3KSXA

The alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
b'AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
total genus 95
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA02
5DEXA 3GZGA 4KI0E 1N84A 3JYRA 5IKBA 2XX8A 4OFLA 1DMBA 3U8QA 2VOZA 2F97A 5F7VA 1MY1A 3OEMA 4XKQA 2ABHA 1POTA 1M5CA 5CRYA 4IGTA 4OERA 1RYOA 2ZNTA 3K6XA 1B51A 2HCAA 1A7LA 1LB9A 3PPNA 4IGRA 1OMPA 5I59A 2R71A 3CFLA 1BP5A 3OO8A 4JXIA 3S9EA 4KQPA 3PV0E 3PUWE 4OEUA 3GXAA 3T9VA 5JTYB 4HS7A 2QS1A 1FQEA 4R74A 4GD5A 4TLLB 4GXSB 1SW4A 1SQYA 1URGA 2O69A 3W9WA 1OLCA 3S9LC 3HSTA 3KOSA 1A8EA 4XKRA 4G8MA 3TODA 4LUBA 1UIVA 2ZMBA 4G8NA 3O6GA 3VLUA 2ZYMA 3T96B 3C33A 1Y1ZA 4F29A 3TTLA 3MPKA 1MPDA 4ND9A 1Y4TA 3KN3A 2AL4A 1UTHA 1MXUA 3IOTA 3MUQA 5DVJA 2AYSA 4GF8A 1B7HA 3KGCA 1M5BA 1NMUA 3EF7A 3I5OA 5DTBA 4JWXA 4PQJA 1IXCA 4WEPA 1Y3QA 3MVYA 1WODA 3M3FA 3K1MA 2REJA 1LB8A 3OSQA 1B3LA 1TFDA 1SW5A 1UTBB 3UP9A 3ONMA 2XX9A 1H44A 4TQUQ 4YMAA 4ECFA 4DDDA 3LSFB 1QJMA 4U4SA 1P1UA 3PU5A 3PUYE 5H8QB 3G3KA 1JW4A 3O9PA 3M3LA 1TT1A 2Z22A 1N3WA 4DXUA 2CMOA 4BDNA 1XVYA 4RK9A 3TDJA 4RJZA 3A3CA 1LFIA 1DTGA 4Q8RA 4IO6A 3TZAA 3RT6B 2ZYOA 2DE4A 1SYIA 3S9MC 2DSFA 4BLAA 1ZKBA 1JNFA 2OWSA 3MW0A 4U21A 2A5TA 3TCFA 1UIUA 1Z7NE 4H65A 1UTBA 2W7YA 3KSJA 1R9QA 2XXUA 4EQBA 1A54A 4C1UA 1B3HA 1J1NA 1OIBA 2OWTA 2RCAA 2XXYA 3KJTA 3C32A 4XXUA 3MVZA 5H8QA 1B1XA 3CFZA 4FEDA 1IXHA 1GTKA 3OENA 2ONSA 1GGGA 4F31B 2I58A 3K6WA 4N13A 4X48A 3KJ7A 4RK2A 2QMXA 3PUVE 4G68A 4ZZEA 3VDFA 4QSEA 2X7PA 1PDAA 3FVKA 2YJPA 3VVEA 3RTFB 1JETA 3UORA 3PD9A 3ECRA 3W15C 4NF6B 4PFWA 4QSDA 2GHAA 2XXPA 4ONYA 4I62A 5AE4A 3HHFA 2ONRA 2NUVA 3TKDA 2UVJA 4FATA 4Z0IA 4LZ5A 3MJNA 3CR9A 1FQAA 3ILUB 2QS4A 4JDFA 4OFOA 3IB0A 3PPOA 5TU0A 3MBPA 1IEJA 2ZXTA 2XXRA 4DLDA 3EPEA 1A40A 2HZKA 5M2VA 2PMSA 2RF1A 3T66A 3RY3A 1XVXA 4FEBA 3O28A 2DXYA 4PP0A 3VXBA 3IJOB 3PD8A 1EZ9A 3SERA 3FXUA 4GXAA 4G8HA 2XXVA 2RKMA 3SEWA 1ZLQA 3JZJA 3DP6A 4TOZA 2Z8DA 2Y7RA 1WDNA 1Y3NA 2Q89A 1B3FA 3L6GA 4IO2A 4H8JA 3MWBA 3UN6A 4X9TA 1Y1MA 1XHYA 4GWOA 4MLVA 3FJMA 3LR1A 3OELA 4H5FA 4JWYA 2R6GE 5F1QA 1F9BA 2E0SA 4ZDMA 4FJPA 3N6TA 2GHBA 4QFOA 4UACA 3GBAA 2Z8EA 4FIMA 1LCFA 3VE1B 2NXOA 4QFKA 1HSJA 4OENA 2H98A 2ANJA 5H8NA 4YKIA 5L8DA 3RT8A 1JEUA 2XXIA 3SDFA 1JW1A 1IQ7A 2KLFA 3P7IA 4U1ZA 1MXVA 2H9BA 3G3JA 4YMBA 5KZTA 1CE2A 2F5XA 1MPCA 4NF4B 4GL8A 1LSTA 4N07A 1P1WA 4G2ZA 1B40A 3FGSA 1SD3A 4OETA 1FW0A 4XIGQ 3BKIB 3M8UA 3MVWA 2DWAA 2DQVA 4C0RA 1PBPA 1TFAA 3F11A 3MP6A 4LZ7A 1S7YA 1GV8A 2HFBA 3Q27A 3K0VA 1MY2A 5CMBA 4O3AA 4M1VA 4H67A 1ZIUA 1A55A 3C4MA 5H8FB 3TQWA 4F1UA 2NWJA 1T0KA 4UA8A 4IB2A 4YZZA 2P2AA 1FTJA 4RPOA 1R6ZA 4FAJA 2ZYNA 3K1NA 5AA1A 4X1BA 3RUMA 2VD3A 1URDA 5AA4A 1OLAA 1TXFA 3LUYA 4PFYA 2I3VA 4LA9A 3O6IA 3QK6A 5ITPA 1NNKA 4EF1A 1QW0A 5I2NA 1ZU0A 1N0TA 3FATA 4THIA 4F3GA 3FVGA 3OMBA 5A5XB 2VGQA 2V3UA 1B2HA 4KYSA 4G68C 2IA4A 3TTRA 1H43A 4H1XA 1URSA 1JQFA 4H6DA 1LAHE 1ZTYA 3IOWA 3GBBA 3B6TA 3S4UA 5ICTA 2D5WA 3H6WA 5H8FA 1AH5A 2CZLA 3FVOA 4KCCA 3MZ9A 4DXCA 1P1OA 3TELA 2DS9A 4KPTA 4L17A 2FYIA 4OXVA 3U93A 3H06B 3KN8A 1SVXB 1B7UA 4JB7A 1XC1A 4GLIA 4F3SA 1B05A 1SYHA 4BDLA 3OO9A 4NMYA 3LBSA 4PFTA 1FQBA 4BDOA 4ZEDA 1USYE 1Y3PA 5A5XA 4RNSA 4HCWA 3LSXA 2HAUA 4O3BA 1JVXA 3HN0A 1ELJA 5JTYA 4ELPA 2OCUA 1MS7A 2D3IA 3KFMA 2Y7PA 4GQOA 4EQ7A 4POXA 3QSLA 3RNNA 2G29A 3TYHA 4IY6A 4E0XA 4QF9A 5J1DA 4HW8A 3CG3A 4FORA 1OVBA 2DE2A 2XD3A 3CRBA 4OMBA 4AB6A 3BFTA 2RCBA 1EZOA 1N76A 4EF2A 3BBRA 3TTKA 3FIRA 1ZBMA 2UVIA 1I69A 4NF8B 3G3HA 1PC3A 4DZ1A 3HV1A 4XKNA 3LSWA 1QULA 2QMWA 1XT8A 2VD2A 2Y7WA 2XD2A 1B3EA 4RY1A 3RGYA 4I9DA 3H6UA 2D21A 3TTNA 2DE3A 4OYVA 1US5A 3VLWA 3O2AA 3FD3A 1EH3A 2DXRA 4EDPA 2FA7A 5CMKA 4KR5A 1B58A 4YU0A 3MC2A 2O68A 4U23A 4K3FA 4U4XA 2R9JA 3EHTA 1LGBC 5EHSA 1VR5A 4DE8A 2DP8A 2F78A 5K2XA 1KWHA 2Y84A 2I4CA 1AMFA 4MLQA 3DP8A 2XXQA 5I58B 2PX1A 1Y4CA 2ZYKA 1QUJA 2H99A 2XXTA 4WEDA 3EHUA 1VFEA 3IJXB 3CVGA 3SEUA 1L5TA 5I56B 1EU8A 1B5JA 1MQGA 3IR1A 4YKKA 5HBCA 1DPPA 3QAXA 5ICQA 2VP1A 3UA8A 3TPAA 3ZKKA 1MQJA 5BWJA 3R7XA 2XXWA 3PGFA 3B6QA 2HXWA 1US4A 1QKAA 1DSNA 3KOTA 4ZE8A 1LAFE 4QFLA 3SKPA 3CG1A 3T93B 3U72A 4P0GA 2WKYA 1DOTA 3G7WA 4ZECA 4R73A 3ILTB 4C1TA 4F18A 5CMCA 1XOCA 4JWOA 5H8SA 4GIZA 4HTGA 1H76A 4MH5A 5I58A 1IZ1A 1PEBA 1OQHA 3B6WA 4GOTA 1MY0A 4NWCA 1GVCA 3CFXA 3OXNA 4ISUA 2UVGA 4N6PA 2PT2A 1LLSA 1B5IA 3FUZA 4JSOA 1N3XA 4DXBA 4YKJA 4YB5A 4PFUA 1BTJA 3VV5A 1Q1KA 5AA3A 3RLFE 2F35A 3FJGA 4F19A 5HM4B 4ELOA 2FNCA 2QS3A 1LFHA 4R6HA 4OESA 4KD5A 1LAXA 5LOMA 4FE8A 3L6HA 3W9VA 2H5YA 3TQLA 5H8HB 3FJ7A 3MP8A 3K02A 5EYFA 4H5GA 3N94A 1M5FA 2ESNA 5CI5A 4R75A 3CSBA 1PB8A 2V3TA 4XTCQ 1Q35A 4R2FA 4P0IA 3TAJA 4NF6A 3MAMA 2RINA 1BKAA 3Q25A 5I2KB 1D9VA 4OWDA 2I3WA 1MY3A 1B52A 1MH3A 2XXXA 4XKPA 1P99A 3E3KA 1B7ZA 2OLBA 3MZBA 3RTWB 3VVDA 1SW1A 5CM6A 2X26A 5CC2A 2Z8FA 2F8DA 2OZZA 1M5EA 1A8FA 5EHMA 3D4GA 4X1DA 3CI8A 5ELVA 3MPLA 2DWJA 1USYH 5H8HA 1FQDA 1LBCA 1O63A 4LP2B 2E1SA 5I57B 2Q9TA 3IB1A 3G3GA 3VLVA 4F1YA 2AIXA 3O66A 1O7TA 3D4CA 2Q2CA 1B5HA 1R1NA 4YB6A 4R6YA 4JBZA 5K2YA 3IO6A 4U22A 2XX7A 1Z7ME 4IY5A 5I2KA 1ZJLA 3VFJA 3TUSA 3PUXE 3T9HB 3VXCA 1MQHA 3O29A 1JVYA 2A5SA 3UK4A 3N5LA 1BLFA 4IO7A 3KEIA 2ZNUA 3LSLA 4NF5B 2GFEA 1A99A 1MG1A 3EN3A 3VVFA 4MBPA 1FTKA 4TLMB 2IEEA 4FECA 1H45A 4ESWA 1NKXA 5I57A 1P1QA 3RPWA 1HSLA 3TFLA 1Y9UA 3R6UA 1YPNA 1VE4A 5FHNA 1IUDA 1FCKA 3V5AA 3S2VA 4DCXA 4QRZA 4E0WA 2V25A 3BFUA 2O6AA 2I49A 2QPQA 4NF4A 4F1VA 4U1OA 1ANFA 4P11A 3ZSFA 1IIWA 3IO4A 1XS5A 4F22A 4KCDA 1MPBA 3MQ9A 2YPNA 1IXIA 3ODBA 5AA2D 1SW2A 3MP1A 3K6UA 4NF5A 3TMGA 3A3UA 3PPRA 1SBPA 1IXGA 1TWYA 1MM6A 4IO4A 3H7MA 1MXXA 2M8CA 1AOVA 2HQ0A 4ESXA 3K1PA 3O6HA 5CBSA 2Q8JA 4H0WA 3IX1A 4QHQA 4IO5A 1B4ZA 5L9MA 1UTHB 2OBGA 4LVQA 3TCHA 3DELB 4F39A 1O64A 3FVNA 1NL5A 3OEKA 3IK6B 4GL0A 4EXKA 2O1MA 1OQGA 2QL3A 3UGWA 1D4NA 3EQ1A 3E4RA 4ZEKA 3B7DA 3I6VA 4MF3A 2AL5A 2ONKE 2GRVA 2PYYA 3FZVA 5DVFA 3SEYA 4KFQA 4OHNA 3DLNA 3Q28A 4GRKA 4RXLA 1LBBA 1DPEA 1FQFA 4EXLA 2O1LA 5KCJB 3C34A 4O3CA 1AIVA 4OVJA 3QUJA 4POWA 1NNFA 4EQ9A 5L9SA 3MVXA 2F6GA 2XXHA 4Z7EA 3PMXA 5FHOA 2O7UA 3C36A 2I0CA 4I8CA 4KYDA 3DM0A 3O97A 2YLNA 4Q30B 2B3BA 5KDTB 1M5DA 4ZS9A 3PUZE 3Q29A 3TEPA 4ZE9A 3UIFA 4QFNA 3T9UA 5TPAB 1P1NA 5FHMA 4BDMA 1MXZA 3PMWA 2A5TB 1BIYA 3FV2A 3OO6A 2H25A 2BJJX 3T22A 1MY4A 5FTHA 5KCJA 4PETA 1S9TA 4LONB 2V3QA 1SDXA 2Y7KA 4OZ9A 1HSEA 1N7WA 3OSRA 1EZPA 1PB7A 2PBWA 2O84X 3IOVA 3H3GA 5DT6A 3U94A 1H3DA 2F36A 5KDTA 2V84A 4LZ8A 3R26A 1LFGA 4LATA 4NE4A 4R72A 4OFJA 3SEVA 2I4BA 2VHAA 1B4HA 3FV1A 4EUOA 5TPAA 4NF8A 2X7QA 3HCQA 2REGA 1B0HA 2DVCA 4YAHX 1LCTA 3K2DA 4G68B 1Y20A 3S9NC 3K01A 4G77A 3HPIA 2B3FA 3C31A 4HCYA 2OK2A 3C35A 1B1HA 2NVUB 2QRYA 5AA2B 3T9XB 1UQWA 1SI1A 4F3PA 3FXRA 1B32A 1MQIA 3IORA 2OJTA 5JEIA 4R9FA 2PVUA 1I6AA 2UVHA 3FASA 3H4ZA 3IOUA 4F3BA 3K00A 4I1DA 5DYHA 3ZKLA 1JW5A 3QIMA 5DVIA 4BDQA 5FTIA 4BDRA 4Q5TA 3USDA 1CB6A 1QKBA 2DWIA 2QJEA 3FXQA 3SESA 3SETA 3KSXA 5I56A 1QVSA 1NNTA 1ATGA 3H6TA 3KZGA 4F2OA 4LQ5A 4LQ2A 4ZEFA 1FTLA 1FTOA 1DTZA 2HEUA 3V89B 2F7AA 3IAZA 4WKMA 2G93A 1D3KA 4JSDA 5AA2A 4H8IA 3M3KA 3V83A 3EHSA 3K4UA 1PBQA 3OOAA 3ZS6A 1MH4A 1NNPA 3CIJA 4ZZAA 5JK4A 1YTVA 1MRPA 3LC8A 3K6VA 5B70A 1D9YA 2GH9A 1RKMA 4U2RA 1IITA 3IB2A 3WAEA 2Z23A 3DP4A 2HAVA 3HHGA 1RYXA 2PT1A 2QS2A 3OD7A 1N7XA 1YAEA 4M4GA 2I48A 4AQ4A 4WXJA 3I3VA 4KHZE 4RA1A 4AB5A 1S50A 2ZNSA 2I6EA 2ALUA 1SI0A 1ZMGA 2LAOA 5CBRA 3PPPA 2UXAA 3THIA 3E13X 4GFRA 3IL1B 2DOJA 2F7BA 2DVZA 2XHDA 3G3FA 4F2QA 5H8NB 1FQCA 4PE5B 1QUKA 1VFDA 2NOOA 4R9GA 5B7DA 1JEVA 1YCJA 2F34A 3KG2A 3OO7A 1MM7A 4OTEA 1GR2A 3Q26A 1MDP1 4GVOA 1B9JA 3KBRA 1NFTA 1LAGE 3E9XA 2Y7IA 4RPNA 3KN7A 4ZEIA 3HO7A 2UYFA 4MFIA 1PB9A 4NTLA 3V8XB 1NH7A 4YICA 2O51A 3GLBA 2B65A 1NH8A 3TCGA 2P0SA 2RC8A 4RYAA 2RC9A 1B3GA 1MXWA 3N6UA 4IO3A 5I84A 5HPQA 1OVTA 1WVJA 2DWHA 4ZEBA 1MQDA 3QXMA 3RN8A 2P1SA 3H03A 5TP9B 1B0LA 2F7CA 2I0BA 3PPQA 4R6KA 3G3IA 2UYEA 3RQTA 3QUFA 2Q2AA 2HZLA 5DEXB 3U1OA 1N04A 3AXFA 2DYXA 3N26A 1VSOA 2QSXA 2F6PA 5L9OA 2RC7A 3JV9A 4R2BA 3SEXA 1MDQA 3QYTA 1POY1 4ELQA 2THIA 1I6BA 4ELRA 1FTMA 3C9HA 4QFPA 4DIGA 3H6VA 5AA4B 4OEVA 4OQOA 3A09A 2V93A 2H4IA 5IAIA 5CMMA 4DCYA 1I6QA 5BUUA 2Q88A 3TTMA 1II5A 3MZ1A 3PMVA 4QSCA 5ISUA 4KYEA 5I2NB 1AL3A 4NWDA 5I59B 4G4PA 1B46A 5ITOA 4YB7A 1MXYA 2O7IA 3U92A 1B6HA 3WAFA 5TP9A 4NEDA 1R9LA 3CSGA 4Q0CA 4YKPA 1QUIA
chains in the Genus database with same CATH superfamily
1MN3A 5DEXA 3GZGA 2DAEA 4KI0E 2JA2A 1N84A 4R3DA 5LTCA 3UGJA 3JYRA 1IN5A 5IKBA 2XX8A 2CE7A 1T6OA 4OFLA 1G71A 2L2DA 1DMBA 3U8QA 3HKPA 2CZIA 2F97A 2VOZA 5F7VA 1J09A 4B7HA 1MY1A 3IG5A 3OEMA 4X62M 1C1KA 2KZSA 4XKQA 2OOBA 2QENA 2CEYA 2ABHA 1POTA 1M5CA 3RFWA 4L6V6 5CRYA 2F5OA 1Q02A 4IGTA 2Y21A 1RYOA 4OERA 2H1RA 2ZNTA 3K6XA 1AWBA 1B51A 2HCAA 4OA4A 1A7LA 2DHYA 1LB9A 3PPNA 4IGRA 1GLNA 1PJSA 2DNAA 1OMPA 5I59A 4PTKA 2R71A 3CFLA 3GLGA 1BP5A 4AS4A 3OO8A 2HCBA 2ZAMA 4JXIA 5ET8A 3S9EA 3GQ3A 4KQPA 5ITXE 3TL4X 3PV0E 3LVWA 3CTWB 3V76A 3PUWE 4OEUA 3GXAA 3T9VA 2R45A 5JTYB 1NNUC 3SMPA 2QS1A 4HS7A 1FQEA 5EP1A 4R74A 4GD5A 4TLLB 1ZV1A 4GXSB 1SW4A 1SQYA 1URGA 3K92A 2C96A 2XWVA 2O69A 3W9WA 3W0LB 1OLCA 3S9LC 3HSTA 5EYGA 3C58A 3KOSA 1F4IA 1A8EA 1HT1E 4XKRA 1IMFA 3D1RA 4DR3M 2X8AA 4G8MA 3TODA 2VF8A 3AL0C 4N8YA 5KPZA 4LUBA 4NGUA 1UIVA 2QPAA 2ZMBA 4G8NA 3T15A 1EYJA 3GLIE 5IT9S 3O6GA 3VLUA 4MGHA 4I4LA 2ZYMA 3T96B 4PBHA 2GQFA 5ITQA 3C33A 2LVPC 1Y1ZA 5J16A 1ORYB 4F29A 4D80A 3U6MA 3TTLA 3MPKA 1R2ZA 3B9PA 3K9OA 1MPDA 4ND9A 2X4AA 1Y4TA 2BNKA 3KN3A 2AL4A 4NX1A 1UTHA 1L8QA 1MXUA 1FPLA 3IOTA 3MUQA 5IZ3A 2R6FA 5DVJA 2AYSA 2QSFX 3AJIB 4GF8A 1B7HA 2A5YB 1SXJD 3R9XB 4GBWA 3KGCA 5DNYA 2KQZA 5BPVA 1IBMM 1M5BA 4OU7A 1NMUA 3Q8GA 3EF7A 3MHVC 1IMEA 3I5OA 5DTBA 4G4QA 3IHPA 4JWXA 4PQJA 1IXCA 4WEPA 4WP2A 2YQZA 2C99A 1Y3QA 2FBPA 3MVYA 2BWBA 2LHGA 1FBFA 2F5SA 4RKUF 3FTEA 1WODA 3M3FA 3K1MA 2REJA 1DK4A 1VEKA 4P1LA 1WGNA 2UU9M 3E79A 1LB8A 4N15A 2B3TA 3QYBA 4QNMA 3OSQA 1B3LA 1MX0A 1SW5A 1TFDA 1UTBB 3UP9A 3ONMA 4TUWA 1NV2A 2XX9A 1SG9A 4JV5M 1YXIA 4LG2A 1TH2A 5IZ1A 4MGYE 3PXGA 1VDWA 4LN5A 3GPUA 5ITRA 1ZMVA 1H44A 4TQUQ 2HWJA 4YMAA 4ECFA 1OIPA 4BB9A 4DDDA 3LSFB 4IBJA 1QJMA 1DO0A 4U4SA 3B7NA 1QVRA 1WHCA 4I3EA 1P1UA 4XF5A 3LCVB 3PU5A 3PUYE 5H8QB 3G3KA 1N33M 1JW4A 3O9PA 3M3LA 2UUAM 4IBGA 1TT1A 4GH9A 2Z22A 1EYKA 1PM5A 1N3WA 4DXUA 4CJ6A 2CMOA 1NJGA 3HWSA 1NY5A 2C5RA 4BDNA 3E21A 3DOAA 1XVYA 3NBXX 1FPKA 4RK9A 3TDJA 4RJZA 3A3CA 1LFIA 1DTGA 4AI6A 4Q8RA 3F92A 1DV0A 4IO6A 1KZ8A 3TZAA 1LBYA 3RT6B 2ZYOA 4IBIA 4DV2M 2B4MA 2DE4A 1I4WA 1SYIA 2UXDM 3S9MC 2DSFA 4BLAA 5EJCA 2OOAA 4K0KM 4IBFA 1ZKBA 1JNFA 3U6SA 3EKIA 2BJIA 1D0KA 2OWSA 3MW0A 2A5TA 1G0HA 4U21A 2OPFA 4L4UA 3TCFA 4G6ZA 3PNVA 1UIUA 3ISPA 1Z7NE 4H65A 1NY6A 1UTBA 2W7YA 1QUSA 3T0JA 3KSJA 1R9QA 2OWZA 2XXUA 1NUWA 4EQBA 1JR3E 2LVAA 2I7PA 3DZDA 1A54A 4I81A 4C1UA 2DAGA 3BIGA 4FBPA 4B7GA 3QYEA 1B3HA 2HL7A 1J1NA 1OIBA 2OWTA 2RCAA 2XXYA 3KJTA 2Z7JA 1AUAA 3C32A 4XXUA 3MVZA 5H8QA 1B1XA 1NSFA 3CFZA 2CEXA 4FEDA 1H6UA 3A98B 2DDKA 1IXHA 1GTKA 4M9SA 3OENA 3BBZA 2ONSA 1GGGA 2LVOC 2WX9A 4LZZA 4F31B 3SYLA 1VDLA 1XXHA 2I58A 3KP0E 1NUXA 3HX3A 4IIWA 2F5QA 2PCRA 4KLNA 3K6WA 4N13A 1NV5A 4X48A 5I3SA 4EIWA 3C9PA 4GWUA 4GX6A 3U6EA 2VT5A 2R8TA 4FWGA 3KJ7A 3C3EA 4RK2A 2LXEA 1E9SA 2QMXA 4GX3A 3PUVE 1IY2A 4G68A 2G8LA 4S12A 4ZZEA 3VDFA 5DYIA 4QSEA 1CNQA 1QANA 2X7PA 1PDAA 3FVKA 2VQFM 5DW8A 3I01M 4L16A 2YJPA 4N6DA 3VVEA 1Z5BA 2CP8A 3RTFB 1JETA 3UORA 2Q2EB 3PD9A 3ECRA 2GQ1A 1IN7A 4OVQA 3W15C 4F2LA 4NF6B 1JB0F 2EKFA 1GO5A 4PFWA 2JY6B 4QSDA 3SZPA 2GHAA 2XXPA 2Z8YM 2ZZXA 4ONYA 4I62A 5AE4A 3HHFA 4PAFA 3I04M 2ONRA 4PDHA 2NUVA 3TKDA 5IREB 2OX3A 1Z59A 2UVJA 4FATA 4Z0IA 4LZ5A 3MJNA 5LMUM 1MJGM 3CR9A 1FQAA 2R4JA 3ILUB 4AZFA 2QS4A 4JDFA 4NXMM 4OFOA 3IB0A 3B89A 3PPOA 5FTLA 1FBDA 