;  4UQI M;  1F5M A;  4NKP A;  4XXR A;  2HGV A;  2QJ5 A;  1GHI A;  1Q2P A;  1N9O A;  5DJU A;  3A3I A;  1OTD A;  3E0Y A;  4MBF A;  5HL1 A;  3F1P A;  2FFF B;  3F1N B;  3FC7 A;  2DCF A;  2GX5 A;  1CEG A;  5AQ7 A;  3KO6 A;  3T4J A;  2FZ0 A;  4JPM A;  3F1O B;  2B02 A;  2Y4A A;  2J3W A;  2XH9 A;  2L0W A;  3PXP A;  2HF6 A;  4HJ4 A;  3BYD A;  2R78 A;  4ZBE A;  3BFD A;  4WZ5 A;  3NOP C;  3MR0 A;  4GW9 A;  2K2N A;  2V20 A;  2Y55 A;  5GLB A;  2QYB A;  3MSH A;  5EVI B;  1E4D A;  1N9B A;  2XD5 A;  3TG9 A;  1BLS A;  5CHU A;  5HPF A;  4QJG A;  2J7V A;  3VP1 A;  2Q9N A;  1EWZ A;  4OPZ A;  3IT9 A;  2EX9 A;  2W3H A;  4LV0 A;  5D3O A;  5KIZ A;  4R38 A;  3HLC A;  1BUL A;  1LSW A;  1Z09 A;  1DJA A;  4UAA A;  3N6I A;  4IVK A;  3GDI A;  1XXM A;  4E3M A;  1K4F A;  1KGE A;  5EOO A;  5FI7 A;  3SH8 A;  5AQB A;  3IXG A;  5I94 A;  4K0X A;  3CZD A;  3C2W A;  3ZGA B;  2WAF A;  3SOI A;  3G32 A;  3FV7 A;  3WS4 A;  3PR6 A;  5HZH A;  2XRO A;  4KQD A;  3OCN A;  3SS5 A;  2XFS A;  4OOM A;  5HAI A;  1JTD A;  3WRT A;  3MXS A;  1LT0 A;  4P6Z S;  1GA0 A;  2HDS A;  4E6W A;  2E8J A;  4L9F A;  2JKG A;  1LL8 A;  2V1Z A;  2H5S A;  3N8R A;  2G2W A;  3IHA A;  4S2P A;  3NUL A;  5DTS A;  3ZQ5 A;  2ZL1 B;  3EQU A;  3D72 A;  1JWP A;  3K3D A;  2GZA A;  4YWZ A;  2DRW A;  5TGF A;  3N7W A;  3HLE A;  3TJZ C;  2JKT M;  5DF9 A;  4Z1W A;  2OOL A;  4P87 A;  1KDW A;  3JVV A;  4LCL A;  5EVI C;  3QNB A;  5EVI D;  5BOH A;  3OPL A;  4YNR A;  1OPX A;  2XSS A;  4KG6 A;  3E2K A;  2ZL1 A;  3EGX C;  4PAU A;  1JTG A;  2C5W B;  3VP4 A;  1TVF A;  5IT5 A;  2P9V B;  3PBT A;  3L9K A;  2OWJ A;  4JXV A;  2LB9 A;  3UB7 A;  3QP6 A;  4OLG A;  2ZM8 A;  1K56 A;  3UE1 A;  4IUK A;  4JKT A;  2VKS A;  1S66 L;  4QB8 A;  3HLG A;  3FKW A;  1L0F A;  1XP4 A;  1BT5 A;  3N8L A;  4ARZ B;  4QPR A;  4ZJ3 A;  3C38 A;  1O07 A;  3IX4 A;  1PW1 A;  1ZG4 A;  1JNU A;  1I5Q A;  1SKO A;  5CX7 A;  1PZP A;  4KUK A;  4JGQ A;  3IS2 A;  1W63 Q;  3RFB A;  2PU2 A;  4S2N A;  4EXO A;  5DFX