3KSHA

Structure of frmsr of staphylococcus aureus (oxidized form)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kshA00
2VZWA 4R70A 4ETXA 3IBJA 3NOPC 5HPFA 4O8GA 2M7UA 1MC0A 2W1TB 5LBRA 1YKDA 1MKMA 2LB9A 2HGVA 3C2WA 2W3EA 3DBAA 2W1TA 4G3WA 2G7UA 3MMHA 4MMNA 2OOLA 5DFXA 2O9BA 2W3DA 3G6OA 5HPIA 3O5YA 5TJJA 4Q0HA 2XROA 3CITA 1YSPA 4QPRA 4IUHA 4CQHA 5DFYA 2M7VA 4Y3IA 2W1RA 2W3GA 4G3KA 2QYBA 2XSSA 4ME4A 4R6LA 3S7PA 4MN7A 4Z1WA 2KLIA 3OBFA 4EUVA 3D3OA 2LB5A 2XRNA 4MCWA 3VV4A 5C5KA 3K2NA 2KOIA 4GLQA 4GW9A 3S7OA 2O9AA 5I5LA 1TD5A 3S7NA 3ZQ5A 2VEAA 4DN0A 3KSFA 4LRYC 4YNRA 3NOUC 2W3HA 3CI6A 4ETZA 3OOVA 3NHQA 4PAUA 2W3FA 4Q0JA 4Y5FA 2O99A 3TRCA 3HCYA 3KSHA 3BJNA 4O01A 4YOFA 4LRXC 5HSQA 3KSIA 2IA2A 5AJGA 2Y79A 4RQ9A 3S7QA 1STZA 4ZRRA 2GX5A 4IUKA 4FOFA 4MDZA 4BWIA 1ZTUA 2ZMFA 4EU0A 2K2NA 3KO6A 5L8MA 2Y8HA 5K5BA 4LRZE 3E0YA 2B18A 4IJGA 1VHMA 3E98A 2K31A 4E04A 3MF0A 2VKSA 3R4KA 3LFVA 4O0PA 2VJWA 3KSGA 4Y2FA 1F5MA 3EEAA 4DMZA 3W2ZA 3MQ0A 4Q0IA 2O9CA 4G3VA 2O0YA 5HL6A 1TF1A 1YSQA 3IBRA 3NOTC 3RFBA
chains in the Genus database with same CATH superfamily
4C6YA 3HLGA 4P6ZM 3VE4A 5FI6A 1FR6A 5J7EA 3UB9A 3W8KA 4CLCA 2P7JA 2H28A 2W3DA 5DJUA 4GCZA 1EI5A 4HP9A 3M2JA 3IX3A 5HW3A 1KE0A 3EWKA 3LIAA 3K3CA 3IH8A 5DF9A 4HNBA 3C30A 3KX0X 3QP2A 1P0ZA 1G28A 5CHJA 4KUOA 3QHYA 4Y7PA 3DTMA 1IEMA 3W4QA 4HBUA 2L0WA 4GS9A 4X25A 5FSRA 3LI8A 4NXFA 3GSGA 2HDSA 2JKRM 1Y28A 3S7QA 1WYBA 2H0YA 4IBRA 1Y4OA 4Y15A 1A0KA 1LLBA 3O88A 3KO6A 2VV6A 5FQQA 2WKHA 5L8MA 4NG2A 1N4OA 2B18A 4R1GA 2PR5A 1I5QA 2PYPA 4L9GA 1XGIA 5HAQA 5L2FA 1PRQA 4OOMA 3UDFA 3VOYA 4ZJ1A 3U2AA 4DKIA 2VJWA 1H8YA 1YMSA 2ZL1B 5JYOA 2Y2GA 1BZAA 1TS7A 1H3QA 4N9KA 3NJAA 3GRJA 3C5AA 1K55A 4C75A 5FEFA 4U3TA 4WMCA 4Y0UA 2P9VA 3U4LP 2C5WB 2ZMAA 5GHYA 1HD8A 3MXRA 2W1TB 2ZQCA 1E25A 5EUAA 4RA7A 1DJCA 5HPIA 4RX3A 2BLSA 3LGOA 4PM9A 4RYEA 4BL2A 1LHYA 1MPLA 3DAVA 1N9LA 3IXBA 2V8CA 2MJ6A 1EROA 1W79A 2KLIA 3A3IA 1DJAA 1LI0A 3CAXA 2EX8A 3UMDA 3HBRA 4R0QA 5GLAA 1KVMA 5F83A 2J9PA 4NK3A 2JE5A 1LSXA 3PHYA 5KIZA 4QY5A 1P97A 1PZPA 4OQHA 3BLSA 3PTEA 1HZOA 3OLOA 3RJUA 1N9OA 4P85A 4S2IA 4DJ3A 4PM5A 1JWVA 3UPOA 4KUKA 2EXAA 1WYCA 3E0YA 2PYRA 3T1QB 4DE0A 2HP5A 3VMAA 1OMEA 1K25A 2OWJA 5FI2A 4HEFA 3BWLA 4KZ9A 1NYMA 2PT7A 2JN7A 4MEZA 1T1AA 2Q9NA 4Q0IA 1YMXA 1BLPA 3G34A 2ZL1A 4X1LA 1HVBA 4GN2A 4GB7A 3LCEA 3Q81A 3OC2A 2VZWA 4CLCE 2M1CA 1Q2QA 2BASA 4XXRA 4OPZA 4JF6A 3RTYA 3IXDA 1KVLA 1ZC2A 3OPLA 1LL9A 2W1TA 4LENA 3A3EA 4LV0A 5E2HA 2ZQDA 1OPXA 4S2NC 2IWBA 4LCMA 2PU2A 5AQ7A 3NECA 3QNBA 3VSLA 1CJFA 1P9RA 1LL8A 1DY6A 2OLVA 5EM0A 3AGEA 4K0XA 2ZQ8A 4I3IA 2ZM0A 4B4XA 1Z6FA 4FH4A 1W5DA 4IBXA 1T1CA 2A49A 5IU1A 3A0SA 2EA9A 4O01A 4LRXC 3TE8A 4EEUA 4UQIS 4BWIA 2ZMFA 3L9KA 4R38A 5F82A 1FQGA 3S4XA 4K91A 1TS0A 4A5RA 3C7VA 2PD8A 1FCNA 1MBLA 3QP5A 3VFHA 2WZXA 1NZOA 2K31A 5EM1A 1I2WA 4EBLA 4EW7A 2H5SA 3MQ0A 3ZYTA 1XJ3A 3LEZA 2ZQ9A 3HLCA 3IQAA 3SH8A 4PMAA 3LEQA 5G18A 5EV0A 3PXPA 2WKQA 4LFUA 2M7UA 2WGWB 2W3EA 3DBAA 2G2UA 2WAEA 2JKRI 3UE0A 4BL3A 3QNCA 1JVJA 1S0WA 4NEED 5EVEA 4CQHA 3FG8A 4KQDA 3TW8A 4EBPA 1PWDA 4Y3IA 3SOIA 3K3DA 5GLBA 2ZMVA 1ACFA 3EEHA 3OCNA 4MBHA 2XDMA 4MN7A 4B93A 3D3OA 2ZJ9A 2XRNA 4MCWA 4Q8IA 3OPPA 2CMNA 3G4PA 4WUJA 3S7NA 2V0WA 2XFTA 3KSFA 4P6ZS 4I5SA 4X56A 4E3NA 3TRCA 3MZEA 4Y17A 3T4LA 3FV7A 5HD5A 5HZHA 1NRJA 3ICYA 1K57A 4EU0A 1L0FA 2PAVP 3KYZA 1MWUA 2P74A 2VV7A 1VETA 1U60A 5F6AA 5F1GA 3C4PA 1E3UD 3CUEC 4B9OA 1NWZA 4FTXA 3MF0A 4BBVA 1XKZA 2V1ZA 4EXOA 5GHZA 5GLDA 4IVKA 3KSGA 2VX8A 4HH2A 4DMZA 4M3KA 1D06A 1F9IA 2DCFA 5G4ZA 4X69A 4BD1A 1VB6A 1OTAA 1MWSA 2ZM2A 2J3WA 3O3VA 1OTBA 1YLTA 3H82A 4NXEA 1M6KA 2WUQA 3UDXA 3MMHA 2O9BA 3G6OA 3G31A 5FAOA 4H6JA 3N8SA 4PKYG 1IELA 2L1MA 3C7UA 5DKLA 2V1BA 3MSHA 4S2LA 3F1PB 3OBFA 5JYPA 3C8CA 4KZ6A 3LY4A 4ZBEA 2INWA 5C5KA 2WKIA 4PM8A 1GSWA 4P87A 1Y54A 2HJ9C 4R3BA 3DTIA 1TD5A 2WAFA 3ZG9B 5EVIB 3DW0A 4YNRA 5U47A 4E6WA 4UQIM 3CLOA 1TS8A 3PAGA 3VP4A 1BTLA 2R9XA 5KMWA 3B3XA 4CLCD 3CJMA 3ITAA 4DE3A 5AJGA 2Y79A 3MQQA 4MNRA 5FL3A 3FKVA 1RCJA 5CEDA 5CX7A 3W4PA 3SZTA 5F5YA 2Z6DA 2B02A 1MZUA 3LR3A 3DTEA 1XX2A 2Y2QA 3LFVA 4O0PA 1DP9A 2KDKA 3EEAA 3V3SA 3IS2A 3UO9A 5HARA 1O7EA 1NY0A 5HL6A 1YSQA 2A24B 3CPTB 1PNEA 3V39A 4XT2B 1XXMA 5GL9A 4YWZA 2JHEA 2V9AA 1BULA 4EQIA 1ERQA 2LB9A 4PPRA 3KYQA 4JKTA 2PD7A 1ONHA 2WZZA 4KZ5A 3GVBA 3CMZA 1TS6A 3TJZC 1BUEA 4BBUA 3T1XA 2J3TC 3F1PA 5TFQA 2XK1A 1WA9A 1G6AA 4HJ3A 4HOIA 3VSKA 3BFGA 3LR5A 1KGEA 2VGKA 3T1RA 4M4XA 4WMCD 4BENA 2W3HA 1N9NA 4PAUA 4YINA 3EQUA 3G2YA 2PU4A 4GD8A 5EPHA 3ZG8B 2EX6A 1KDSA 4X55A 1ES4A 3IHBA 3FYZA 2XH9A 4DF6A 1G6OA 3AGDA 4LLOB 1VEUB 4H8RA 3JVVA 3GQZA 2CC1A 1OT6A 3LIEA 2UWXA 