5TU0A 3MBPA 2MR9A 1IEJA 2ZXTA 1S3SA 1XNRM 2XXRA 1A5TA 3K1JA 4DLDA 4PT5A 2DXIA 3J2PB 1G4AE 3EPEA 1A40A 2HZKA 5M2VA 2PMSA 2RF1A 1RDYA 3T66A 3RY3A 1XVXA 3VDUA 4FEBA 3O28A 2DXYA 4PP0A 4MJOA 3VXBA 3IJOB 1IN8A 2P3VA 1JR3D 4DR2M 3PD8A 1EZ9A 2EUCA 4IJFA 4CHTB 4AG5A 4ANRA 5EXSA 2ZZWA 1N77A 2FH0A 2RGHA 3SERA 3FXUA 4GXAA 4G8HA 2XXVA 3U6LA 2RKMA 3MSTA 3SEWA 4GHLA 1ZLQA 4CISA 4PCDA 3JZJA 2DHRA 3DP6A 4TOZA 3ILKA 2Z8DA 1GJSA 2Y7RA 1WDNA 3ROJA 2CV0A 1Y3NA 2Q89A 4N4UA 1B3FA 3L6GA 4P3LA 3HHXA 2CV1A 4AW4A 4JI8M 4IO2A 4H8JA 3MWBA 3UN6A 4B7FA 1NV0A 4X9TA 1Y1MA 1K82A 1XHYA 3JR5A 4GWOA 4MLVA 4XK8F 3OTOM 3FJMA 3LR1A 1RDZA 3OELA 3T1YM 4H5FA 4JWYA 2R6GE 5F1QA 1F9BA 2E0SA 4ZDMA 1J7KA 4FJPA 4GKKM 4GIPA 4DR5M 1LBZA 3N6TA 2GHBA 4NC6A 4N6KA 4QFOA 3B50A 2VPNA 2O25A 4UACA 4MMPA 3KC0A 3U5ZB 2MJ5B 1SXJA 4LF8M 3GBAA 2Z8EA 4W5WA 4FIMA 3GLIB 4DUZM 4NQ8A 1LCFA 3RPLB 3GRRA 3VE1B 2KZUA 1PJIA 4MB7A 2NXOA 5DFLA 4N17A 3LUZA 4QFKA 1HSJA 4OENA 2H98A 1FRPA 1FJ9A 2Z4RA 2ANJA 1QUIA 5H8NA 4YKIA 5L8DA 3RT8A 1JEUA 2XXIA 4MEVA 3SDFA 1JW1A 4NRWA 1IQ7A 2KLFA 4B3MM 2DKLA 1OTRA 2LHCA 2HPGA 3P7IA 4U1ZA 1MXVA 2H9BA 3G3JA 2QHOB 4YMBA 5KZTA 1IMCA 3ZCBB 1CE2A 1FNNA 2F5XA 3FBPA 3SYKA 3UJNA 1LV7A 1MPCA 5ITXA 4NF4B 1E94E 2L7IA 2XA5A 1LSTA 4GL8A 4N07A 3GQ5A 3SMSA 1P1WA 4G2ZA 1B40A 3FGSA 1SD3A 4UABA 4N91A 4OETA 4GITA 1FW0A 4XIGQ 3BKIB 1NHWC 4PF6A 3M8UA 3MVWA 2DWAA 2DQVA 4PFIA 3AOEC 4DI3D 2QVUA 3M6AA 1WXQA 2WEFA 4C0RA 1PBPA 4NG7A 1TFAA 3F11A 4XBOA 3MP6A 4LZ7A 2KNAA 1S7YA 4KHPM 3GLIA 2XWOA 1WR1B 4QOZC 1GV8A 3W67A 2XSZD 2HFBA 3Q27A 5IWAM 5I7IA 2WZJA 3K0VA 1MY2A 5CMBA 4YHHM 3B7ZA 4O3AA 4JI4M 4JI1M 2D7GA 2VPOA 4M1VA 4H67A 2R65A 1ZIUA 1D0LA 1A55A 1NUZA 3C4MA 5H8FB 3TQWA 4F1UA 4NXNM 4N8GA 2NWJA 1FPBA 1HQYE 1T0KA 3HJ8A 4UA8A 4IB2A 4BBAA 2Y20A 4YZZA 5FTJA 2P2AA 1FTJA 3U6DA 2KR0A 3K8ZA 2KW0A 4RPOA 1R6ZA 4FAJA 2ZYNA 3K1NA 1DBZA 5AA1A 2QCUA 4R71A 4CIZA 3H4MA 3B8BA 4X1BA 3RUMA 2VD3A 1URDA 5AA4A 2LNHC 3TWLA 1OLAA 1OFHA 1DO2A 4OW0A 1TXFA 3LUYA 4PFYA 3T6PA 2I3VA 4LA9A 3FTDA 1Z5AA 1YUBA 3O6IA 4KXPA 2KHHA 1K3XA 5FTMA 3QK6A 2WBDA 5ITPA 1NNKA 4EF1A 1QW0A 5I2NA 1ZU0A 1N0TA 3FATA 1NV4A 4THIA 4MNPA 4F3GA 3FVGA 1XMQM 3KBZA 1D2NA 3OMBA 3FUUA 5A5XB 3SAWA 3PFIA 1EE8A 4ZPXA 2VGQA 4OVZB 2V3UA 3KOXE 4GWXA 1B2HA 4KYSA 4G68C 2L4FA 2I7NA 2IA4A 3TTRA 1DGHB 2DZNB 1H43A 4H1XA 5F3WA 2YFQA 4I5SA 1URSA 1JQFA 4H6DA 1LAHE 1ZTYA 2R46A 2DAMA 4FW9A 1IM2A 4GC5A 3IOWA 3GBBA 3B6TA 3S4UA 2EJSA 5ICTA 4IBDA 4AG6A 2D5WA 3H6WA 5H8FA 2VF7A 1AH5A 2CZLA 3FVOA 4MGZE 2VDBB 3HJQA 2Y0TA 4KCCA 3MZ9A 4JI7M 4DXCA 1FBPA 1P1OA 2JY8A 3RE8A 3TELA 2DS9A 2J7NA 4KPTA 2KRKA 4L17A 1QAOA 1NV6A 2FYIA 2Y5KA 5JI3E 4OXVA 3U93A 3H06B 2C9OA 3KN8A 3KC1A 1PGYA 3TPZA 1SVXB 1B7UA 1D9QA 1BVSA 2R18A 3SHFA 4JB7A 3SAVA 4MHFA 1FPFA 1Q39A 1XC1A 1QDTA 4LJ4A 2CHGA 4GLIA 4F3SA 1B05A 3UMMA 1HNXM 3WHKA 1SYHA 4BDLA 3OO9A 4NMYA 1WGLA 4AQYM 3LBSA 4PFTA 3MK6A 1FQBA 5EQAA 4BDOA 3I51A 3U6PA 4ZEDA 1USYE 1Y3PA 3E46A 3SARA 5A5XA 4RNSA 4HCWA 3IG8A 2WSEF 3LSXA 2HAUA 3U60B 3HU3A 4O3BA 2FNAA 3BXWA 3KOYE 3CHGA 1JVXA 3HN0A 1ELJA 5JTYA 1L1TA 2OCUA 4PE3A 1MS7A 4ELPA 2D3IA 3KFMA 2Y7PA 4KT0F 4OVRA 1UFZA 3GPPA 4GQOA 4EQ7A 4POXA 3QSLA 3RNNA 2G29A 3TYHA 2HKJA 4XFEA 4IY6A 4E0XA 4JI2M 1HT2E 4QF9A 2XXKA 3QWLA 2DI0A 2B4LA 4O7MA 5J1DA 4HW8A 3CG3A 4FORA 1QYRA 1OVBA 4G4NA 2DE2A 2XD3A 3Q8XA 1R4GA 2QP9X 4GMQA 3CRBA 5A5LA 4OMBA 4AB6A 3BFTA 2RCBA 1EZOA 2XEPA 1N76A 4EF2A 2LBCA 3BBRA 3TTKA 3FIRA 1ZBMA 2UVIA 1I69A 4NF8B 1WJ7A 3G3HA 2KNZA 2MGWA 1PC3A 3KS4A 5ET6A 4N81A 4DZ1A 3HV1A 2FE8A 3LSWA 4XKNA 1QULA 2QMWA 4JYAM 1XT8A 3D8LA 1TH4A 3GLGE 2VD2A 4OANA 4LJ7A 2Y7WA 3M7GA 1YSYA 2XD2A 2F5NA 1B3EA 4RY1A 5IGAA 3RGYA 4I9DA 3H6UA 1DGFA 2D21A 1SXJC 3TTNA 2DE3A 4OYVA 1US5A 3VLWA 3O2AA 3FD3A 1EH3A 2DXRA 2M5ZA 3WHLA 4EDPA 2FA7A 5CMKA 4KR5A 1B58A 4L15A 4YU0A 3H4JA 2XFTA 3MC2A 2O68A 4LFBM 2ZANA 2L6OA 1L2DA 5EP3A 4U23A 4K3FA 4U4XA 4M0WA 4LJ9A 1LGBC 2R9JA 2WYKA 3EHTA 5EHSA 5ET5A 2JJKA 1VR5A 4DE8A 2DP8A 2F78A 5K2XA 1KWHA 4JVDA 1AIPC 2Y84A 2I4CA 1AMFA 2ZAOA 1EYIA 4MLQA 3JR4A 4HE0A 3DP8A 4M9ZA 2ZBKB 2XXQA 4QBAA 5I58B 4G4RA 2PX1A 3I4VA 1Z6TA 3J27B 3J7AS 1DCUA 2X49A 1Y4CA 3VK7A 2ZYKA 1QUJA 2H99A 3UK6A 2XXTA 4WEDA 3EHUA 1VFEA 3IJXB 3CVGA 3HY5A 3SEUA 1L5TA 5I56B 4DV7M 1EU8A 1B5JA 1MQGA 3IR1A 4YKKA 5HBCA 2BJWA 1DPPA 3QAXA 5ICQA 3CF2A 2VP1A 3PNYA 3TPAA 3UA8A 3EIHA 3ZKKA 4MX6A 1MQJA 3GPXA 5BWJA 3VKGA 2ZTCA 1KA1A 3R7XA 3GLHB 2XXWA 5KQ8A 4B3TM 3PGFA 1IY0A 3B6QA 4FWDA 2HXWA 1US4A 1QGXA 1QKAA 1PRBA 1HR0M 1DSNA 3KOTA 4ZE8A 1LAFE 2Z3XA 4QFLA 3SKPA 3CG1A 3T93B 4IR8A 3U72A 4MGIE 2CZHA 4DV4M 2MKZA 4P0GA 2WKYA 1DOTA 3G7WA 2EKKA 4DI4B 4ZECA 4L78A 1RDXA 4R73A 4DUYM 5EXPA 2RKOA 3ILTB 4C1TA 4F18A 3IFCA 5CMCA 1XOCA 4JWOA 2XSZA 5H8SA 2UXBM 1TTEA 2HXRA 2DZLA 1IMAA 4Y28F 3L25A 5H37D 4GIZA 4HTGA 4GWYA 1H76A 3GYYA 1VEJA 1QAQA 1NNJA 4MH5A 1IN6A 2XFSA 5I58A 4NN3A 1IZ1A 4JVIA 1K9ZA 1PEBA 4OVPA 5I5PA 2L09A 1OQHA 1G8PA 3B6WA 4GOTA 4D82A 1MY0A 4NWCA 1GVCA 3HJSA 3CFXA 2V4CA 3OXNA 4ISUA 2ZTDA 2UVGA 4N6PA 3RGSA 5IZ7D 5IZZA 3U6QA 2PT2A 1LLSA 1OKSA 4QHTA 1B5IA 3FUZA 4JSOA 2JY7A 2J7OA 4JI5M 3HHZA 4PCZA 1N3XA 4DXBA 4NF0A 2FFJA 4YKJA 4YB5A 4PFUA 1BTJA 3NOHA 4I3YA 3VV5A 1NUYA 2DWNA 1Q1KA 5AA3A 5L8RF 2F35A 3RLFE 3FJGA 4F19A 5HM4B 4ELOA 1YYZA 1EFUB 3L28A 2QBYB 2FNCA 2QS3A 2L4EA 1LFHA 2Q74A 4R6HA 1QDRA 4OESA 1YZ0A 4KD5A 1LAXA 5LOMA 4FE8A 3J80S 3KDSE 4MGKE 2RRUA 4O94A 3CF0A 4IJEA 2UUBM 1XMOM 4DR4M 3L6HA 3W9VA 1FBGA 4GKJM 3A29A 2CEAA 1OQYA 2H5YA 3TQLA 3T1HM 5ITYA 5H8HB 5T3JA 5KO3A 3FJ7A 3MP8A 4PDGA 3K02A 3U6OA 5EYFA 4H5GA 2CWBA 3NBIA 1E32A 2XGNA 2J5YA 2YNMD 1TGUA 2UUCM 3N94A 1M5FA 4IBCA 2ESNA 4GX4A 5CI5A 4R75A 1L1ZA 3CSBA 1PB8A 1G59A 2V3TA 4XTCQ 1Q35A 4R2FA 4P0IA 3LVVA 4B3RM 3TAJA 4JI6M 3RYDA 4NF6A 3I4YA 1T3TA 4AKHA 4O8MA 3MAMA 2RINA 5IM2A 1IMBA 1NI9A 1BKAA 5ITUA 3Q25A 5I2KB 2H5XA 2D7HA 1D9VA 4Z8XA 5BR8M 4OWDA 3HFUA 1NVMA 2I3WA 4OX9M 1MY3A 1B52A 1MH3A 2XXXA 1XXHE 1P99A 4XKPA 3E3KA 3FUXA 1B7ZA 2OLBA 1R7RA 2DWMA 1LBVA 1QUTA 4Q7JA 2QBYA 3MZBA 3RTWB 3VVDA 4LFAM 1SW1A 5CM6A 1G41A 2QVVA 2MH8A 2X26A 5CC2A 2WYPA 2Z8FA 3ZC7B 2E5LM 2F8DA 2OZZA 1M5EA 1A8FA 5EHMA 3D4GA 4X1DA 4ITQA 1GKIA 4P56A 2C9CA 3CI8A 5ELVA 3MPLA 2DWJA 1USYH 1I94M 3PTYA 1IXSB 4MIJA 4LF6M 1OJLA 1DGBA 5H8HA 1FQDA 1LBCA 3GLHE 4X04A 3SBJA 1O63A 1OAOC 4X65M 1Y8GA 3TWMA 4LP2B 2E1SA 5I57B 2DWZB 2Q9TA 2QFLA 3IB1A 3G3GA 3VLVA 4F1YA 2AIXA 3O66A 1O7TA 3D4CA 2Q2CA 1B5HA 4DV1M 1R1NA 4YB6A 4MNCA 4P8BA 4R6YA 4JBZA 3M0EA 4GC9A 3GO8A 1FPDA 1KSFX 1FJGM 1NV7A 5K2YA 1R2YA 2CV2A 3FUVA 3IO6A 3L27A 4U22A 2XX7A 3C3DA 1RU3A 5EP2A 1C7YA 1Z7ME 4IY5A 4LRSA 1NJFA 5I2KA 3LCUA 1GVNA 1VG5A 1ZJLA 3VFJA 4DBGB 2QNJA 3TUSA 3PUXE 1G3IA 2Z4SA 2XWIA 3T9HB 3VXCA 3PVSA 1MQHA 1XHBA 3O29A 4DV5M 3THGA 2PFYA 3FXBA 1JVYA 2A5SA 3UK4A 3N5LA 1BLFA 3LW5F 3EIEA 4IO7A 3IECA 3KEIA 1GL6A 5EYHA 2ZNUA 3LSLA 4NF5B 3ZQJA 1HQCA 2GFEA 1A99A 1MG1A 3EN3A 3VVFA 1QZEA 4MBPA 2JNHA 3U5ZA 3VFDA 4L8RC 1FTKA 2CHQA 4H45A 4TLMB 4IBBA 2IEEA 5GKNA 3U65A 4FECA 1H45A 2GNOA 1XB2B 4ESWA 3RPLA 1NKXA 4P17A 5I57A 1P1QA 3RPWA 2L7HA 1HSLA 5KQDA 3MMPA 3BIHA 1GJTA 3TFLA 2WSCF 1Y9UA 2K0BX 3R6UA 1YPNA 4LRTA 1VE4A 2FS1A 5FHNA 3SC3A 1IUDA 2QVRA 3GLGB 1W5TA 1FCKA 3U6CA 3V5AA 2DAKA 3S2VA 4DCXA 4QRZA 1Q3BA 4E0WA 2V25A 3BFUA 2O6AA 2NQ8C 2I49A 2QPQA 2RGOA 4G4OA 3HGIA 3KOZE 3KW6A 5FTNA 4NF4A 4F1VA 4U1OA 1ANFA 4P11A 3ZSFA 3A42A 1IIWA 3W0FA 4FWHA 1JP4A 4AS5A 3IO4A 3VKHA 1XS5A 3A45A 1L2BA 4X64M 4F22A 4KCDA 3D8BA 3VLFB 2O5RA 4WW0A 1MPBA 2Y0QA 3MQ9A 2P5TA 1K3WA 2YPNA 4R7GA 1IXIA 2EO2A 3ODBA 5AA2D 1SW2A 4AKGA 3TQSA 3MP1A 3K6UA 1SXJE 1WIVA 4NF5A 3TMGA 3A3UA 4GWSA 3PPRA 4G61A 5E26A 2F5PA 4II7A 1SBPA 5ITTA 3MJ5A 1IXGA 4Z6YA 3GLFE 1UM8A 1TWYA 2FVZA 5KPRA 1MM6A 2XZUA 4QHSA 4IO4A 4X8RA 3H7MA 1MXXA 2M8CA 1AOVA 2HQ0A 4ESXA 1INPA 1XWIA 3K1PA 3O6HA 3MYUA 1N36M 4P47A 5CBSA 4PDIA 5ESYA 2Q8JA 4H0WA 3HHWA 3IX1A 4QHQA 4IO5A 2JWSA 1B4ZA 5L9MA 1UTHB 2OBGA 3FUTA 5IZ3B 4LVQA 4PFBA 2V6ZM 3LV0A 3UZUA 1T43A 2LH0A 3TCHA 3DELB 3AOGA 3GP1A 3U61B 2F4VM 1EIJA 4F39A 1O64A 3FVNA 2D7EA 1NL5A 3OEKA 1FPEA 3IK6B 4GL0A 1HNWM 5C1BA 4REZA 4EXKA 2O1MA 1IN4A 4PBQA 1OQGA 2QL3A 2AHMA 3UGWA 1XC8A 3B7QA 4HE2A 4DV0M 1GABA 2FIEA 1D4NA 4LCBA 4RNAA 2KDLA 1VDDA 3EQ1A 3E4RA 1FTAA 4ZEKA 4DR7M 1HJPA 4JN6A 1IMDA 3B7DA 3I6VA 4MF3A 4P9KA 2O01F 2AL5A 2ONKE 2GRVA 2V1CA 2PYYA 3FZVA 5DVFA 3SEYA 2UXCM 4FCWA 2P3NA 3GPYA 1TDHA 4KFQA 5EXTA 4OHNA 3DLNA 2XH9A 4FCTA 3Q28A 4GRKA 4RXLA 4NRVA 1LBBA 4OVZA 1DPEA 1FQFA 5F24A 4EXLA 2O1LA 4PF8A 5KCJB 1ZAEA 1DGHA 3C34A 4O3CA 1AIVA 4OVJA 1OFIA 3QUJA 1W5SA 4POWA 2JZ0A 1NNFA 4EQ9A 5L9SA 3MVXA 2F6GA 1JR3A 2ZM6M 2XXHA 4Z7EA 2R62A 2CZKA 3PMXA 5FHOA 2O7UA 3C36A 4M9XA 2I0CA 4I8CA 3W68A 1NV8A 4KYDA 1IFYA 1DGGA 3DM0A 3U61A 3O97A 2YLNA 1MU5A 4Q30B 2B3BA 4NSOB 5KDTB 1M5DA 3LMMA 1V34A 4P1EA 4KODA 2F3DA 4ZS9A 1Q3CA 3PUZE 1ZMUA 3Q29A 3TEPA 4ZE9A 3UIFA 4QFNA 1FPGA 3T9UA 1IY1A 3J7BA 2BJVA 1NV9A 5TPAB 1PJTA 1P1NA 1HNZM 5FHMA 4BDMA 1MXZA 4LGYA 4LZJA 2DVWB 4LY6A 3PMWA 2CRUA 4B3SM 2A5TB 2DENA 2K47A 2R44A 2LTUA 2EA0A 1TF0B 1BIYA 3FV2A 4PAIA 3OO6A 8CATA 2H25A 2BJJX 3T22A 3T38A 3LQRA 3J81S 2FOIC 1MY4A 1L2CA 5FTHA 1R5LA 3U60A 1FPJA 5KCJA 4CGYB 4XGIA 4PETA 1IBLM 4IBEA 4NL4H 1S9TA 4LONB 2V3QA 3FTCA 4LJ6A 1SDXA 2Y7KA 4OZ9A 4HLQA 1HSEA 1N7WA 4KO8A 3OSRA 4GRIA 1FBEA 1EZPA 1PB7A 3E78A 2PBWA 4MAGA 2O84X 3R8FA 3H3GA 2PFZA 3IOVA 4O7IA 5DT6A 3U94A 1H3DA 2F36A 4I40A 5KDTA 2WBBA 3L26A 1NO1A 3KP1E 1XXHB 2LVQD 2M60A 1KA0A 2V84A 4LZ8A 2Q8MA 4HEOA 1LEVA 3R26A 3JAMS 1LFGA 4LATA 3AOEA 3GRYA 4NE4A 4R72A 4OFJA 3SEVA 3KXEC 2I4BA 2VHAA 1B4HA 3ZH9B 3FV1A 4EUOA 5TPAA 4MM3B 1GL7A 4NF8A 2QZ4A 2X7QA 3SASA 3HU1A 3L29A 4LGMA 3HCQA 2REGA 5DYGA 1KFVA 5KPTA 1B0HA 2DVCA 4YAHX 1LCTA 3CGWA 3K2DA 4G68B 1V92A 1Y20A 4F1IA 1FBHA 3S9NC 2K6BA 3K01A 1XNQM 4G77A 3HPIA 2JP7A 2B3FA 2XWKA 3C31A 4HCYA 2OK2A 3C35A 1VQ1A 1B1HA 3HZJA 2NVUB 1YE9A 4A3VB 2QRYA 3FKEA 5AA2B 1E9RA 3T9XB 1UQWA 3L2AA 1N32M 1SI1A 2VQEM 4F3PA 3FXRA 5JI2E 1B32A 1NV3A 3GRVA 1MQIA 3IORA 7CATA 3FYCA 2XLJA 2OJTA 4R9FA 4JXJA 5JEIA 3QAUA 3SFZA 2PVUA 1I6AA 4WURA 4QXDA 2UVHA 2N35A 5EQ9A 3FASA 3H4ZA 3IOUA 3FRHA 4F3BA 4PDDA 5A2QS 3QMFA 3K00A 3T1BA 4I1DA 4LFCM 3FUWA 3FTFA 5DYHA 3AV0A 3ZKLA 1JW5A 3QIMA 4PFRA 5DVIA 4BDQA 5FTIA 4BDRA 1SPIA 2R0IA 3KS8A 4PC9A 4Q5TA 1K9YA 5C18A 3USDA 3TE6A 1CB6A 1FBCA 1QKBA 2DWIA 2LWXA 3HHYA 4PGPA 2QJEA 3FXQA 4PAKA 5LMNM 3SESA 3SETA 3KSXA 5I56A 1QVSA 4MH0E 5E6JA 1NNTA 1ATGA 2APLA 1LBXA 3H6TA 1G0IA 1VEGA 3KZGA 4FCVA 3NWLA 4G3OA 4F2OA 4LQ5A 4LQ2A 4GBVA 4ZEFA 2MROB 1FTLA 3GLHA 1FTOA 1DTZA 2HEUA 3V89B 2F7AA 2YR0A 3SAUA 3IAZA 4WKMA 2G93A 1D3KA 3FRIA 2HAKA 4FVMA 5EQTA 4LF4M 4JSDA 5AA2A 3GQ4A 4H8IA 3M3KA 1Z5CA 3FYDA 4PGNA 3V83A 3EHSA 2V1UA 3K4UA 1P3QQ 4DV6M 1PBQA 2KXEA 3OOAA 3RGPA 3ZS6A 1MH4A 1FPIA 1NNPA 3CIJA 4ZZAA 2ZZVA 5JK4A 1LBWA 1YTVA 4NSRA 1MRPA 3LC8A 3K6VA 4JI0M 4GWWA 1IQPA 4LJ8A 5B70A 1D9YA 2GH9A 1RKMA 4U2RA 2G3QA 1IITA 2XZFA 4X66M 3IB2A 2JY5A 4RF0A 2QQ8A 3WAEA 2Z23A 4LF7M 1QAMA 3DP4A 5ET7A 2HAVA 3HHGA 3VK8A 1RYXA 2PT1A 2QS2A 3AKZA 4M0DA 3OD7A 1N7XA 1YAEA 4BLCA 4M4GA 4IBKA 2I48A 2KA6B 4AQ4A 3LQQA 4WXJA 3E9SA 3I3VA 4KHZE 4RA1A 4YY3M 3SHGB 1S50A 4NHBA 4AB5A 3TWKA 2ZNSA 2I6EA 2Y5LA 1QQWA 2ALUA 1SXJB 1SI0A 2DAIA 1ZMGA 2KEBA 2LAOA 2KRUA 5FBPA 4H46A 5CBRA 2VIIA 3KVWA 3PPPA 4UN2B 5EXXA 2UXAA 3VDPA 3THIA 3GLFB 1ZMWA 2LVNC 1N75A 3E13X 4GFRA 1J5EM 3IL1B 1LTMA 2DOJA 1PJQA 1XI6A 2F7BA 2DVZA 2XHDA 3HU2A 1QZMA 3G3FA 4DV3M 4F2QA 5H8NB 1FQCA 4PE5B 1QUKA 1VFDA 2NOOA 5FTKA 4R9GA 4NOOB 1KYIA 1JEVA 5B7DA 1YCJA 1FJ6A 2F34A 3DA1A 3KG2A 3K2LA 3OO7A 1MM7A 4OTEA 1GR2A 3Q26A 1TH3A 1MDP1 4D81A 3BOSA 2JZ1A 4GVOA 1B9JA 3KBRA 3B74A 1NFTA 5EQ7A 3AFHA 1LAGE 4HXVA 3E9XA 2Y7IA 4RPNA 3KN7A 4ZEIA 4LJ5A 3FD9A 3HO7A 1X37A 2UYFA 4MFIA 1PB9A 2CHVA 4B08A 3KFUG 1Q9DA 4NAPA 4NTLA 4JI3M 3V8XB 3KOWE 1NH7A 4YICA 2O51A 4HE1A 3GLBA 2B65A 1NH8A 2CFOA 1ZQ9A 3GRUA 3TCGA 2DWLA 2FHYA 1CUKA 2HHMA 2P0SA 2RC8A 4RYAA 3CF6E 2RC9A 1B3GA 1MXWA 4PD2A 2L5VA 5EQ8A 4RF1A 3N6UA 1IBKM 1TR8A 4IO3A 5I84A 5HPQA 3A46A 1OVTA 1WVJA 5LDZA 2DWHA 4HL4A 5FSWA 4MCOA 4ZEBA 2DZOB 1MQDA 2CUZA 3QXMA 2KNVA 3RN8A 3GLFA 2P1SA 2OQ4A 3H03A 5TP9B 1N78A 1BK4A 1B0LA 2F7CA 2I0BA 1PJJA 3PPQA 4R6KA 1YLAA 3G3IA 1NHGC 3DFZA 1NV1A 2UYEA 3QUFA 2Q2AA 2JXNA 3RQTA 2HZLA 4JVCA 5DEXB 4P16A 3U1OA 1N04A 3AXFA 2DYXA 1V33A 3N26A 1TDZA 2OO9A 2HHHM 1VSOA 2QSXA 2F6PA 2BWEA 3FE3A 5L9OA 2C98A 2RC7A 3JV9A 4LF5M 4R2BA 3SEXA 1MDQA 3QYTA 4DR1M 1POY1 4ELQA 4OVTA 4I8OA 2THIA 5FLXS 1IXSA 1I6BA 4ELRA 1FTMA 3C9HA 2XF3A 4QFPA 2JUJA 4LJAA 5EP4A 2W82A 4DIGA 2WSFF 3H6VA 5AA4B 4OEVA 4OVSA 4QNRA 4GWZA 4OQOA 3A09A 2V93A 3SATA 2H4IA 5IAIA 4QOSA 5CMMA 4DCYA 1JQJC 1I6QA 5BUUA 2Q88A 3TTMA 1II5A 3MZ1A 3PMVA 4QSCA 5ISUA 4KYEA 5I2NB 1AL3A 4NWDA 1D0MA 5I59B 2G5GX 4FD2A 4G4PA 1B46A 5ITOA 4XEQA 3K9PA 2ERCA 4YB7A 2F3BA 1MXYA 2O7IA 4MNIA 3U92A 2K9DA 2R4EA 3IFAA 1IXRC 1B6HA 3WAFA 1IXZA 5TP9A 1R6BX 4AKIA 2FIXA 1N34M 4NEDA 1R9LA 1OAIA 4LF9M 3CSGA 4GEWA 4GHAA 4Q0CA 4DR6M 4YKPA 1OIZA 1FSAA