A;  4E3N A;  3UB9 A;  5FSR A;  1K0K A;  1PW8 A;  1I2S A;  4E3O A;  4GZB A;  5FQ9 A;  5J3W A;  4OQ0 A;  4DF6 A;  4IBR A;  3ZVT A;  5GHY A;  1DP8 A;  2UV0 E;  3NY4 A;  2OAP 1;  4PM8 A;  3ZG8 B;  4O7D A;  4X1L A;  3S22 A;  3T50 A;  4MN5 A;  3IF6 A;  2B18 A;  2EWV A;  1S1Y A;  3KYE A;  3ZG7 B;  3K3C A;  4NG2 A;  5FAP A;  1H3Q A;  5AVF A;  5A92 A;  3MFD A;  1WA9 A;  4HES A;  3OBF A;  2ZQA A;  3PYP A;  2HJE A;  1K57 C;  3M2J A;  1SDE A;  2M1C A;  3G31 A;  3KSH A;  2BTF P;  3HCY A;  5HW3 A;  2A2L A;  3F1P B;  3T4S A;  2V1A A;  4NK3 A;  1G28 A;  2WYX A;  2J8Y A;  3ITB A;  1K38 A;  4N9L A;  3UE3 A;  3ISG A;  1D7E A;  1HTZ A;  3IX8 A;  4GCZ A;  3MJQ A;  1CI8 A;  4R6L A;  5J4E A;  3MMH A;  3S7N A;  5TJJ A;  5CER A;  3MQO A;  4OOY A;  3IWI A;  3Q7V B;  2ZLY A;  4BLM A;  4EBN A;  2Y2G A;  1PIO A;  3DW0 A;  2X01 A;  3WWX A;  2NUP C;  2V2F F;  4P6Z M;  4E3J A;  1XJ4 A;  4XT2 B;  1ES3 A;  4AFI A;  3QP5 A;  4WEK A;  4JXS A;  1MXO A;  5DF8 A;  4FSF A;  5FQI A;  2OAQ 1;  4N92 A;  4HOI A;  1ONG A;  2D02 A;  4GKU A;  1LSV A;  5KZH A;  3LR4 A;  5E2H A;  1YSQ A;  1XJ2 A;  3LR0 A;  3WS1 A;  1ES4 A;  1VEU B;  2J9P A;  4LV1 A;  4WZ5 C;  1ERQ A;  4I38 A;  2B95 A;  1ERM A;  1MKM A;  1ESU A;  4PM5 A;  4GB7 A;  4HH3 A;  4LFU A;  4ARZ A;  2IWB A;  2Z2M B;  1MBL A;  1PYY A;  1RP5 A;  2JBF A;  1IEL A;  4R3A A;  4WBG A;  2W3F A;  2A3U A;  3AGD A;  3UE0 A;  2GNX A;  2HP6 A;  1OTA A;  5F68 A;  1YPR A;  2VJW A;  3S7P A;  1W63 M;  1XJ6 A;  3WS0 A;  1W7F A;  2Z2L B;  4NET A;  2ACG A;  3VSK A;  1QMF A;  4OP5 A;  4KZ9 A;  4XUZ A;  4BL3 A;  1J3W A;  3PAG A;  4BBT A;  2Y2I A;  1M6K A;  4M3K A;  3IQA A;  3IS2 B;  4BD1 A;  2V8C A;  4IBX A;  1DP6 A;  2IWD A;  3IXD A;  2V1B A;  4RX2 A;  4EEP A;  5G4Z A;  2QZ6 A;  1T18 A;  3H82 A;  3DWK A;  1E25 A;  4Y3I A;  2Y2L A;  1MPL A;  3WS5 A;  2H0T A;  4KZ7 A;  1K55 A;  1HD8 A;  2H0Y A;  3LY3 A;  3T4L A;  3A3D A;  3VP2 A;  1BUE A;  3VSL A;  3CJM A;  4X53 A;  2E8I A;  3T1R A;  