3KSXA

The alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
molecule keywords Nitrate transport protein
total genus 95
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA02
3PMXA 1ZBMA 4KHZE 3T9XB 2XX8A 1JEUA 5H8HB 4OYVA 1SYHA 4BDNA 2HFBA 2I3VA 1ATGA 4GXSB 3QIMA 3VE1B 1CB6A 4KQPA 1A55A 4POXA 1T0KA 1MXVA 1H76A 5HBCA 3H6UA 5AE4A 2F36A 3VFJA 4F3GA 1UTBA 1NH7A 1JEVA 1RYOA 2O1LA 1PBPA 3FIRA 3SERA 4KD5A 5BWJA 1R9LA 2CZLA 3T96B 1B40A 2KLFA 2QL3A 4GL0A 5DT6A 5AA2A 1B51A 1IUDA 4LATA 3KG2A 4N07A 2G29A 1VR5A 3Q25A 4N6PA 4H5GA 3TTLA 3DP6A 3RNNA 3UGWA 5F7VA 5KDTB 1B32A 5DEXA 5ISUA 3O2AA 1N7XA 4WEPA 3TPAA 3VLWA 4E0WA 2GHBA 2QMWA 3PPQA 4EUOA 1R6ZA 3HO7A 4O3AA 5EYFA 2HCAA 4L17A 2IEEA 5FHNA 4GQOA 1B1XA 2UYEA 1ZKBA 1B58A 3RTFB 4F2QA 1Y3NA 2YJPA 1ZTYA 3TUSA 3FJGA 4POWA 1MPBA 1S7YA 2O7IA 3I3VA 5HPQA 4YKIA 3B6QA 4R6YA 2DXYA 4GRKA 3N94A 1MXXA 1B2HA 3PUWE 4JB7A 4TLLB 3MPKA 1XVXA 1B6HA 1MG1A 1LAGE 1Q35A 2UVGA 2ZXTA 3O6GA 4RJZA 3K6WA 3UIFA 1DMBA 1B52A 2ZNSA 2THIA 2QSXA 3LSLA 5I56A 4GLIA 2O68A 3PV0E 5EHSA 1TT1A 3MP8A 3VVFA 3D4GA 1MQJA 4GVOA 3FXUA 5L9SA 1GR2A 3O66A 5KDTA 3FJMA 4GFRA 5AA4A 2OBGA 3GXAA 2Z8FA 3IX1A 4IB2A 4QFPA 2P0SA 1SW1A 5DEXB 1B9JA 1TFAA 1ZJLA 3E13X 2UYFA 3K1PA 4OFJA 1UIVA 1SBPA 4Q30B 1USYE 5ITOA 5TU0A 2B3FA 3PUYE 3IB0A 3TAJA 2XX7A 1NNPA 3FXRA 4OETA 2RC9A 2GRVA 1H43A 3EF7A 5CI5A 3TYHA 3DM0A 2DWHA 1EU8A 4DCYA 2RC8A 3EN3A 2F6PA 3DELB 3CRBA 1UTHB 1FQDA 4G68B 2F34A 3MZ9A 3C32A 1QKAA 4KYSA 1Y1ZA 2HZLA 1OLAA 4ELOA 2X26A 1Y4CA 2I4BA 1US5A 3QYTA 2RINA 2NWJA 2O6AA 3CG3A 1JW4A 4YKPA 1A40A 1Z7ME 4EF2A 3CIJA 3RQTA 3RT8A 1FQFA 1VFEA 4GWOA 2QS3A 2UVJA 2FYIA 4IO4A 4YB6A 2XXHA 3D4CA 4XXUA 3M3LA 1XHYA 2Q89A 4OFLA 1A7LA 1PBQA 3IB2A 3CSGA 3MVZA 3U93A 5AA4B 5ICQA 1IEJA 3MVWA 3MUQA 4GF8A 1BLFA 2REGA 4ZEBA 2IA4A 4PFTA 2FA7A 1MPCA 3IJXB 3MP1A 5JTYB 1LAHE 1Y1MA 2Y84A 1N84A 1NNKA 4I9DA 4RPNA 4F19A 3M3FA 2V3QA 3SDFA 2GFEA 1MY2A 2I6EA 4DE8A 3L6GA 2W7YA 4ZEDA 2DVCA 1LLSA 2OZZA 3LBSA 3V89B 2R9JA 2G93A 1B3FA 3IAZA 4QFKA 3IOTA 1GGGA 2F5XA 3OD7A 4HCYA 4OHNA 3OO6A 3Q27A 5FTIA 3VDFA 3TZAA 2A5TA 4NEDA 3A09A 3PMVA 4ISUA 1NMUA 2V25A 3KOTA 1NFTA 4BDMA 5DVIA 4KCDA 1NL5A 4YB5A 4I62A 4F29A 1B7ZA 1B3LA 3H6TA 3USDA 4EXLA 4C1UA 1ZMGA 4LP2B 1TFDA 2AL4A 4IO3A 2Q2CA 3HSTA 1IXCA 4OEUA 3SKPA 3MBPA 4OENA 5H8SA 4LQ5A 4WEDA 1P1QA 4MBPA 4ZDMA 3FVOA 1ANFA 1YCJA 3CG1A 3IOWA 3OENA 3RT6B 1JQFA 3LSFB 3OXNA 4GL8A 4RPOA 1GV8A 4OFOA 3WAEA 2O1MA 3RY3A 2I0CA 4KI0E 3TELA 2E1SA 1FTLA 3W9WA 4C1TA 2DP8A 1XC1A 5TP9A 1B4HA 4NF6A 4NF4B 4JWXA 3FVGA 3MWBA 2H5YA 3DLNA 3H6WA 2Z23A 3K00A 1PB8A 4MLVA 4U1ZA 1PEBA 2HZKA 1M5DA 3H7MA 3S2VA 3BKIB 4BLAA 3BBRA 3DP4A 1RYXA 2PVUA 4LZ8A 2NUVA 