chains in the Genus database with same CATH topology
5DEXA 3GZGA 4KI0E 2JA2A 1N84A 4R3DA 3UGJA 3JYRA 1IN5A 5IKBA 2XX8A 2CE7A 4OFLA 1DMBA 3U8QA 3HKPA 2F97A 2VOZA 5F7VA 1J09A 4B7HA 1MY1A 3IG5A 3OEMA 4X62M 1C1KA 2KZSA 4XKQA 2QENA 2ABHA 1POTA 1M5CA 3RFWA 5CRYA 2F5OA 4IGTA 2Y21A 1RYOA 4OERA 2H1RA 2ZNTA 3K6XA 1B51A 2HCAA 1A7LA 1LB9A 3PPNA 4IGRA 1GLNA 1OMPA 5I59A 2R71A 3CFLA 3GLGA 1BP5A 3OO8A 2HCBA 2ZAMA 4JXIA 3S9EA 3GQ3A 4KQPA 5ITXE 3TL4X 3PV0E 3LVWA 3CTWB 3PUWE 4OEUA 3GXAA 3T9VA 2R45A 5JTYB 1NNUC 3SMPA 2QS1A 4HS7A 1FQEA 5EP1A 4R74A 4GD5A 4TLLB 4GXSB 1SW4A 1SQYA 1URGA 3K92A 2C96A 2O69A 3W9WA 3W0LB 1OLCA 3S9LC 3HSTA 3C58A 3KOSA 1A8EA 1HT1E 4XKRA 4DR3M 2X8AA 4G8MA 3TODA 3AL0C 5KPZA 4LUBA 1UIVA 2QPAA 2ZMBA 4G8NA 3T15A 5IT9S 3O6GA 3VLUA 4MGHA 4I4LA 2ZYMA 3T96B 5ITQA 3C33A 1Y1ZA 1ORYB 4F29A 4D80A 3U6MA 3TTLA 3MPKA 1R2ZA 3B9PA 1MPDA 4ND9A 2X4AA 1Y4TA 2BNKA 3KN3A 2AL4A 1UTHA 1L8QA 1MXUA 3IOTA 3MUQA 5DVJA 2AYSA 3AJIB 4GF8A 1B7HA 2A5YB 1SXJD 3R9XB 3KGCA 5DNYA 5BPVA 1IBMM 1M5BA 4OU7A 1NMUA 3EF7A 3MHVC 3I5OA 5DTBA 4G4QA 4JWXA 4PQJA 1IXCA 4WEPA 2YQZA 2C99A 1Y3QA 3MVYA 2F5SA 3FTEA 1WODA 3M3FA 3K1MA 2REJA 2UU9M 1LB8A 4QNMA 3OSQA 1B3LA 1MX0A 1SW5A 1TFDA 1UTBB 3UP9A 3ONMA 4TUWA 2XX9A 4JV5M 4LG2A 1TH2A 4MGYE 3PXGA 3GPUA 5ITRA 1H44A 4TQUQ 4YMAA 4ECFA 4BB9A 4DDDA 3LSFB 4IBJA 1QJMA 1DO0A 4U4SA 1QVRA 1P1UA 3PU5A 3PUYE 5H8QB 3G3KA 1N33M 1JW4A 3O9PA 3M3LA 2UUAM 4IBGA 1TT1A 4GH9A 2Z22A 1PM5A 1N3WA 4DXUA 2CMOA 1NJGA 3HWSA 1NY5A 2C5RA 4BDNA 3DOAA 1XVYA 4RK9A 3TDJA 4RJZA 3A3CA 1LFIA 1DTGA 4AI6A 4Q8RA 4IO6A 3TZAA 3RT6B 2ZYOA 4IBIA 4DV2M 2DE4A 1I4WA 1SYIA 2UXDM 3S9MC 2DSFA 4BLAA 5EJCA 4K0KM 4IBFA 1ZKBA 1JNFA 3U6SA 2OWSA 3MW0A 4U21A 2A5TA 2OPFA 4L4UA 3TCFA 4G6ZA 3PNVA 1UIUA 1Z7NE 4H65A 1NY6A 1UTBA 2W7YA 3KSJA 1R9QA 2XXUA 4EQBA 2I7PA 3DZDA 1A54A 4I81A 4C1UA 4B7GA 1B3HA 2HL7A 1J1NA 1OIBA 2OWTA 2RCAA 2XXYA 3KJTA 2Z7JA 3C32A 4XXUA 3MVZA 5H8QA 1B1XA 1NSFA 3CFZA 4FEDA 1H6UA 3A98B 1IXHA 1GTKA 4M9SA 3OENA 2ONSA 1GGGA 4LZZA 4F31B 3SYLA 1XXHA 2I58A 3KP0E 4IIWA 2F5QA 4KLNA 3K6WA 4N13A 4X48A 4EIWA 3U6EA 4FWGA 3KJ7A 4RK2A 2LXEA 1E9SA 2QMXA 3PUVE 1IY2A 4G68A 2G8LA 4S12A 4ZZEA 3VDFA 5DYIA 4QSEA 1QANA 2X7PA 1PDAA 3FVKA 2VQFM 4L16A 2YJPA 3VVEA 1Z5BA 3RTFB 1JETA 3UORA 2Q2EB 3PD9A 3ECRA 1IN7A 3W15C 4NF6B 4PFWA 4QSDA 2GHAA 2XXPA 4ONYA 4I62A 5AE4A 3HHFA 2ONRA 2NUVA 3TKDA 5IREB 2UVJA 1Z59A 4FATA 4Z0IA 4LZ5A 3MJNA 5LMUM 3CR9A 1FQAA 2R4JA 3ILUB 4AZFA 2QS4A 4JDFA 4NXMM 4OFOA 3IB0A 3PPOA 5TU0A 5FTLA 3MBPA 1IEJA 2ZXTA 1S3SA 1XNRM 2XXRA 3K1JA 4DLDA 4PT5A 2DXIA 3J2PB 1G4AE 3EPEA 1A40A 2HZKA 5M2VA 2PMSA 2RF1A 3T66A 3RY3A 1XVXA 3VDUA 4FEBA 3O28A 2DXYA 4PP0A 3VXBA 3IJOB 1IN8A 1JR3D 4DR2M 3PD8A 1EZ9A 2EUCA 4IJFA 4CHTB 4AG5A 5EXSA 1N77A 2RGHA 3SERA 3FXUA 4GXAA 4G8HA 2XXVA 3U6LA 2RKMA 3SEWA 4GHLA 1ZLQA 4CISA 3JZJA 2DHRA 3DP6A 4TOZA 3ILKA 2Z8DA 2Y7RA 1WDNA 2CV0A 1Y3NA 2Q89A 1B3FA 3L6GA 3HHXA 2CV1A 4AW4A 4JI8M 4IO2A 4H8JA 3MWBA 3UN6A 4B7FA 4X9TA 1Y1MA 1K82A 1XHYA 3JR5A 4GWOA 4MLVA 3OTOM 3FJMA 3LR1A 3OELA 3T1YM 4H5FA 4JWYA 2R6GE 5F1QA 1F9BA 2E0SA 4ZDMA 1J7KA 4FJPA 4GKKM 4GIPA 4DR5M 3N6TA 2GHBA 4QFOA 4UACA 3U5ZB 1SXJA 4LF8M 3GBAA 2Z8EA 4W5WA 4FIMA 3GLIB 4DUZM 1LCFA 3GRRA 3VE1B 2KZUA 1PJIA 4MB7A 2NXOA 4QFKA 1HSJA 4OENA 2H98A 2Z4RA 2ANJA 5H8NA 4YKIA 5L8DA 3RT8A 1JEUA 2XXIA 3SDFA 1JW1A 4NRWA 1IQ7A 2KLFA 4B3MM 3P7IA 4U1ZA 1MXVA 2H9BA 3G3JA 4YMBA 5KZTA 3ZCBB 1CE2A 1FNNA 2F5XA 3SYKA 3UJNA 1LV7A 1MPCA 5ITXA 4NF4B 1E94E 2L7IA 4GL8A 1LSTA 4N07A 3GQ5A 3SMSA 1P1WA 4G2ZA 1B40A 3FGSA 1SD3A 4OETA 4GITA 1FW0A 4XIGQ 3BKIB 1NHWC 3M8UA 3MVWA 2DWAA 2DQVA 3AOEC 3M6AA 1WXQA 4C0RA 1PBPA 1TFAA 3F11A 4XBOA 3MP6A 4LZ7A 1S7YA 4KHPM 3GLIA 4QOZC 1GV8A 2XSZD 2HFBA 3Q27A 5IWAM 3K0VA 1MY2A 5CMBA 4YHHM 4O3AA 4JI4M 4JI1M 2D7GA 4M1VA 4H67A 2R65A 1ZIUA 1A55A 3C4MA 5H8FB 3TQWA 4F1UA 4NXNM 2NWJA 1HQYE 1T0KA 3HJ8A 4UA8A 4IB2A 4BBAA 2Y20A 4YZZA 5FTJA 2P2AA 1FTJA 3U6DA 3K8ZA 2KW0A 4RPOA 1R6ZA 4FAJA 2ZYNA 3K1NA 5AA1A 2QCUA 3H4MA 4X1BA 3RUMA 2VD3A 1URDA 5AA4A 2LNHC 3TWLA 1OLAA 1OFHA 1DO2A 4OW0A 1TXFA 3LUYA 4PFYA 2I3VA 4LA9A 3FTDA 1Z5AA 1YUBA 3O6IA 1K3XA 5FTMA 3QK6A 5ITPA 1NNKA 4EF1A 1QW0A 5I2NA 1ZU0A 1N0TA 3FATA 4THIA 4F3GA 3FVGA 1XMQM 1D2NA 3OMBA 3FUUA 5A5XB 3SAWA 3PFIA 1EE8A 4ZPXA 2VGQA 4OVZB 2V3UA 3KOXE 1B2HA 4KYSA 4G68C 2I7NA 2IA4A 3TTRA 1DGHB 2DZNB 1H43A 4H1XA 5F3WA 2YFQA 4I5SA 1URSA 1JQFA 4H6DA 1LAHE 1ZTYA 2R46A 4FW9A 1IM2A 4GC5A 3IOWA 3GBBA 3B6TA 3S4UA 5ICTA 4IBDA 4AG6A 2D5WA 3H6WA 5H8FA 1AH5A 2CZLA 3FVOA 4MGZE 3HJQA 2Y0TA 4KCCA 3MZ9A 4JI7M 4DXCA 1P1OA 3RE8A 3TELA 2DS9A 2J7NA 4KPTA 2KRKA 4L17A 1QAOA 2FYIA 5JI3E 4OXVA 3U93A 3H06B 2C9OA 3KN8A 3TPZA 1SVXB 1B7UA 2R18A 3SHFA 4JB7A 3SAVA 1Q39A 1XC1A 4LJ4A 2CHGA 4GLIA 4F3SA 1B05A 3UMMA 1HNXM 3WHKA 1SYHA 4BDLA 3OO9A 4NMYA 4AQYM 3LBSA 4PFTA 3MK6A 1FQBA 4BDOA 3I51A 3U6PA 4ZEDA 1USYE 1Y3PA 5A5XA 3SARA 4RNSA 4HCWA 3IG8A 3LSXA 2HAUA 3U60B 3HU3A 4O3BA 2FNAA 3KOYE 1JVXA 3HN0A 1ELJA 5JTYA 1L1TA 2OCUA 4ELPA 1MS7A 2D3IA 3KFMA 2Y7PA 3GPPA 4GQOA 4EQ7A 4POXA 3QSLA 3RNNA 2G29A 3TYHA 2HKJA 4IY6A 4E0XA 4JI2M 1HT2E 4QF9A 3QWLA 5J1DA 4HW8A 3CG3A 4FORA 1QYRA 1OVBA 4G4NA 2DE2A 2XD3A 3Q8XA 2QP9X 4GMQA 3CRBA 4OMBA 4AB6A 3BFTA 2RCBA 1EZOA 2XEPA 1N76A 4EF2A 3BBRA 3TTKA 3FIRA 1ZBMA 2UVIA 1I69A 4NF8B 3G3HA 1PC3A 3KS4A 4DZ1A 3HV1A 2FE8A 3LSWA 4XKNA 1QULA 2QMWA 4JYAM 1XT8A 3D8LA 1TH4A 2VD2A 4LJ7A 2Y7WA 3M7GA 1YSYA 2XD2A 2F5NA 1B3EA 4RY1A 3RGYA 4I9DA 3H6UA 1DGFA 2D21A 1SXJC 3TTNA 2DE3A 4OYVA 1US5A 3VLWA 3O2AA 3FD3A 1EH3A 2DXRA 2M5ZA 3WHLA 4EDPA 2FA7A 5CMKA 4KR5A 1B58A 4L15A 4YU0A 2XFTA 3MC2A 2O68A 4LFBM 2ZANA 2L6OA 1L2DA 5EP3A 4U23A 4K3FA 4U4XA 4M0WA 4LJ9A 1LGBC 2R9JA 3EHTA 5EHSA 1VR5A 4DE8A 2DP8A 2F78A 5K2XA 1KWHA 2Y84A 2I4CA 1AMFA 2ZAOA 4MLQA 3JR4A 3DP8A 4M9ZA 2ZBKB 2XXQA 5I58B 4G4RA 2PX1A 3I4VA 1Z6TA 3J27B 3J7AS 2X49A 1Y4CA 3VK7A 2ZYKA 1QUJA 2H99A 3UK6A 2XXTA 4WEDA 3EHUA 1VFEA 3IJXB 3CVGA 3SEUA 1L5TA 5I56B 4DV7M 1EU8A 1B5JA 1MQGA 3IR1A 4YKKA 5HBCA 2BJWA 1DPPA 3QAXA 5ICQA 3CF2A 2VP1A 3PNYA 3TPAA 3UA8A 3EIHA 3ZKKA 1MQJA 3GPXA 5BWJA 3VKGA 3R7XA 3GLHB 2XXWA 5KQ8A 4B3TM 3PGFA 1IY0A 3B6QA 4FWDA 2HXWA 1US4A 1QKAA 1HR0M 1DSNA 3KOTA 4ZE8A 1LAFE 2Z3XA 4QFLA 3SKPA 3CG1A 3T93B 3U72A 4MGIE 4DV4M 4P0GA 2WKYA 1DOTA 3G7WA 4ZECA 4L78A 4R73A 4DUYM 5EXPA 2RKOA 3ILTB 4C1TA 4F18A 5CMCA 1XOCA 4JWOA 2XSZA 5H8SA 2UXBM 3L25A 5H37D 4GIZA 4HTGA 1H76A 1QAQA 1NNJA 4MH5A 1IN6A 2XFSA 5I58A 1IZ1A 1PEBA 2L09A 1OQHA 1G8PA 3B6WA 4GOTA 4D82A 1MY0A 4NWCA 1GVCA 3HJSA 3CFXA 3OXNA 4ISUA 2UVGA 4N6PA 3RGSA 5IZ7D 3U6QA 2PT2A 1LLSA 4QHTA 1B5IA 3FUZA 4JSOA 2J7OA 4JI5M 3HHZA 4PCZA 1N3XA 4DXBA 2FFJA 4YKJA 4YB5A 4PFUA 1BTJA 3VV5A 2DWNA 1Q1KA 5AA3A 3RLFE 2F35A 3FJGA 4F19A 5HM4B 4ELOA 3L28A 2FNCA 2QBYB 2QS3A 1LFHA 4R6HA 4OESA 4KD5A 1LAXA 5LOMA 4FE8A 3J80S 3KDSE 4MGKE 3CF0A 4IJEA 2UUBM 1XMOM 4DR4M 3L6HA 3W9VA 4GKJM 2CEAA 2H5YA 3TQLA 3T1HM 5ITYA 5H8HB 5KO3A 3FJ7A 3MP8A 4PDGA 3K02A 3U6OA 5EYFA 4H5GA 3NBIA 1E32A 2XGNA 2YNMD 1TGUA 2UUCM 3N94A 1M5FA 4IBCA 2ESNA 5CI5A 4R75A 1L1ZA 3CSBA 1PB8A 1G59A 2V3TA 4XTCQ 1Q35A 4R2FA 4P0IA 3LVVA 4B3RM 3TAJA 4JI6M 4NF6A 3I4YA 1T3TA 4AKHA 3MAMA 2RINA 1BKAA 5ITUA 3Q25A 5I2KB 2D7HA 1D9VA 4Z8XA 5BR8M 4OWDA 1NVMA 2I3WA 4OX9M 1MY3A 1B52A 1MH3A 2XXXA 4XKPA 1P99A 3E3KA 3FUXA 1B7ZA 2OLBA 1R7RA 2DWMA 2QBYA 3MZBA 3RTWB 3VVDA 4LFAM 1SW1A 5CM6A 1G41A 2X26A 5CC2A 2Z8FA 3ZC7B 2E5LM 2F8DA 2OZZA 1M5EA 1A8FA 5EHMA 3D4GA 4X1DA 4ITQA 1GKIA 2C9CA 3CI8A 5ELVA 3MPLA 2DWJA 1USYH 1I94M 1IXSB 4LF6M 1OJLA 1DGBA 5H8HA 1FQDA 1LBCA 3SBJA 1O63A 4X65M 3TWMA 4LP2B 2E1SA 5I57B 2DWZB 2Q9TA 3IB1A 3G3GA 3VLVA 4F1YA 2AIXA 3O66A 1O7TA 3D4CA 2Q2CA 1B5HA 4DV1M 1R1NA 4YB6A 4R6YA 4JBZA 3M0EA 4GC9A 3GO8A 1KSFX 1FJGM 5K2YA 1R2YA 2CV2A 3FUVA 3IO6A 3L27A 4U22A 2XX7A 5EP2A 1Z7ME 4IY5A 4LRSA 1NJFA 5I2KA 1GVNA 1ZJLA 3VFJA 3TUSA 3PUXE 1G3IA 2Z4SA 3T9HB 3VXCA 3PVSA 1MQHA 1XHBA 3O29A 4DV5M 3THGA 1JVYA 2A5SA 3UK4A 3N5LA 1BLFA 3EIEA 4IO7A 3KEIA 1GL6A 2ZNUA 3LSLA 4NF5B 1HQCA 2GFEA 1A99A 1MG1A 3EN3A 3VVFA 4MBPA 3U5ZA 3VFDA 4L8RC 1FTKA 2CHQA 4TLMB 4IBBA 2IEEA 5GKNA 4FECA 1H45A 4ESWA 1NKXA 5I57A 1P1QA 3RPWA 2L7HA 1HSLA 5KQDA 3TFLA 1Y9UA 3R6UA 1YPNA 4LRTA 1VE4A 5FHNA 3SC3A 1IUDA 3GLGB 1W5TA 1FCKA 3U6CA 3V5AA 3S2VA 4DCXA 4QRZA 1Q3BA 4E0WA 2V25A 3BFUA 2O6AA 2NQ8C 2I49A 2QPQA 2RGOA 4G4OA 3HGIA 3KOZE 3KW6A 5FTNA 4NF4A 4F1VA 4U1OA 1ANFA 4P11A 3ZSFA 3A42A 1IIWA 3W0FA 4FWHA 3IO4A 3VKHA 1XS5A 3A45A 1L2BA 4X64M 4F22A 4KCDA 3D8BA 3VLFB 2O5RA 4WW0A 1MPBA 2Y0QA 3MQ9A 2P5TA 1K3WA 2YPNA 4R7GA 1IXIA 2EO2A 3ODBA 5AA2D 1SW2A 4AKGA 3TQSA 3MP1A 3K6UA 1SXJE 4NF5A 3TMGA 3A3UA 3PPRA 5E26A 2F5PA 4II7A 1SBPA 5ITTA 3MJ5A 1IXGA 4Z6YA 1UM8A 1TWYA 5KPRA 1MM6A 2XZUA 4QHSA 4IO4A 3H7MA 1MXXA 2M8CA 1AOVA 2HQ0A 4ESXA 1XWIA 3K1PA 3O6HA 1N36M 5CBSA 4PDIA 2Q8JA 4H0WA 3HHWA 3IX1A 4QHQA 4IO5A 1B4ZA 5L9MA 1UTHB 2OBGA 3FUTA 4LVQA 2V6ZM 3UZUA 2LH0A 3TCHA 3DELB 3AOGA 3GP1A 3U61B 2F4VM 4F39A 1O64A 3FVNA 2D7EA 1NL5A 3OEKA 3IK6B 4GL0A 1HNWM 5C1BA 4REZA 4EXKA 2O1MA 1IN4A 1OQGA 2QL3A 2AHMA 3UGWA 1XC8A 4DV0M 1D4NA 4LCBA 4RNAA 1VDDA 3EQ1A 3E4RA 4ZEKA 4DR7M 4JN6A 3B7DA 3I6VA 4MF3A 2AL5A 2ONKE 2GRVA 2V1CA 2PYYA 3FZVA 5DVFA 3SEYA 2UXCM 4FCWA 3GPYA 1TDHA 4KFQA 5EXTA 4OHNA 3DLNA 2XH9A 4FCTA 3Q28A 4GRKA 4RXLA 4NRVA 1LBBA 4OVZA 1DPEA 1FQFA 4EXLA 2O1LA 5KCJB 1ZAEA 1DGHA 3C34A 4O3CA 1AIVA 4OVJA 1OFIA 3QUJA 1W5SA 4POWA 1NNFA 4EQ9A 5L9SA 3MVXA 2F6GA 1JR3A 2ZM6M 2XXHA 4Z7EA 2R62A 3PMXA 5FHOA 2O7UA 3C36A 4M9XA 2I0CA 4I8CA 4KYDA 1DGGA 3DM0A 3U61A 3O97A 2YLNA 1MU5A 4Q30B 2B3BA 4NSOB 5KDTB 1M5DA 3LMMA 4KODA 4ZS9A 1Q3CA 3PUZE 3Q29A 3TEPA 4ZE9A 3UIFA 4QFNA 3T9UA 1IY1A 3J7BA 2BJVA 5TPAB 1P1NA 1HNZM 5FHMA 4BDMA 1MXZA 4LGYA 4LZJA 2DVWB 4LY6A 3PMWA 4B3SM 2A5TB 2K47A 2EA0A 1BIYA 3FV2A 3OO6A 8CATA 2H25A 2BJJX 3T22A 3T38A 3LQRA 3J81S 2FOIC 1MY4A 1L2CA 5FTHA 5KCJA 3U60A 4CGYB 4XGIA 4PETA 1IBLM 4IBEA 4NL4H 1S9TA 4LONB 2V3QA 3FTCA 4LJ6A 1SDXA 2Y7KA 4OZ9A 4HLQA 1HSEA 1N7WA 4KO8A 3OSRA 4GRIA 1EZPA 1PB7A 2PBWA 2O84X 3R8FA 3H3GA 3IOVA 5DT6A 3U94A 1H3DA 2F36A 5KDTA 3L26A 3KP1E 1XXHB 2V84A 2M60A 4LZ8A 3R26A 3JAMS 1LFGA 4LATA 3AOEA 3GRYA 4NE4A 4R72A 4OFJA 3SEVA 3KXEC 2I4BA 2VHAA 1B4HA 3ZH9B 3FV1A 4EUOA 5TPAA 4MM3B 1GL7A 4NF8A 2QZ4A 2X7QA 3SASA 3HU1A 3L29A 4LGMA 3HCQA 2REGA 5DYGA 1KFVA 5KPTA 1B0HA 2DVCA 4YAHX 1LCTA 3K2DA 4G68B 1Y20A 3S9NC 3K01A 1XNQM 4G77A 3HPIA 2B3FA 3C31A 4HCYA 2OK2A 3C35A 1B1HA 2NVUB 1YE9A 4A3VB 2QRYA 3FKEA 5AA2B 1E9RA 3T9XB 1UQWA 3L2AA 1N32M 1SI1A 2VQEM 4F3PA 3FXRA 5JI2E 1B32A 3GRVA 