5AJG A;  3CWF A;  1NYM A;  3BWL A;  3M6B A;  1BLC A;  1L0G A;  4WL9 A;  1ZC2 A;  5M1A A;  3DTE A;  2QPN A;  3CHW P;  1DJB A;  1MWU A;  3IF5 A;  4GS9 B;  4DXB A;  4KZ3 A;  1IYQ A;  5EV0 A;  1MWS A;  4EU0 A;  5EVI A;  3GVB A;  2M7U A;  2KOI A;  4WUJ A;  3O3V A;  2ZQC A;  5KMW A;  2HPB A;  5KSH A;  2X02 A;  3BRM A;  4X6T A;  1HLU P;  2HP5 A;  4MLL A;  4L9E A;  4MEZ A;  5FDH A;  5DVA A;  4G3V A;  1T1C A;  3PTE A;  3MFX A;  1P9W A;  2H10 A;  3H9W A;  1YSP A;  5F69 A;  3OPP A;  3WRZ A;  1VEU A;  2OV5 A;  3LIB A;  3I7J A;  4GNU A;  4R0Q A;  3HLB A;  3VMA A;  3HLD A;  4Z9Q A;  3CUE A;  4JBF A;  4DE3 A;  4GD6 A;  1TS6 A;  5CXW A;  5HFO A;  2FFY A;  3CIT A;  3Q07 A;  2WAD A;  4P85 A;  1V9Y A;  2OLU A;  3E4Q A;  3VOY A;  1FIK A;  4LEN A;  1PZO A;  4R3B A;  1P9R A;  4MN7 A;  4Q0H A;  4G3K A;  4EET B;  4UA9 A;  2O9C A;  2KDK A;  5G18 A;  3TRC A;  3TE8 A;  1S0W A;  5FQJ A;  3IBR A;  1TDL A;  3B42 A;  5HL6 A;  3Q7Z A;  1YLT A;  3BW6 A;  5F82 A;  1HZO A;  5FDS A;  1G6O A;  2Y2M A;  4HP9 A;  2Y2K A;  3G30 A;  2V0U A;  3O5Y A;  2WKQ A;  1XFQ A;  5FA7 A;  1RGZ A;  2W1R A;  2JKR I;  2Q9M A;  4YIN A;  1OT6 A;  2WAE A;  4E04 A;  4WEJ A;  3FKV A;  1MKI A;  1YM1 A;  1MC0 A;  4D60 A;  1OT9 A;  4OVD A;  2JKR M;  3V39 A;  2C6W B;  3UDF A;  4X55 A;  1S4R A;  3UMD A;  4PKY A;  2JKF A;  2ZC7 A;  4I3J A;  2ZMV A;  5EPH A;  3NOU C;  2V0W A;  5EE8 A;  3UPP A;  3OPR A;  4LGW A;  3UE6 A;  4IHQ A;  2I72 A;  4DJ2 A;  3ZG5 A;  5HPI A;  4I3A A;  1W5D A;  2W0N A;  1YKD A;  2D01 A;  3UY6 A;  4OPR A;  2EA9 A;  2XK1 A;  2P9V A;  4R4R A;  2EX6 A;  5J7E A;  5E2G A;  4GOG A;  2W1T A;  3UO9 A;  3IF6 C;  4U0T A;  1H8M A;  3MZD A;  1KE4 A;  4ME4 A;  2V9A A;  4S2O A;  4R70 A;  1O7E A;  2DMW A;  2JN7 A;  4NXE A;  3O88 A;  3NIA A;  4A5R A;  3HRE A;  1S6R A;  4K91 A;  4WN5 A;  4K08 A;  2KX6 A;  4ZJ1 A;  1SCW A;  4S2N C;  1PNE A;  4B88 A;  3HUN A;  3H82 B;  1H5X A;  2XD1 A;  4R3J A;  4NXB A;  3G2Y A;  3OOV A;  4DN0 A;  3R7W A;  