1IXGA 1A99A 4ZE8A 2E0SA 2OCUA 4AQ4A 2GH9A 4OERA 3PD8A 1BKAA 2VD2A 4NF8B 3IOUA 3PD9A 1B3GA 1IITA 3LUYA 1UQWA 4EQ9A 4P0GA 4ZE9A 4ZECA 1QUJA 3K1NA 2ZYMA 3Q29A 2V3TA 1ZIUA 4X9TA 1DTGA 1B7UA 1JETA 4QFNA 1DTZA 3TDJA 5IAIA 5LOMA 3O6HA 4R75A 1LAFE 4Q0CA 4QSEA 5JEIA 5AA2B 2Y7RA 3V83A 2ZNUA 3U8QA 4JDFA 4RA1A 4Z0IA 3GBBA 1QJMA 1FW0A 3CFLA 1M5BA 3OSRA 4H0WA 2O84X 4I1DA 2V3UA 4PQJA 4M4GA 2YLNA 1NH8A 1NKXA 4H1XA 4KYEA 1SYIA 2AIXA 3SEXA 3R6UA 2DE2A 4H67A 5DTBA 1L5TA 4YMBA 1JVXA 3SEWA 1B5HA 3OOAA 5KCJB 4NF6B 4NF4A 4PE5B 3CSBA 3EHSA 1LFIA 1MY3A 1OIBA 2F6GA 2O69A 2QS2A 4KPTA 1N0TA 1DSNA 1JVYA 3HPIA 3HN0A 3JZJA 3PPPA 4ZEIA 1I69A 2Z8EA 3E3KA 5CMCA 3CFXA 3TFLA 3U1OA 5CRYA 3PUXE 1S9TA 1A8EA 1I6AA 3G3JA 3C9HA 1DPPA 4I8CA 1MDP1 5CMBA 4MH5A 3RLFE 4ESXA 1EZOA 1Q1KA 2DE4A 1HSJA 3MJNA 2LAOA 2D3IA 1P1NA 1P1UA 4NF8A 4KFQA 4XKPA 4FATA 1P1WA 2NVUB 1KWHA 1URGA 3O9PA 1OVBA 4EF1A 1PB7A 2F8DA 1FTOA 4X1BA 2VOZA 2Y7PA 1ZU0A 4ELQA 2AYSA 2ZMBA 3I5OA 3FVKA 4NWDA 2REJA 3KJ7A 4WXJA 2PMSA 2QJEA 3PPRA 2DOJA 2BJJX 3G3IA 1MRPA 2ZYNA 4X1DA 2XXIA 3OO8A 3FZVA 1AMFA 3FV2A 1OMPA 5AA2D 3PPNA 4F3SA 4XKQA 1LFGA 3OO7A 4OMBA 4IY6A 4LQ2A 2F97A 2HAVA 3FATA 3N5LA 2QS1A 1LFHA 3B6WA 2XD2A 2ZYOA 5FTHA 3VXBA 4QHQA 2I4CA 1DPEA 1MXYA 3EHUA 2R6GE 4M1VA 3IO6A 1OQHA 3C34A 4R72A 4F2OA 5JK4A 3OO9A 1MXWA 1UTHA 2R71A 1GVCA 2DE3A 4BDRA 4Z7EA 3JV9A 3O6IA 4EXKA 3IR1A 4IGTA 1R9QA 3T66A 2OJTA 2RCBA 4N13A 1S50A 4DLDA 1N7WA 3G3KA 3M3KA 4YAHX 3PGFA 1TWYA 3A3CA 2QMXA 3EPEA 1I6QA 1BTJA 4OXVA 4XIGQ 3ONMA 5I59A 3R7XA 2XXXA 1PDAA 4MF3A 3T9HB 4IO5A 4LVQA 1BP5A 1XVYA 3N6TA 5I57A 1POY1 3PU5A 4DZ1A 4FECA 3QAXA 4R2BA 4G68C 2V84A 1D4NA 4R74A 1F9BA 3VV5A 4DXBA 3W15C 4F3PA 4Q8RA 1AOVA 1N3WA 5JTYA 1XT8A 2VD3A 3UA8A 1OQGA 4RXLA 4XKRA 4O3CA 5EHMA 4RK9A 4F1VA 2F7AA 1Z7NE 1OVTA 2ONSA 3K6VA 3SEYA 1VFDA 3HV1A 2FNCA 4U23A 1QUKA 1VE4A 4F31B 2UVIA 4NE4A 4P11A 4DXUA 3PMWA 3K6UA 4LZ7A 1YPNA 1OLCA 2DWJA 3MPLA 4KYDA 4P0IA 4FJPA 4H6DA 4JSOA 3ZKKA 5IKBA 5I2KB 3KBRA 3KFMA 3TCHA 2B3BA 1FTJA 4OVJA 2XXWA 1MY0A 1IZ1A 3UORA 1Y9UA 1AIVA 4PFWA 2PBWA 2XXUA 3EHTA 4FEDA 4HTGA 5F1QA 1O7TA 3H06B 3K0VA 3Q28A 4YKJA 4F22A 1M5CA 1MQIA 2OLBA 5I57B 4ONYA 3PPOA 1MS7A 1PB9A 1QW0A 2HQ0A 4U1OA 3TTNA 4EDPA 4QFOA 2XXRA 1URDA 2XX9A 1QULA 3LC8A 4FEBA 3K1MA 1MQGA 1J1NA 1Y3PA 1FQEA 3HHFA 1B05A 4WKMA 1FQAA 3MQ9A 3G3GA 2WKYA 4GOTA 4JXIA 4U4SA 3UK4A 4BDOA 3K01A 3MVXA 5I58B 2X7QA 1LBBA 1LGBC 2F7CA 4THIA 1WODA 3T9VA 4NF5B 1FQCA 3R26A 2D21A 2XXQA 5J1DA 1JW1A 2RC7A 5DYHA 5B7DA 2UXAA 3AXFA 4KCCA 2HEUA 4OEVA 3HCQA 4F1UA 3FD3A 4G77A 4ZS9A 2Q8JA 3ZKLA 1H3DA 4MFIA 1B46A 3T9UA 3TODA 4FORA 5L9OA 1B5IA 1IQ7A 3DP8A 4G2ZA 3KSJA 3B7DA 3PUZE 3ECRA 3FUZA 3H3GA 1JW5A 