2OV5A 4E6XA 1XP4A 4UA7A 5HDDA 5HWTA 4LGWA 1FCMA 4FCFA 2XQZA 4KQOA 5L10A 3NCKA 3HJIA 2R78A 4BBTA 3IXHA 2V0UA 2QMIA 4UEYA 4K08A 4I38A 3MFXA 1D7EA 1S67L 3W4OA 2FFYA 3FC7A 4KG5A 2X01A 1XA7A 2A24A 3UPNA 4EESA 1W63Q 3MXQA 4XT2A 4O8GA 5FAQA 5LBRA 1FOFA 3L7HA 1IKGA 2WYXA 4OVDA 2G7UA 4MMNA 2XGNA 4WLAA 1TDLA 2GZAA 3SH9A 3S22A 4F3LB 3E4PA 4HIAA 2WADA 4S2JA 2L4RA 5MC7A 1SKOB 2Y91A 3VP2A 4S2NA 4UAAA 5DF8A 3T4KA 3VE3A 3G30A 4EUVA 1H8MA 3HUNA 2Y2HA 4E3JA 1WE4A 1V9YA 2QWSA 2VEAA 5F69A 5HL1A 2YKHA 3Q82A 1GCEA 4HJ6A 1XGJA 2GDNA 1BYWA 3G32A 3BJNA 3Q07A 5KZHA 3NC8A 4GKUA 3BRMA 5E2EA 4MBKA 2XEPA 1DRMA 4K0WA 1JTDA 4KG2A 4MDZA 3T4JA 5EVIC 4YFMA 3LI9A 1ESIA 4WZ5C 5DVAA 1VEUA 5FQMA 2DNSA 2JCHA 2OAQ1 3EGXC 4KENB 4OPYA 3UN7A 3E4OA 4OLGA 1H0MA 3HLWA 4QHCA 1MKIA 1NLZA 1BSGA 2HDUA 2D02A 1XFNA 3QP6A 5DTSA 1YLWA 3UE6A 3P09A 3T1SA 3ZGAB 2V20A 2ZC4B 1SCWA 4GHIB 3LICA 4EQ1A 1KGGA 5A91A 1XPBA 5HDSA 5TBMB 3ZG0A 1SDEA 3BM6A 5F68A 4HESA 3MFDA 2XROA 2XD5A 4QB8A 3UPPA 4IUHA 2M7VA 3T4TA 3T50A 1YLJA 4OOLA 5FQIA 4N1HA 2Y2LA 4FUWA 1GSVA 2WK0A 4N92A 2XSSA 1KOUA 4ME4A 4Y0OA 3MKFA 4E3LA 3S7PA 1MY8A 2Y2OA 1UWPX 3UB7A 3PBOA 1K54C 1NYYA 5FI7A 2G2WA 1PYYA 4PM7A 1PI5A 3TG9A 4BQMA 3G35A 4LRYC 4NXBA 4ETZA 3BY8A 5FA7A 1JNUA 4UA6A 1ES2A 4KZ7A 2ZC6B 4JGOA 3KYEA 1LI9A 1RP5A 5G4YA 3FZCA 4D2OA 1KE3A 2PDRA 1IYQA 4OQIA 1NJ4A 1X0OA 5KSCA 3E4QA 1GHMA 3E2LA 1K38A 3WS1A 3V50A 4WYYA 3MS6A 4OQGA 3Q1FA 4JGPA 4OH0A 1K56A 4RVAA 3VOLA 3CUEA 1G5UA 1YAXA 2XA7S 3IF5A 1TF1A 5HDCA 5EE8A 5HD3A 3P98A 3BEBA 3IF6C 3I7JA 1L3LA 1FCOA 3A3JA 1KDWA 3P7NA 1HLUP 4P6BA 4ID4A 5TBMA 2Z6CA 1CEFA 3E2KA 1BLHA 4GOGA 1CEGA 3VP0A 4WL9A 5AQAA 4DDSA 2PBYA 4PM6A 1LL5A 3DWKA 3T4SA 3GMWA 4Z1WA 2KX6A 2LB5A 1Q2PA 3A0RA 3VV4A 2P04A 2HDRA 3WRTA 2K7SA 3LUQA 3S7OA 4OP5A 2Q0OA 1ES3A 1H8ZA 4ESPA 3LIFA 4DN0A 1GHPA 4OPQA 5A92A 3FKWA 4MBFA 3CZDA 1OTDA 1C3BA 4UHUA 2W0NA 2A3UA 1OJ5A 1YQSA 3MQOA 4RQ9A 1H5XA 3VFFA 3IX8A 1W7FA 4GZBA 1PW8A 4QU3A 4Z9QA 2ZOHA 1K6SA 4EWFA 3VP3A 3FWLA 4WELA 4GDBA 2GNXA 3VP1A 3O86A 1S4RA 5E2FA 1VHMA 4KQQA 1CF0A 1S6RA 2XF3A 3IX4A 3IBRA 4BMWA 1D1JA 2VLGA 5CECA 1ALQA 4I3JA 3RXXA 5HWWA 5HPFA 2A2LA 1YLYA 3NY4A 4JGQA 4WBGA 5M1AA 3NBLA 2OOLA 3HUMA 3ITBA 1BLCA 2DMWA 1SHVA 1RGZA 3QP1A 4JXGA 2Q9MA 1CQAA 5CEBA 4GD6A 2GJ3A 2BG1A 3K2NA 5FATA 2HV1A 2EWWA 5AQBA 5I5LA 4KQRA 2WGWA 2FH5A 2J80A 2WGIA 2VGLS 4WN5A 4LCLA 1CI9A 5CGSA 3BECA 3PBRA 4JGRA 2Y59A 2XFSA 2HF6A 3BFEA 4KZ3A 2H0TA 3LY3A 1ESUA 4S2MA 5HAPA 3ZCZA 4OKPA 1TVFA 1YPRA 2BTFP 3CG5A 3WS0A 1XA1A 4LRZE 3B47A 2XA7M 3WS4A 2NUTC 2VA0A 4CLCB 4KZ8A 2Y2PA 2VKSA 2WKEA 3UE1A 4XUXA 2OAP1 3Q7VB 3V67A 2O9CA 2QZ6A 4II7A 3D72A 2E8IA 1KGFA 2EWVA 2ZOIA 4S2PA 2WGVA 3N6IA 4HHDA 4EUZA 4HBTA 4R70A 4ETXA 2JKGA 5DF7A 1L0EA 3LIDA 3OZHA 3PBNA 5EOEA 2HGVA 5DTKA 4N9LA 4F94A 3WS2A 3HLEA 1IKIA 1SDNA 4C3QA 1YSPA 2QJ7A 1CI8A 2W1RA 2W3GA 1T19A 4G3KA 1J9MA 2VK3A 4HI4A 2XLNA 2EX2A 3G2ZA 4HY8A 3BFFA 2Z2LB 3OCLA 2HZ5A 1F98A 2Y2MA 4Y13A 3ZQ5A 2AVXA 3ULFA 1EW0A 3GTCA 3NI9A 3NHQA 2W3FA 2R9WA 1FR1A 4OPRA 3JVUA 2C6WB 4JXVA 1LSVA 3T12B 4UA9A 1PWCA 2HP6A 4WEJA 4OLDA 2ZC3B 2NUPC 2ZC7A 2P9VB 5EVIA 4WF0A 4JF4A 1DP8A 4EERA 4WZ5A 5J8XA 4GDNA 1GA0A 1AWIA 4EEPA 3ZFZA 3IXGA 5FAPA 4WEKA 4HH3A 5AQ9A 1GSXA 3FPVA 5EFWA 3N7WA 3Q7VA 3BLMA 3EGDC 3EOIA 3HREA 4G3VA 4U0XA 4KZBA 3MJQA 4B4ZA 4E3KA 2XR0A 5D3OA 3VOZA 4HJ4A 3IWOA 3BQAA 3IF6B 3PBTA 3SS3A 3O87A 4DXCA 3F1OB 5TJJA 1ZG4A 4Q0HA 3BQ8A 1PFLA 3NDEA 2OWHA 3A3DA 2VGLM 3CPTA 4P0MA 4MN5A 3SW1A 4R6LA 1W8QA 5CGXA 3MKEA 1FIKA 4LV3A 1SKFA 4ZJ2A 1OTIA 3N4IA 4D60A 3H9WA 1K54A 3T4OA 4E3IA 5HWVA 3WWXA 4R4SA 4E3MA 3HCYA 1S1ZA 4OQ0A 3BW6A 3ZNYA 2IWCA 1NLYA 2IA2A 3IHAA 4OOYA 5I94A 2EX9A 1STZA 2FZ0A 3BYDA 2X71A 3V5MA 3SS4A 4R3AA 4L9EA 3UY6A 5CHUA 1UWNX 3CWFA 3LR4A 3NDGA 5A90A 3RH8B 4NXGA 5GHXA 1QMEA 2JBFA 4E04A 2QPNA 3M2KA 3UNWA 3LO7A 3GV9A 1ES5A 4CPKA 5IS1A 2WKPA 4QD4A 3HL9A 3PBSA 4CLCC 4E3OA 1MKMA 3IF6A 3B42A 4DXBA 4DDYA 1FILA 3C2WA 3UMEA 3JPUA 3F1OA 5BOHA 1OTEA 5AVFA 1E4DA 3HLDA 5FQ9A 1VM1A 2DRWA 2ACGA 4JXWA 1DJBA 1K56D 2QYBA 2EFXA 1K4FA 2I9VA 3ZDJA 2E8JA 4RX2A 1PW1A 1TEMA 3ZNTA 3A0VA 2O9AA 2JKTM 2EXBA 2JC7A 2ZM8A 1PWGA 1L2SA 2H10A 4WM9A 2V1AA 4F3LA 1S1YA 5L07A 4Q0JA 1SKOA 3UE3A 5CTMA 1ZKJA 4JXSA 5HX9A 5CERA 4JF5A 1LSWA 4ZRRA 1HTZA 3HLBA 1PI4A 4EETB 2QJ5A 3PBQA 3GECA 3N8RA 2PHYA 3EQVA 3HJKA 4QY6A 1ONGA 1PZOA 1LT0A 1M40A 4HP4A 2QHKA 3SH7A 1FSWA 1V9ZA 2B5RA 2B95A 1K55C 4FSFA 1OJGA 2RL3A 2VV8A 2IWDA 1BT5A 4R3JA 5EVLA 3NOPC 3IH9A 4KG6A 5FQKA 5L09A 3GR2A 4BLMA 3A3FA 5DFXA 3S1YA 3IWQA 4X1MA 1GHIA 1XFQA 4QPRA 5DKKA 4KZAA 1T18A 3M6BA 1K6RA 3WS5A 2HJEA 1MWRA 1KE4A 5TGFA 3IWIA 3D4FA 4EBNA 1S4SA 2Y55A 1QMFA 4GHIA 