1S1Z A;  4BJP A;  1Q2Q A;  3LEZ A;  3ZVW A;  5F83 A;  1K57 A;  2PAV P;  2QJ7 A;  1TD5 A;  2JHE A;  1SKF A;  5HD3 A;  1FR6 A;  1VET A;  1GHM A;  1OJG A;  5CEC A;  1TEM A;  4Q0I A;  2VA0 A;  2Y2Q A;  2W3E A;  4HH2 A;  5F1F A;  1BLH A;  2WKH A;  3QP2 A;  1G6A A;  3OCL A;  3OPH A;  2VX8 A;  3MZE A;  1GSV A;  2Y8H A;  5E2F A;  4XT2 A;  3TSG A;  2CMN A;  3KSF A;  4QY5 A;  3PBN A;  1GA9 A;  3C7U A;  3G2Z A;  1VET B;  4JF6 A;  4QWO A;  2XEP A;  3KYZ A;  5CHM A;  2VV8 A;  3W4P A;  5HDD A;  2HDR A;  4OKP A;  4Y17 A;  2PYP A;  5L2F A;  3HL9 A;  2IA2 A;  4Y2F A;  3P7N A;  4GDN A;  3T1X A;  4H8R A;  3BEC A;  3ULF A;  1YMX A;  1HVB A;  4I39 A;  3RXX A;  1DP9 A;  4YFM A;  3UDI A;  3IWQ A;  3NOT C;  1DRM A;  2WKR A;  3D9Y A;  4B4X A;  3CPT A;  4C75 A;  4R4S A;  5U47 A;  3SS3 A;  2VV6 A;  5LBR A;  3UME A;  5HWV A;  3MKE A;  4FD8 A;  4FUW A;  3U2A A;  4E3K A;  2XLN A;  3MBZ A;  2MJ6 A;  1ERO A;  1SHV A;  2WUQ A;  2EWW A;  4KG2 A;  4B4Z A;  4BEN A;  2HDQ A;  1CI9 A;  2ZC6 B;  1N9N A;  5GHZ A;  3HUO A;  4FTX A;  1YAX A;  3SS4 A;  1K54 C;  4YOF A;  4EBL A;  3NHQ A;  2EXB A;  4LRY C;  4F3L A;  4R23 A;  1N9L A;  3C30 A;  5FI2 A;  4Y5F A;  3N8S A;  1FCO A;  4LPZ A;  1NYY A;  1MZU A;  3UN7 A;  2BAS A;  5GHX A;  2ZQD A;  2IWC A;  1GCE A;  3ICY A;  4Y15 A;  5DFY A;  1I2W A;  1SDN A;  3BY8 A;  5DKL A;  3CG5 A;  2ZMA A;  3LCE A;  4MN6 A;  1ZTU A;  5CEB A;  1BLP A;  2A24 A;  4XUX A;  3VE4 A;  1ESI A;  4GJ4 A;  3IH9 A;  4JGR A;  1DJC A;  3LR5 A;  3T4O A;  3SH9 A;  3Q82 A;  5HWT A;  2QMI A;  2V8F A;  5AQ9 A;  4OPY A;  2HJ9 C;  3DBA A;  1P0Z A;  2WKE A;  4KUO A;  4DDY A;  5L09 A;  4LLO B;  3VOZ A;  5HAQ A;  5HX9 A;  2WGI A;  2VGL S;  1Y54 A;  1PRQ A;  2PD7 A;  3EEA A;  2J3T D;  4P0M A;  2L4R A;  4B93 A;  4DXC A;  1KVM A;  3SZT A;  2VEA A;  1OJ5 A;  1ALQ A;  1F9I A;  3FYZ A;  4UEY A;  5HAR A;  1MY8 A;  2G7U A;  2Y2N A;  1KGF A;  5HDS A;  4LRX C;  1T19 A;  4PM9 A;  4RA7 A;  1LL5 A;  2GJ3 A;  4KG5 A;  5F6A