2OWTA 2ESNA 3E9XA 1M5EA 2H99A 1IXIA 3FXQA 2XHDA 1HSLA 4ELRA 4JWYA 3S9MC 3TEPA 5TPAB 2PX1A 3O28A 1M5FA 2X7PA 3L6HA 1B7HA 4G8NA 4OZ9A 3GBAA 5ELVA 4E0XA 3FV1A 5ITPA 2QS4A 5FHMA 1N76A 1WDNA 3VLVA 4F3BA 2Y7WA 5KCJA 3BFUA 3JYRA 4G4PA 3S9NC 3A3UA 3IORA 1BIYA 2V93A 5DVFA 3IK6B 5DVJA 5I58A 3CI8A 3RGYA 1FQBA 2H25A 3OELA 4RYAA 4NF5A 2DWAA 1QKBA 5A5XA 3KJTA 3KN8A 2H98A 1MXUA 3C36A 1FTMA 3OMBA 4PP0A 2DSFA 4XTCQ 3THIA 3C4MA 4R2FA 1TXFA 3TQWA 5BUUA 3IOVA 3O29A 1MQDA 1MQHA 2RF1A 3TTKA 4ZEKA 2NXOA 1B4ZA 4HW8A 1LBCA 2Y7KA 3FASA 5B70A 3K6XA 4GD5A 4HCWA 4RNSA 5CBSA 4R6KA 3T22A 1H45A 3G3HA 3TMGA 2QPQA 1IIWA 5TPAA 2RCAA 1I6BA 3MZBA 3MC2A 3IJOB 1EH3A 3W9VA 4G8MA 1B1HA 3QUFA 1PC3A 1ZLQA 2I0BA 2I48A 1UTBB 2XXVA 3QSLA 1B5JA 2M8CA 1SW4A 3KZGA 1D9VA 1N04A 1SD3A 1QUIA 1LSTA 2ONKE 3K02A 1VSOA 4U21A 2DQVA 4AB5A 3N6UA 3FJ7A 2B65A 4TLMB 2Y7IA 4U22A 1D3KA 2P1SA 1A54A 2DVZA 3ILTB 5A5XB 3LR1A 4MLQA 4U2RA 3PUVE 1MY1A 4YICA 3RUMA 1LAXA 3GLBA 4OWDA 4R6HA 4YZZA 5L8DA 3TTMA 5ICTA 1H44A 1P99A 3KEIA 1DOTA 4FIMA 3OEMA 3H6VA 3C35A 3Q26A 4ZEFA 3B6TA 3LSXA 2PT2A 3G7WA 5CBRA 3QUJA 4LUBA 4F39A 3C31A 3GZGA 4IGRA 5I59B 4EQBA 2ANJA 5TP9B 2Z8DA 2Q88A 4OQOA 4NWCA 5H8NA 4RK2A 4DXCA 5I2NA 2ZNTA 4GIZA 1Y3QA 3U92A 4GXAA 2H4IA 1B3HA 3E4RA 3S4UA 5K2XA 3SETA 3P7IA 3KOSA 4QSDA 3WAFA 4DCXA 4DIGA 1MPDA 3G3FA 1MH3A 4ELPA 1MXZA 4BDLA 4IY5A 1CE2A 4YKKA 1FTKA 2CMOA 4QF9A 1EZ9A 4Q5TA 4YU0A 4EQ7A 1O63A 4H65A 4ZZAA 4FAJA 1POTA 3S9EA 2O7UA 5H8QA 3MW0A 4R9GA 1QVSA 1HSEA 4K3FA 4NTLA 1SW5A 3BFTA 4DDDA 1LCFA 2I3WA 3TTRA 4ESWA 5I84A 1IXHA 3IL1B 3QK6A 3H03A 3FGSA 4PETA 3F11A 4NMYA 5M2VA 1JNFA 2VGQA 1B0HA 3VVDA 5I2KA 4IO2A 3EQ1A 2F78A 4LONB 1MM6A 4G68A 4YMAA 1D9YA 1USYH 5AA3A 4ZZEA 1R1NA 3ILUB 2OWSA 1URSA 2OK2A 4FE8A 3SEVA 5H8NB 2HAUA 5HM4B 5I2NB 2DYXA 3IB1A 3M8UA 1YTVA 4IO7A 1LB8A 4OTEA 1SQYA 4H5FA 3VXCA 1YAEA 4PFUA 1SVXB 4OESA 3VVEA 3RPWA 4C0RA 3KSXA 2O51A 3TQLA 2GHAA 3UP9A 2XD3A 3C33A 3SESA 4YB7A 1AH5A 4JBZA 4QRZA 2XXTA 4JSDA 4LA9A 2D5WA 4KR5A 2ZYKA 4UA8A 2DXRA 5H8QB 1XS5A 3KN7A 3MZ1A 4UACA 5CMMA 1LB9A 2Q2AA 4PFYA 1ELJA 4R9FA 5FHOA 3TCFA 3K2DA 1MM7A 2DWIA 2ONRA 4H8IA 3HHGA 2Z22A 4HS7A 3ZS6A 1MDQA 2UVHA 1N3XA 1SI0A 3CR9A 3H4ZA 4BDQA 3KGCA 1GTKA 2VP1A 3TCGA 1RKMA 1UIUA 1AL3A 3I6VA 3OEKA 3SEUA 4F18A 3S9LC 1B3EA 3K4UA 2ALUA 3V5AA 4AB6A 1NNTA 2A5TB 5H8FB 3RTWB 2PYYA 4ND9A 2XXPA 4U4XA 3RN8A 4F1YA 5H8HA 5I56B 4QSCA 5CM6A 4G8HA 2H9BA 1B0LA 5KZTA 2A5SA 3U72A 1O64A 1EZPA 2QRYA 4R73A 3OSQA 4RY1A 5L9MA 4ECFA 1MH4A 1MY4A 2YPNA 3MAMA 3UN6A 2NOOA 2ABHA 2Q9TA 1XOCA 2XXYA 1P1OA 1II5A 2DS9A 3KN3A 1LCTA 4IO6A 4XKNA 3MP6A 5AA1A 1SI1A 2I58A 4H8JA 5CC2A 2F7BA 1SDXA 1WVJA 5CMKA 4QFLA 3LSWA 4LZ5A 3IO4A 3QXMA 3U94A 4O3BA 1NNFA 2RKMA 3ZSFA 3CFZA 2I49A 4TOZA 3N26A 3V8XB 2AL5A 3MVYA 1SW2A 2HXWA 5K2YA 2VHAA 3O97A 3ODBA 1US4A 4JWOA 2PT1A 4X48A 1A8FA 1FCKA 2P2AA 3CVGA 3TKDA 4TQUQ 3FVNA 1Y4TA 2F35A 3T93B 3VLUA 5H8FA 1Y20A