3BY9A 4B88A 2OLUA 2PBDP 2KOIA 4NKPA 4GW9A 3UDIA 3R7WB 3MZFA 4LV2A 1VETB 3NOUC 4X6TA 4BJPA 2ZD8A 2O99A 1JTGA 3ZG5A 3PAEA 1DP6A 5HSQA 4MN6A 4IUKA 2D01A 4DE2A 3C38A 2W27A 3F1NB 4HQAA 5A93A 1W8YA 1G68A 2K2NA 4ARZB 5FDHA 3WRZA 2Y8HA 1NXYA 5AVEA 3B33A 4IJGA 1L0GA 2HPBA 4IHQA 4PKYA 3H82B 4IEDA 5DTTA 1BLSA 3SS5A 3MR0A 2J3TD 4GJ4A 1ZG6A 3FPWA 1F5MA 3LYXA 2Y2JA 3W2ZA 4H6JB 4ZTKA 4DJ2A 3ZVWA 5FASA 2ZC5B 3NOTC 1JWPA 3RFBA 1N9BA 3AGFA 3CHWP 1NZUA 1L0DA 1IYPA 1MC0A 5E43A 4PHTA 4LV1A 5M18A 2EFUA 4GNUA 4G3WA 2VGJA 5E2GA 3TOIA 4S2KA 2J7VA 4NETA 5CRFA 5IT5A 5DFYA 3ZG7B 5GLCA 2ZLYA 1EWZA 1NRFA 5CGWA 4DRTA 2FFFB 3PYPA 4Y0TA 4FH2A 5IHVA 4DE1A 3ISGA 1IFQA 1IYOA 1AXBA 4GLQA 5EOOA 4BD0A 3OPHA 5M19A 2V8FA 5CXWA 3DWZA 4WZ4A 3R7WA 4OP8A 2PRFA 3CI6A 3OOVA 3TSGA 4Y5FA 3DTKA 5CTNA 5KSHA 2Z2MB 3KSIA 5J3WA 2V2FF 3QP4A 2Y2KA 3BFDA 3IS2B 3M6HA 1IOUA 1ZTUA 3RXWA 4R4RA 1Z09A 1ODVA 3F1NA 4FD8A 4ARZA 2PR6A 3UB8A 2Y2NA 1GA9A 1PIOA 5TR7A 2QKPA 3NULA 3H7WB 3HUOA 4ZDXA 2X02A 3LIBA 1W63M 5F1FA 4L9FA 2P08A 1K0KA 3PR6A 1XJ4A 2HDQA 1TDGA 2OSUA 3GDIA 1K4EA 2O0YA 2UV0E 5HAIA 4KZ4A 2YKFA 1F2KA 1IYSA 5A8BA 2WKRA 3V3RA 2JKTI 1SZVA 4CJNA 3IBJA 2Y4AA 1OT9A 4XUZA 1YT4A 1YKDA 1UGUA 2ZQAA 3Q7ZA 3N8LA 1XJ2A 3OPRA 3QP8A 3ZHHA 1YLZA 2XD1A 3O5YA 5EVID 3T4QA 5J4EA 3CITA 3P01A 4U0TA 4EV4A 1I2SA 3C4OA 3D9YA 5FQJA 3UB5P 4QJGA 3NIAA 4JLFA 2Y2IA 1E3UA 4I39A 3MXSA 1RGYA 4GS9B 1VQQA 4O7DA 1MXOA 1CK3A 1MWTA 3ZVTA 3LR0A 1S66L 5FEGA 4L0LA 3HVFA 5HFOA 4AFIA 2HP9A 3UB6A 3HLFA 3KSHA 4X53A 1K57C 4YOFA 3JYIA 4IVIA 4JPMA 2GX5A 2J8YA 2JKFA 4FOFA 1YM1A 3MBZA 4QWOA 2ZQ7A 2I72A 2ZBBA 1ZHHB 4ZAMA 2J9OA 4R23A 5K5BA 4I3AA 4LPZA 1T1BA 4N1XA 1ERMA 1JWZA 3H7WA 5CHMA 3BFCA 3E98A 4ZJ3A 1YLPA 4X68A 3MZDA 4MLLA 3R4KA 4Y2FA 4S2OA 1FSYA 1O07A 5DJTA 4JBFA 2RCXA 5FDSA 1J3WA 5EECA 4OONA 3IT9A 1XJ6A 1P9WA
chains in the Genus database with same CATH topology
5HD3A 3PBSA 1VB6A 4P6ZM 4CLCC 3VE4A 1OTAA 2J3WA 1MKMA 3P7NA 5J7EA 3B42A 3UB9A 1OTBA 3C2WA 3H82A 3UMEA 4NXEA 5TBMA 4CLCA 3F1OA 3MMHA 2Z6CA 2P7JA 2O9BA 2H28A 2W3DA 1OTEA 3G6OA 5DJUA 4GCZA 5AVFA 4HP9A 4WL9A 4H6JA 4PKYG 2L1MA 3EWKA 3LIAA 5DKLA 2V1BA 3K3CA 3T4SA 2QYBA 3F1PB 5DF9A 4Z1WA 3OBFA 2KX6A 4HNBA 3C8CA 2LB5A 2I9VA 3C30A 3A0RA 2INWA 5C5KA 2P04A 3VV4A 3KX0X 1P0ZA 1GSWA 1G28A 2K7SA 3LUQA 4KUOA 3A0VA 2HJ9C 2O9AA 2JKTM 3S7OA 1TD5A 3LIFA 2L0WA 4DN0A 4GS9A 4YNRA 4UQIM 3CLOA 1TS8A 2V1AA 4F3LA 1S1YA 4Q0JA 3LI8A 4NXFA 1OTDA 3UE3A 4CLCD 2JKRM 2W0NA 1OJ5A 1Y28A 5AJGA 2Y79A 3MQOA 4RQ9A 3S7QA 1LSWA 4ZRRA 4EETB 3MQQA 2QJ5A 3PBQA 3GECA 5FL3A 2PHYA 3EQVA 3HJKA 3KO6A 2VV6A 5L8MA 2ZOHA 5CX7A 4WELA 2B18A 2GNXA 2PR5A 5F5YA 2Z6DA 2PYPA 1LT0A 4L9GA 1S4RA 4HP4A 2QHKA 2B02A 1VHMA 4OOMA 1MZUA 3LR3A 3U2AA 3LFVA 4O0PA 2VJWA 1DP9A 2KDKA 3EEAA 1V9ZA 3IS2A 1TS7A 5HL6A 1H3QA 1YSQA 4FSFA 3IBRA 4BMWA 2A24B 2VLGA 1OJGA 3NJAA 2VV8A 4XT2B 4I3JA 3NOPC 5HWWA 4YWZA 5HPFA 2JHEA 2V9AA 2A2LA 2W1TB 4JGQA 2LB9A 3KYQA 2OOLA 5DFXA 2PD7A 5HPIA 1XFQA 2DMWA 4QPRA 5DKKA 1T18A 2HJEA 1TS6A 1N9LA 3TJZC 1S4SA 2MJ6A 4GHIA 3BY9A 4BBUA 2KLIA 2GJ3A 2J3TC 3F1PA 3K2NA 2KOIA 2HV1A 4NKPA 3CAXA 4GW9A 2EWWA 1WA9A 3UMDA 4HJ3A 5I5LA 3R7WB 4HOIA 2FH5A 2J80A 3LR5A 2VGLS 4M4XA 4WN5A 1LSXA 3NOUC 2W3HA 4BJPA 3PHYA 5KIZA 1N9NA 1P97A 3PBRA 4PAUA 4JGRA 2O99A 3EQUA 1DP6A 2HF6A 5HSQA 4MN6A 3OLOA 1N9OA 4IUKA 2D01A 4DJ3A 3C38A 2W27A 3F1NB 4HQAA 1G6OA 4ARZB 2K2NA 4KUKA 4LLOB 3JVVA 1OT6A 3LIEA 2Y8HA 4LRZE 5AVEA 3B33A 3E0YA 5HDDA 5HWTA 2PYRA 3B47A 2XA7M 4IJGA 2NUTC 4KQOA 4IHQA 2VA0A 4PKYA 3H82B 2OWJA 3HJIA 4CLCB 2R78A 4BBTA 2VKSA 2V0UA 3MR0A 2J3TD 3BWLA 2OAP1 4GJ4A 3V67A 2PT7A 1F5MA 2JN7A 3FPWA 4UEYA 3LYXA 1T1AA 3W2ZA 4K08A 4Q0IA 2O9CA 4I38A 3MFXA 4H6JB 4II7A 1D7EA 3D72A 1S67L 2EWVA 4DJ2A 3FC7A 3NOTC 3RFBA 2ZOIA 3OC2A 2VZWA 4HHDA 4CLCE 2M1CA 4R70A 2A24A 4ETXA 2BASA 3RTYA 4EESA 1W63Q 3LIDA 3MXQA 4XT2A 3PBNA 4O8GA 1MC0A 5LBRA 4PHTA 2HGVA 2W1TA 4G3WA 2G7UA 4MMNA 1OPXA 4WLAA 2GZAA 4F3LB 3E4PA 4HIAA 1YSPA 2L4RA 2QJ7A 5IT5A 5MC7A 5DFYA 1P9RA 2W1RA 1LL8A 2W3GA 3PYPA 1T19A 4G3KA 3T4KA 3VE3A 4EUVA 4HI4A 1H8MA 1IFQA 4HY8A 4GLQA 3OCLA 1V9YA 2QWSA 1F98A 4I3IA 3ZQ5A 2VEAA 3R7WA 3ULFA 5F69A 1EW0A 2YKHA 3CI6A 3OOVA 4HJ6A 3NHQA 2W3FA 4Y5FA 1T1CA 5KSHA 5IU1A 3A0SA 1BYWA 2EA9A 3BJNA 4O01A 3JVUA 4LRXC 3KSIA 5J3WA 3IS2B 3TE8A 1LSVA 4EEUA 1DRMA 4MDZA 4UQIS 3T4JA 4BWIA 1ZTUA 2ZMFA 1IOUA 4WEJA 1ODVA 3F1NA 4R38A 3LI9A 2NUPC 4ARZA 2PR6A 3UB8A 1TS0A 2QKPA 3H7WB 2PD8A 4WF0A 1DP8A 4EERA 2OAQ1 3EGXC 3LIBA 1W63M 3E4OA 4L9FA 2P08A 4EEPA 2K31A 3PR6A 4WEKA 1NLZA 4HH3A 1XJ4A 1GSXA 3FPVA 5EFWA 2D02A 4EW7A 1XFNA 3MQ0A 3ZYTA 1XJ3A 3EGDC 3EOIA 3GDIA 4G3VA 2O0YA 3UE6A 2YKFA 3MJQA 5A8BA 