A;  3QNC A;  4KQQ A;  1K55 C;  2KLI A;  1W79 A;  3JVU A;  2W1T B;  2VZW A;  1PFL A;  4FOF A;  3A3J A;  1WYC A;  2JCH A;  4PKY G;  1YLZ A;  4GDB A;  3NEC A;  3S4X A;  4F94 A;  4E6X A;  4GS9 A;  3C5A A;  3OC2 A;  1CJF A;  4KQO A;  3O87 A;  3BLM A;  1OME A;  4JXG A;  4CJN A;  3VV4 A;  5KSC A;  4BBU A;  3T1S A;  3UB5 P;  4P6B A;  4BWI A;  2Y2J A;  2Y2O A;  2WZX A;  4E3I A;  5JYO A;  3RH8 B;  1AXB A;  3HJK A;  5HD5 A;  1XA7 A;  2ZJ9 A;  3KSI A;  3CMZ A;  4KZ8 A;  4NEE D;  4UA6 A;  2DNS A;  1F2K A;  1KVL A;  4CLC D;  1JWV A;  2O9B A;  1YQS A;  4OON A;  5A8B A;  4RVA A;  2PT7 A;  3Q7V A;  3NDE A;  2EXA A;  4OP8 A;  4O01 A;  5G4Y A;  3S7O A;  3GRJ A;  3M2K A;  3E98 A;  3T4T A;  4BL2 A;  1IOU A;  2Y2P A;  1KE0 A;  3BFC A;  2R9W A;  3ZFZ A;  4F3L B;  1G68 A;  4Y0O A;  1PWC A;  1SZV A;  4X56 A;  3KYQ A;  3BQA A;  4UQI S;  2PHY A;  3PBQ A;  4KZ5 A;  3P01 A;  1ACF A;  4HI4 A;  3BFF A;  5CGS A;  3FPW A;  3LI8 A;  3MS6 A;  5FAS A;  5EFW A;  4WMC D;  1LL9 A;  1EW0 A;  2AVX A;  4K0W A;  3IXB A;  4H6J B;  4BQM A;  3ZHH A;  2PU4 A;  3KX0 X;  3CPT B;  3CAX A;  3H7W A;  2RL3 A;  3V5M A;  3MF0 A;  2HP9 A;  4DE1 A;  5GL9 A;  1PWD A;  1UWP X;  3LGO A;  1XKZ A;  1GSW A;  1LI0 A;  5EM0 A;  4G3W A;  3HBR A;  2GDN A;  3M6H A;  1CF0 A;  3IX3 A;  3LIE A;  4Y0T A;  1NXY A;  4O8G A;  3R4K A;  2Y79 A;  4PM7 A;  5FEF A;  2ZMF A;  4CLC B;  3TW8 A;  2HDU A;  3F1N A;  4I3I A;  3BFE A;  3N4I A;  3MXR A;  3LI9 A;  4GN2 A;  5IS1 A;  4WEL A;  4EV4 A;  1M40 A;  1J9M A;  3LID A;  4RYE A;  2K31 A;  3BLS A;  1CK3 A;  3FZC A;  4ZAM A;  4KQR A;  2J80 A;  3Q1F A;  3HJI A;  5FL3 A;  2PR5 A;  5HWW A;  3LO7 A;  4L0L A;  3LIA A;  2ZC3 B;  1K6S A;  3ZG9 B;  1XPB A;  2BLS A;  4DMZ A;  4EEU A;  2Y2H A;  4JGO A;  3OLO A;  1PWG A;  4HBT A;  3MQ0 A;  1LLB A;  5J8X A;  3VP3 A;  2ZC4 B;  4MNR A;  2P7J A;  3T4K A;  1L0D A;  1Z6F A;  2JKT I;  4CLC C;  2ZQ7 A;  1NZU A;  3A3F A;  2VLG A;  3IHB A;  4CPK A;  5K5B A;  3HLF A;  2L1M A;  2Q0O A;  4S2K A;  4ZTK A;  1U60 A;  2J9O A;  1OTB A;  2W3D A;  5IU1 A;  5TFQ A;  1IYP A;  1F98 A;  3LFV A;  3QHY A;  4MBH A;  3VOL A;  3GSG A;  4KEN B;  3U4L P;  1YMS A;  2WGW A;  4DDS A;  3UNW A;  3T12 B;  2WGW B;  4RX3 A;  3BQ8 A;  3SW1 A;  3MQQ A;  1IKG A;  1KE3 A;  5CGW A; 