1MQIA 3IORA 7CATA 3FYCA 2XLJA 2OJTA 4R9FA 4JXJA 5JEIA 3QAUA 3SFZA 2PVUA 1I6AA 4WURA 2UVHA 3FASA 3H4ZA 3IOUA 4F3BA 5A2QS 3K00A 4I1DA 4LFCM 3FUWA 3FTFA 5DYHA 3AV0A 3ZKLA 1JW5A 3QIMA 5DVIA 4BDQA 5FTIA 4BDRA 3KS8A 4Q5TA 5C18A 3USDA 3TE6A 1CB6A 1QKBA 2DWIA 2LWXA 3HHYA 2QJEA 3FXQA 5LMNM 3SESA 3SETA 3KSXA 5I56A 1QVSA 4MH0E 5E6JA 1NNTA 1ATGA 3H6TA 3KZGA 4FCVA 3NWLA 4F2OA 4LQ5A 4LQ2A 4ZEFA 1FTLA 3GLHA 1FTOA 1DTZA 2HEUA 3V89B 2F7AA 2YR0A 3SAUA 3IAZA 4WKMA 2G93A 1D3KA 4FVMA 5EQTA 4LF4M 4JSDA 5AA2A 3GQ4A 4H8IA 3M3KA 1Z5CA 3FYDA 3V83A 3EHSA 2V1UA 3K4UA 4DV6M 1PBQA 2KXEA 3OOAA 3RGPA 3ZS6A 1MH4A 1NNPA 3CIJA 4ZZAA 5JK4A 1YTVA 4NSRA 1MRPA 3LC8A 3K6VA 4JI0M 1IQPA 4LJ8A 5B70A 1D9YA 2GH9A 1RKMA 4U2RA 1IITA 2XZFA 4X66M 3IB2A 4RF0A 3WAEA 2Z23A 4LF7M 1QAMA 3DP4A 2HAVA 3HHGA 3VK8A 1RYXA 2PT1A 2QS2A 3AKZA 4M0DA 3OD7A 1N7XA 1YAEA 4BLCA 4M4GA 4IBKA 2I48A 2KA6B 4AQ4A 3LQQA 4WXJA 3E9SA 3I3VA 4KHZE 4RA1A 4YY3M 3SHGB 1S50A 4AB5A 3TWKA 2ZNSA 2I6EA 1QQWA 2ALUA 1SXJB 1SI0A 1ZMGA 2KEBA 2LAOA 2KRUA 5CBRA 2VIIA 3KVWA 3PPPA 5EXXA 2UXAA 3VDPA 3THIA 3GLFB 1N75A 3E13X 4GFRA 1J5EM 3IL1B 2DOJA 2F7BA 2DVZA 2XHDA 3HU2A 1QZMA 3G3FA 4DV3M 4F2QA 5H8NB 1FQCA 4PE5B 1QUKA 1VFDA 2NOOA 5FTKA 4R9GA 4NOOB 1KYIA 1JEVA 5B7DA 1YCJA 2F34A 3DA1A 3KG2A 3K2LA 3OO7A 1MM7A 4OTEA 1GR2A 3Q26A 1TH3A 1MDP1 4D81A 3BOSA 4GVOA 1B9JA 3KBRA 1NFTA 3AFHA 1LAGE 3E9XA 2Y7IA 4RPNA 3KN7A 4ZEIA 4LJ5A 3FD9A 3HO7A 1X37A 2UYFA 4MFIA 1PB9A 2CHVA 4B08A 3KFUG 4NTLA 4JI3M 3V8XB 3KOWE 1NH7A 4YICA 2O51A 3GLBA 2B65A 1NH8A 2CFOA 1ZQ9A 3GRUA 3TCGA 2DWLA 2P0SA 2RC8A 4RYAA 3CF6E 2RC9A 1B3GA 1MXWA 4PD2A 4RF1A 3N6UA 1IBKM 4IO3A 5I84A 5HPQA 3A46A 1OVTA 1WVJA 2DWHA 4HL4A 5FSWA 4ZEBA 2DZOB 1MQDA 2CUZA 3QXMA 3RN8A 3GLFA 2P1SA 2OQ4A 3H03A 5TP9B 1N78A 1B0LA 2F7CA 2I0BA 1PJJA 3PPQA 4R6KA 3G3IA 1NHGC 3DFZA 2UYEA 3QUFA 3RQTA 2Q2AA 2HZLA 5DEXB 4P16A 3U1OA 1N04A 3AXFA 2DYXA 3N26A 1TDZA 2HHHM 1VSOA 2QSXA 2F6PA 5L9OA 2C98A 2RC7A 3JV9A 4LF5M 4R2BA 3SEXA 1MDQA 3QYTA 4DR1M 1POY1 4ELQA 4I8OA 2THIA 5FLXS 1I6BA 4ELRA 1FTMA 3C9HA 2XF3A 4QFPA 4LJAA 5EP4A 2W82A 4DIGA 3H6VA 5AA4B 4OEVA 4QNRA 4OQOA 3A09A 2V93A 3SATA 2H4IA 5IAIA 4QOSA 5CMMA 4DCYA 1JQJC 1I6QA 5BUUA 2Q88A 3TTMA 1II5A 3MZ1A 3PMVA 4QSCA 5ISUA 4KYEA 5I2NB 1AL3A 4NWDA 5I59B 2G5GX 4FD2A 4G4PA 1B46A 5ITOA 2ERCA 4YB7A 1MXYA 2O7IA 3U92A 2R4EA 1IXRC 1B6HA 3WAFA 1IXZA 5TP9A 1R6BX 4AKIA 1N34M 4NEDA 1R9LA 4LF9M 3CSGA 4Q0CA 4GHAA 4DR6M 4YKPA 1QUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEX A;  3GZG A;  4KI0 E;  1N84 A;  3JYR A;  5IKB A;  2XX8 A;  4OFL A;  1DMB A;  3U8Q A;  2VOZ A;  2F97 A;  5F7V A;  1MY1 A;  3OEM A;  4XKQ A;  2ABH A;  1POT A;  1M5C A;  5CRY A;  4IGT A;  4OER A;  1RYO A;  2ZNT A;  3K6X A;  1B51 A;  2HCA A;  1A7L A;  1LB9 A;  3PPN A;  4IGR A;  1OMP A;  5I59 A;  2R71 A;  3CFL A;  1BP5 A;  3OO8 A;  4JXI A;  3S9E A;  4KQP A;  3PV0 E;  3PUW E;  4OEU A;  3GXA A;  3T9V A;  5JTY B;  4HS7 A;  2QS1 A;  1FQE A;  4R74 A;  4GD5 A;  4TLL B;  4GXS B;  1SW4 A;  1SQY A;  1URG A;  2O69 A;  3W9W A;  1OLC A;  3S9L C;  3HST A;  3KOS A;  1A8E A;  4XKR A;  4G8M A;  3TOD A;  4LUB A;  1UIV A;  2ZMB A;  4G8N A;  3O6G A;  3VLU A;  2ZYM A;  3T96 B;  3C33 A;  1Y1Z A;  4F29 A;  3TTL A;  3MPK A;  1MPD A;  4ND9 A;  1Y4T A;  3KN3 A;  2AL4 A;  1UTH A;  1MXU A;  3IOT A;  3MUQ A;  5DVJ A;  2AYS A;  4GF8 A;  1B7H A;  3KGC A;  1M5B A;  1NMU A;  3EF7 A;  3I5O A;  5DTB A;  4JWX A;  4PQJ A;  1IXC A;  4WEP A;  1Y3Q A;  3MVY A;  1WOD A;  3M3F A;  3K1M A;  2REJ A;  1LB8 A;  3OSQ A;  1B3L A;  1TFD A;  1SW5 A;  1UTB B;  3UP9 A;  3ONM A;  2XX9 A;  1H44 A;  4TQU Q;  4YMA A;  4ECF A;  4DDD A;  3LSF B;  1QJM A;  4U4S A;  1P1U A;  3PU5 A;  3PUY E;  5H8Q B;  3G3K A;  1JW4 A;  3O9P A;  3M3L A;  1TT1 A;  2Z22 A;  1N3W A;  4DXU A;  2CMO A;  4BDN A;  1XVY A;  4RK9 A;  3TDJ A;  4RJZ A;  3A3C A;  1LFI A;  1DTG A;  4Q8R A;  4IO6 A;  3TZA A;  3RT6 B;  2ZYO A;  2DE4 A;  1SYI A;  3S9M C;  2DSF A;  4BLA A;  1ZKB A;  1JNF A;  2OWS A;  3MW0 A;  4U21 A;  2A5T A;  3TCF A;  1UIU A;  1Z7N E;  4H65 A;  1UTB A;  2W7Y A;  3KSJ A;  1R9Q A;  2XXU A;  4EQB A;  1A54 A;  4C1U A;  1B3H A;  1J1N A;  1OIB A;  2OWT A;  2RCA A;  2XXY A;  3KJT A;  3C32 A;  4XXU A;  3MVZ A;  5H8Q A;  1B1X A;  3CFZ A;  4FED A;  1IXH A;  1GTK A;  3OEN A;  2ONS A;  1GGG A;  4F31 B;  2I58 A;  3K6W A;  4N13 A;  4X48 A;  3KJ7 A;  4RK2 A;  2QMX A;  3PUV E;  4G68 A;  4ZZE A;  3VDF A;  4QSE A;  2X7P A;  1PDA A;  3FVK A;  2YJP A;  3VVE A;  3RTF B;  1JET A;  3UOR A;  3PD9 A;  3ECR A;  3W15 C;  4NF6 B;  4PFW A;  4QSD A;  2GHA A;  2XXP A;  4ONY A;  4I62 A;  5AE4 A;  3HHF A;  2ONR A;  2NUV A;  3TKD A;  2UVJ A;  4FAT A;  4Z0I A;  4LZ5 A;  3MJN A;  3CR9 A;  1FQA A;  3ILU B;  2QS4 A;  4JDF A;  4OFO A;  3IB0 A;  3PPO A;  5TU0 A;  3MBP A;  1IEJ A;  2ZXT A;  2XXR A;  4DLD A;  3EPE A;  1A40 A;  2HZK A;  5M2V A;  2PMS A;  2RF1 A;  3T66 A;  3RY3 A;  1XVX A;  4FEB A;  3O28 A;  2DXY A;  4PP0 A;  3VXB A;  3IJO B;  3PD8 A;  1EZ9 A;  3SER A;  3FXU A;  4GXA A;  4G8H A;  2XXV A;  2RKM A;  3SEW A;  1ZLQ A;  3JZJ A;  3DP6 A;  4TOZ A;  2Z8D A;  2Y7R A;  1WDN A;  1Y3N A;  2Q89 A;  1B3F A;  3L6G A;  4IO2 A;  4H8J A;  3MWB A;  3UN6 A;  4X9T A;  1Y1M A;  1XHY A;  4GWO A;  4MLV A;  3FJM A;  3LR1 A;  3OEL A;  4H5F A;  4JWY A;  2R6G E;  5F1Q A;  1F9B A;  2E0S A;  4ZDM A;  4FJP A;  3N6T A;  2GHB A;  4QFO A;  4UAC A;  3GBA A;  2Z8E A;  4FIM A;  1LCF A;  3VE1 B;  2NXO A;  4QFK A;  1HSJ A;  4OEN A;  2H98 A;  2ANJ A;  5H8N A;  4YKI A;  5L8D A;  3RT8 A;  1JEU A;  2XXI A;  3SDF A;  1JW1 A;  1IQ7 A;  2KLF A;  3P7I A;  4U1Z A;  1MXV A;  2H9B A;  3G3J A;  4YMB A;  5KZT A;  1CE2 A;  2F5X A;  1MPC A;  4NF4 B;  4GL8 A;  1LST A;  4N07 A;  1P1W A;  4G2Z A;  1B40 A;  3FGS A;  1SD3 A;  4OET A;  1FW0 A;  4XIG Q;  3BKI B;  3M8U A;  3MVW A;  2DWA A;  2DQV A;  4C0R A;  1PBP A;  1TFA A;  3F11 A;  3MP6 A;  4LZ7 A;  1S7Y A;  1GV8 A;  2HFB A;  3Q27 A;  3K0V A;  1MY2 A;  5CMB A;  4O3A A;  4M1V A;  4H67 A;  1ZIU A;  1A55 A;  3C4M A;  5H8F B;  3TQW A;  4F1U A;  2NWJ A;  1T0K A;  4UA8 A;  4IB2 A;  4YZZ A;  2P2A A;  1FTJ A;  4RPO A;  1R6Z A;  4FAJ A;  2ZYN A;  3K1N A;  5AA1 A;  4X1B A;  3RUM A;  2VD3 A;  1URD A;  5AA4 A;  1OLA A;  1TXF A;  3LUY A;  4PFY A;  2I3V A;  4LA9 A;  3O6I A;  3QK6 A;  5ITP A;  1NNK A;  4EF1 A;  1QW0 A;  5I2N A;  1ZU0 A;  1N0T A;  3FAT A;  4THI A;  4F3G A;  3FVG A;  3OMB A;  5A5X B;  2VGQ A;  2V3U A;  1B2H A;  4KYS A;  4G68 C;  2IA4 A;  3TTR A;  1H43 A;  4H1X A;  1URS A;  1JQF A;  4H6D A;  1LAH E;  1ZTY A;  3IOW A;  3GBB A;  3B6T A;  3S4U A;  5ICT A;  2D5W A;  3H6W A;  5H8F A;  1AH5 A;  2CZL A;  3FVO A;  4KCC A;  3MZ9 A;  4DXC A;  1P1O A;  3TEL A;  2DS9 A;  4KPT A;  4L17 A;  2FYI A;  4OXV A;  3U93 A;  3H06 B;  3KN8 A;  1SVX B;  1B7U A;  4JB7 A;  1XC1 A;  4GLI A;  4F3S A;  1B05 A;  1SYH A;  4BDL A;  3OO9 A;  4NMY A;  3LBS A;  4PFT A;  1FQB A;  4BDO A;  4ZED A;  1USY E;  1Y3P A;  5A5X A;  4RNS A;  4HCW A;  3LSX A;  2HAU A;  4O3B A;  1JVX A;  3HN0 A;  1ELJ A;  5JTY A;  4ELP A;  2OCU A;  1MS7 A;  2D3I A;  3KFM A;  2Y7P A;  4GQO A;  4EQ7 A;  4POX A;  3QSL A;  3RNN A;  2G29 A;  3TYH A;  4IY6 A;  4E0X A;  4QF9 A;  5J1D A;  4HW8 A;  3CG3 A;  4FOR A;  1OVB A;  2DE2 A;  2XD3 A;  3CRB A;  4OMB A;  4AB6 A;  3BFT A;  2RCB A;  1EZO A;  1N76 A;  4EF2 A;  3BBR A;  3TTK A;  3FIR A;  1ZBM A;  2UVI A;  1I69 A;  4NF8 B;  3G3H A;  1PC3 A;  4DZ1 A;  3HV1 A;  4XKN A;  3LSW A;  1QUL A;  2QMW A;  1XT8 A;  2VD2 A;  2Y7W A;  2XD2 A;  1B3E A;  4RY1 A;  3RGY A;  4I9D A;  3H6U A;  2D21 A;  3TTN A;  2DE3 A;  4OYV A;  1US5 A;  3VLW A;  3O2A A;  3FD3 A;  1EH3 A;  2DXR A;  4EDP A;  2FA7 A;  5CMK A;  4KR5 A;  1B58 A;  4YU0 A;  3MC2 A;  2O68 A;  4U23 A;  4K3F A;  4U4X A;  2R9J A;  3EHT A;  1LGB C;  5EHS A;  1VR5 A;  4DE8 A;  2DP8 A;  2F78 A;  5K2X A;  1KWH A;  2Y84 A;  2I4C A;  1AMF A;  4MLQ A;  3DP8 A;  2XXQ A;  5I58 B;  2PX1 A;  1Y4C A;  2ZYK A;  1QUJ A;  2H99 A;  2XXT A;  4WED A;  3EHU A;  1VFE A;  3IJX B;  3CVG A;  3SEU A;  1L5T A;  5I56 B;  1EU8 A;  1B5J A;  1MQG A;  3IR1 A;  4YKK A;  5HBC A;  1DPP A;  3QAX A;  5ICQ A;  2VP1 A;  3UA8 A;  3TPA A;  3ZKK A;  1MQJ A;  5BWJ A;  3R7X A;  2XXW A;  3PGF A;  3B6Q A;  2HXW A;  1US4 A;  1QKA A;  1DSN A;  3KOT A;  4ZE8 A;  1LAF E;  4QFL A;  3SKP A;  3CG1 A;  3T93 B;  3U72 A;  4P0G A;  2WKY A;  1DOT A;  3G7W A;  4ZEC A;  4R73 A;  3ILT B;  4C1T A;  4F18 A;  5CMC A;  1XOC A;  4JWO A;  5H8S A;  4GIZ A;  4HTG A;  1H76 A;  4MH5 A;  5I58 A;  1IZ1 A;  1PEB A;  1OQH A;  3B6W A;  4GOT A;  1MY0 A;  4NWC A;  1GVC A;  3CFX A;  3OXN A;  4ISU A;  2UVG A;  4N6P A;  2PT2 A;  1LLS A;  1B5I A;  3FUZ A;  4JSO A;  1N3X A;  4DXB A;  4YKJ A;  4YB5 A;  4PFU A;  1BTJ A;  3VV5 A;  1Q1K A;  5AA3 A;  3RLF E;  2F35 A;  3FJG A;  4F19 A;  5HM4 B;  4ELO A;  2FNC A;  2QS3 A;  1LFH A;  4R6H A;  4OES A;  4KD5 A;  1LAX A;  5LOM A;  4FE8 A;  3L6H A;  3W9V A;  2H5Y A;  3TQL A;  5H8H B;  3FJ7 A;  3MP8 A;  3K02 A;  5EYF A;  4H5G A;  3N94 A;  1M5F A;  2ESN A;  5CI5 A;  4R75 A;  3CSB A;  1PB8 A;  2V3T A;  4XTC Q;  1Q35 A;  4R2F A;  4P0I A;  3TAJ A;  4NF6 A;  3MAM A;  2RIN A;  1BKA A;  3Q25 A;  5I2K B;  1D9V A;  4OWD A;  2I3W A;  1MY3 A;  1B52 A;  1MH3 A;  2XXX A;  4XKP A;  1P99 A;  3E3K A;  1B7Z A;  2OLB A;  3MZB A;  3RTW B;  3VVD A;  1SW1 A;  5CM6 A;  2X26 A;  5CC2 A;  2Z8F A;  2F8D A;  2OZZ A;  1M5E A;  1A8F A;  5EHM A;  3D4G A;  4X1D A;  3CI8 A;  5ELV A;  3MPL A;  2DWJ A;  1USY H;  5H8H A;  1FQD A;  1LBC A;  1O63 A;  4LP2 B;  2E1S A;  5I57 B;  2Q9T A;  3IB1 A;  3G3G A;  3VLV A;  4F1Y A;  2AIX A;  3O66 A;  1O7T A;  3D4C A;  2Q2C A;  1B5H A;  1R1N A;  4YB6 A;  4R6Y A;  4JBZ A;  5K2Y A;  3IO6 A;  4U22 A;  2XX7 A;  1Z7M E;  4IY5 A;  5I2K A;  1ZJL A;  3VFJ A;  3TUS A;  3PUX E;  3T9H B;  3VXC A;  1MQH A;  3O29 A;  1JVY A;  2A5S A;  3UK4 A;  3N5L A;  1BLF A;  4IO7 A;  3KEI A;  2ZNU A;  3LSL A;  4NF5 B;  2GFE A;  1A99 A;  1MG1 A;  3EN3 A;  3VVF A;  4MBP A;  1FTK A;  4TLM B;  2IEE A;  4FEC A;  1H45 A;  4ESW A;  1NKX A;  5I57 A;  1P1Q A;  3RPW A;  1HSL A;  3TFL A;  1Y9U A;  3R6U A;  1YPN A;  1VE4 A;  5FHN A;  1IUD A;  1FCK A;  3V5A A;  3S2V A;  4DCX A;  4QRZ A;  4E0W A;  2V25 A;  3BFU A;  2O6A A;  2I49 A;  2QPQ A;  4NF4 A;  4F1V A;  4U1O A;  1ANF A;  4P11 A;  3ZSF A;  1IIW A;  3IO4 A;  1XS5 A;  4F22 A;  4KCD A;  1MPB A;  3MQ9 A;  2YPN A;  1IXI A;  3ODB A;  5AA2 D;  1SW2 A;  3MP1 A;  3K6U A;  4NF5 A;  3TMG A;  3A3U A;  3PPR A;  1SBP A;  1IXG A;  1TWY A;  1MM6 A;  4IO4 A;  3H7M A;  1MXX A;  2M8C A;  1AOV A;  2HQ0 A;  4ESX A;  3K1P A;  3O6H A;  5CBS A;  2Q8J A;  4H0W A;  3IX1 A;  4QHQ A;  4IO5 A;  1B4Z A;  5L9M A;  1UTH B;  2OBG A;  4LVQ A;  3TCH A;  3DEL B;  4F39 A;  1O64 A;  3FVN A;  1NL5 A;  3OEK A;  3IK6 B;  4GL0 A;  4EXK A;  2O1M A;  1OQG A;  2QL3 A;  3UGW A;  1D4N A;  3EQ1 A;  3E4R A;  4ZEK A;  3B7D A;  3I6V A;  4MF3 A;  2AL5 A;  2ONK E;  2GRV A;  2PYY A;  3FZV A;  5DVF A;  3SEY A;  4KFQ A;  4OHN A;  3DLN A;  3Q28 A;  4GRK A;  4RXL A;  1LBB A;  1DPE A;  1FQF A;  4EXL A;  2O1L A;  5KCJ B;  3C34 A;  4O3C A;  1AIV A;  4OVJ A;  3QUJ A;  4POW A;  1NNF A;  4EQ9 A;  5L9S A;  3MVX A;  2F6G A;  2XXH A;  4Z7E A;  3PMX A;  5FHO A;  2O7U A;  3C36 A;  2I0C A;  4I8C A;  4KYD A;  3DM0 A;  3O97 A;  2YLN A;  4Q30 B;  2B3B A;  5KDT B;  1M5D A;  4ZS9 A;  3PUZ E;  3Q29 A;  3TEP A;  4ZE9 A;  3UIF A;  4QFN A;  3T9U A;  5TPA B;  1P1N A;  5FHM A;  4BDM A;  1MXZ A;  3PMW A;  2A5T B;  1BIY A;  3FV2 A;  3OO6 A;  2H25 A;  2BJJ X;  3T22 A;  1MY4 A;  5FTH A;  5KCJ A;  4PET A;  1S9T A;  4LON B;  2V3Q A;  1SDX A;  2Y7K A;  4OZ9 A;  1HSE A;  1N7W A;  