2WKRA 2JKTI 4GHIB 3LICA 3PXPA 2WKQA 3IBJA 4EQ1A 4HJ4A 3BQAA 1OT9A 2M7UA 3PBTA 5HDSA 5TBMB 1YKDA 3F1OB 1UGUA 2W3EA 3DBAA 5F68A 1XJ2A 2JKRI 3O5YA 5TJJA 4Q0HA 3T4QA 2XROA 5J4EA 3CITA 3BQ8A 4NEED 4IUHA 4CQHA 3FG8A 4KQDA 3TW8A 2M7VA 3T4TA 3T50A 2OWHA 4OOLA 4Y3IA 3K3DA 3P01A 2ZMVA 3EEHA 1GSVA 2VGLM 4MN5A 3OCNA 2XSSA 1KOUA 4ME4A 4R6LA 3SW1A 3S7PA 4MN7A 4B93A 3D3OA 1UWPX 3UB7A 2XRNA 4MCWA 3PBOA 2CMNA 4I39A 1OTIA 4GS9B 4WUJA 3S7NA 2V0WA 3H9WA 3KSFA 4LRYC 4P6ZS 4I5SA 3LR0A 4NXBA 4ETZA 1S66L 3BY8A 4L0LA 3T4OA 5HWVA 3TRCA 1JNUA 4AFIA 3UB6A 3HCYA 1S1ZA 3KSHA 3BW6A 4YOFA 1NLYA 2IA2A 4JGOA 3T4LA 1STZA 2FZ0A 2GX5A 5HD5A 5HZHA 5G4YA 1NRJA 4FOFA 3ICYA 4EU0A 2PDRA 3KYZA 4R3AA 4L9EA 2ZBBA 1X0OA 3E4QA 1ZHHB 2VV7A 5K5BA 1UWNX 4I3AA 3CWFA 3LR4A 4LPZA 5F6AA 1T1BA 3H7WA 3RH8B 4NXGA 4JGPA 3CUEC 4B9OA 1NWZA 3E98A 4E04A 3MF0A 4BBVA 3R4KA 4EXOA 3KSGA 2VX8A 4HH2A 4Y2FA 3VOLA 3CUEA 4DMZA 1YAXA 5DJTA 1D06A 2XA7S 1F9IA 1TF1A 5HDCA 5IS1A 1XJ6A 5G4ZA 2WKPA 1P9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZW A;  4R70 A;  4ETX A;  3IBJ A;  3NOP C;  5HPF A;  4O8G A;  2M7U A;  1MC0 A;  2W1T B;  5LBR A;  1YKD A;  1MKM A;  2LB9 A;  2HGV A;  3C2W A;  2W3E A;  3DBA A;  2W1T A;  4G3W A;  2G7U A;  3MMH A;  4MMN A;  2OOL A;  5DFX A;  2O9B A;  2W3D A;  3G6O A;  5HPI A;  3O5Y A;  5TJJ A;  4Q0H A;  2XRO A;  3CIT A;  1YSP A;  4QPR A;  4IUH A;  4CQH A;  5DFY A;  2M7V A;  4Y3I A;  2W1R A;  2W3G A;  4G3K A;  2QYB A;  2XSS A;  4ME4 A;  4R6L A;  3S7P A;  4MN7 A;  4Z1W A;  2KLI A;  3OBF A;  4EUV A;  3D3O A;  2LB5 A;  2XRN A;  4MCW A;  3VV4 A;  5C5K A;  3K2N A;  2KOI A;  4GLQ A;  4GW9 A;  3S7O A;  2O9A A;  5I5L A;  1TD5 A;  3S7N A;  3ZQ5 A;  2VEA A;  4DN0 A;  3KSF A;  4LRY C;  4YNR A;  3NOU C;  2W3H A;  3CI6 A;  4ETZ A;  3OOV A;  3NHQ A;  4PAU A;  2W3F A;  4Q0J A;  4Y5F A;  2O99 A;  3TRC A;  3HCY A;  3KSH A;  3BJN A;  4O01 A;  4YOF A;  4LRX C;  5HSQ A;  3KSI A;  2IA2 A;  5AJG A;  2Y79 A;  4RQ9 A;  3S7Q A;  1STZ A;  4ZRR A;  2GX5 A;  4IUK A;  4FOF A;  4MDZ A;  4BWI A;  1ZTU A;  2ZMF A;  4EU0 A;  2K2N A;  3KO6 A;  5L8M A;  2Y8H A;  5K5B A;  4LRZ E;  3E0Y A;  2B18 A;  4IJG A;  1VHM A;  3E98 A;  2K31 A;  4E04 A;  3MF0 A;  2VKS A;  3R4K A;  3LFV A;  4O0P A;  2VJW A;  3KSG A;  4Y2F A;  1F5M A;  3EEA A;  4DMZ A;  3W2Z A;  3MQ0 A;  4Q0I A;  2O9C A;  4G3V A;  2O0Y A;  5HL6 A;  1TF1 A;  1YSQ A;  3IBR A;  3NOT C;  3RFB A; 
#chains in the Genus database with same CATH topology
 4C6Y A;  3HLG A;  4P6Z M;  3VE4 A;  5FI6 A;  1FR6 A;  5J7E A;  3UB9 A;  3W8K A;  4CLC A;  2P7J A;  2H28 A;  2W3D A;  5DJU A;  4GCZ A;  1EI5 A;  4HP9 A;  3M2J A;  3IX3 A;  5HW3 A;  1KE0 A;  3EWK A;  3LIA A;  3K3C A;  3IH8 A;  5DF9 A;  4HNB A;  3C30 A;  3KX0 X;  3QP2 A;  1P0Z A;  1G28 A;  5CHJ A;  4KUO A;  3QHY A;  4Y7P A;  3DTM A;  1IEM A;  3W4Q A;  4HBU A;  2L0W A;  4GS9 A;  4X25 A;  5FSR A;  3LI8 A;  4NXF A;  3GSG A;  2HDS A;  2JKR M;  1Y28 A;  3S7Q A;  1WYB A;  2H0Y A;  4IBR A;  1Y4O A;  4Y15 A;  1A0K A;  1LLB A;  3O88 A;  3KO6 A;  2VV6 A;  5FQQ A;  2WKH A;  5L8M A;  4NG2 A;  1N4O A;  2B18 A;  4R1G A;  2PR5 A;  1I5Q A;  2PYP A;  4L9G A;  1XGI A;  5HAQ A;  5L2F A;  1PRQ A;  4OOM A;  3UDF A;  3VOY A;  4ZJ1 A;  3U2A A;  4DKI A;  2VJW A;  1H8Y A;  1YMS A;  2ZL1 B;  5JYO A;  2Y2G A;  1BZA A;  1TS7 A;  1H3Q A;  4N9K A;  3NJA A;  3GRJ A;  3C5A A;  1K55 A;  4C75 A;  5FEF A;  4U3T A;  4WMC A;  4Y0U A;  2P9V A;  3U4L P;  2C5W B;  2ZMA A;  5GHY A;  1HD8 A;  3MXR A;  2W1T B;  2ZQC A;  1E25 A;  5EUA A;  4RA7 A;  1DJC A;  5HPI A;  4RX3 A;  2BLS A;  3LGO A;  4PM9 A;  4RYE A;  4BL2 A;  1LHY A;  1MPL A;  3DAV A;  1N9L A;  3IXB A;  2V8C A;  2MJ6 A;  1ERO A;  1W79 A;  2KLI A;  3A3I A;  1DJA A;  1LI0 A;  3CAX A;  2EX8 A;  3UMD A;  3HBR A;  4R0Q A;  5GLA A;  1KVM A;  5F83 A;  2J9P A;  4NK3 A;  2JE5 A;  1LSX A;  3PHY A;  5KIZ A;  4QY5 A;  1P97 A;  1PZP A;  4OQH A;  3BLS A;  3PTE A;  1HZO A;  3OLO A;  3RJU A;  1N9O A;  4P85 A;  4S2I A;  4DJ3 A;  4PM5 A;  1JWV A;  3UPO A;  4KUK A;  2EXA A;  1WYC A;  3E0Y A;  2PYR A;  3T1Q B;  4DE0 A;  2HP5 A;  3VMA A;  1OME A;  1K25 A;  2OWJ A;  5FI2 A;  4HEF A;  3BWL A;  4KZ9 A;  1NYM A;  2PT7 A;  2JN7 A;  4MEZ A;  1T1A A;  2Q9N A;  4Q0I A;  1YMX A;  1BLP A;  3G34 A;  2ZL1 A;  4X1L A;  1HVB A;  4GN2 A;  4GB7 A;  3LCE A;  3Q81 A;  3OC2 A;  2VZW A;  4CLC E;  2M1C A;  1Q2Q A;  2BAS A;  4XXR A;  4OPZ A;  4JF6 A;  3RTY A;  3IXD A;  1KVL A;  1ZC2 A;  3OPL A;  1LL9 A;  2W1T A;  4LEN A;  3A3E A;  4LV0 A;  5E2H A;  2ZQD A;  1OPX A;  4S2N C;  2IWB A;  4LCM A;  2PU2 A;  5AQ7 A;  3NEC A;  3QNB A;  3VSL A;  1CJF A;  1P9R