#chains in the Genus database with same CATH homology
 5C5K A;  3E4P A;  4DJ3 A;  3ULF A;  2P08 A;  2PYR A;  2NUP C;  4I39 A;  4P6Z M;  1DP9 A;  1XJ4 A;  4XT2 B;  3NOT C;  4AFI A;  1GSX A;  3KSG A;  4GLQ A;  4WEK A;  4IJG A;  1DRM A;  3ZYT A;  2WKR A;  1TF1 A;  3PHY A;  4FSF A;  2OAQ 1;  1OTE A;  2VV6 A;  4HOI A;  2O0Y A;  5LBR A;  1S4S A;  4HQA A;  2D02 A;  3PBS A;  3UME A;  5HWV A;  1LSV A;  3U2A A;  3LR4 A;  4OOL A;  1YSQ A;  2QWS A;  2MJ6 A;  4GHI A;  3UB8 A;  1XJ2 A;  3LR0 A;  2EWW A;  3B47 A;  3A0R A;  5L8M A;  4RQ9 A;  2VV7 A;  4HHD A;  4B9O A;  4I38 A;  2H28 A;  3D3O A;  1MKM A;  3CI6 A;  1TS7 A;  1N9N A;  1ODV A;  2QHK A;  2OWH A;  1YAX A;  4HH3 A;  4NXG A;  4ZRR A;  4YOF A;  4ARZ A;  3LYX A;  3NHQ A;  3LIC A;  4F3L A;  4LRY C;  2YKH A;  1N9L A;  3C30 A;  4ETX A;  4Y5F A;  2O99 A;  4LPZ A;  1MZU A;  4R3A A;  4MCW A;  3W2Z A;  3T4Q A;  2W3F A;  3EGD C;  2XA7 M;  2BAS A;  1T1B A;  2GNX A;  1X0O A;  3C8C A;  1ZHH B;  2Z6D A;  3ICY A;  3EWK A;  1OTA A;  4MDZ A;  5DFY A;  5F68 A;  3RTY A;  3BY8 A;  5DJT A;  5DKL A;  4PHT A;  2VJW A;  3S7P A;  4H6J A;  2LB5 A;  1W63 M;  1BYW A;  1ZTU A;  4MN6 A;  1XJ6 A;  2ZBB A;  4LRZ E;  2A24 A;  3VE4 A;  4WF0 A;  4GJ4 A;  3EQV A;  2M7V A;  1Y28 A;  3V67 A;  2PDR A;  3PBR A;  1T1A A;  4JGR A;  4BBV A;  3LR5 A;  3T4O A;  4BBT A;  3IS2 B;  5HWT A;  2W3G A;  2HJ9 C;  4HP4 A;  3F1O A;  1DP6 A;  3DBA A;  1IFQ A;  2V1B A;  4HNB A;  4JGP A;  1P0Z A;  4HY8 A;  4KUO A;  4EEP A;  5G4Z A;  1T18 A;  4LLO B;  3H82 A;  3E4O A;  4UQI M;  2VGL S;  1F5M A;  3BJN A;  4NKP A;  3LIF A;  4Y3I A;  2HGV A;  2QJ5 A;  2PD7 A;  1N9O A;  5DJU A;  1S67 L;  3EEA A;  1OTD A;  1XFN A;  2J3T D;  