chains in the Genus database with same CATH superfamily
2XX8A 4PDIA 2M5ZA 2I3VA 1DGHA 1ATGA 3VE1B 1CB6A 1A55A 1G0HA 3MMPA 4IBFA 3VFJA 1JEVA 2O1LA 3FIRA 5BWJA 2LVQD 1B40A 4LJ6A 1B51A 4N6PA 2QVUA 2GQ1A 3Q25A 1VR5A 3RNNA 5F7VA 2JNHA 1B32A 5ISUA 3GQ5A 2JY7A 4E0WA 2UU9M 4EUOA 3HO7A 1ZAEA 4K0KM 3RGPA 1B1XA 2UYEA 4F2QA 3KOZE 2UUCM 3FJGA 1MPBA 1WR1B 4NF0A 4YKIA 1OTRA 3N94A 3AV0A 2Z7JA 3PUWE 5H37D 3MPKA 1B6HA 1MG1A 1LAGE 1Q35A 2DAKA 4LF9M 2UVGA 3O6GA 3A45A 3K6WA 1FBDA 4DV2M 4GLIA 4MIJA 4X8RA 5EXTA 2O68A 4GVOA 4Z8XA 1GR2A 5AA4A 3GXAA 5ITTA 2DWLA 1NVMA 1ZJLA 3E13X 4I3YA 1KA0A 2JY8A 3GLHE 4F2LA 1UIVA 4Q30B 3TAJA 5ITOA 1H6UA 3GLGB 3M6AA 3FXRA 1QDRA 2RC8A 3EN3A 3CRBA 1UTHB 2OPFA 5JI3E 1QKAA 1FBGA 1OLAA 2HPGA 1PJQA 1IY0A 1Z5BA 1A40A 1Z7ME 5ET6A 4GRIA 4JYAM 3CIJA 2KW0A 3FRHA 2UVJA 4IO4A 4GMQA 4OFLA 3JR5A 1XNRM 3MVWA 2XA5A 1BLFA 4PAFA 3MP1A 1LAHE 4I9DA 3TWKA 2GFEA 3SC3A 4B3TM 3R9XB 3V89B 2R9JA 5LMUM 5FTIA 3OD7A 1N75A 3GLHB 3A09A 3PMVA 4R3DA 3FBPA 2KQZA 4PAKA 1NL5A 4MGZE 4F29A 1TH4A 1HQYE 3B9PA 3A46A 1OIZA 3BXWA 1ZMGA 4EXLA 5LDZA 5KPTA 3ZH9B 1AWBA 4P8BA 3H4MA 3OENA 3ZQJA 4RPOA 1OQYA 4B3SM 4BBAA 2I0CA 2JUJA 4JWXA 3NBXX 3HFUA 2HZKA 3B7QA 3FKEA 3GLIA 3RE8A 1FBHA 3BBRA 1RYXA 4GBVA 5KO3A 5EQ8A 2NUVA 5EQ7A 2VD2A 4NF8B 3PD9A 1B3GA 4JVDA 1L2CA 1UQWA 3I01M 4ZECA 2R4EA 3GPYA 3TDJA 1DCUA 5AA2B 2ZNUA 3K1JA 4LY6A 3FXBA 1QJMA 2V3UA 3MJ5A 1NKXA 4G4OA 1VEKA 3DA1A 4H1XA 3R6UA 1FPJA 5DTBA 1JVXA 5EP3A 3CSBA 2HKJA 4IJEA 1P3QQ 1DSNA 5ICQA 3U1OA 1I69A 2Z8EA 4PBQA 5CRYA 2KDLA 3G3JA 4LF4M 3GPXA 4AKIA 1MDP1 4ESXA 4PBHA 1Q1KA 2Q2EB 4KFQA 4FATA 1P1WA 1G0IA 2NVUB 3KBZA 1PB7A 2Y7PA 3HJSA 2ZMBA 1NUYA 1TH2A 4JI7M 1EYIA 4X1DA 3C9PA 2XXIA 1AMFA 5AA2D 3D8BA 4P47A 1LFGA 4IY6A 4LQ2A 1OAIA 4KLNA 3D1RA 1GL6A 3B6WA 4PGPA 1JP4A 1DPEA 2F4VM 3OO9A 2KA6B 1MXWA 4BDRA 2LVOC 4EXKA 1S50A 1QUSA 3LCVB 3EPEA 4DBGB 5FLXS 1BTJA 3GRYA 4XIGQ 5I59A 4UN2B 2XXXA 2DDKA 2D7EA 4LVQA 5I57A 3N6TA 2BWBA 1POY1 1L8QA 4LF5M 4KXPA 4R2BA 3QAXA 5KQ8A 1QZEA 4AW4A 2LTUA 5JTYA 2VD3A 1OQGA 3TQSA 4RXLA 4F1VA 4RK9A 2ONSA 4N6KA 2CUZA 2MJ5B 4U23A 1IY1A 5EXXA 5FTKA 3H4JA 3CHGA 4G4QA 4NE4A 3KP0E 4DXUA 2XSZD 1OLCA 2DWJA 4JSOA 3ZKKA 5IKBA 2Y0TA 2FOIC 3KBRA 3KFMA 1G3IA 1C1KA 3UORA 4OANA 1BK4A 1RDXA 4FEDA 4HTGA 4YKJA 2C99A 5L8RF 1M5CA 4P56A 5KPRA 1MS7A 4PF6A 2EUCA 2ZAMA 2WYKA 2XXRA 1URDA 2XX9A 4GXSB 3K1MA 3GPUA 3L25A 1FQEA 5TP9B 2WSFF 4BDOA 1IN5A 1FBFA 1LBBA 1LGBC 3GYYA 3T9VA 5EP4A 2XXQA 1HNWM 1D0MA 