A;  1LL8 A;  1DY6 A;  2OLV A;  5EM0 A;  3AGE A;  4K0X A;  2ZQ8 A;  4I3I A;  2ZM0 A;  4B4X A;  1Z6F A;  4FH4 A;  1W5D A;  4IBX A;  1T1C A;  2A49 A;  5IU1 A;  3A0S A;  2EA9 A;  4O01 A;  4LRX C;  3TE8 A;  4EEU A;  4UQI S;  4BWI A;  2ZMF A;  3L9K A;  4R38 A;  5F82 A;  1FQG A;  3S4X A;  4K91 A;  1TS0 A;  4A5R A;  3C7V A;  2PD8 A;  1FCN A;  1MBL A;  3QP5 A;  3VFH A;  2WZX A;  1NZO A;  2K31 A;  5EM1 A;  1I2W A;  4EBL A;  4EW7 A;  2H5S A;  3MQ0 A;  3ZYT A;  1XJ3 A;  3LEZ A;  2ZQ9 A;  3HLC A;  3IQA A;  3SH8 A;  4PMA A;  3LEQ A;  5G18 A;  5EV0 A;  3PXP A;  2WKQ A;  4LFU A;  2M7U A;  2WGW B;  2W3E A;  3DBA A;  2G2U A;  2WAE A;  2JKR I;  3UE0 A;  4BL3 A;  3QNC A;  1JVJ A;  1S0W A;  4NEE D;  5EVE A;  4CQH A;  3FG8 A;  4KQD A;  3TW8 A;  4EBP A;  1PWD A;  4Y3I A;  3SOI A;  3K3D A;  5GLB A;  2ZMV A;  1ACF A;  3EEH A;  3OCN A;  4MBH A;  2XDM A;  4MN7 A;  4B93 A;  3D3O A;  2ZJ9 A;  2XRN A;  4MCW A;  4Q8I A;  3OPP A;  2CMN A;  3G4P A;  4WUJ A;  3S7N A;  2V0W A;  2XFT A;  3KSF A;  4P6Z S;  4I5S A;  4X56 A;  4E3N A;  3TRC A;  3MZE A;  4Y17 A;  3T4L A;  3FV7 A;  5HD5 A;  5HZH A;  1NRJ A;  3ICY A;  1K57 A;  4EU0 A;  1L0F A;  2PAV P;  3KYZ A;  1MWU A;  2P74 A;  2VV7 A;  1VET A;  1U60 A;  5F6A A;  5F1G A;  3C4P A;  1E3U D;  3CUE C;  4B9O A;  1NWZ A;  4FTX A;  3MF0 A;  4BBV A;  1XKZ A;  2V1Z A;  4EXO A;  5GHZ A;  5GLD A;  4IVK A;  3KSG A;  2VX8 A;  4HH2 A;  4DMZ A;  4M3K A;  1D06 A;  1F9I A;  2DCF A;  5G4Z A;  4X69 A;  4BD1 A;  1VB6 A;  1OTA A;  1MWS A;  2ZM2 A;  2J3W A;  3O3V A;  1OTB A;  1YLT A;  3H82 A;  4NXE A;  1M6K A;  2WUQ A;  3UDX A;  3MMH A;  2O9B A;  3G6O A;  3G31 A;  5FAO A;  4H6J A;  3N8S A;  4PKY G;  1IEL A;  2L1M A;  3C7U A;  5DKL A;  2V1B A;  3MSH A;  4S2L A;  3F1P B;  3OBF A;  5JYP A;  3C8C A;  4KZ6 A;  3LY4 A;  4ZBE A;  2INW A;  5C5K A;  2WKI A;  4PM8 A;  1GSW A;  4P87 A;  1Y54 A;  2HJ9 C;  4R3B A;  3DTI A;  1TD5 A;  2WAF A;  3ZG9 B;  5EVI B;  3DW0 A;  4YNR A;  5U47 A;  4E6W A;  4UQI M;  3CLO A;  1TS8 A;  3PAG A;  3VP4 A;  1BTL A;  2R9X A;  5KMW A;  3B3X A;  4CLC D;  3CJM A;  3ITA A;  4DE3 A;  5AJG A;  2Y79 A;  3MQQ A;  4MNR A;  5FL3 A;  3FKV A;  1RCJ A;  5CED A;  5CX7 A;  3W4P A;  3SZT A;  5F5Y A;  2Z6D A;  2B02 A;  1MZU A;  3LR3 A;  3DTE A;  1XX2 A;  2Y2Q A;  3LFV A;  4O0P A;  1DP9 A;  2KDK A;  3EEA A;  3V3S A;  3IS2 A;  3UO9 A;  5HAR A;  1O7E A;  1NY0 A;  5HL6 A;  1YSQ A;  2A24 B;  3CPT B;  1PNE A;  3V39 A;  4XT2 B;  1XXM A;  5GL9 A;  4YWZ A;  2JHE A;  2V9A A;  1BUL A;  4EQI A;  1ERQ A;  2LB9 A;  4PPR A;  3KYQ A;  4JKT A;  2PD7 A;  1ONH A;  2WZZ A;  4KZ5 A;  3GVB A;  3CMZ A;  1TS6 A;  3TJZ C;  1BUE A;  4BBU A;  3T1X A;  2J3T C;  3F1P A;  5TFQ A;  2XK1 A;  1WA9 A;  1G6A A;  4HJ3 A;  4HOI A;  3VSK A;  3BFG A;  3LR5 A;  1KGE A;  2VGK A;  3T1R A;  4M4X A;  4WMC D;  4BEN A;  2W3H A;  1N9N A;  4PAU A;  4YIN A;  3EQU A;  3G2Y A;  2PU4 A;  4GD8 A;  5EPH A;  3ZG8 B;  2EX6 A;  1KDS A;  4X55 A;  1ES4 A;  3IHB A;  3FYZ A;  2XH9 A;  4DF6 A;  1G6O A;  3AGD A;  4LLO B;  1VEU B;  4H8R A;  3JVV A;  3GQZ A;  2CC1 A;  1OT6 A;  3LIE A;  2UWX A;  2OV5 A;  4E6X A;  1XP4 A;  4UA7 A;  5HDD A;  5HWT A;  4LGW A;  1FCM A;  4FCF A;  2XQZ A;  4KQO A;  5L10 A;  3NCK A;  3HJI A;  2R78 A;  4BBT A;  3IXH A;  2V0U A;  2QMI A;  4UEY A;  4K08 A;  4I38 A;  3MFX A;  1D7E A;  1S67 L;  3W4O A;  2FFY A;  3FC7 A;  4KG5 A;  2X01 A;  1XA7 A;  2A24 A;  3UPN A;  4EES A;  1W63 Q;  3MXQ A;  4XT2 A;  4O8G A;  5FAQ A;  5LBR A;  1FOF A;  3L7H A;  1IKG A;  2WYX A;  4OVD A;  2G7U A;  4MMN A;  2XGN A;  4WLA A;  1TDL A;  2GZA A;  3SH9 A;  3S22 A;  4F3L B;  3E4P A;  4HIA A;  2WAD A;  4S2J A;  2L4R A;  5MC7 A;  1SKO B;  2Y91 A;  3VP2 A;  4S2N A;  4UAA A;  5DF8 A;  3T4K A;  3VE3 A;  3G30 A;  4EUV A;  1H8M A;  3HUN A;  2Y2H A;  4E3J A;  1WE4 A;  1V9Y A;  2QWS A;  2VEA A;  5F69 A;  5HL1 A;  2YKH A;  3Q82 A;  1GCE A;  4HJ6 A;  1XGJ A;  2GDN A;  1BYW A;  3G32 A;  3BJN A;  3Q07 A;  5KZH A;  3NC8 A;  4GKU A;  3BRM A;  5E2E A;  4MBK A;  2XEP A;  1DRM A;  4K0W A;  1JTD A;  4KG2 A;  4MDZ A;  3T4J A;  5EVI C;  4YFM A;  3LI9 A;  1ESI A;  4WZ5 C;  5DVA A;  1VEU A;  5FQM A;  2DNS A;  2JCH A;  2OAQ 1;  3EGX C;  4KEN B;  4OPY A;  3UN7 A;  3E4O A;  4OLG A;  1H0M A;  3HLW A;  4QHC A;  1MKI A;  1NLZ A;  1BSG A;  2HDU A;  2D02 A;  1XFN A;  3QP6 A;  5DTS A;  1YLW A;  3UE6 A;  3P09 A;  3T1S A;  3ZGA B;  2V20 A;  2ZC4 B;  1SCW A;  4GHI B;  3LIC A;  4EQ1 A;  1KGG A;  5A91 A;  1XPB A;  5HDS A;  5TBM B;  3ZG0 A;  1SDE A;  3BM6 A;  5F68 A;  4HES A;  3MFD A;  2XRO A;  2XD5 A;  4QB8 A;  3UPP A;  4IUH A;  2M7V A;  3T4T