3E0Y A;  3R7W B;  3T4L A;  2J3T C;  2L4R A;  4B93 A;  3F1P A;  3PBO A;  3F1N B;  3FC7 A;  2VEA A;  2GX5 A;  1OJ5 A;  1F9I A;  4UEY A;  4EER A;  1NWZ A;  3KO6 A;  3T4J A;  5AJG A;  3CWF A;  2FZ0 A;  3BWL A;  2G7U A;  3F1O B;  5HDS A;  4LRX C;  2B02 A;  1T19 A;  2J3W A;  3CLO A;  2GJ3 A;  4WL9 A;  2L0W A;  5F6A A;  3PXP A;  2HF6 A;  2KLI A;  4HJ4 A;  3JVU A;  2W1T B;  2R78 A;  5F5Y A;  4EQ1 A;  2VZW A;  4FOF A;  4GS9 B;  4PKY G;  3NOP C;  3MR0 A;  4GW9 A;  3EOI A;  3GEC A;  4GS9 A;  2K2N A;  2WKP A;  4EU0 A;  2M7U A;  3OC2 A;  2QYB A;  2KOI A;  4WUJ A;  4CLC A;  4KQO A;  5KSH A;  5DKK A;  4Q0J A;  5HPF A;  1V9Z A;  4L9E A;  3VV4 A;  4BBU A;  1TS8 A;  4G3V A;  1T1C A;  3MFX A;  1P9W A;  3H9W A;  1YSP A;  5F69 A;  4BWI A;  2QKP A;  3P7N A;  1XJ3 A;  3LIB A;  2W3H A;  3LR3 A;  5MC7 A;  2O9A A;  2HV1 A;  5KIZ A;  4R38 A;  5I5L A;  1LSW A;  3RH8 B;  3HJK A;  3CUE A;  5HD5 A;  1TS6 A;  3KSI A;  3GDI A;  2W27 A;  4NEE D;  3CIT A;  2I9V A;  5AVE A;  1V9Y A;  3LUQ A;  4CLC D;  3E4Q A;  3C2W A;  3G6O A;  2P04 A;  3PR6 A;  5HZH A;  2XRO A;  2O9B A;  3VE3 A;  1UGU A;  1P9R A;  4MN7 A;  4HJ6 A;  4Q0H A;  5A8B A;  4G3K A;  4KQD A;  2PT7 A;  3OCN A;  4OOM A;  4EET B;  2O9C A;  1LT0 A;  2KDK A;  4P6Z S;  3TRC A;  3TE8 A;  5TBM B;  2PD8 A;  2VGL M;  4O01 A;  3IBR A;  5G4Y A;  5TBM A;  3S7O A;  3B42 A;  5HL6 A;  1OTI A;  4L9F A;  3BW6 A;  1G6O A;  1TS0 A;  1LSX A;  3E98 A;  1LL8 A;  2YKF A;  3T4T A;  4HP9 A;  1IOU A;  2V0U A;  3O5Y A;  2WKQ A;  4HJ3 A;  1XFQ A;  4F3L B;  3EEH A;  3ZQ5 A;  3EQU A;  3D72 A;  3K3D A;  2GZA A;  2W1R A;  4YWZ A;  4ETZ A;  4CQH A;  2JKR I;  2ZOH A;  3TJZ C;  5HSQ A;  2NUT C;  4GHI B;  3KYQ A;  3BQA A;  1OT6 A;  4UQI S;  4E04 A;  2PHY A;  4WEJ A;  5HDC A;  2ZOI A;  3PBQ A;  2JKT M;  4MMN A;  4CLC E;  5DF9 A;  1MC0 A;  3P01 A;  1P97 A;  1OT9 A;  1NLZ A;  4HI4 A;  3FPW A;  3LI8 A;  4Z1W A;  2OOL A;  2JKR M;  5EFW A;  3JVV A;  1S4R A;  3UMD A;  4II7 A;  1EW0 A;  4I3J A;  