4I8OA 1JW1A 5DYHA 2OWZA 4GWZA 5B7DA 2N35A 4KCCA 1OFIA 4OEVA 2F3DA 2FHYA 4LJ8A 4QHTA 3ZKLA 1H3DA 1B46A 1HJPA 4B7FA 3KSJA 3H3GA 4ELRA 1Q39A 3T1YM 1IXIA 1FPDA 1HSLA 3U6MA 2LVPC 1TF0B 3L6HA 5F24A 3GBAA 5ELVA 4F1IA 3FV1A 2QS4A 1WDNA 2KNVA 3CI8A 2H25A 2XWIA 5A5XA 1NV2A 3T6PA 3RPLA 2H98A 1MXUA 3FRIA 2F5SA 2F5NA 3TQWA 1CUKA 1MQDA 2OQ4A 1MQHA 2RF1A 3LQRA 5EQAA 5EYGA 3WHKA 4LG2A 4GD5A 4HCWA 3KVWA 4R6KA 2C9OA 4QNRA 2RCAA 2QVRA 3J7BA 1EH3A 3QUFA 2I0BA 2XXVA 1SW4A 1QUIA 1YUBA 4HL4A 1LBWA 2VIIA 1VSOA 1JR3E 1QAOA 5BPVA 3N6UA 1ORYB 2B65A 5EQ9A 2P1SA 2DVZA 5GKNA 4MLQA 4GHLA 3PUVE 3ZCBB 4KODA 3SAWA 4YZZA 2UXBM 1AIPC 2X49A 3KEIA 4FIMA 3FE3A 4F39A 1IXZA 5ESYA 4NWCA 1QZMA 4GIZA 1Y3QA 2L2DA 3Q8GA 2JJKA 3E4RA 5IWAM 3SETA 3TWLA 4ANRA 1LEVA 1N32M 3KOSA 1PJSA 4NQ8A 4QSDA 1MH3A 2PFZA 3K9PA 1NY6A 1MXZA 4YKKA 4QOZC 4EQ7A 1G8PA 3BIGA 4ZZAA 4LFCM 4K3FA 3I04M 1R4GA 2I3WA 3H03A 1IY2A 1IXRC 2AHMA 4D80A 3VVDA 5I2KA 4IO2A 4GHAA 4XEQA 4JI1M 2F78A 4LONB 3FUVA 3JAMS 8CATA 3A42A 4MB7A 1HQCA 1URSA 1G71A 4FE8A 2JP7A 3I4VA 2DYXA 1NV8A 1T3TA 1LB8A 4OTEA 3VXCA 4PFUA 4XBOA 3VVEA 3RPWA 4FCTA 3SESA 1R2ZA 2KHHA 1FPKA 3GP1A 1V34A 3MZ1A 4N15A 2Q2AA 3EKIA 4PFYA 2JZ0A 1ELJA 1NO1A 5FHOA 3K2DA 4R7GA 4F18A 1JQJC 3KGCA 3I6VA 4I81A 3K4UA 2ALUA 1FPLA 3VKGA 1GL7A 5H8FB 2FIEA 2XXPA 5I56B 5H8HA 1K3WA 5CM6A 2C9CA 5ITQA 2HWJA 4NAPA 2WYPA 1YXIA 4H46A 4RY1A 2Q9TA 3KC1A 1II5A 4YY3M 3MP6A 5CMKA 2I58A 3NWLA 4QHSA 3U6CA 3LSWA 4LZ5A 5IREB 3ZSFA 4BB9A 3CFZA 3V8XB 4KO8A 5K2YA 1WHCA 1US4A 3CVGA 4LN5A 3FVNA 2FS1A 3GPPA 1ZBMA 1JEUA 4BDNA 1XI6A 2HFBA 1XC8A 3I4YA 1H76A 5HBCA 2EJSA 2G3QA 5F3WA 1UTBA 3SERA 4KD5A 2KLFA 2G29A 2RKOA 4H5GA 2XZFA 3O2AA 4P17A 1N7XA 3TPAA 4X04A 4O3AA 2APLA 3AOGA 1FTAA 5FHNA 4I3EA 1B58A 1XHBA 3RTFB 4N91A 5E6JA 1D0LA 1S7YA 4DV5M 2XH9A 1UM8A 3B6QA 1IBKM 4GRKA 1B2HA 3HHXA 4TUWA 2ZXTA 2ZM6M 3EIEA 2THIA 3LSLA 1TT1A 3VVFA 1MQJA 3FXUA 2CP8A 3FJMA 3HHYA 3KP1E 2OBGA 3IX1A 2Z8FA 4IB2A 2P0SA 1SW1A 4FW9A 2GNOA 4OFJA 4LF7M 3SMSA 1SBPA 5TU0A 2B3FA 4DV0M 3THGA 2XX7A 1LBYA 4L78A 2RC9A 3EF7A 2C5RA 2LVAA 5CI5A 4DCYA 3EIHA 3DELB 4G68B 2F34A 3PTYA 1Y1ZA 2HZLA 5ET7A 4ELOA 2X26A 3QYTA 3K92A 3C3DA 2NWJA 1JW4A 4EF2A 4FWHA 3F92A 1FQFA 4GWOA 2DNAA 3MVZA 2HXRA 4GX6A 3CSGA 1NNUC 3MUQA 1LBVA 4GF8A 4NXMM 5I7IA 1MPCA 1R7RA 4OVRA 1N84A 3M3FA 4DI4B 3TE6A 1NUXA 2XFTA 4ZEDA 4HXVA 1IMDA 2F5XA 3KFUG 4HCYA 2DAGA 3Q27A 3TZAA 1DK4A 4ISUA 2F5OA 3KOTA 2J5YA 4YB5A 4I62A 2CZIA 3USDA 3IG5A 2AL4A 3UMMA 3HSTA 4GX3A 1IXCA 4OENA 4WEDA 4MBPA 1YLAA 3IOWA 2LVNC 1JQFA 3LSFB 3OXNA 4Z6YA 5IZ3A 3B7NA 3W9WA 4C1TA 5TP9A 1B4HA 5FTMA 2H5YA 3WHLA 4MLVA 1PB8A 3S2VA 4U1ZA 2FIXA 1Q02A 3H7MA 4RNAA 3BKIB 4BLAA 4B7HA 3DP4A 2OOBA 