A;  3T50 A;  1YLJ A;  4OOL A;  5FQI A;  4N1H A;  2Y2L A;  4FUW A;  1GSV A;  2WK0 A;  4N92 A;  2XSS A;  1KOU A;  4ME4 A;  4Y0O A;  3MKF A;  4E3L A;  3S7P A;  1MY8 A;  2Y2O A;  1UWP X;  3UB7 A;  3PBO A;  1K54 C;  1NYY A;  5FI7 A;  2G2W A;  1PYY A;  4PM7 A;  1PI5 A;  3TG9 A;  4BQM A;  3G35 A;  4LRY C;  4NXB A;  4ETZ A;  3BY8 A;  5FA7 A;  1JNU A;  4UA6 A;  1ES2 A;  4KZ7 A;  2ZC6 B;  4JGO A;  3KYE A;  1LI9 A;  1RP5 A;  5G4Y A;  3FZC A;  4D2O A;  1KE3 A;  2PDR A;  1IYQ A;  4OQI A;  1NJ4 A;  1X0O A;  5KSC A;  3E4Q A;  1GHM A;  3E2L A;  1K38 A;  3WS1 A;  3V50 A;  4WYY A;  3MS6 A;  4OQG A;  3Q1F A;  4JGP A;  4OH0 A;  1K56 A;  4RVA A;  3VOL A;  3CUE A;  1G5U A;  1YAX A;  2XA7 S;  3IF5 A;  1TF1 A;  5HDC A;  5EE8 A;  5HD3 A;  3P98 A;  3BEB A;  3IF6 C;  3I7J A;  1L3L A;  1FCO A;  3A3J A;  1KDW A;  3P7N A;  1HLU P;  4P6B A;  4ID4 A;  5TBM A;  2Z6C A;  1CEF A;  3E2K A;  1BLH A;  4GOG A;  1CEG A;  3VP0 A;  4WL9 A;  5AQA A;  4DDS A;  2PBY A;  4PM6 A;  1LL5 A;  3DWK A;  3T4S A;  3GMW A;  4Z1W A;  2KX6 A;  2LB5 A;  1Q2P A;  3A0R A;  3VV4 A;  2P04 A;  2HDR A;  3WRT A;  2K7S A;  3LUQ A;  3S7O A;  4OP5 A;  2Q0O A;  1ES3 A;  1H8Z A;  4ESP A;  3LIF A;  4DN0 A;  1GHP A;  4OPQ A;  5A92 A;  3FKW A;  4MBF A;  3CZD A;  1OTD A;  1C3B A;  4UHU A;  2W0N A;  2A3U A;  1OJ5 A;  1YQS A;  3MQO A;  4RQ9 A;  1H5X A;  3VFF A;  3IX8 A;  1W7F A;  4GZB A;  1PW8 A;  4QU3 A;  4Z9Q A;  2ZOH A;  1K6S A;  4EWF A;  3VP3 A;  3FWL A;  4WEL A;  4GDB A;  2GNX A;  3VP1 A;  3O86 A;  1S4R A;  5E2F A;  1VHM A;  4KQQ A;  1CF0 A;  1S6R A;  2XF3 A;  3IX4 A;  3IBR A;  4BMW A;  1D1J A;  2VLG A;  5CEC A;  1ALQ A;  4I3J A;  3RXX A;  5HWW A;  5HPF A;  2A2L A;  1YLY A;  3NY4 A;  4JGQ A;  4WBG A;  5M1A A;  3NBL A;  2OOL A;  3HUM A;  3ITB A;  1BLC A;  2DMW A;  1SHV A;  1RGZ A;  3QP1 A;  4JXG A;  2Q9M A;  1CQA A;  5CEB A;  4GD6 A;  2GJ3 A;  2BG1 A;  3K2N A;  5FAT A;  2HV1 A;  2EWW A;  5AQB A;  5I5L A;  4KQR A;  2WGW A;  2FH5 A;  2J80 A;  2WGI A;  2VGL S;  4WN5 A;  4LCL A;  1CI9 A;  5CGS A;  3BEC A;  3PBR A;  4JGR A;  2Y59 A;  2XFS A;  2HF6 A;  3BFE A;  4KZ3 A;  2H0T A;  3LY3 A;  1ESU A;  4S2M A;  5HAP A;  3ZCZ A;  4OKP A;  1TVF A;  1YPR A;  2BTF P;  3CG5 A;  3WS0 A;  1XA1 A;  4LRZ E;  3B47 A;  2XA7 M;  3WS4 A;  2NUT C;  2VA0 A;  4CLC B;  4KZ8 A;  2Y2P A;  2VKS A;  2WKE A;  3UE1 A;  4XUX A;  2OAP 1;  3Q7V B;  3V67 A;  2O9C A;  2QZ6 A;  4II7 A;  3D72 A;  2E8I A;  1KGF A;  2EWV A;  2ZOI A;  4S2P A;  2WGV A;  3N6I A;  4HHD A;  4EUZ A;  4HBT A;  4R70 A;  4ETX A;  2JKG A;  5DF7 A;  1L0E A;  3LID A;  3OZH A;  3PBN A;  5EOE A;  2HGV A;  5DTK A;  4N9L A;  4F94 A;  3WS2 A;  3HLE A;  1IKI A;  1SDN A;  4C3Q A;  1YSP A;  2QJ7 A;  1CI8 A;  2W1R A;  2W3G A;  1T19 A;  4G3K A;  1J9M A;  2VK3 A;  4HI4 A;  2XLN A;  2EX2 A;  3G2Z A;  4HY8 A;  3BFF A;  2Z2L B;  3OCL A;  2HZ5 A;  1F98 A;  2Y2M A;  4Y13 A;  3ZQ5 A;  2AVX A;  3ULF A;  1EW0 A;  3GTC A;  3NI9 A;  3NHQ A;  2W3F A;  2R9W A;  1FR1 A;  4OPR A;  3JVU A;  2C6W B;  4JXV A;  1LSV A;  3T12 B;  4UA9 A;  1PWC A;  2HP6 A;  4WEJ A;  4OLD A;  2ZC3 B;  2NUP C;  2ZC7 A;  2P9V B;  5EVI A;  4WF0 A;  4JF4 A;  1DP8 A;  4EER A;  4WZ5 A;  5J8X A;  4GDN A;  1GA0 A;  1AWI A;  4EEP A;  3ZFZ A;  3IXG A;  5FAP A;  4WEK A;  4HH3 A;  5AQ9 A;  1GSX A;  3FPV A;  5EFW A;  3N7W A;  3Q7V A;  3BLM A;  3EGD C;  3EOI A;  3HRE A;  4G3V A;  4U0X A;  4KZB A;  3MJQ A;  4B4Z A;  4E3K A;  2XR0 A;  5D3O A;  3VOZ A;  4HJ4 A;  3IWO A;  3BQA A;  3IF6 B;  3PBT A;  3SS3 A;  3O87 A;  4DXC A;  3F1O B;  5TJJ A;  1ZG4 A;  4Q0H A;  3BQ8 A;  1PFL A;  3NDE A;  2OWH A;  3A3D A;  2VGL M;  3CPT A;  4P0M A;  4MN5 A;  3SW1 A;  4R6L A;  1W8Q A;  5CGX A;  3MKE A;  1FIK A;  4LV3 A;  1SKF A;  4ZJ2 A;  1OTI A;  3N4I A;  4D60 A;  3H9W A;  1K54 A;  3T4O A;  4E3I A;  5HWV A;  3WWX A;  4R4S A;  4E3M A;  3HCY A;  1S1Z A;  4OQ0 A;  3BW6 A;  3ZNY A;  2IWC A;  1NLY A;  2IA2 A;  3IHA A;  4OOY A;  5I94 A;  2EX9 A;  1STZ A;  2FZ0 A;  3BYD A;  2X71 A;  3V5M A;  3SS4 A;  4R3A A;  4L9E A;  3UY6 A;  5CHU A;  1UWN X;  3CWF A;  3LR4 A;  3NDG A;  5A90 A;  3RH8 B;  4NXG A;  5GHX A;  1QME A;  2JBF A;  4E04 A;  2QPN A;  3M2K A;  3UNW A;  3LO7 A;  3GV9 A;  1ES5 A;  4CPK A;  5IS1 A;  2WKP A;  4QD4 A;  3HL9 A;  3PBS A;  4CLC C;  4E3O A;  1MKM A;  3IF6 A;  3B42 A;  4DXB A;  4DDY A;  1FIL A;  3C2W A;  3UME A;  3JPU A;  3F1O A;  5BOH A;  1OTE A;  5AVF A;  1E4D A;  3HLD A;  5FQ9 A;  1VM1 A;  2DRW A;  2ACG A;  4JXW A;  1DJB A;  1K56 D;  2QYB A;  2EFX A;  1K4F A;  2I9V A;  3ZDJ A;  2E8J A;  4RX2 A;  1PW1 A;  1TEM A;  3ZNT A;  3A0V A;  2O9A A;  2JKT M;  