3OSR A;  1EZP A;  1PB7 A;  2PBW A;  2O84 X;  3IOV A;  3H3G A;  5DT6 A;  3U94 A;  1H3D A;  2F36 A;  5KDT A;  2V84 A;  4LZ8 A;  3R26 A;  1LFG A;  4LAT A;  4NE4 A;  4R72 A;  4OFJ A;  3SEV A;  2I4B A;  2VHA A;  1B4H A;  3FV1 A;  4EUO A;  5TPA A;  4NF8 A;  2X7Q A;  3HCQ A;  2REG A;  1B0H A;  2DVC A;  4YAH X;  1LCT A;  3K2D A;  4G68 B;  1Y20 A;  3S9N C;  3K01 A;  4G77 A;  3HPI A;  2B3F A;  3C31 A;  4HCY A;  2OK2 A;  3C35 A;  1B1H A;  2NVU B;  2QRY A;  5AA2 B;  3T9X B;  1UQW A;  1SI1 A;  4F3P A;  3FXR A;  1B32 A;  1MQI A;  3IOR A;  2OJT A;  5JEI A;  4R9F A;  2PVU A;  1I6A A;  2UVH A;  3FAS A;  3H4Z A;  3IOU A;  4F3B A;  3K00 A;  4I1D A;  5DYH A;  3ZKL A;  1JW5 A;  3QIM A;  5DVI A;  4BDQ A;  5FTI A;  4BDR A;  4Q5T A;  3USD A;  1CB6 A;  1QKB A;  2DWI A;  2QJE A;  3FXQ A;  3SES A;  3SET A;  3KSX A;  5I56 A;  1QVS A;  1NNT A;  1ATG A;  3H6T A;  3KZG A;  4F2O A;  4LQ5 A;  4LQ2 A;  4ZEF A;  1FTL A;  1FTO A;  1DTZ A;  2HEU A;  3V89 B;  2F7A A;  3IAZ A;  4WKM A;  2G93 A;  1D3K A;  4JSD A;  5AA2 A;  4H8I A;  3M3K A;  3V83 A;  3EHS A;  3K4U A;  1PBQ A;  3OOA A;  3ZS6 A;  1MH4 A;  1NNP A;  3CIJ A;  4ZZA A;  5JK4 A;  1YTV A;  1MRP A;  3LC8 A;  3K6V A;  5B70 A;  1D9Y A;  2GH9 A;  1RKM A;  4U2R A;  1IIT A;  3IB2 A;  3WAE A;  2Z23 A;  3DP4 A;  2HAV A;  3HHG A;  1RYX A;  2PT1 A;  2QS2 A;  3OD7 A;  1N7X A;  1YAE A;  4M4G A;  2I48 A;  4AQ4 A;  4WXJ A;  3I3V A;  4KHZ E;  4RA1 A;  4AB5 A;  1S50 A;  2ZNS A;  2I6E A;  2ALU A;  1SI0 A;  1ZMG A;  2LAO A;  5CBR A;  3PPP A;  2UXA A;  3THI A;  3E13 X;  4GFR A;  3IL1 B;  2DOJ A;  2F7B A;  2DVZ A;  2XHD A;  3G3F A;  4F2Q A;  5H8N B;  1FQC A;  4PE5 B;  1QUK A;  1VFD A;  2NOO A;  4R9G A;  5B7D A;  1JEV A;  1YCJ A;  2F34 A;  3KG2 A;  3OO7 A;  1MM7 A;  4OTE A;  1GR2 A;  3Q26 A;  1MDP 1;  4GVO A;  1B9J A;  3KBR A;  1NFT A;  1LAG E;  3E9X A;  2Y7I A;  4RPN A;  3KN7 A;  4ZEI A;  3HO7 A;  2UYF A;  4MFI A;  1PB9 A;  4NTL A;  3V8X B;  1NH7 A;  4YIC A;  2O51 A;  3GLB A;  2B65 A;  1NH8 A;  3TCG A;  2P0S A;  2RC8 A;  4RYA A;  2RC9 A;  1B3G A;  1MXW A;  3N6U A;  4IO3 A;  5I84 A;  5HPQ A;  1OVT A;  1WVJ A;  2DWH A;  4ZEB A;  1MQD A;  3QXM A;  3RN8 A;  2P1S A;  3H03 A;  5TP9 B;  1B0L A;  2F7C A;  2I0B A;  3PPQ A;  4R6K A;  3G3I A;  2UYE A;  3RQT A;  3QUF A;  2Q2A A;  2HZL A;  5DEX B;  3U1O A;  1N04 A;  3AXF A;  2DYX A;  3N26 A;  1VSO A;  2QSX A;  2F6P A;  5L9O A;  2RC7 A;  3JV9 A;  4R2B A;  3SEX A;  1MDQ A;  3QYT A;  1POY 1;  4ELQ A;  2THI A;  1I6B A;  4ELR A;  1FTM A;  3C9H A;  4QFP A;  4DIG A;  3H6V A;  5AA4 B;  4OEV A;  4OQO A;  3A09 A;  2V93 A;  2H4I A;  5IAI A;  5CMM A;  4DCY A;  1I6Q A;  5BUU A;  2Q88 A;  3TTM A;  1II5 A;  3MZ1 A;  3PMV A;  4QSC A;  5ISU A;  4KYE A;  5I2N B;  1AL3 A;  4NWD A;  5I59 B;  4G4P A;  1B46 A;  5ITO A;  4YB7 A;  1MXY A;  2O7I A;  3U92 A;  1B6H A;  3WAF A;  5TP9 A;  4NED A;  1R9L A;  3CSG A;  4Q0C A;  4YKP A;  1QUI A; 
#chains in the Genus database with same CATH topology
 1MN3 A;  5DEX A;  3GZG A;  2DAE A;  4KI0 E;  2JA2 A;  1N84 A;  4R3D A;  5LTC A;  3UGJ A;  3JYR A;  1IN5 A;  5IKB A;  2XX8 A;  2CE7 A;  1T6O A;  4OFL A;  1G71 A;  2L2D A;  1DMB A;  3U8Q A;  3HKP A;  2CZI A;  2F97 A;  2VOZ A;  5F7V A;  1J09 A;  4B7H A;  1MY1 A;  3IG5 A;  3OEM A;  4X62 M;  1C1K A;  2KZS A;  4XKQ A;  2OOB A;  2QEN A;  2CEY A;  2ABH A;  1POT A;  1M5C A;  3RFW A;  4L6V 6;  5CRY A;  2F5O A;  1Q02 A;  4IGT A;  2Y21 A;  1RYO A;  4OER A;  2H1R A;  2ZNT A;  3K6X A;  1AWB A;  1B51 A;  2HCA A;  4OA4 A;  1A7L A;  2DHY A;  1LB9 A;  3PPN A;  4IGR A;  1GLN A;  1PJS A;  2DNA A;  1OMP A;  5I59 A;  4PTK A;  2R71 A;  3CFL A;  3GLG A;  1BP5 A;  4AS4 A;  3OO8 A;  2HCB A;  2ZAM A;  4JXI A;  5ET8 A;  3S9E A;  3GQ3 A;  4KQP A;  5ITX E;  3TL4 X;  3PV0 E;  3LVW A;  3CTW B;  3V76 A;  3PUW E;  4OEU A;  3GXA A;  3T9V A;  2R45 A;  5JTY B;  1NNU C;  3SMP A;  2QS1 A;  4HS7 A;  1FQE A;  5EP1 A;  4R74 A;  4GD5 A;  4TLL B;  1ZV1 A;  4GXS B;  1SW4 A;  1SQY A;  1URG A;  3K92 A;  2C96 A;  2XWV A;  2O69 A;  3W9W A;  3W0L B;  1OLC A;  3S9L C;  3HST A;  5EYG A;  3C58 A;  3KOS A;  1F4I A;  1A8E A;  1HT1 E;  4XKR A;  1IMF A;  3D1R A;  4DR3 M;  2X8A A;  4G8M A;  3TOD A;  2VF8 A;  3AL0 C;  4N8Y A;  5KPZ A;  4LUB A;  4NGU A;  1UIV A;  2QPA A;  2ZMB A;  4G8N A;  3T15 A;  1EYJ A;  3GLI E;  5IT9 S;  3O6G A;  3VLU A;  4MGH A;  4I4L A;  2ZYM A;  3T96 B;  4PBH A;  2GQF A;  5ITQ A;  3C33 A;  2LVP C;  1Y1Z A;  5J16 A;  1ORY B;  4F29 A;  4D80 A;  3U6M A;  3TTL A;  3MPK A;  1R2Z A;  3B9P A;  3K9O A;  1MPD A;  4ND9 A;  2X4A A;  1Y4T A;  2BNK A;  3KN3 A;  2AL4 A;  4NX1 A;  1UTH A;  1L8Q A;  1MXU A;  1FPL A;  3IOT A;  3MUQ A;  5IZ3 A;  2R6F A;  5DVJ A;  2AYS A;  2QSF X;  3AJI B;  4GF8 A;  1B7H A;  2A5Y B;  1SXJ D;  3R9X B;  4GBW A;  3KGC A;  5DNY A;  2KQZ A;  5BPV A;  1IBM M;  1M5B A;  4OU7 A;  1NMU A;  3Q8G A;  3EF7 A;  3MHV C;  1IME A;  3I5O A;  5DTB A;  4G4Q A;  3IHP A;  4JWX A;  4PQJ A;  1IXC A;  4WEP A;  4WP2 A;  2YQZ A;  2C99 A;  1Y3Q A;  2FBP A;  3MVY A;  2BWB A;  2LHG A;  1FBF A;  2F5S A;  4RKU F;  3FTE A;  1WOD A;  3M3F A;  3K1M A;  2REJ A;  1DK4 A;  1VEK A;  4P1L A;  1WGN A;  2UU9 M;  3E79 A;  1LB8 A;  4N15 A;  2B3T A;  3QYB A;  4QNM A;  3OSQ A;  1B3L A;  1MX0 A;  1SW5 A;  1TFD A;  1UTB B;  3UP9 A;  3ONM A;  4TUW A;  1NV2 A;  2XX9 A;  1SG9 A;  4JV5 M;  1YXI A;  4LG2 A;  1TH2 A;  5IZ1 A;  4MGY E;  3PXG A;  1VDW A;  4LN5 A;  3GPU A;  5ITR A;  1ZMV A;  1H44 A;  4TQU Q;  2HWJ A;  4YMA A;  4ECF A;  1OIP A;  4BB9 A;  4DDD A;  3LSF B;  4IBJ A;  1QJM A;  1DO0 A;  4U4S A;  3B7N A;  1QVR A;  1WHC A;  4I3E A;  1P1U A;  4XF5 A;  3LCV B;  3PU5 A;  3PUY E;  5H8Q B;  3G3K A;  1N33 M;  1JW4 A;  3O9P A;  3M3L A;  2UUA M;  4IBG A;  1TT1 A;  4GH9 A;  2Z22 A;  1EYK A;  1PM5 A;  1N3W A;  4DXU A;  4CJ6 A;  2CMO A;  1NJG A;  3HWS A;  1NY5 A;  2C5R A;  4BDN A;  3E21 A;  3DOA A;  1XVY A;  3NBX X;  1FPK A;  4RK9 A;  3TDJ A;  4RJZ A;  3A3C A;  1LFI A;  1DTG A;  4AI6 A;  4Q8R A;  3F92 A;  1DV0 A;  4IO6 A;  1KZ8 A;  3TZA A;  1LBY A;  3RT6 B;  2ZYO A;  4IBI A;  4DV2 M;  2B4M A;  2DE4 A;  1I4W A;  1SYI A;  2UXD M;  3S9M C;  2DSF A;  4BLA A;  5EJC A;  2OOA A;  4K0K M;  4IBF A;  1ZKB A;  1JNF A;  3U6S A;  3EKI A;  2BJI A;  1D0K A;  2OWS A;  3MW0 A;  2A5T A;  1G0H A;  4U21 A;  2OPF A;  4L4U A;  3TCF A;  4G6Z A;  3PNV A;  1UIU A;  3ISP A;  1Z7N E;  4H65 A;  1NY6 A;  1UTB A;  2W7Y A;  1QUS A;  3T0J A;  3KSJ A;  1R9Q A;  2OWZ A;  2XXU A;  1NUW A;  4EQB A;  1JR3 E;  2LVA A;  2I7P A;  3DZD A;  1A54 A;  4I81 A;  4C1U A;  2DAG A;  3BIG A;  4FBP A;  4B7G A;  3QYE A;  1B3H A;  2HL7 A;  1J1N A;  1OIB A;  2OWT A;  2RCA A;  2XXY A;  3KJT A;  2Z7J A;  1AUA A;  3C32 A;  4XXU A;  3MVZ A;  5H8Q A;  1B1X A;  1NSF A;  3CFZ A;  2CEX A;  4FED A;  1H6U A;  3A98 B;  2DDK A;  1IXH A;  1GTK A;  4M9S A;  3OEN A;  3BBZ A;  2ONS A;  1GGG A;  2LVO C;  2WX9 A;  4LZZ A;  4F31 B;  3SYL A;  1VDL A;  1XXH A;  2I58 A;  3KP0 E;  1NUX A;  3HX3 A;  4IIW A;  2F5Q A;  2PCR A;  4KLN A;  3K6W A;  4N13 A;  1NV5 A;  4X48 A;  5I3S A;  4EIW A;  3C9P A;  4GWU A;  4GX6 A;  3U6E A;  2VT5 A;  2R8T A;  4FWG A;  3KJ7 A;  3C3E A;  4RK2 A;  2LXE A;  1E9S A;  2QMX A;  4GX3 A;  3PUV E;  1IY2 A;  4G68 A;  2G8L A;  4S12 A;  4ZZE A;  3VDF A;  5DYI A;  4QSE A;  1CNQ A;  1QAN A;  2X7P A;  1PDA A;  3FVK A;  2VQF M;  5DW8 A;  3I01 M;  4L16 A;  2YJP A;  4N6D A;  3VVE A;  1Z5B A;  2CP8 A;  3RTF B;  1JET A;  3UOR A;  2Q2E B;  3PD9 A;  3ECR A;  2GQ1 A;  1IN7 A;  4OVQ A;  3W15 C;  4F2L A;  4NF6 B;  1JB0 F;  2EKF A;  1GO5 A;  4PFW A;  2JY6 B;  4QSD A;  3SZP A;  2GHA A;  2XXP A;  2Z8Y M;  2ZZX A;  4ONY A;  4I62 A;  5AE4 A;  3HHF A;  4PAF A;  3I04 M;  2ONR A;  4PDH A;  2NUV A;  3TKD A;  5IRE B;  2OX3 A;  1Z59 A;  2UVJ A;  4FAT A;  4Z0I A;  4LZ5 A;  3MJN A;  5LMU M;  1MJG M;  3CR9 A;  1FQA A;  2R4J A;  3ILU B;  4AZF A;  2QS4 A;  4JDF A;  4NXM M;  4OFO A;  3IB0 A;  3B89 A;  3PPO A;  5FTL A;  1FBD A;  5TU0 A;  3MBP A;  2MR9 A;  1IEJ A;  2ZXT A;  1S3S A;  1XNR M;  2XXR A;  1A5T A;  3K1J A;  4DLD A;  4PT5 A;  2DXI A;  3J2P B;  1G4A E;  3EPE A;  1A40 A;  2HZK A;  5M2V A;  2PMS A;  2RF1 A;  1RDY A;  3T66 A;  3RY3 A;  1XVX A;  3VDU A;  4FEB A;  3O28 A;  2DXY A;  4PP0 A;  4MJO A;  3VXB A;  3IJO B;  1IN8 A;  2P3V A;  1JR3 D;  4DR2 M;  3PD8 A;  1EZ9 A;  2EUC A;  4IJF A;  4CHT B;  4AG5 A;  4ANR A;  5EXS A;  2ZZW A;  1N77 A;  2FH0 A;  2RGH A;  3SER A;  3FXU A;  4GXA A;  4G8H A;  2XXV A;  3U6L A;  2RKM A;  3MST A;  3SEW A;  4GHL A;  1ZLQ A;  4CIS A;  4PCD A;  3JZJ A;  2DHR A;  3DP6 A;  4TOZ A;  3ILK A;  2Z8D A;  1GJS A;  2Y7R A;  1WDN A;  3ROJ A;  2CV0 A;  1Y3N A;  2Q89 A;  4N4U A;  1B3F A;  3L6G A;  4P3L A;  3HHX A;  2CV1 A;  4AW4 A;  4JI8 M;  4IO2 A;  4H8J A;  3MWB A;  3UN6 A;  4B7F A;  1NV0 A;  4X9T A;  1Y1M A;  1K82 A;  1XHY A;  3JR5 A;  4GWO A;  4MLV A;  4XK8 F;  3OTO M;  3FJM A;  3LR1 A;  1RDZ A;  3OEL A;  3T1Y M;  4H5F A;  4JWY A;  2R6G E;  5F1Q A;  1F9B A;  2E0S A;  4ZDM A;  1J7K A;  4FJP A;  4GKK M;  4GIP A;  4DR5 M;  1LBZ A;  3N6T A;  2GHB A;  4NC6 A;  4N6K A;  4QFO A;  3B50 A;  2VPN A;  2O25 A;  4UAC A;  4MMP A;  3KC0 A;  3U5Z B;  2MJ5 B;  1SXJ A;  4LF8 M;  3GBA A;  2Z8E A;  4W5W A;  4FIM A;  3GLI B;  4DUZ M;  4NQ8 A;  1LCF A;  3RPL B;  3GRR A;  3VE1 B;  2KZU A;  1PJI A;  4MB7 A;  2NXO A;  5DFL A;  4N17 A;  3LUZ A;  4QFK A;  1HSJ A;  4OEN A;  2H98 A;  1FRP A;  1FJ9 A;  2Z4R A;  2ANJ A;  1QUI A;  5H8N A;  4YKI A;  5L8D A;  3RT8 A;  1JEU A;  2XXI A;  4MEV A;  3SDF A;  1JW1 A;  4NRW A;  1IQ7 A;  2KLF A;  4B3M M;  2DKL A;  1OTR A;  2LHC A;  2HPG A;  3P7I A;  4U1Z A;  1MXV A;  2H9B A;  3G3J A;  2QHO B;  4YMB A;  5KZT A;  1IMC A;  3ZCB B;  1CE2 A;  1FNN A;  2F5X A;  3FBP A;  3SYK A;  3UJN A;  1LV7 A;  1MPC A;  5ITX A;  4NF4 B;  1E94 E;  2L7I A;  2XA5 A;  1LST A;  4GL8 A;  4N07 A;  3GQ5 A;  3SMS A;  1P1W A;  4G2Z A;  1B40 A;  3FGS A;  1SD3 A;  4UAB A;  4N91 A;  4OET A;  4GIT A;  1FW0 A;  4XIG Q;  3BKI B;  1NHW C;  4PF6 A;  3M8U A;  3MVW A;  2DWA A;  2DQV A;  4PFI A;  3AOE C;  4DI3 D;  2QVU A;  3M6A A;  1WXQ A;  2WEF A;  4C0R A;  1PBP A;  4NG7 A;  1TFA A;  3F11 A;  4XBO A;  3MP6 A;  4LZ7 A;  2KNA A;  1S7Y A;  4KHP M;  3GLI A;  2XWO A;  1WR1 B;  4QOZ C;  1GV8 A;  3W67 A;  2XSZ D;  2HFB A;  3Q27 A;  5IWA M;  5I7I A;  2WZJ A;  3K0V A;  1MY2 A;  5CMB A;  4YHH M;  3B7Z A;  4O3A A;  4JI4 M;  4JI1 M;  2D7G A;  2VPO A;  4M1V A;  4H67 A;  2R65 A;  1ZIU A;  1D0L A;  1A55 A;  1NUZ A;  3C4M A;  5H8F B;  3TQW A;  4F1U A;  4NXN M;  4N8G A;  2NWJ A;  1FPB A;  1HQY E;  1T0K A;  3HJ8 A;  4UA8 A;  4IB2 A;  4BBA A;  2Y20 A;  4YZZ A;  5FTJ A;  2P2A A;  1FTJ A;  3U6D A;  2KR0 A;  3K8Z A;  2KW0 A;  4RPO A;  1R6Z A;  4FAJ A;  2ZYN A;  3K1N A;  1DBZ A;  5AA1 A;  2QCU A;  4R71 A;  4CIZ A;  3H4M A;  3B8B A;  4X1B A;  3RUM A;  2VD3 A;  1URD A;  5AA4 A;  2LNH C;  3TWL A;  1OLA A;  1OFH A;  1DO2 A;  4OW0 A;  1TXF A;  3LUY A;  4PFY A;  3T6P A;  2I3V A;  4LA9 A;  3FTD A;  1Z5A A;  1YUB A;  3O6I A;  4KXP A;  2KHH A;  1K3X A;  5FTM A;  3QK6 A;  2WBD A;  5ITP A;  1NNK A;  4EF1 A;  1QW0 A;  5I2N A;  1ZU0 A;  1N0T A;  3FAT A;  1NV4 A;  4THI A;  4MNP A;  4F3G A;  3FVG A;  1XMQ M;  3KBZ A;  1D2N A;  3OMB A;  3FUU A;  5A5X B;  3SAW A;  3PFI A;  1EE8 A;  4ZPX A;  2VGQ A;  4OVZ B;  2V3U A;  3KOX E;  4GWX A;  1B2H A;  4KYS A;  4G68 C;  2L4F A;  2I7N A;  2IA4 A;  3TTR A;  1DGH B;  2DZN B;  1H43 A;  4H1X A;  5F3W A;  2YFQ A;  4I5S A;  1URS A;  1JQF A;  4H6D A;  1LAH E;  1ZTY A;  2R46 A;  2DAM A;  4FW9 A;  1IM2 A;  4GC5 A;  3IOW A;  3GBB A;  3B6T A;  3S4U A;  2EJS A;  5ICT A;  4IBD A;  4AG6 A;  