4PDGA 4LZ8A 5IZ1A 1IXGA 1A99A 4ZE8A 2E0SA 3GO8A 4JI3M 2GH9A 5J16A 1MN3A 3LUYA 2R44A 4DUYM 2WZJA 2V3TA 1B7UA 1JETA 1G4AE 2CV0A 1LAFE 2WEFA 4Q0CA 3U8QA 3GBBA 3OSRA 1FW0A 4PQJA 3SEXA 2YLNA 5FSWA 1MU5A 1SYIA 3NOHA 2DE2A 1L5TA 4YMBA 2A5YB 5KCJB 4IBEA 3OOAA 3NBIA 4PAIA 1GVCA 3EHSA 5I84A 3SAVA 1E9RA 3GLFA 2O69A 2MGWA 3JZJA 4DR2M 3HN0A 5CMCA 3UP9A 3UJNA 2WBDA 5CMBA 4I8CA 3RLFE 3FUUA 4MH5A 4MMPA 2DE4A 4XKPA 2D3IA 1P1NA 1P1UA 2F3BA 4G6ZA 4EF1A 3O9PA 4AS4A 3U6DA 4X1BA 2P5TA 3E46A 1I94M 1TR8A 4NWDA 3U6QA 3FVKA 1ZMVA 2REJA 3KJ7A 2PMSA 1HNZM 3PPRA 4UABA 2BJJX 3G3IA 3T15A 1V33A 3FV2A 2M60A 4JI2M 4MHFA 2R65A 2QVVA 2XD2A 3VFDA 2I4CA 4M1VA 2DZOB 3IO6A 2L6OA 1OQHA 3C34A 2LHGA 5BR8M 1C7YA 2R71A 4M0WA 3O6IA 2RCBA 2K6BA 1N7WA 4YAHX 4OA4A 1NUZA 3A3CA 3R7XA 1PDAA 3SASA 4DR5M 3T9HB 1XVYA 4IBKA 1XMOM 1GABA 3L28A 1R2YA 4G68C 1GO5A 4F3PA 3W15C 2R62A 4N4UA 1XT8A 3UA8A 3FTFA 1D0KA 2F7AA 1Z7NE 1OVTA 1KZ8A 1IBLM 2CV1A 3SEYA 2C98A 4B7GA 1PJTA 3GLHA 3KS8A 1FPEA 3K6UA 1YPNA 4FJPA 2V1CA 5LTCA 2VQEM 1N78A 4OVJA 1IZ1A 1AIVA 2L7HA 2PBWA 5F1QA 3EHTA 1O7TA 1QVRA 1XMQM 2OLBA 4ONYA 2J7OA 3PPOA 2KEBA 3HX3A 1CNQA 1QW0A 3B8BA 3TTNA 3ZC7B 4EDPA 4QFOA 1VDWA 2Z4RA 1QULA 4WKMA 1DO0A 1MQGA 3LUZA 1Y8GA 2WKYA 4JXIA 4U4SA 3K01A 5I58B 1Z5CA 4NF5B 5DW8A 4LFAM 2RC7A 1RDYA 3AXFA 2HEUA 3LQQA 2B4LA 3HCQA 4G77A 3CF6E 3BBZA 1B5IA 3PUZE 3ECRA 3FUZA 2X4AA 2L09A 3E9XA 3TEPA 2XHDA 4NXNM 1N33M 5TPAB 2PX1A 2X7PA 1RDZA 3W67A 2P3VA 3FUXA 5FHMA 3E78A 5EP2A 4GX4A 5KCJA 3BFUA 3JYRA 1Z6TA 1IFYA 4DV4M 1Z5AA 2QCUA 5I58A 5DVJA 3HY5A 1FQBA 4NF5A 2DWAA 4P1EA 2P3NA 1TH3A 3SATA 3C36A 3THIA 2DSFA 3DFZA 4R2FA 1TXFA 5BUUA 3IOVA 2DENA 2XLJA 2NXOA 3E9SA 3KOYE 1LBCA 3B74A 2KRKA 5A2QS 5EXSA 4RNSA 4BLCA 1H45A 1VQ1A 2EKFA 5C18A 2UXDM 3MC2A 4GWYA 2I48A 2PCRA 4X62M 1IXSA 1QUTA 1WGLA 3HWSA 4RF0A 2M8CA 1D9VA 4U21A 1YZ0A 4LZJA 3LCUA 2O01F 1S3SA 4PE3A 4TLMB 1D3KA 1A54A 1N34M 3LR1A 4U2RA 3J27B 4GWWA 2DAEA 2XWKA 2HHMA 2Y20A 2MR9A 4OWDA 5L8DA 1SXJA 3W0LB 3H6VA 3Q26A 3LSXA 2DAIA 4LUBA 5I59B 2VPNA 1G59A 2WX9A 2ANJA 4MM3B 2QBYA 5H8NA 4RK2A 4FCVA 4JI8M 1JR3A 4GXAA 2H4IA 1B3HA 4QBAA 4FVMA 4X66M 3WAFA 3G3FA 3ROJA 1KFVA 4H45A 4HEOA 4IY5A 3AFHA 1FTKA 4Q7JA 4MAGA 1EZ9A 2VQFM 1DGBA 1NV1A 2QENA 1O63A 4GC9A 5H8QA 4R9GA 3DZDA 1HSEA 1KYIA 1LCFA 3TTRA 2V6ZM 4D82A 2ERCA 3IL1B 3QK6A 4PETA 3F11A 4NMYA 1JNFA 2VGQA 3L26A 3CTWB 4YMAA 1D9YA 4PCZA 2ZZWA 4NRWA 2BNKA 1NV9A 1IM2A 3IB1A 1YTVA 2KNAA 3ILKA 1SQYA 4C0RA 2OOAA 4OESA 1EYJA 3TQLA 3C33A 3SHGB 4JBZA 4LA9A 2ZYKA 4UA8A 1XS5A 3TCFA 4R9FA 3BIHA 1MM7A 2DWIA 2ONRA 4H8IA 5IAIA 3CR9A 1SI0A 4AS5A 4LJ4A 4MGHA 3TCGA 1UIUA 4DUZM 3OEKA 3I51A 3V5AA 3FTDA 4XFEA 1NNTA 1HR0M 4JV5M 4N8GA 3UZUA 