2EXB A;  2JC7 A;  2ZM8 A;  1PWG A;  1L2S A;  2H10 A;  4WM9 A;  2V1A A;  4F3L A;  1S1Y A;  5L07 A;  4Q0J A;  1SKO A;  3UE3 A;  5CTM A;  1ZKJ A;  4JXS A;  5HX9 A;  5CER A;  4JF5 A;  1LSW A;  4ZRR A;  1HTZ A;  3HLB A;  1PI4 A;  4EET B;  2QJ5 A;  3PBQ A;  3GEC A;  3N8R A;  2PHY A;  3EQV A;  3HJK A;  4QY6 A;  1ONG A;  1PZO A;  1LT0 A;  1M40 A;  4HP4 A;  2QHK A;  3SH7 A;  1FSW A;  1V9Z A;  2B5R A;  2B95 A;  1K55 C;  4FSF A;  1OJG A;  2RL3 A;  2VV8 A;  2IWD A;  1BT5 A;  4R3J A;  5EVL A;  3NOP C;  3IH9 A;  4KG6 A;  5FQK A;  5L09 A;  3GR2 A;  4BLM A;  3A3F A;  5DFX A;  3S1Y A;  3IWQ A;  4X1M A;  1GHI A;  1XFQ A;  4QPR A;  5DKK A;  4KZA A;  1T18 A;  3M6B A;  1K6R A;  3WS5 A;  2HJE A;  1MWR A;  1KE4 A;  5TGF A;  3IWI A;  3D4F A;  4EBN A;  1S4S A;  2Y55 A;  1QMF A;  4GHI A;  3BY9 A;  4B88 A;  2OLU A;  2PBD P;  2KOI A;  4NKP A;  4GW9 A;  3UDI A;  3R7W B;  3MZF A;  4LV2 A;  1VET B;  3NOU C;  4X6T A;  4BJP A;  2ZD8 A;  2O99 A;  1JTG A;  3ZG5 A;  3PAE A;  1DP6 A;  5HSQ A;  4MN6 A;  4IUK A;  2D01 A;  4DE2 A;  3C38 A;  2W27 A;  3F1N B;  4HQA A;  5A93 A;  1W8Y A;  1G68 A;  2K2N A;  4ARZ B;  5FDH A;  3WRZ A;  2Y8H A;  1NXY A;  5AVE A;  3B33 A;  4IJG A;  1L0G A;  2HPB A;  4IHQ A;  4PKY A;  3H82 B;  4IED A;  5DTT A;  1BLS A;  3SS5 A;  3MR0 A;  2J3T D;  4GJ4 A;  1ZG6 A;  3FPW A;  1F5M A;  3LYX A;  2Y2J A;  3W2Z A;  4H6J B;  4ZTK A;  4DJ2 A;  3ZVW A;  5FAS A;  2ZC5 B;  3NOT C;  1JWP A;  3RFB A;  1N9B A;  3AGF A;  3CHW P;  1NZU A;  1L0D A;  1IYP A;  1MC0 A;  5E43 A;  4PHT A;  4LV1 A;  5M18 A;  2EFU A;  4GNU A;  4G3W A;  2VGJ A;  5E2G A;  3TOI A;  4S2K A;  2J7V A;  4NET A;  5CRF A;  5IT5 A;  5DFY A;  3ZG7 B;  5GLC A;  2ZLY A;  1EWZ A;  1NRF A;  5CGW A;  4DRT A;  2FFF B;  3PYP A;  4Y0T A;  4FH2 A;  5IHV A;  4DE1 A;  3ISG A;  1IFQ A;  1IYO A;  1AXB A;  4GLQ A;  5EOO A;  4BD0 A;  3OPH A;  5M19 A;  2V8F A;  5CXW A;  3DWZ A;  4WZ4 A;  3R7W A;  4OP8 A;  2PRF A;  3CI6 A;  3OOV A;  3TSG A;  4Y5F A;  3DTK A;  5CTN A;  5KSH A;  2Z2M B;  3KSI A;  5J3W A;  2V2F F;  3QP4 A;  2Y2K A;  3BFD A;  3IS2 B;  3M6H A;  1IOU A;  1ZTU A;  3RXW A;  4R4R A;  1Z09 A;  1ODV A;  3F1N A;  4FD8 A;  4ARZ A;  2PR6 A;  3UB8 A;  2Y2N A;  1GA9 A;  1PIO A;  5TR7 A;  2QKP A;  3NUL A;  3H7W B;  3HUO A;  4ZDX A;  2X02 A;  3LIB A;  1W63 M;  5F1F A;  4L9F A;  2P08 A;  1K0K A;  3PR6 A;  1XJ4 A;  2HDQ A;  1TDG A;  2OSU A;  3GDI A;  1K4E A;  2O0Y A;  2UV0 E;  5HAI A;  4KZ4 A;  2YKF A;  1F2K A;  1IYS A;  5A8B A;  2WKR A;  3V3R A;  2JKT I;  1SZV A;  4CJN A;  3IBJ A;  2Y4A A;  1OT9 A;  4XUZ A;  1YT4 A;  1YKD A;  1UGU A;  2ZQA A;  3Q7Z A;  3N8L A;  1XJ2 A;  3OPR A;  3QP8 A;  3ZHH A;  1YLZ A;  2XD1 A;  3O5Y A;  5EVI D;  3T4Q A;  5J4E A;  3CIT A;  3P01 A;  4U0T A;  4EV4 A;  1I2S A;  3C4O A;  3D9Y A;  5FQJ A;  3UB5 P;  4QJG A;  3NIA A;  4JLF A;  2Y2I A;  1E3U A;  4I39 A;  3MXS A;  1RGY A;  4GS9 B;  1VQQ A;  4O7D A;  1MXO A;  1CK3 A;  1MWT A;  3ZVT A;  3LR0 A;  1S66 L;  5FEG A;  4L0L A;  3HVF A;  5HFO A;  4AFI A;  2HP9 A;  3UB6 A;  3HLF A;  3KSH A;  4X53 A;  1K57 C;  4YOF A;  3JYI A;  4IVI A;  4JPM A;  2GX5 A;  2J8Y A;  2JKF A;  4FOF A;  1YM1 A;  3MBZ A;  4QWO A;  2ZQ7 A;  2I72 A;  2ZBB A;  1ZHH B;  4ZAM A;  2J9O A;  4R23 A;  5K5B A;  4I3A A;  4LPZ A;  1T1B A;  4N1X A;  1ERM A;  1JWZ A;  3H7W A;  5CHM A;  3BFC A;  3E98 A;  4ZJ3 A;  1YLP A;  4X68 A;  3MZD A;  4MLL A;  3R4K A;  4Y2F A;  4S2O A;  1FSY A;  1O07 A;  5DJT A;  4JBF A;  2RCX A;  5FDS A;  1J3W A;  5EEC A;  4OON A;  3IT9 A;  1XJ6 A;  1P9W A; 
#chains in the Genus database with same CATH homology
 5HD3 A;  3PBS A;  1VB6 A;  4P6Z M;  4CLC C;  3VE4 A;  1OTA A;  2J3W A;  1MKM A;  3P7N A;  5J7E A;  3B42 A;  3UB9 A;  1OTB A;  3C2W A;  3H82 A;  3UME A;  4NXE A;  5TBM A;  4CLC A;  3F1O A;  3MMH A;  2Z6C A;  2P7J A;  2O9B A;  2H28 A;  2W3D A;  1OTE A;  3G6O A;  5DJU A;  4GCZ A;  5AVF A;  4HP9 A;  4WL9 A;  4H6J A;  4PKY G;  2L1M A;  3EWK A;  3LIA A;  5DKL A;  2V1B A;  3K3C A;  3T4S A;  2QYB A;  3F1P B;  5DF9 A;  4Z1W A;  3OBF A;  2KX6 A;  4HNB A;  3C8C A;  2LB5 A;  2I9V A;  3C30 A;  3A0R A;  2INW A;  5C5K A;  2P04 A;  3VV4 A;  3KX0 X;  1P0Z A;  1GSW A;  1G28 A;  2K7S A;  3LUQ A;  4KUO A;  3A0V A;  2HJ9 C;  2O9A A;  2JKT M;  3S7O A;  1TD5 A;  3LIF A;  2L0W A;  4DN0 A;  4GS9 A;  4YNR A;  4UQI M;  3CLO A;  1TS8 A;  2V1A A;  4F3L A;  1S1Y A;  4Q0J A;  3LI8 A;  4NXF A;  1OTD A;  3UE3 A;  4CLC D;  2JKR M;  2W0N A;  1OJ5 A;  1Y28 A;  5AJG A;  2Y79 A;  3MQO A;  4RQ9 A;  3S7Q A;  1LSW A;  4ZRR A;  4EET B;  3MQQ A;  2QJ5 A;  3PBQ A;  3GEC A;  5FL3 A;  2PHY A;  3EQV A;  