2D5W A;  3H6W A;  5H8F A;  2VF7 A;  1AH5 A;  2CZL A;  3FVO A;  4MGZ E;  2VDB B;  3HJQ A;  2Y0T A;  4KCC A;  3MZ9 A;  4JI7 M;  4DXC A;  1FBP A;  1P1O A;  2JY8 A;  3RE8 A;  3TEL A;  2DS9 A;  2J7N A;  4KPT A;  2KRK A;  4L17 A;  1QAO A;  1NV6 A;  2FYI A;  2Y5K A;  5JI3 E;  4OXV A;  3U93 A;  3H06 B;  2C9O A;  3KN8 A;  3KC1 A;  1PGY A;  3TPZ A;  1SVX B;  1B7U A;  1D9Q A;  1BVS A;  2R18 A;  3SHF A;  4JB7 A;  3SAV A;  4MHF A;  1FPF A;  1Q39 A;  1XC1 A;  1QDT A;  4LJ4 A;  2CHG A;  4GLI A;  4F3S A;  1B05 A;  3UMM A;  1HNX M;  3WHK A;  1SYH A;  4BDL A;  3OO9 A;  4NMY A;  1WGL A;  4AQY M;  3LBS A;  4PFT A;  3MK6 A;  1FQB A;  5EQA A;  4BDO A;  3I51 A;  3U6P A;  4ZED A;  1USY E;  1Y3P A;  3E46 A;  3SAR A;  5A5X A;  4RNS A;  4HCW A;  3IG8 A;  2WSE F;  3LSX A;  2HAU A;  3U60 B;  3HU3 A;  4O3B A;  2FNA A;  3BXW A;  3KOY E;  3CHG A;  1JVX A;  3HN0 A;  1ELJ A;  5JTY A;  1L1T A;  2OCU A;  4PE3 A;  1MS7 A;  4ELP A;  2D3I A;  3KFM A;  2Y7P A;  4KT0 F;  4OVR A;  1UFZ A;  3GPP A;  4GQO A;  4EQ7 A;  4POX A;  3QSL A;  3RNN A;  2G29 A;  3TYH A;  2HKJ A;  4XFE A;  4IY6 A;  4E0X A;  4JI2 M;  1HT2 E;  4QF9 A;  2XXK A;  3QWL A;  2DI0 A;  2B4L A;  4O7M A;  5J1D A;  4HW8 A;  3CG3 A;  4FOR A;  1QYR A;  1OVB A;  4G4N A;  2DE2 A;  2XD3 A;  3Q8X A;  1R4G A;  2QP9 X;  4GMQ A;  3CRB A;  5A5L A;  4OMB A;  4AB6 A;  3BFT A;  2RCB A;  1EZO A;  2XEP A;  1N76 A;  4EF2 A;  2LBC A;  3BBR A;  3TTK A;  3FIR A;  1ZBM A;  2UVI A;  1I69 A;  4NF8 B;  1WJ7 A;  3G3H A;  2KNZ A;  2MGW A;  1PC3 A;  3KS4 A;  5ET6 A;  4N81 A;  4DZ1 A;  3HV1 A;  2FE8 A;  3LSW A;  4XKN A;  1QUL A;  2QMW A;  4JYA M;  1XT8 A;  3D8L A;  1TH4 A;  3GLG E;  2VD2 A;  4OAN A;  4LJ7 A;  2Y7W A;  3M7G A;  1YSY A;  2XD2 A;  2F5N A;  1B3E A;  4RY1 A;  5IGA A;  3RGY A;  4I9D A;  3H6U A;  1DGF A;  2D21 A;  1SXJ C;  3TTN A;  2DE3 A;  4OYV A;  1US5 A;  3VLW A;  3O2A A;  3FD3 A;  1EH3 A;  2DXR A;  2M5Z A;  3WHL A;  4EDP A;  2FA7 A;  5CMK A;  4KR5 A;  1B58 A;  4L15 A;  4YU0 A;  3H4J A;  2XFT A;  3MC2 A;  2O68 A;  4LFB M;  2ZAN A;  2L6O A;  1L2D A;  5EP3 A;  4U23 A;  4K3F A;  4U4X A;  4M0W A;  4LJ9 A;  1LGB C;  2R9J A;  2WYK A;  3EHT A;  5EHS A;  5ET5 A;  2JJK A;  1VR5 A;  4DE8 A;  2DP8 A;  2F78 A;  5K2X A;  1KWH A;  4JVD A;  1AIP C;  2Y84 A;  2I4C A;  1AMF A;  2ZAO A;  1EYI A;  4MLQ A;  3JR4 A;  4HE0 A;  3DP8 A;  4M9Z A;  2ZBK B;  2XXQ A;  4QBA A;  5I58 B;  4G4R A;  2PX1 A;  3I4V A;  1Z6T A;  3J27 B;  3J7A S;  1DCU A;  2X49 A;  1Y4C A;  3VK7 A;  2ZYK A;  1QUJ A;  2H99 A;  3UK6 A;  2XXT A;  4WED A;  3EHU A;  1VFE A;  3IJX B;  3CVG A;  3HY5 A;  3SEU A;  1L5T A;  5I56 B;  4DV7 M;  1EU8 A;  1B5J A;  1MQG A;  3IR1 A;  4YKK A;  5HBC A;  2BJW A;  1DPP A;  3QAX A;  5ICQ A;  3CF2 A;  2VP1 A;  3PNY A;  3TPA A;  3UA8 A;  3EIH A;  3ZKK A;  4MX6 A;  1MQJ A;  3GPX A;  5BWJ A;  3VKG A;  2ZTC A;  1KA1 A;  3R7X A;  3GLH B;  2XXW A;  5KQ8 A;  4B3T M;  3PGF A;  1IY0 A;  3B6Q A;  4FWD A;  2HXW A;  1US4 A;  1QGX A;  1QKA A;  1PRB A;  1HR0 M;  1DSN A;  3KOT A;  4ZE8 A;  1LAF E;  2Z3X A;  4QFL A;  3SKP A;  3CG1 A;  3T93 B;  4IR8 A;  3U72 A;  4MGI E;  2CZH A;  4DV4 M;  2MKZ A;  4P0G A;  2WKY A;  1DOT A;  3G7W A;  2EKK A;  4DI4 B;  4ZEC A;  4L78 A;  1RDX A;  4R73 A;  4DUY M;  5EXP A;  2RKO A;  3ILT B;  4C1T A;  4F18 A;  3IFC A;  5CMC A;  1XOC A;  4JWO A;  2XSZ A;  5H8S A;  2UXB M;  1TTE A;  2HXR A;  2DZL A;  1IMA A;  4Y28 F;  3L25 A;  5H37 D;  4GIZ A;  4HTG A;  4GWY A;  1H76 A;  3GYY A;  1VEJ A;  1QAQ A;  1NNJ A;  4MH5 A;  1IN6 A;  2XFS A;  5I58 A;  4NN3 A;  1IZ1 A;  4JVI A;  1K9Z A;  1PEB A;  4OVP A;  5I5P A;  2L09 A;  1OQH A;  1G8P A;  3B6W A;  4GOT A;  4D82 A;  1MY0 A;  4NWC A;  1GVC A;  3HJS A;  3CFX A;  2V4C A;  3OXN A;  4ISU A;  2ZTD A;  2UVG A;  4N6P A;  3RGS A;  5IZ7 D;  5IZZ A;  3U6Q A;  2PT2 A;  1LLS A;  1OKS A;  4QHT A;  1B5I A;  3FUZ A;  4JSO A;  2JY7 A;  2J7O A;  4JI5 M;  3HHZ A;  4PCZ A;  1N3X A;  4DXB A;  4NF0 A;  2FFJ A;  4YKJ A;  4YB5 A;  4PFU A;  1BTJ A;  3NOH A;  4I3Y A;  3VV5 A;  1NUY A;  2DWN A;  1Q1K A;  5AA3 A;  5L8R F;  2F35 A;  3RLF E;  3FJG A;  4F19 A;  5HM4 B;  4ELO A;  1YYZ A;  1EFU B;  3L28 A;  2QBY B;  2FNC A;  2QS3 A;  2L4E A;  1LFH A;  2Q74 A;  4R6H A;  1QDR A;  4OES A;  1YZ0 A;  4KD5 A;  1LAX A;  5LOM A;  4FE8 A;  3J80 S;  3KDS E;  4MGK E;  2RRU A;  4O94 A;  3CF0 A;  4IJE A;  2UUB M;  1XMO M;  4DR4 M;  3L6H A;  3W9V A;  1FBG A;  4GKJ M;  3A29 A;  2CEA A;  1OQY A;  2H5Y A;  3TQL A;  3T1H M;  5ITY A;  5H8H B;  5T3J A;  5KO3 A;  3FJ7 A;  3MP8 A;  4PDG A;  3K02 A;  3U6O A;  5EYF A;  4H5G A;  2CWB A;  3NBI A;  1E32 A;  2XGN A;  2J5Y A;  2YNM D;  1TGU A;  2UUC M;  3N94 A;  1M5F A;  4IBC A;  2ESN A;  4GX4 A;  5CI5 A;  4R75 A;  1L1Z A;  3CSB A;  1PB8 A;  1G59 A;  2V3T A;  4XTC Q;  1Q35 A;  4R2F A;  4P0I A;  3LVV A;  4B3R M;  3TAJ A;  4JI6 M;  3RYD A;  4NF6 A;  3I4Y A;  1T3T A;  4AKH A;  4O8M A;  3MAM A;  2RIN A;  5IM2 A;  1IMB A;  1NI9 A;  1BKA A;  5ITU A;  3Q25 A;  5I2K B;  2H5X A;  2D7H A;  1D9V A;  4Z8X A;  5BR8 M;  4OWD A;  3HFU A;  1NVM A;  2I3W A;  4OX9 M;  1MY3 A;  1B52 A;  1MH3 A;  2XXX A;  1XXH E;  1P99 A;  4XKP A;  3E3K A;  3FUX A;  1B7Z A;  2OLB A;  1R7R A;  2DWM A;  1LBV A;  1QUT A;  4Q7J A;  2QBY A;  3MZB A;  3RTW B;  3VVD A;  4LFA M;  1SW1 A;  5CM6 A;  1G41 A;  2QVV A;  2MH8 A;  2X26 A;  5CC2 A;  2WYP A;  2Z8F A;  3ZC7 B;  2E5L M;  2F8D A;  2OZZ A;  1M5E A;  1A8F A;  5EHM A;  3D4G A;  4X1D A;  4ITQ A;  1GKI A;  4P56 A;  2C9C A;  3CI8 A;  5ELV A;  3MPL A;  2DWJ A;  1USY H;  1I94 M;  3PTY A;  1IXS B;  4MIJ A;  4LF6 M;  1OJL A;  1DGB A;  5H8H A;  1FQD A;  1LBC A;  3GLH E;  4X04 A;  3SBJ A;  1O63 A;  1OAO C;  4X65 M;  1Y8G A;  3TWM A;  4LP2 B;  2E1S A;  5I57 B;  2DWZ B;  2Q9T A;  2QFL A;  3IB1 A;  3G3G A;  3VLV A;  4F1Y A;  2AIX A;  3O66 A;  1O7T A;  3D4C A;  2Q2C A;  1B5H A;  4DV1 M;  1R1N A;  4YB6 A;  4MNC A;  4P8B A;  4R6Y A;  4JBZ A;  3M0E A;  4GC9 A;  3GO8 A;  1FPD A;  1KSF X;  1FJG M;  1NV7 A;  5K2Y A;  1R2Y A;  2CV2 A;  3FUV A;  3IO6 A;  3L27 A;  4U22 A;  2XX7 A;  3C3D A;  1RU3 A;  5EP2 A;  1C7Y A;  1Z7M E;  4IY5 A;  4LRS A;  1NJF A;  5I2K A;  3LCU A;  1GVN A;  1VG5 A;  1ZJL A;  3VFJ A;  4DBG B;  2QNJ A;  3TUS A;  3PUX E;  1G3I A;  2Z4S A;  2XWI A;  3T9H B;  3VXC A;  3PVS A;  1MQH A;  1XHB A;  3O29 A;  4DV5 M;  3THG A;  2PFY A;  3FXB A;  1JVY A;  2A5S A;  3UK4 A;  3N5L A;  1BLF A;  3LW5 F;  3EIE A;  4IO7 A;  3IEC A;  3KEI A;  1GL6 A;  5EYH A;  2ZNU A;  3LSL A;  4NF5 B;  3ZQJ A;  1HQC A;  2GFE A;  1A99 A;  1MG1 A;  3EN3 A;  3VVF A;  1QZE A;  4MBP A;  2JNH A;  3U5Z A;  3VFD A;  4L8R C;  1FTK A;  2CHQ A;  4H45 A;  4TLM B;  4IBB A;  2IEE A;  5GKN A;  3U65 A;  4FEC A;  1H45 A;  2GNO A;  1XB2 B;  4ESW A;  3RPL A;  1NKX A;  4P17 A;  5I57 A;  1P1Q A;  3RPW A;  2L7H A;  1HSL A;  5KQD A;  3MMP A;  3BIH A;  1GJT A;  3TFL A;  2WSC F;  1Y9U A;  2K0B X;  3R6U A;  1YPN A;  4LRT A;  1VE4 A;  2FS1 A;  5FHN A;  3SC3 A;  1IUD A;  2QVR A;  3GLG B;  1W5T A;  1FCK A;  3U6C A;  3V5A A;  2DAK A;  3S2V A;  4DCX A;  4QRZ A;  1Q3B A;  4E0W A;  2V25 A;  3BFU A;  2O6A A;  2NQ8 C;  2I49 A;  2QPQ A;  2RGO A;  4G4O A;  3HGI A;  3KOZ E;  3KW6 A;  5FTN A;  4NF4 A;  4F1V A;  4U1O A;  1ANF A;  4P11 A;  3ZSF A;  3A42 A;  1IIW A;  3W0F A;  4FWH A;  1JP4 A;  4AS5 A;  3IO4 A;  3VKH A;  1XS5 A;  3A45 A;  1L2B A;  4X64 M;  4F22 A;  4KCD A;  3D8B A;  3VLF B;  2O5R A;  4WW0 A;  1MPB A;  2Y0Q A;  3MQ9 A;  2P5T A;  1K3W A;  2YPN A;  4R7G A;  1IXI A;  2EO2 A;  3ODB A;  5AA2 D;  1SW2 A;  4AKG A;  3TQS A;  3MP1 A;  3K6U A;  1SXJ E;  1WIV A;  4NF5 A;  3TMG A;  3A3U A;  4GWS A;  3PPR A;  4G61 A;  5E26 A;  2F5P A;  4II7 A;  1SBP A;  5ITT A;  3MJ5 A;  1IXG A;  4Z6Y A;  3GLF E;  1UM8 A;  1TWY A;  2FVZ A;  5KPR A;  1MM6 A;  2XZU A;  4QHS A;  4IO4 A;  4X8R A;  3H7M A;  1MXX A;  2M8C A;  1AOV A;  2HQ0 A;  4ESX A;  1INP A;  1XWI A;  3K1P A;  3O6H A;  3MYU A;  1N36 M;  4P47 A;  5CBS A;  4PDI A;  5ESY A;  2Q8J A;  4H0W A;  3HHW A;  3IX1 A;  4QHQ A;  4IO5 A;  2JWS A;  1B4Z A;  5L9M A;  1UTH B;  2OBG A;  3FUT A;  5IZ3 B;  4LVQ A;  4PFB A;  2V6Z M;  3LV0 A;  3UZU A;  1T43 A;  2LH0 A;  3TCH A;  3DEL B;  3AOG A;  3GP1 A;  3U61 B;  2F4V M;  1EIJ A;  4F39 A;  1O64 A;  3FVN A;  2D7E A;  1NL5 A;  3OEK A;  1FPE A;  3IK6 B;  4GL0 A;  1HNW M;  5C1B A;  4REZ A;  4EXK A;  2O1M A;  1IN4 A;  4PBQ A;  1OQG A;  2QL3 A;  2AHM A;  3UGW A;  1XC8 A;  3B7Q A;  4HE2 A;  4DV0 M;  1GAB A;  2FIE A;  1D4N A;  4LCB A;  4RNA A;  2KDL A;  1VDD A;  3EQ1 A;  3E4R A;  1FTA A;  4ZEK A;  4DR7 M;  1HJP A;  4JN6 A;  1IMD A;  3B7D A;  3I6V A;  4MF3 A;  4P9K A;  2O01 F;  2AL5 A;  2ONK E;  2GRV A;  2V1C A;  2PYY A;  3FZV A;  5DVF A;  3SEY A;  2UXC M;  4FCW A;  2P3N A;  3GPY A;  1TDH A;  4KFQ A;  5EXT A;  4OHN A;  3DLN A;  2XH9 A;  4FCT A;  3Q28 A;  4GRK A;  4RXL A;  4NRV A;  1LBB A;  4OVZ A;  1DPE A;  1FQF A;  5F24 A;  4EXL A;  2O1L A;  4PF8 A;  5KCJ B;  1ZAE A;  1DGH A;  3C34 A;  4O3C A;  1AIV A;  4OVJ A;  1OFI A;  3QUJ A;  1W5S A;  4POW A;  2JZ0 A;  1NNF A;  4EQ9 A;  5L9S A;  3MVX A;  2F6G A;  1JR3 A;  2ZM6 M;  2XXH A;  4Z7E A;  2R62 A;  2CZK A;  3PMX A;  5FHO A;  2O7U A;  3C36 A;  4M9X A;  2I0C A;  4I8C A;  3W68 A;  1NV8 A;  4KYD A;  1IFY A;  1DGG A;  3DM0 A;  3U61 A;  3O97 A;  2YLN A;  1MU5 A;  4Q30 B;  2B3B A;  4NSO B;  5KDT B;  1M5D A;  3LMM A;  1V34 A;  4P1E A;  4KOD A;  2F3D A;  4ZS9 A;  1Q3C A;  3PUZ E;  1ZMU A;  3Q29 A;  3TEP A;  4ZE9 A;  3UIF A;  4QFN A;  1FPG A;  3T9U A;  1IY1 A;  3J7B A;  2BJV A;  1NV9 A;  5TPA B;  1PJT A;  1P1N A;  1HNZ M;  5FHM A;  4BDM A;  1MXZ A;  4LGY A;  4LZJ A;  2DVW B;  4LY6 A;  3PMW A;  2CRU A;  4B3S M;  2A5T B;  2DEN A;  2K47 A;  2R44 A;  2LTU A;  2EA0 A;  1TF0 B;  1BIY A;  3FV2 A;  4PAI A;  3OO6 A;  8CAT A;  2H25 A;  2BJJ X;  3T22 A;  3T38 A;  3LQR A;  3J81 S;  2FOI C;  1MY4 A;  1L2C A;  5FTH A;  1R5L A;  3U60 A;  1FPJ A;  5KCJ A;  4CGY B;  4XGI A;  4PET A;  1IBL M;  4IBE A;  4NL4 H;  1S9T A;  4LON B;  2V3Q A;  3FTC A;  4LJ6 A;  1SDX A;  2Y7K A;  4OZ9 A;  4HLQ A;  1HSE A;  1N7W A;  4KO8 A;  3OSR A;  4GRI A;  1FBE A;  1EZP A;  1PB7 A;  3E78 A;  2PBW A;  4MAG A;  2O84 X;  3R8F A;  3H3G A;  2PFZ A;  3IOV A;  4O7I A;  5DT6 A;  3U94 A;  1H3D A;  2F36 A;  4I40 A;  5KDT A;  2WBB A;  3L26 A;  1NO1 A;  3KP1 E;  1XXH B;  2LVQ D;  2M60 A;  1KA0 A;  2V84 A;  4LZ8 A;  2Q8M A;  4HEO A;  1LEV A;  3R26 A;  3JAM S;  1LFG A;  4LAT A;  3AOE A;  3GRY A;  4NE4 A;  4R72 A;  4OFJ A;  3SEV A;  3KXE C;  2I4B A;  2VHA A;  1B4H A;  3ZH9 B;  3FV1 A;  4EUO A;  5TPA A;  4MM3 B;  1GL7 A;  4NF8 A;  2QZ4 A;  2X7Q A;  3SAS A;  3HU1 A;  3L29 A;  4LGM A;  3HCQ A;  2REG A;  5DYG A;  1KFV A;  5KPT A;  1B0H A;  2DVC A;  4YAH X;  1LCT A;  3CGW A;  3K2D A;  4G68 B;  1V92 A;  1Y20 A;  4F1I A;  1FBH A;  3S9N C;  2K6B A;  3K01 A;  1XNQ M;  4G77 A;  3HPI A;  2JP7 A;  2B3F A;  2XWK A;  3C31 A;  4HCY A;  2OK2 A;  3C35 A;  1VQ1 A;  1B1H A;  3HZJ A;  2NVU B;  1YE9 A;  4A3V B;  2QRY A;  3FKE A;  5AA2 B;  1E9R A;  3T9X B;  1UQW A;  3L2A A;  1N32 M;  1SI1 A;  2VQE M;  4F3P A;  3FXR A;  5JI2 E;  1B32 A;  1NV3 A;  3GRV A;  1MQI A;  3IOR A;  7CAT A;  3FYC A;  2XLJ A;  2OJT A;  4R9F A;  4JXJ A;  5JEI A;  3QAU A;  3SFZ A;  2PVU A;  1I6A A;  4WUR A;  4QXD A;  2UVH A;  2N35 A;  5EQ9 A;  3FAS A;  3H4Z A;  3IOU A;  3FRH A;  4F3B A;  4PDD A;  5A2Q S;  3QMF A;  3K00 A;  3T1B A;  4I1D A;  4LFC M;  3FUW A;  3FTF A;  5DYH A;  3AV0 A;  3ZKL A;  1JW5 A;  3QIM A;  4PFR A;  5DVI A;  4BDQ A;  5FTI A;  4BDR A;  1SPI A;  2R0I A;  3KS8 A;  4PC9 A;  4Q5T A;  1K9Y A;  5C18 A;  3USD A;  3TE6 A;  1CB6 A;  1FBC