3RN8A 4FBPA 1OIPA 4IBJA 2H9BA 4MGKE 1B0LA 2A5SA 5KZTA 1O64A 2KNZA 1YSYA 4R73A 3OSQA 3T1HM 1MH4A 2YPNA 3UN6A 5ITXA 1P1OA 1LCTA 1ZV1A 2PFYA 1SI1A 2XSZA 3TWMA 2L7IA 4O3BA 1NNFA 2FBPA 2AL5A 3JR4A 1SW2A 5KPZA 2HXWA 3RPLB 3LMMA 4X48A 2PT1A 3MYUA 1Q3BA 2P2AA 3TKDA 4CHTB 3T93B 2FFJA 1Y20A 3T9XB 5H8HB 4OYVA 1G41A 3GLIE 4KQPA 2BJIA 4POXA 1T0KA 1MXVA 2XWOA 3H6UA 5AE4A 4PFRA 4F3GA 1PBPA 2CZLA 4Y28F 4GL0A 2DXIA 5AA2A 4N07A 4LATA 1QQWA 5FTLA 3TTLA 3UGWA 3LVVA 5KDTB 4X65M 5DEXA 3FTEA 4P1LA 1XWIA 2FE8A 1NUWA 2QMWA 3PPQA 5IZZA 5EYFA 1Z59A 4L17A 4GH9A 3CGWA 4M9SA 4NN3A 4CGYB 3TUSA 5EJCA 4POWA 3I3VA 4R6YA 2DXYA 2Z3XA 4GEWA 4PD2A 2QBYB 1XVXA 4MGYE 3UIFA 2ZNSA 1B52A 5EHSA 5L9SA 3O66A 2R0IA 4GFRA 1EFUB 4DV3M 4QFPA 5DEXB 2DAMA 1QYRA 3KOXE 1TFAA 1YYZA 2OX3A 1USYE 2YR0A 4QOSA 1NNPA 2Z8YM 2GRVA 3TYHA 2F6PA 2RGOA 4PT5A 2O25A 3HZJA 2EO2A 4KYSA 1Y4CA 2I4BA 5FBPA 2RINA 3RQTA 3HJQA 2JY5A 1VFEA 2QS3A 2L4EA 2UUAM 2KRUA 1WXQA 2VF8A 1E9SA 4JI4M 2Q89A 1A7LA 1PBQA 3IB2A 3U93A 5AA4B 4N17A 4MGIE 4ZEBA 2IA4A 4PFTA 5ET8A 2H5XA 5JTYB 1Y1MA 2Y84A 1Q9DA 4RPNA 1NNKA 3FYCA 3SDFA 1MY2A 2I6EA 3U65A 1L2DA 1UFZA 2G93A 3IAZA 4QFKA 1J5EM 4OHNA 3VDFA 4DV7M 2LH0A 1NMUA 1L1ZA 1NFTA 4BDMA 3SBJA 4KCDA 3H6TA 2QQ8A 4C1UA 3D8LA 2ZZXA 4II7A 4LP2B 4IO3A 1NV5A 2ZZVA 3HHZA 4OEUA 1K82A 5H8SA 1P1QA 2V4CA 4ZDMA 5IM2A 1W5TA 1YCJA 2G5GX 3RT6B 5ET5A 4I40A 1GV8A 2K47A 4IBBA 1EIJA 2O1MA 3TELA 3HGIA 4L4UA 2DP8A 1XC1A 3UK6A 1IMAA 3MWBA 2Z23A 1EZOA 1PEBA 1M5DA 2E5LM 1PJIA 3W0FA 1N36M 1L2BA 2O5RA 4AQ4A 2OCUA 2F5QA 4OERA 3PD8A 1BKAA 1IITA 4P0GA 3QWLA 1QUJA 3K1NA 2ZYMA 3Q29A 4X9TA 1IQPA 5LOMA 1DTZA 3O6HA 5EQTA 4QSEA 5JEIA 1XXHE 3AKZA 2Y7RA 4MJOA 4RA1A 4CIZA 1FBCA 4H0WA 4MNIA 1NH8A 4KYEA 2AIXA 4H67A 4PDDA 2R18A 1B5HA 3L27A 4NF4A 1MY3A 1D9QA 2QS2A 1JVYA 3KXEC 3TFLA 2ZAOA 3PUXE 1S9TA 3C9HA 1DPPA 3E79A 1T6OA 4M9ZA 1HSJA 7CATA 4NF8A 3B7ZA 4DV6M 3IFAA 4PC9A 1KA1A 1URGA 2F8DA 1FTOA 2VOZA 1ZU0A 3I5OA 3M0EA 4WXJA 3AOEC 3VDUA 2ZYNA 5ITYA 3OO8A 1OMPA 1VEGA 3VKHA 4NGUA 3OO7A 4XKQA 4F3SA 3FATA 2QS1A 3U6OA 2MROB 3SYKA 5FTHA 4QHQA 3BOSA 3VXBA 4F2OA 3HU2A 5JK4A 1OAOC 4JI6M 1UTHA 3JV9A 4O7IA 3IR1A 2LXEA 3HKPA 4DLDA 5A5LA 4AQYM 1WJ7A 3G3KA 4GBWA 1TWYA 2QMXA 3ONMA 4AZFA 2DWZB 4GC5A 4MF3A 2CV2A 4IO5A 3J7AS 3PU5A 1NJGA 3KS4A 4R74A 1AOVA 1F9BA 1NV0A 5I3SA 1N3WA 5I5PA 1NHWC 4XKRA 1VFDA 3HV1A 2FNCA 1QUKA 1VE4A 2Z4SA 4P11A 3PMWA 4LZ7A 2JWSA 2XEPA 4KYDA 1Q3CA 2FH0A 5I2KB 1AUAA 4FCWA 3TCHA 1FTJA 1Y9UA 4LF8M 4LCBA 2XXUA 3K0VA 3Q28A 3SMPA 5I57B 1E32A 4FWGA 4P3LA 2HQ0A 4U1OA 2XFSA 4WURA 3LV0A 3LC8A 3T66A 1J1NA 1Y3PA 3HHFA 1B05A 3UK4A 1FQAA 2WSEF 3MVXA 4G61A 4THIA 4OW0A 1WODA 1DV0A 1FQCA 1FJ9A 3R26A 4NOOB 4X64M 4IIWA 