3HJK A;  3KO6 A;  2VV6 A;  5L8M A;  2ZOH A;  5CX7 A;  4WEL A;  2B18 A;  2GNX A;  2PR5 A;  5F5Y A;  2Z6D A;  2PYP A;  1LT0 A;  4L9G A;  1S4R A;  4HP4 A;  2QHK A;  2B02 A;  1VHM A;  4OOM A;  1MZU A;  3LR3 A;  3U2A A;  3LFV A;  4O0P A;  2VJW A;  1DP9 A;  2KDK A;  3EEA A;  1V9Z A;  3IS2 A;  1TS7 A;  5HL6 A;  1H3Q A;  1YSQ A;  4FSF A;  3IBR A;  4BMW A;  2A24 B;  2VLG A;  1OJG A;  3NJA A;  2VV8 A;  4XT2 B;  4I3J A;  3NOP C;  5HWW A;  4YWZ A;  5HPF A;  2JHE A;  2V9A A;  2A2L A;  2W1T B;  4JGQ A;  2LB9 A;  3KYQ A;  2OOL A;  5DFX A;  2PD7 A;  5HPI A;  1XFQ A;  2DMW A;  4QPR A;  5DKK A;  1T18 A;  2HJE A;  1TS6 A;  1N9L A;  3TJZ C;  1S4S A;  2MJ6 A;  4GHI A;  3BY9 A;  4BBU A;  2KLI A;  2GJ3 A;  2J3T C;  3F1P A;  3K2N A;  2KOI A;  2HV1 A;  4NKP A;  3CAX A;  4GW9 A;  2EWW A;  1WA9 A;  3UMD A;  4HJ3 A;  5I5L A;  3R7W B;  4HOI A;  2FH5 A;  2J80 A;  3LR5 A;  2VGL S;  4M4X A;  4WN5 A;  1LSX A;  3NOU C;  2W3H A;  4BJP A;  3PHY A;  5KIZ A;  1N9N A;  1P97 A;  3PBR A;  4PAU A;  4JGR A;  2O99 A;  3EQU A;  1DP6 A;  2HF6 A;  5HSQ A;  4MN6 A;  3OLO A;  1N9O A;  4IUK A;  2D01 A;  4DJ3 A;  3C38 A;  2W27 A;  3F1N B;  4HQA A;  1G6O A;  4ARZ B;  2K2N A;  4KUK A;  4LLO B;  3JVV A;  1OT6 A;  3LIE A;  2Y8H A;  4LRZ E;  5AVE A;  3B33 A;  3E0Y A;  5HDD A;  5HWT A;  2PYR A;  3B47 A;  2XA7 M;  4IJG A;  2NUT C;  4KQO A;  4IHQ A;  2VA0 A;  4PKY A;  3H82 B;  2OWJ A;  3HJI A;  4CLC B;  2R78 A;  4BBT A;  2VKS A;  2V0U A;  3MR0 A;  2J3T D;  3BWL A;  2OAP 1;  4GJ4 A;  3V67 A;  2PT7 A;  1F5M A;  2JN7 A;  3FPW A;  4UEY A;  3LYX A;  1T1A A;  3W2Z A;  4K08 A;  4Q0I A;  2O9C A;  4I38 A;  3MFX A;  4H6J B;  4II7 A;  1D7E A;  3D72 A;  1S67 L;  2EWV A;  4DJ2 A;  3FC7 A;  3NOT C;  3RFB A;  2ZOI A;  3OC2 A;  2VZW A;  4HHD A;  4CLC E;  2M1C A;  4R70 A;  2A24 A;  4ETX A;  2BAS A;  3RTY A;  4EES A;  1W63 Q;  3LID A;  3MXQ A;  4XT2 A;  3PBN A;  4O8G A;  1MC0 A;  5LBR A;  4PHT A;  2HGV A;  2W1T A;  4G3W A;  2G7U A;  4MMN A;  1OPX A;  4WLA A;  2GZA A;  4F3L B;  3E4P A;  4HIA A;  1YSP A;  2L4R A;  2QJ7 A;  5IT5 A;  5MC7 A;  5DFY A;  1P9R A;  2W1R A;  1LL8 A;  2W3G A;  3PYP A;  1T19 A;  4G3K A;  3T4K A;  3VE3 A;  4EUV A;  4HI4 A;  1H8M A;  1IFQ A;  4HY8 A;  4GLQ A;  3OCL A;  1V9Y A;  2QWS A;  1F98 A;  4I3I A;  3ZQ5 A;  2VEA A;  3R7W A;  3ULF A;  5F69 A;  1EW0 A;  2YKH A;  3CI6 A;  3OOV A;  4HJ6 A;  3NHQ A;  2W3F A;  4Y5F A;  1T1C A;  5KSH A;  5IU1 A;  3A0S A;  1BYW A;  2EA9 A;  3BJN A;  4O01 A;  3JVU A;  4LRX C;  3KSI A;  5J3W A;  3IS2 B;  3TE8 A;  1LSV A;  4EEU A;  1DRM A;  4MDZ A;  4UQI S;  3T4J A;  4BWI A;  1ZTU A;  2ZMF A;  1IOU A;  4WEJ A;  1ODV A;  3F1N A;  4R38 A;  3LI9 A;  2NUP C;  4ARZ A;  2PR6 A;  3UB8 A;  1TS0 A;  2QKP A;  3H7W B;  2PD8 A;  4WF0 A;  1DP8 A;  4EER A;  2OAQ 1;  3EGX C;  3LIB A;  1W63 M;  3E4O A;  4L9F A;  2P08 A;  4EEP A;  2K31 A;  3PR6 A;  4WEK A;  1NLZ A;  4HH3 A;  1XJ4 A;  1GSX A;  3FPV A;  5EFW A;  2D02 A;  4EW7 A;  1XFN A;  3MQ0 A;  3ZYT A;  1XJ3 A;  3EGD C;  3EOI A;  3GDI A;  4G3V A;  2O0Y A;  3UE6 A;  2YKF A;  3MJQ A;  5A8B A;  2WKR A;  2JKT I;  4GHI B;  3LIC A;  3PXP A;  2WKQ A;  3IBJ A;  4EQ1 A;  4HJ4 A;  3BQA A;  1OT9 A;  2M7U A;  3PBT A;  5HDS A;  5TBM B;  1YKD A;  3F1O B;  1UGU A;  2W3E A;  3DBA A;  5F68 A;  1XJ2 A;  2JKR I;  3O5Y A;  5TJJ A;  4Q0H A;  3T4Q A;  2XRO A;  5J4E A;  3CIT A;  3BQ8 A;  4NEE D;  4IUH A;  4CQH A;  3FG8 A;  4KQD A;  3TW8 A;  2M7V A;  3T4T A;  3T50 A;  2OWH A;  4OOL A;  4Y3I A;  3K3D A;  3P01 A;  2ZMV A;  3EEH A;  1GSV A;  2VGL M;  4MN5 A;  3OCN A;  2XSS A;  1KOU A;  4ME4 A;  4R6L A;  3SW1 A;  3S7P A;  4MN7 A;  4B93 A;  3D3O A;  1UWP X;  3UB7 A;  2XRN A;  4MCW A;  3PBO A;  2CMN A;  4I39 A;  1OTI A;  4GS9 B;  4WUJ A;  3S7N A;  2V0W A;  3H9W A;  3KSF A;  4LRY C;  4P6Z S;  4I5S A;  3LR0 A;  4NXB A;  4ETZ A;  1S66 L;  3BY8 A;  4L0L A;  3T4O A;  5HWV A;  3TRC A;  1JNU A;  4AFI A;  3UB6 A;  3HCY A;  1S1Z A;  3KSH A;  3BW6 A;  4YOF A;  1NLY A;  2IA2 A;  4JGO A;  3T4L A;  1STZ A;  2FZ0 A;  2GX5 A;  5HD5 A;  5HZH A;  5G4Y A;  1NRJ A;  4FOF A;  3ICY A;  4EU0 A;  2PDR A;  3KYZ A;  4R3A A;  4L9E A;  2ZBB A;  1X0O A;  3E4Q A;  1ZHH B;  2VV7 A;  5K5B A;  1UWN X;  4I3A A;  3CWF A;  3LR4 A;  4LPZ A;  5F6A A;  1T1B A;  3H7W A;  3RH8 B;  4NXG A;  4JGP A;  3CUE C;  4B9O A;  1NWZ A;  3E98 A;  4E04 A;  3MF0 A;  4BBV A;  3R4K A;  4EXO A;  3KSG A;  2VX8 A;  4HH2 A;  4Y2F A;  3VOL A;  3CUE A;  4DMZ A;  1YAX A;  5DJT A;  1D06 A;  2XA7 S;  1F9I A;  1TF1 A;  5HDC A;  5IS1 A;  1XJ6 A;  5G4Z A;  2WKP A;  1P9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...