A;  1QKB A;  2DWI A;  2LWX A;  3HHY A;  4PGP A;  2QJE A;  3FXQ A;  4PAK A;  5LMN M;  3SES A;  3SET A;  3KSX A;  5I56 A;  1QVS A;  4MH0 E;  5E6J A;  1NNT A;  1ATG A;  2APL A;  1LBX A;  3H6T A;  1G0I A;  1VEG A;  3KZG A;  4FCV A;  3NWL A;  4G3O A;  4F2O A;  4LQ5 A;  4LQ2 A;  4GBV A;  4ZEF A;  2MRO B;  1FTL A;  3GLH A;  1FTO A;  1DTZ A;  2HEU A;  3V89 B;  2F7A A;  2YR0 A;  3SAU A;  3IAZ A;  4WKM A;  2G93 A;  1D3K A;  3FRI A;  2HAK A;  4FVM A;  5EQT A;  4LF4 M;  4JSD A;  5AA2 A;  3GQ4 A;  4H8I A;  3M3K A;  1Z5C A;  3FYD A;  4PGN A;  3V83 A;  3EHS A;  2V1U A;  3K4U A;  1P3Q Q;  4DV6 M;  1PBQ A;  2KXE A;  3OOA A;  3RGP A;  3ZS6 A;  1MH4 A;  1FPI A;  1NNP A;  3CIJ A;  4ZZA A;  2ZZV A;  5JK4 A;  1LBW A;  1YTV A;  4NSR A;  1MRP A;  3LC8 A;  3K6V A;  4JI0 M;  4GWW A;  1IQP A;  4LJ8 A;  5B70 A;  1D9Y A;  2GH9 A;  1RKM A;  4U2R A;  2G3Q A;  1IIT A;  2XZF A;  4X66 M;  3IB2 A;  2JY5 A;  4RF0 A;  2QQ8 A;  3WAE A;  2Z23 A;  4LF7 M;  1QAM A;  3DP4 A;  5ET7 A;  2HAV A;  3HHG A;  3VK8 A;  1RYX A;  2PT1 A;  2QS2 A;  3AKZ A;  4M0D A;  3OD7 A;  1N7X A;  1YAE A;  4BLC A;  4M4G A;  4IBK A;  2I48 A;  2KA6 B;  4AQ4 A;  3LQQ A;  4WXJ A;  3E9S A;  3I3V A;  4KHZ E;  4RA1 A;  4YY3 M;  3SHG B;  1S50 A;  4NHB A;  4AB5 A;  3TWK A;  2ZNS A;  2I6E A;  2Y5L A;  1QQW A;  2ALU A;  1SXJ B;  1SI0 A;  2DAI A;  1ZMG A;  2KEB A;  2LAO A;  2KRU A;  5FBP A;  4H46 A;  5CBR A;  2VII A;  3KVW A;  3PPP A;  4UN2 B;  5EXX A;  2UXA A;  3VDP A;  3THI A;  3GLF B;  1ZMW A;  2LVN C;  1N75 A;  3E13 X;  4GFR A;  1J5E M;  3IL1 B;  1LTM A;  2DOJ A;  1PJQ A;  1XI6 A;  2F7B A;  2DVZ A;  2XHD A;  3HU2 A;  1QZM A;  3G3F A;  4DV3 M;  4F2Q A;  5H8N B;  1FQC A;  4PE5 B;  1QUK A;  1VFD A;  2NOO A;  5FTK A;  4R9G A;  4NOO B;  1KYI A;  1JEV A;  5B7D A;  1YCJ A;  1FJ6 A;  2F34 A;  3DA1 A;  3KG2 A;  3K2L A;  3OO7 A;  1MM7 A;  4OTE A;  1GR2 A;  3Q26 A;  1TH3 A;  1MDP 1;  4D81 A;  3BOS A;  2JZ1 A;  4GVO A;  1B9J A;  3KBR A;  3B74 A;  1NFT A;  5EQ7 A;  3AFH A;  1LAG E;  4HXV A;  3E9X A;  2Y7I A;  4RPN A;  3KN7 A;  4ZEI A;  4LJ5 A;  3FD9 A;  3HO7 A;  1X37 A;  2UYF A;  4MFI A;  1PB9 A;  2CHV A;  4B08 A;  3KFU G;  1Q9D A;  4NAP A;  4NTL A;  4JI3 M;  3V8X B;  3KOW E;  1NH7 A;  4YIC A;  2O51 A;  4HE1 A;  3GLB A;  2B65 A;  1NH8 A;  2CFO A;  1ZQ9 A;  3GRU A;  3TCG A;  2DWL A;  2FHY A;  1CUK A;  2HHM A;  2P0S A;  2RC8 A;  4RYA A;  3CF6 E;  2RC9 A;  1B3G A;  1MXW A;  4PD2 A;  2L5V A;  5EQ8 A;  4RF1 A;  3N6U A;  1IBK M;  1TR8 A;  4IO3 A;  5I84 A;  5HPQ A;  3A46 A;  1OVT A;  1WVJ A;  5LDZ A;  2DWH A;  4HL4 A;  5FSW A;  4MCO A;  4ZEB A;  2DZO B;  1MQD A;  2CUZ A;  3QXM A;  2KNV A;  3RN8 A;  3GLF A;  2P1S A;  2OQ4 A;  3H03 A;  5TP9 B;  1N78 A;  1BK4 A;  1B0L A;  2F7C A;  2I0B A;  1PJJ A;  3PPQ A;  4R6K A;  1YLA A;  3G3I A;  1NHG C;  3DFZ A;  1NV1 A;  2UYE A;  3QUF A;  2Q2A A;  2JXN A;  3RQT A;  2HZL A;  4JVC A;  5DEX B;  4P16 A;  3U1O A;  1N04 A;  3AXF A;  2DYX A;  1V33 A;  3N26 A;  1TDZ A;  2OO9 A;  2HHH M;  1VSO A;  2QSX A;  2F6P A;  2BWE A;  3FE3 A;  5L9O A;  2C98 A;  2RC7 A;  3JV9 A;  4LF5 M;  4R2B A;  3SEX A;  1MDQ A;  3QYT A;  4DR1 M;  1POY 1;  4ELQ A;  4OVT A;  4I8O A;  2THI A;  5FLX S;  1IXS A;  1I6B A;  4ELR A;  1FTM A;  3C9H A;  2XF3 A;  4QFP A;  2JUJ A;  4LJA A;  5EP4 A;  2W82 A;  4DIG A;  2WSF F;  3H6V A;  5AA4 B;  4OEV A;  4OVS A;  4QNR A;  4GWZ A;  4OQO A;  3A09 A;  2V93 A;  3SAT A;  2H4I A;  5IAI A;  4QOS A;  5CMM A;  4DCY A;  1JQJ C;  1I6Q A;  5BUU A;  2Q88 A;  3TTM A;  1II5 A;  3MZ1 A;  3PMV A;  4QSC A;  5ISU A;  4KYE A;  5I2N B;  1AL3 A;  4NWD A;  1D0M A;  5I59 B;  2G5G X;  4FD2 A;  4G4P A;  1B46 A;  5ITO A;  4XEQ A;  3K9P A;  2ERC A;  4YB7 A;  2F3B A;  1MXY A;  2O7I A;  4MNI A;  3U92 A;  2K9D A;  2R4E A;  3IFA A;  1IXR C;  1B6H A;  3WAF A;  1IXZ A;  5TP9 A;  1R6B X;  4AKI A;  2FIX A;  1N34 M;  4NED A;  1R9L A;  1OAI A;  4LF9 M;  3CSG A;  4GEW A;  4GHA A;  4Q0C A;  4DR6 M;  4YKP A;  1OIZ A;  1FSA A; 
#chains in the Genus database with same CATH homology
 5DEX A;  3GZG A;  4KI0 E;  2JA2 A;  1N84 A;  4R3D A;  3UGJ A;  3JYR A;  1IN5 A;  5IKB A;  2XX8 A;  2CE7 A;  4OFL A;  1DMB A;  3U8Q A;  3HKP A;  2F97 A;  2VOZ A;  5F7V A;  1J09 A;  4B7H A;  1MY1 A;  3IG5 A;  3OEM A;  4X62 M;  1C1K A;  2KZS A;  4XKQ A;  2QEN A;  2ABH A;  1POT A;  1M5C A;  3RFW A;  5CRY A;  2F5O A;  4IGT A;  2Y21 A;  1RYO A;  4OER A;  2H1R A;  2ZNT A;  3K6X A;  1B51 A;  2HCA A;  1A7L A;  1LB9 A;  3PPN A;  4IGR A;  1GLN A;  1OMP A;  5I59 A;  2R71 A;  3CFL A;  3GLG A;  1BP5 A;  3OO8 A;  2HCB A;  2ZAM A;  4JXI A;  3S9E A;  3GQ3 A;  4KQP A;  5ITX E;  3TL4 X;  3PV0 E;  3LVW A;  3CTW B;  3PUW E;  4OEU A;  3GXA A;  3T9V A;  2R45 A;  5JTY B;  1NNU C;  3SMP A;  2QS1 A;  4HS7 A;  1FQE A;  5EP1 A;  4R74 A;  4GD5 A;  4TLL B;  4GXS B;  1SW4 A;  1SQY A;  1URG A;  3K92 A;  2C96 A;  2O69 A;  3W9W A;  3W0L B;  1OLC A;  3S9L C;  3HST A;  3C58 A;  3KOS A;  1A8E A;  1HT1 E;  4XKR A;  4DR3 M;  2X8A A;  4G8M A;  3TOD A;  3AL0 C;  5KPZ A;  4LUB A;  1UIV A;  2QPA A;  2ZMB A;  4G8N A;  3T15 A;  5IT9 S;  3O6G A;  3VLU A;  4MGH A;  4I4L A;  2ZYM A;  3T96 B;  5ITQ A;  3C33 A;  1Y1Z A;  1ORY B;  4F29 A;  4D80 A;  3U6M A;  3TTL A;  3MPK A;  1R2Z A;  3B9P A;  1MPD A;  4ND9 A;  2X4A A;  1Y4T A;  2BNK A;  3KN3 A;  2AL4 A;  1UTH A;  1L8Q A;  1MXU A;  3IOT A;  3MUQ A;  5DVJ A;  2AYS A;  3AJI B;  4GF8 A;  1B7H A;  2A5Y B;  1SXJ D;  3R9X B;  3KGC A;  5DNY A;  5BPV A;  1IBM M;  1M5B A;  4OU7 A;  1NMU A;  3EF7 A;  3MHV C;  3I5O A;  5DTB A;  4G4Q A;  4JWX A;  4PQJ A;  1IXC A;  4WEP A;  2YQZ A;  2C99 A;  1Y3Q A;  3MVY A;  2F5S A;  3FTE A;  1WOD A;  3M3F A;  3K1M A;  2REJ A;  2UU9 M;  1LB8 A;  4QNM A;  3OSQ A;  1B3L A;  1MX0 A;  1SW5 A;  1TFD A;  1UTB B;  3UP9 A;  3ONM A;  4TUW A;  2XX9 A;  4JV5 M;  4LG2 A;  1TH2 A;  4MGY E;  3PXG A;  3GPU A;  5ITR A;  1H44 A;  4TQU Q;  4YMA A;  4ECF A;  4BB9 A;  4DDD A;  3LSF B;  4IBJ A;  1QJM A;  1DO0 A;  4U4S A;  1QVR A;  1P1U A;  3PU5 A;  3PUY E;  5H8Q B;  3G3K A;  1N33 M;  1JW4 A;  3O9P A;  3M3L A;  2UUA M;  4IBG A;  1TT1 A;  4GH9 A;  2Z22 A;  1PM5 A;  1N3W A;  4DXU A;  2CMO A;  1NJG A;  3HWS A;  1NY5 A;  2C5R A;  4BDN A;  3DOA A;  1XVY A;  4RK9 A;  3TDJ A;  4RJZ A;  3A3C A;  1LFI A;  1DTG A;  4AI6 A;  4Q8R A;  4IO6 A;  3TZA A;  3RT6 B;  2ZYO A;  4IBI A;  4DV2 M;  2DE4 A;  1I4W A;  1SYI A;  2UXD M;  3S9M C;  2DSF A;  4BLA A;  5EJC A;  4K0K M;  4IBF A;  1ZKB A;  1JNF A;  3U6S A;  2OWS A;  3MW0 A;  4U21 A;  2A5T A;  2OPF A;  4L4U A;  3TCF A;  4G6Z A;  3PNV A;  1UIU A;  1Z7N E;  4H65 A;  1NY6 A;  1UTB A;  2W7Y A;  3KSJ A;  1R9Q A;  2XXU A;  4EQB A;  2I7P A;  3DZD A;  1A54 A;  4I81 A;  4C1U A;  4B7G A;  1B3H A;  2HL7 A;  1J1N A;  1OIB A;  2OWT A;  2RCA A;  2XXY A;  3KJT A;  2Z7J A;  3C32 A;  4XXU A;  3MVZ A;  5H8Q A;  1B1X A;  1NSF A;  3CFZ A;  4FED A;  1H6U A;  3A98 B;  1IXH A;  1GTK A;  4M9S A;  3OEN A;  2ONS A;  1GGG A;  4LZZ A;  4F31 B;  3SYL A;  1XXH A;  2I58 A;  3KP0 E;  4IIW A;  2F5Q A;  4KLN A;  3K6W A;  4N13 A;  4X48 A;  4EIW A;  3U6E A;  4FWG A;  3KJ7 A;  4RK2 A;  2LXE A;  1E9S A;  2QMX A;  3PUV E;  1IY2 A;  4G68 A;  2G8L A;  4S12 A;  4ZZE A;  3VDF A;  5DYI A;  4QSE A;  1QAN A;  2X7P A;  1PDA A;  3FVK A;  2VQF M;  4L16 A;  2YJP A;  3VVE A;  1Z5B A;  3RTF B;  1JET A;  3UOR A;  2Q2E B;  3PD9 A;  3ECR A;  1IN7 A;  3W15 C;  4NF6 B;  4PFW A;  4QSD A;  2GHA A;  2XXP A;  4ONY A;  4I62 A;  5AE4 A;  3HHF A;  2ONR A;  2NUV A;  3TKD A;  5IRE B;  2UVJ A;  1Z59 A;  4FAT A;  4Z0I A;  4LZ5 A;  3MJN A;  5LMU M;  3CR9 A;  1FQA A;  2R4J A;  3ILU B;  4AZF A;  2QS4 A;  4JDF A;  4NXM M;  4OFO A;  3IB0 A;  3PPO A;  5TU0 A;  5FTL A;  3MBP A;  1IEJ A;  2ZXT A;  1S3S A;  1XNR M;  2XXR A;  3K1J A;  4DLD A;  4PT5 A;  2DXI A;  3J2P B;  1G4A E;  3EPE A;  1A40 A;  2HZK A;  5M2V A;  2PMS A;  2RF1 A;  3T66 A;  3RY3 A;  1XVX A;  3VDU A;  4FEB A;  3O28 A;  2DXY A;  4PP0 A;  3VXB A;  3IJO B;  1IN8 A;  1JR3 D;  4DR2 M;  3PD8 A;  1EZ9 A;  2EUC A;  4IJF A;  4CHT B;  4AG5 A;  5EXS A;  1N77 A;  2RGH A;  3SER A;  3FXU A;  4GXA A;  4G8H A;  2XXV A;  3U6L A;  2RKM A;  3SEW A;  4GHL A;  1ZLQ A;  4CIS A;  3JZJ A;  2DHR A;  3DP6 A;  4TOZ A;  3ILK A;  2Z8D A;  2Y7R A;  1WDN A;  2CV0 A;  1Y3N A;  2Q89 A;  1B3F A;  3L6G A;  3HHX A;  2CV1 A;  4AW4 A;  4JI8 M;  4IO2 A;  4H8J A;  3MWB A;  3UN6 A;  4B7F A;  4X9T A;  1Y1M A;  1K82 A;  1XHY A;  3JR5 A;  4GWO A;  4MLV A;  3OTO M;  3FJM A;  3LR1 A;  3OEL A;  3T1Y M;  4H5F A;  4JWY A;  2R6G E;  5F1Q A;  1F9B A;  2E0S A;  4ZDM A;  1J7K A;  4FJP A;  4GKK M;  4GIP A;  4DR5 M;  3N6T A;  2GHB A;  4QFO A;  4UAC A;  3U5Z B;  1SXJ A;  4LF8 M;  3GBA A;  2Z8E A;  4W5W A;  4FIM A;  3GLI B;  4DUZ M;  1LCF A;  3GRR A;  3VE1 B;  2KZU A;  1PJI A;  4MB7 A;  2NXO A;  4QFK A;  1HSJ A;  4OEN A;  2H98 A;  2Z4R A;  2ANJ A;  5H8N A;  4YKI A;  5L8D A;  3RT8 A;  1JEU A;  2XXI A;  3SDF A;  1JW1 A;  4NRW A;  1IQ7 A;  2KLF A;  4B3M M;  3P7I A;  4U1Z A;  1MXV A;  2H9B A;  3G3J A;  4YMB A;  5KZT A;  3ZCB B;  1CE2 A;  1FNN A;  2F5X A;  3SYK A;  3UJN A;  1LV7 A;  1MPC A;  5ITX A;  4NF4 B;  1E94 E;  2L7I A;  4GL8 A;  1LST A;  4N07 A;  3GQ5 A;  3SMS A;  1P1W A;  4G2Z A;  1B40 A;  3FGS A;  1SD3 A;  4OET A;  4GIT A;  1FW0 A;  4XIG Q;  3BKI B;  1NHW C;  3M8U A;  3MVW A;  2DWA A;  2DQV A;  3AOE C;  3M6A A;  1WXQ A;  4C0R A;  1PBP A;  1TFA A;  3F11 A;  4XBO A;  3MP6 A;  4LZ7 A;  1S7Y A;  4KHP M;  3GLI A;  4QOZ C;  1GV8 A;  2XSZ D;  2HFB A;  3Q27 A;  5IWA M;  3K0V A;  1MY2 A;  5CMB A;  4YHH M;  4O3A A;  4JI4 M;  4JI1 M;  2D7G A;  4M1V A;  4H67 A;  2R65 A;  1ZIU A;  1A55 A;  3C4M A;  5H8F B;  3TQW A;  4F1U A;  4NXN M;  2NWJ A;  1HQY E;  1T0K A;  3HJ8 A;  4UA8 A;  4IB2 A;  4BBA A;  2Y20 A;  4YZZ A;  5FTJ A;  2P2A A;  1FTJ A;  3U6D A;  3K8Z A;  2KW0 A;  4RPO A;  1R6Z A;  4FAJ A;  2ZYN A;  3K1N A;  5AA1 A;  2QCU A;  3H4M A;  4X1B A;  3RUM A;  2VD3 A;  1URD A;  5AA4 A;  2LNH C;  3TWL A;  1OLA A;  1OFH A;  1DO2 A;  4OW0 A;  1TXF A;  3LUY A;  4PFY A;  2I3V A;  4LA9 A;  3FTD A;  1Z5A A;  1YUB A;  3O6I A;  1K3X A;  5FTM A;  3QK6 A;  5ITP A;  1NNK A;  4EF1 A;  1QW0 A;  5I2N A;  1ZU0 A;  1N0T A;  3FAT A;  4THI A;  4F3G A;  3FVG A;  1XMQ M;  1D2N A;  3OMB A;  3FUU A;  5A5X B;  3SAW A;  3PFI A;  1EE8 A;  4ZPX A;  2VGQ A;  4OVZ B;  2V3U A;  3KOX E;  1B2H A;  4KYS A;  4G68 C;  2I7N A;  2IA4 A;  3TTR A;  1DGH B;  2DZN B;  1H43 A;  4H1X A;  5F3W A;  2YFQ A;  4I5S A;  1URS A;  1JQF A;  4H6D A;  1LAH E;  1ZTY A;  2R46 A;  4FW9 A;  1IM2 A;  4GC5 A;  3IOW A;  3GBB A;  3B6T A;  3S4U A;  5ICT A;  4IBD A;  4AG6 A;  2D5W A;  3H6W A;  5H8F A;  1AH5 A;  2CZL A;  3FVO A;  4MGZ E;  3HJQ A;  2Y0T A;  4KCC A;  3MZ9 A;  4JI7 M;  4DXC A;  1P1O A;  3RE8 A;  3TEL A;  2DS9 A;  2J7N A;  4KPT A;  2KRK A;  4L17 A;  1QAO A;  2FYI A;  5JI3 E;  4OXV A;  3U93 A;  3H06 B;  2C9O A;  3KN8 A;  3TPZ A;  1SVX B;  1B7U A;  2R18 A;  3SHF A;  4JB7 A;  3SAV A;  1Q39 A;  1XC1 A;  4LJ4 A;  2CHG A;  4GLI A;  4F3S A;  1B05 A;  3UMM A;  1HNX M;  3WHK A;  1SYH A;  4BDL A;  3OO9 A;  4NMY A;  4AQY M;  3LBS A;  4PFT A;  3MK6 A;  1FQB A;  4BDO A;  3I51 A;  3U6P A;  4ZED A;  1USY E;  1Y3P A;  5A5X A;  3SAR A;  4RNS A;  4HCW A;  3IG8 A;  3LSX A;  2HAU A;  3U60 B;  3HU3 A;  4O3B A;  2FNA A;  3KOY E;  1JVX A;  3HN0 A;  1ELJ A;  5JTY A;  1L1T A;  2OCU A;  4ELP A;  1MS7 A;  2D3I A;  3KFM A;  2Y7P A;  3GPP A;  4GQO A;  4EQ7 A;  4POX A;  3QSL A;  3RNN A;  2G29 A;  3TYH A;  2HKJ A;  4IY6 A;  4E0X A;  4JI2 M;  1HT2 E;  4QF9 A;  3QWL A;  5J1D A;  4HW8 A;  3CG3 A;  4FOR A;  1QYR A;  1OVB A;  4G4N A;  2DE2 A;  2XD3 A;  