4PKY A;  2ZMV A;  4H6J B;  3NOU C;  4YNR A;  3KX0 X;  2A24 B;  2V0W A;  1OPX A;  3CAX A;  3H7W A;  2XSS A;  3MXQ A;  4L9G A;  3UE6 A;  3CUE C;  3EGX C;  3H7W B;  3MF0 A;  4PAU A;  4IHQ A;  4DJ2 A;  5IT5 A;  5HPI A;  4I3A A;  2W0N A;  1UWP X;  1YKD A;  2D01 A;  3PBT A;  3FPV A;  1GSW A;  2EA9 A;  2OWJ A;  2LB9 A;  4G3W A;  3UB7 A;  5J7E A;  4HIA A;  3BY9 A;  4IUK A;  1VB6 A;  2VKS A;  1S66 L;  2W1T A;  2FH5 A;  3LIE A;  1VHM A;  1H8M A;  4O8G A;  3R4K A;  4ME4 A;  2V9A A;  2Y79 A;  3B33 A;  3A0V A;  4ARZ B;  3NJA A;  4QPR A;  3C38 A;  2ZMF A;  4R70 A;  4CLC B;  3UB6 A;  3TW8 A;  2DMW A;  2JN7 A;  4I5S A;  4NXE A;  1JNU A;  3F1N A;  1D06 A;  4I3I A;  5CX7 A;  4KUK A;  1NRJ A;  4JGQ A;  3IS2 A;  1W63 Q;  3LI9 A;  5IS1 A;  3RFB A;  4WEL A;  2K7S A;  4EUV A;  4IUH A;  5DFX A;  4EXO A;  4WN5 A;  4K08 A;  3UB9 A;  3LID A;  2K31 A;  2KX6 A;  2J80 A;  2Z6C A;  3HJI A;  5FL3 A;  3H82 B;  2PR5 A;  5HWW A;  2XA7 S;  4L0L A;  3LIA A;  5J3W A;  1DP8 A;  4NXB A;  2OAP 1;  3OOV A;  4DN0 A;  4DMZ A;  3R7W A;  3T50 A;  4EEU A;  4MN5 A;  1S1Z A;  4BJP A;  4JGO A;  3OLO A;  2B18 A;  3K2N A;  3MQ0 A;  3S7Q A;  4WLA A;  2INW A;  2QJ7 A;  2XRN A;  1TD5 A;  2EWV A;  1S1Y A;  2JHE A;  2PR6 A;  1KOU A;  3K3C A;  5HD3 A;  2P7J A;  1OJG A;  3T4K A;  1H3Q A;  2JKT I;  4M4X A;  4CLC C;  5AVF A;  4Q0I A;  1WA9 A;  3OBF A;  2VA0 A;  1UWN X;  1STZ A;  2W3E A;  4HH2 A;  3PYP A;  2HJE A;  2VLG A;  1NLY A;  3OCL A;  5K5B A;  2VX8 A;  2L1M A;  1GSV A;  2M1C A;  4O0P A;  2Y8H A;  3KSH A;  3HCY A;  1OTB A;  2W3D A;  5IU1 A;  1F98 A;  2A2L A;  3A0S A;  3LFV A;  4XT2 A;  4EW7 A;  3F1P B;  2CMN A;  3T4S A;  3KSF A;  2V1A A;  3VOL A;  3PBN A;  1G28 A;  4BMW A;  3UE3 A;  4EES A;  3KYZ A;  1D7E A;  4GCZ A;  4NXF A;  2VV8 A;  3MJQ A;  5HDD A;  3BQ8 A;  4R6L A;  5J4E A;  3SW1 A;  2PYP A;  3MMH A;  3S7N A;  3MQQ A;  5TJJ A;  3FG8 A;  3MQO A;  2IA2 A;  4Y2F A;  3IBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...