3Q8X A;  2QP9 X;  4GMQ A;  3CRB A;  4OMB A;  4AB6 A;  3BFT A;  2RCB A;  1EZO A;  2XEP A;  1N76 A;  4EF2 A;  3BBR A;  3TTK A;  3FIR A;  1ZBM A;  2UVI A;  1I69 A;  4NF8 B;  3G3H A;  1PC3 A;  3KS4 A;  4DZ1 A;  3HV1 A;  2FE8 A;  3LSW A;  4XKN A;  1QUL A;  2QMW A;  4JYA M;  1XT8 A;  3D8L A;  1TH4 A;  2VD2 A;  4LJ7 A;  2Y7W A;  3M7G A;  1YSY A;  2XD2 A;  2F5N A;  1B3E A;  4RY1 A;  3RGY A;  4I9D A;  3H6U A;  1DGF A;  2D21 A;  1SXJ C;  3TTN A;  2DE3 A;  4OYV A;  1US5 A;  3VLW A;  3O2A A;  3FD3 A;  1EH3 A;  2DXR A;  2M5Z A;  3WHL A;  4EDP A;  2FA7 A;  5CMK A;  4KR5 A;  1B58 A;  4L15 A;  4YU0 A;  2XFT A;  3MC2 A;  2O68 A;  4LFB M;  2ZAN A;  2L6O A;  1L2D A;  5EP3 A;  4U23 A;  4K3F A;  4U4X A;  4M0W A;  4LJ9 A;  1LGB C;  2R9J A;  3EHT A;  5EHS A;  1VR5 A;  4DE8 A;  2DP8 A;  2F78 A;  5K2X A;  1KWH A;  2Y84 A;  2I4C A;  1AMF A;  2ZAO A;  4MLQ A;  3JR4 A;  3DP8 A;  4M9Z A;  2ZBK B;  2XXQ A;  5I58 B;  4G4R A;  2PX1 A;  3I4V A;  1Z6T A;  3J27 B;  3J7A S;  2X49 A;  1Y4C A;  3VK7 A;  2ZYK A;  1QUJ A;  2H99 A;  3UK6 A;  2XXT A;  4WED A;  3EHU A;  1VFE A;  3IJX B;  3CVG A;  3SEU A;  1L5T A;  5I56 B;  4DV7 M;  1EU8 A;  1B5J A;  1MQG A;  3IR1 A;  4YKK A;  5HBC A;  2BJW A;  1DPP A;  3QAX A;  5ICQ A;  3CF2 A;  2VP1 A;  3PNY A;  3TPA A;  3UA8 A;  3EIH A;  3ZKK A;  1MQJ A;  3GPX A;  5BWJ A;  3VKG A;  3R7X A;  3GLH B;  2XXW A;  5KQ8 A;  4B3T M;  3PGF A;  1IY0 A;  3B6Q A;  4FWD A;  2HXW A;  1US4 A;  1QKA A;  1HR0 M;  1DSN A;  3KOT A;  4ZE8 A;  1LAF E;  2Z3X A;  4QFL A;  3SKP A;  3CG1 A;  3T93 B;  3U72 A;  4MGI E;  4DV4 M;  4P0G A;  2WKY A;  1DOT A;  3G7W A;  4ZEC A;  4L78 A;  4R73 A;  4DUY M;  5EXP A;  2RKO A;  3ILT B;  4C1T A;  4F18 A;  5CMC A;  1XOC A;  4JWO A;  2XSZ A;  5H8S A;  2UXB M;  3L25 A;  5H37 D;  4GIZ A;  4HTG A;  1H76 A;  1QAQ A;  1NNJ A;  4MH5 A;  1IN6 A;  2XFS A;  5I58 A;  1IZ1 A;  1PEB A;  2L09 A;  1OQH A;  1G8P A;  3B6W A;  4GOT A;  4D82 A;  1MY0 A;  4NWC A;  1GVC A;  3HJS A;  3CFX A;  3OXN A;  4ISU A;  2UVG A;  4N6P A;  3RGS A;  5IZ7 D;  3U6Q A;  2PT2 A;  1LLS A;  4QHT A;  1B5I A;  3FUZ A;  4JSO A;  2J7O A;  4JI5 M;  3HHZ A;  4PCZ A;  1N3X A;  4DXB A;  2FFJ A;  4YKJ A;  4YB5 A;  4PFU A;  1BTJ A;  3VV5 A;  2DWN A;  1Q1K A;  5AA3 A;  3RLF E;  2F35 A;  3FJG A;  4F19 A;  5HM4 B;  4ELO A;  3L28 A;  2FNC A;  2QBY B;  2QS3 A;  1LFH A;  4R6H A;  4OES A;  4KD5 A;  1LAX A;  5LOM A;  4FE8 A;  3J80 S;  3KDS E;  4MGK E;  3CF0 A;  4IJE A;  2UUB M;  1XMO M;  4DR4 M;  3L6H A;  3W9V A;  4GKJ M;  2CEA A;  2H5Y A;  3TQL A;  3T1H M;  5ITY A;  5H8H B;  5KO3 A;  3FJ7 A;  3MP8 A;  4PDG A;  3K02 A;  3U6O A;  5EYF A;  4H5G A;  3NBI A;  1E32 A;  2XGN A;  2YNM D;  1TGU A;  2UUC M;  3N94 A;  1M5F A;  4IBC A;  2ESN A;  5CI5 A;  4R75 A;  1L1Z A;  3CSB A;  1PB8 A;  1G59 A;  2V3T A;  4XTC Q;  1Q35 A;  4R2F A;  4P0I A;  3LVV A;  4B3R M;  3TAJ A;  4JI6 M;  4NF6 A;  3I4Y A;  1T3T A;  4AKH A;  3MAM A;  2RIN A;  1BKA A;  5ITU A;  3Q25 A;  5I2K B;  2D7H A;  1D9V A;  4Z8X A;  5BR8 M;  4OWD A;  1NVM A;  2I3W A;  4OX9 M;  1MY3 A;  1B52 A;  1MH3 A;  2XXX A;  4XKP A;  1P99 A;  3E3K A;  3FUX A;  1B7Z A;  2OLB A;  1R7R A;  2DWM A;  2QBY A;  3MZB A;  3RTW B;  3VVD A;  4LFA M;  1SW1 A;  5CM6 A;  1G41 A;  2X26 A;  5CC2 A;  2Z8F A;  3ZC7 B;  2E5L M;  2F8D A;  2OZZ A;  1M5E A;  1A8F A;  5EHM A;  3D4G A;  4X1D A;  4ITQ A;  1GKI A;  2C9C A;  3CI8 A;  5ELV A;  3MPL A;  2DWJ A;  1USY H;  1I94 M;  1IXS B;  4LF6 M;  1OJL A;  1DGB A;  5H8H A;  1FQD A;  1LBC A;  3SBJ A;  1O63 A;  4X65 M;  3TWM A;  4LP2 B;  2E1S A;  5I57 B;  2DWZ B;  2Q9T A;  3IB1 A;  3G3G A;  3VLV A;  4F1Y A;  2AIX A;  3O66 A;  1O7T A;  3D4C A;  2Q2C A;  1B5H A;  4DV1 M;  1R1N A;  4YB6 A;  4R6Y A;  4JBZ A;  3M0E A;  4GC9 A;  3GO8 A;  1KSF X;  1FJG M;  5K2Y A;  1R2Y A;  2CV2 A;  3FUV A;  3IO6 A;  3L27 A;  4U22 A;  2XX7 A;  5EP2 A;  1Z7M E;  4IY5 A;  4LRS A;  1NJF A;  5I2K A;  1GVN A;  1ZJL A;  3VFJ A;  3TUS A;  3PUX E;  1G3I A;  2Z4S A;  3T9H B;  3VXC A;  3PVS A;  1MQH A;  1XHB A;  3O29 A;  4DV5 M;  3THG A;  1JVY A;  2A5S A;  3UK4 A;  3N5L A;  1BLF A;  3EIE A;  4IO7 A;  3KEI A;  1GL6 A;  2ZNU A;  3LSL A;  4NF5 B;  1HQC A;  2GFE A;  1A99 A;  1MG1 A;  3EN3 A;  3VVF A;  4MBP A;  3U5Z A;  3VFD A;  4L8R C;  1FTK A;  2CHQ A;  4TLM B;  4IBB A;  2IEE A;  5GKN A;  4FEC A;  1H45 A;  4ESW A;  1NKX A;  5I57 A;  1P1Q A;  3RPW A;  2L7H A;  1HSL A;  5KQD A;  3TFL A;  1Y9U A;  3R6U A;  1YPN A;  4LRT A;  1VE4 A;  5FHN A;  3SC3 A;  1IUD A;  3GLG B;  1W5T A;  1FCK A;  3U6C A;  3V5A A;  3S2V A;  4DCX A;  4QRZ A;  1Q3B A;  4E0W A;  2V25 A;  3BFU A;  2O6A A;  2NQ8 C;  2I49 A;  2QPQ A;  2RGO A;  4G4O A;  3HGI A;  3KOZ E;  3KW6 A;  5FTN A;  4NF4 A;  4F1V A;  4U1O A;  1ANF A;  4P11 A;  3ZSF A;  3A42 A;  1IIW A;  3W0F A;  4FWH A;  3IO4 A;  3VKH A;  1XS5 A;  3A45 A;  1L2B A;  4X64 M;  4F22 A;  4KCD A;  3D8B A;  3VLF B;  2O5R A;  4WW0 A;  1MPB A;  2Y0Q A;  3MQ9 A;  2P5T A;  1K3W A;  2YPN A;  4R7G A;  1IXI A;  2EO2 A;  3ODB A;  5AA2 D;  1SW2 A;  4AKG A;  3TQS A;  3MP1 A;  3K6U A;  1SXJ E;  4NF5 A;  3TMG A;  3A3U A;  3PPR A;  5E26 A;  2F5P A;  4II7 A;  1SBP A;  5ITT A;  3MJ5 A;  1IXG A;  4Z6Y A;  1UM8 A;  1TWY A;  5KPR A;  1MM6 A;  2XZU A;  4QHS A;  4IO4 A;  3H7M A;  1MXX A;  2M8C A;  1AOV A;  2HQ0 A;  4ESX A;  1XWI A;  3K1P A;  3O6H A;  1N36 M;  5CBS A;  4PDI A;  2Q8J A;  4H0W A;  3HHW A;  3IX1 A;  4QHQ A;  4IO5 A;  1B4Z A;  5L9M A;  1UTH B;  2OBG A;  3FUT A;  4LVQ A;  2V6Z M;  3UZU A;  2LH0 A;  3TCH A;  3DEL B;  3AOG A;  3GP1 A;  3U61 B;  2F4V M;  4F39 A;  1O64 A;  3FVN A;  2D7E A;  1NL5 A;  3OEK A;  3IK6 B;  4GL0 A;  1HNW M;  5C1B A;  4REZ A;  4EXK A;  2O1M A;  1IN4 A;  1OQG A;  2QL3 A;  2AHM A;  3UGW A;  1XC8 A;  4DV0 M;  1D4N A;  4LCB A;  4RNA A;  1VDD A;  3EQ1 A;  3E4R A;  4ZEK A;  4DR7 M;  4JN6 A;  3B7D A;  3I6V A;  4MF3 A;  2AL5 A;  2ONK E;  2GRV A;  2V1C A;  2PYY A;  3FZV A;  5DVF A;  3SEY A;  2UXC M;  4FCW A;  3GPY A;  1TDH A;  4KFQ A;  5EXT A;  4OHN A;  3DLN A;  2XH9 A;  4FCT A;  3Q28 A;  4GRK A;  4RXL A;  4NRV A;  1LBB A;  4OVZ A;  1DPE A;  1FQF A;  4EXL A;  2O1L A;  5KCJ B;  1ZAE A;  1DGH A;  3C34 A;  4O3C A;  1AIV A;  4OVJ A;  1OFI A;  3QUJ A;  1W5S A;  4POW A;  1NNF A;  4EQ9 A;  5L9S A;  3MVX A;  2F6G A;  1JR3 A;  2ZM6 M;  2XXH A;  4Z7E A;  2R62 A;  3PMX A;  5FHO A;  2O7U A;  3C36 A;  4M9X A;  2I0C A;  4I8C A;  4KYD A;  1DGG A;  3DM0 A;  3U61 A;  3O97 A;  2YLN A;  1MU5 A;  4Q30 B;  2B3B A;  4NSO B;  5KDT B;  1M5D A;  3LMM A;  4KOD A;  4ZS9 A;  1Q3C A;  3PUZ E;  3Q29 A;  3TEP A;  4ZE9 A;  3UIF A;  4QFN A;  3T9U A;  1IY1 A;  3J7B A;  2BJV A;  5TPA B;  1P1N A;  1HNZ M;  5FHM A;  4BDM A;  1MXZ A;  4LGY A;  4LZJ A;  2DVW B;  4LY6 A;  3PMW A;  4B3S M;  2A5T B;  2K47 A;  2EA0 A;  1BIY A;  3FV2 A;  3OO6 A;  8CAT A;  2H25 A;  2BJJ X;  3T22 A;  3T38 A;  3LQR A;  3J81 S;  2FOI C;  1MY4 A;  1L2C A;  5FTH A;  5KCJ A;  3U60 A;  4CGY B;  4XGI A;  4PET A;  1IBL M;  4IBE A;  4NL4 H;  1S9T A;  4LON B;  2V3Q A;  3FTC A;  4LJ6 A;  1SDX A;  2Y7K A;  4OZ9 A;  4HLQ A;  1HSE A;  1N7W A;  4KO8 A;  3OSR A;  4GRI A;  1EZP A;  1PB7 A;  2PBW A;  2O84 X;  3R8F A;  3H3G A;  3IOV A;  5DT6 A;  3U94 A;  1H3D A;  2F36 A;  5KDT A;  3L26 A;  3KP1 E;  1XXH B;  2V84 A;  2M60 A;  4LZ8 A;  3R26 A;  3JAM S;  1LFG A;  4LAT A;  3AOE A;  3GRY A;  4NE4 A;  4R72 A;  4OFJ A;  3SEV A;  3KXE C;  2I4B A;  2VHA A;  1B4H A;  3ZH9 B;  3FV1 A;  4EUO A;  5TPA A;  4MM3 B;  1GL7 A;  4NF8 A;  2QZ4 A;  2X7Q A;  3SAS A;  3HU1 A;  3L29 A;  4LGM A;  3HCQ A;  2REG A;  5DYG A;  1KFV A;  5KPT A;  1B0H A;  2DVC A;  4YAH X;  1LCT A;  3K2D A;  4G68 B;  1Y20 A;  3S9N C;  3K01 A;  1XNQ M;  4G77 A;  3HPI A;  2B3F A;  3C31 A;  4HCY A;  2OK2 A;  3C35 A;  1B1H A;  2NVU B;  1YE9 A;  4A3V B;  2QRY A;  3FKE A;  5AA2 B;  1E9R A;  3T9X B;  1UQW A;  3L2A A;  1N32 M;  1SI1 A;  2VQE M;  4F3P A;  3FXR A;  5JI2 E;  1B32 A;  3GRV A;  1MQI A;  3IOR A;  7CAT A;  3FYC A;  2XLJ A;  2OJT A;  4R9F A;  4JXJ A;  5JEI A;  3QAU A;  3SFZ A;  2PVU A;  1I6A A;  4WUR A;  2UVH A;  3FAS A;  3H4Z A;  3IOU A;  4F3B A;  5A2Q S;  3K00 A;  4I1D A;  4LFC M;  3FUW A;  3FTF A;  5DYH A;  3AV0 A;  3ZKL A;  1JW5 A;  3QIM A;  5DVI A;  4BDQ A;  5FTI A;  4BDR A;  3KS8 A;  4Q5T A;  5C18 A;  3USD A;  3TE6 A;  1CB6 A;  1QKB A;  2DWI A;  2LWX A;  3HHY A;  2QJE A;  3FXQ A;  5LMN M;  3SES A;  3SET A;  3KSX A;  5I56 A;  1QVS A;  4MH0 E;  5E6J A;  1NNT A;  1ATG A;  3H6T A;  3KZG A;  4FCV A;  3NWL A;  4F2O A;  4LQ5 A;  4LQ2 A;  4ZEF A;  1FTL A;  3GLH A;  1FTO A;  1DTZ A;  2HEU A;  3V89 B;  2F7A A;  2YR0 A;  3SAU A;  3IAZ A;  4WKM A;  2G93 A;  1D3K A;  4FVM A;  5EQT A;  4LF4 M;  4JSD A;  5AA2 A;  3GQ4 A;  4H8I A;  3M3K A;  1Z5C A;  3FYD A;  3V83 A;  3EHS A;  2V1U A;  3K4U A;  4DV6 M;  1PBQ A;  2KXE A;  3OOA A;  3RGP A;  3ZS6 A;  1MH4 A;  1NNP A;  3CIJ A;  4ZZA A;  5JK4 A;  1YTV A;  4NSR A;  1MRP A;  3LC8 A;  3K6V A;  4JI0 M;  1IQP A;  4LJ8 A;  5B70 A;  1D9Y A;  2GH9 A;  1RKM A;  4U2R A;  1IIT A;  2XZF A;  4X66 M;  3IB2 A;  4RF0 A;  3WAE A;  2Z23 A;  4LF7 M;  1QAM A;  3DP4 A;  2HAV A;  3HHG A;  3VK8 A;  1RYX A;  2PT1 A;  2QS2 A;  3AKZ A;  4M0D A;  3OD7 A;  1N7X A;  1YAE A;  4BLC A;  4M4G A;  4IBK A;  2I48 A;  2KA6 B;  4AQ4 A;  3LQQ A;  4WXJ A;  3E9S A;  3I3V A;  4KHZ E;  4RA1 A;  4YY3 M;  3SHG B;  1S50 A;  4AB5 A;  3TWK A;  2ZNS A;  2I6E A;  1QQW A;  2ALU A;  1SXJ B;  1SI0 A;  1ZMG A;  2KEB A;  2LAO A;  2KRU A;  5CBR A;  2VII A;  3KVW A;  3PPP A;  5EXX A;  2UXA A;  3VDP A;  3THI A;  3GLF B;  1N75 A;  3E13 X;  4GFR A;  1J5E M;  3IL1 B;  2DOJ A;  2F7B A;  2DVZ A;  2XHD A;  3HU2 A;  1QZM A;  3G3F A;  4DV3 M;  4F2Q A;  5H8N B;  1FQC A;  4PE5 B;  1QUK A;  1VFD A;  2NOO A;  5FTK A;  4R9G A;  4NOO B;  1KYI A;  1JEV A;  5B7D A;  1YCJ A;  2F34 A;  3DA1 A;  3KG2 A;  3K2L A;  3OO7 A;  1MM7 A;  4OTE A;  1GR2 A;  3Q26 A;  1TH3 A;  1MDP 1;  4D81 A;  3BOS A;  4GVO A;  1B9J A;  3KBR A;  1NFT A;  3AFH A;  1LAG E;  3E9X A;  2Y7I A;  4RPN A;  3KN7 A;  4ZEI A;  4LJ5 A;  3FD9 A;  3HO7 A;  1X37 A;  2UYF A;  4MFI A;  1PB9 A;  2CHV A;  4B08 A;  3KFU G;  4NTL A;  4JI3 M;  3V8X B;  3KOW E;  1NH7 A;  4YIC A;  2O51 A;  3GLB A;  2B65 A;  1NH8 A;  2CFO A;  1ZQ9 A;  3GRU A;  3TCG A;  2DWL A;  2P0S A;  2RC8 A;  4RYA A;  3CF6 E;  2RC9 A;  1B3G A;  1MXW A;  4PD2 A;  4RF1 A;  3N6U A;  1IBK M;  4IO3 A;  5I84 A;  5HPQ A;  3A46 A;  1OVT A;  1WVJ A;  2DWH A;  4HL4 A;  5FSW A;  4ZEB A;  2DZO B;  1MQD A;  2CUZ A;  3QXM A;  3RN8 A;  3GLF A;  2P1S A;  2OQ4 A;  3H03 A;  5TP9 B;  1N78 A;  1B0L A;  2F7C A;  2I0B A;  1PJJ A;  3PPQ A;  4R6K A;  3G3I A;  1NHG C;  3DFZ A;  2UYE A;  3QUF A;  3RQT A;  2Q2A A;  2HZL A;  5DEX B;  4P16 A;  3U1O A;  1N04 A;  3AXF A;  2DYX A;  3N26 A;  1TDZ A;  2HHH M;  1VSO A;  2QSX A;  2F6P A;  5L9O A;  2C98 A;  2RC7 A;  3JV9 A;  4LF5 M;  4R2B A;  3SEX A;  1MDQ A;  3QYT A;  4DR1 M;  1POY 1;  4ELQ A;  4I8O A;  2THI A;  5FLX S;  1I6B A;  4ELR A;  1FTM A;  3C9H A;  2XF3 A;  4QFP A;  4LJA A;  5EP4 A;  2W82 A;  4DIG A;  3H6V A;  5AA4 B;  4OEV A;  4QNR A;  4OQO A;  3A09 A;  2V93 A;  3SAT A;  2H4I A;  5IAI A;  4QOS A;  5CMM A;  4DCY A;  1JQJ C;  1I6Q A;  5BUU A;  2Q88 A;  3TTM A;  1II5 A;  3MZ1 A;  3PMV A;  4QSC A;  5ISU A;  4KYE A;  5I2N B;  1AL3 A;  4NWD A;  5I59 B;  2G5G X;  4FD2 A;  4G4P A;  1B46 A;  5ITO A;  2ERC A;  4YB7 A;  1MXY A;  2O7I A;  3U92 A;  2R4E A;  1IXR C;  1B6H A;  3WAF A;  1IXZ A;  5TP9 A;  1R6B X;  4AKI A;  1N34 M;  4NED A;  1R9L A;  4LF9 M;  3CSG A;  4Q0C A;  4GHA A;  4DR6 M;  4YKP A;  1QUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...