2UXAA 3CF0A 4ITQA 2BJVA 4F1UA 3V76A 2Q8JA 3T9UA 1E94E 5L9OA 1IQ7A 4G2ZA 5I56A 2ESNA 3FXQA 1K9YA 4QNMA 2YQZA 1M5FA 4G8NA 4GKKM 1N76A 3VLVA 1LTMA 2Y7WA 3SHFA 3A3UA 1BIYA 3IK6B 3M7GA 1MJGM 3KJTA 3KN8A 3OMBA 1FTMA 4XTCQ 3C4MA 3CF2A 3TTKA 4ZEKA 2Q74A 3FASA 3K6XA 5CBSA 3G3HA 2FNAA 1IIWA 2KR0A 5TPAA 4JI5M 4JXJA 3VK7A 3IJOB 4G8MA 1FJGM 4AI6A 1B1HA 1ZLQA 1UTBB 3QSLA 1N04A 1SD3A 4O8MA 3Q8XA 2DQVA 4IJFA 3LVWA 3SZPA 4AB5A 1A5TA 3FJ7A 5T3JA 4LFBM 1IN8A 2EA0A 2BJWA 2QZ4A 2F5PA 4JN6A 2D7HA 3RUMA 5DYGA 1LAXA 5ICTA 4R6HA 1VDDA 2JY6B 1FRPA 1P99A 4ZEFA 3B6TA 2PT2A 3AJIB 3G7WA 5CBRA 3QUJA 1HT2E 4OVSA 3C31A 1NJFA 4NL4H 1FBPA 3GZGA 4IGRA 4EQBA 3PXGA 2Q88A 4LGMA 2ZNTA 2KZSA 3S4UA 5K2XA 2DZLA 2Y5KA 3P7IA 4PF8A 1MPDA 1PRBA 3J81S 4GKJM 1CE2A 4QF9A 4PTKA 3HU1A 2FVZA 3S9EA 3MW0A 1QVSA 1X37A 2ZBKB 3SYLA 3BFTA 4DDDA 2CEYA 2QFLA 3RFWA 4ESWA 3HJ8A 3FGSA 5M2VA 2CHQA 3AOEA 1MM6A 1NHGC 4G68A 3U60B 4A3VB 2B3TA 1USYH 5AA3A 4EIWA 4YHHM 1R1NA 2OWSA 4DR3M 4OU7A 5H8NB 1OJLA 4O94A 3M8UA 1EYKA 1SXJD 1WGNA 4H5FA 2LHCA 1SVXB 2O51A 4M9XA 1QGXA 2XD3A 4OVQA 1QAMA 4YB7A 1AH5A 2XXTA 2JA2A 3U5ZB 4JSDA 2K0BX 5H8QB 2DXRA 3C58A 1LB9A 5CMMA 1FNNA 4MX6A 3ZS6A 2UVHA 3H4ZA 1GTKA 1I4WA 3U61A 4NSRA 3SEUA 4HE1A 2A5TB 2Y5LA 2PYYA 4ND9A 4U4XA 1J7KA 1ZMWA 1NV6A 3GQ3A 4G8HA 2R45A 1EZPA 2QRYA 3C3EA 5L9MA 3FTCA 4ECFA 3MAMA 1R5LA 4B3MM 2ABHA 3PPPA 1XOCA 5AA1A 4XKNA 2DS9A 2DZNB 4KT0F 5CC2A 1OFHA 1SDXA 5IZ3B 3VK8A 3QXMA 1NY5A 2CRUA 3TL4X 2RKMA 3U94A 2I49A 2K9DA 1FJ6A 3N26A 4TOZA 3MVYA 3O97A 3R8FA 1VG5A 1KSFX 3VLUA 3T0JA 3K9OA 2YFQA 3CFLA 3PMXA 4KHZE 1SYHA 3QIMA 5FTJA 1GVNA 4RKUF 2F36A 1NH7A 1RYOA 1IXSB 4XK8F 1R9LA 3T96B 2QL3A 5DT6A 1IUDA 3KG2A 4LZZA 3DP6A 3A29A 2CE7A 2ZTCA 3VLWA 4WEPA 2GHBA 3PFIA 1R6ZA 2XWVA 2HAKA 2HCAA 1QANA 2IEEA 4NHBA 4GQOA 5JI2E 1ZKBA 1FPGA 4PGNA 1Y3NA 2YJPA 4L16A 1ZTYA 1F4IA 4CJ6A 2O7IA 4RF1A 5HPQA 2YNMD 1MXXA 2HL7A 4JB7A 4TLLB 2XXKA 1DGHB 2VF7A 3IG8A 2XF3A 4I5SA 2D7GA 4RJZA 1DMBA 2QSXA 1XNQM 3PV0E 1FPIA 2L5VA 3MP8A 3D4GA 3K2LA 5KDTA 2VPOA 1TDZA 1B9JA 1QAQA 2UYFA 3K1PA 2WSCF 3FD9A 3K8ZA 2NQ8C 2Y21A 4OX9M 3IB0A 3PUYE 1INPA 4OETA 4P16A 1H43A 4OVTA 3DM0A 2DWHA 4NRVA 1EU8A 4HLQA 3FUTA 5FTNA 1FQDA 3U60A 3GRUA 3OTOM 2HHHM 3MZ9A 3C32A 3DOAA 1US5A 1PJJA 2O6AA 3CG3A 1VEJA 4YKPA 3W68A 4DV1M 4WP2A 2DHRA 3RT8A 3SFZA 2FYIA 4YB6A 2XXHA 3D4CA 4XXUA 3M3LA 1XHYA 3QYEA 4N6DA 1IEJA 2REGA 4OVZA 4LRSA 2FA7A 3IJXB 2BWEA 1HNXM 3HHWA 4F19A 5EXPA 2V3QA 3GLGA 4DE8A 3L6GA 2W7YA 2DVCA 1LLSA 2OZZA 3LBSA 3LW5F 1K3XA 2QSFX 1B3FA 3IOTA 1GGGA 3OO6A 2RGHA 2A5TA 4NEDA 1GJTA 2DHYA 1MX0A 1NSFA 2QNJA 2V25A 5DVIA 1B7ZA 1B3LA 2XGNA 1TFDA 1GLNA 2Q2CA 3SKPA 3MBPA 4LQ5A 2R4JA 3FVOA 1ANFA 3CG1A 4GL8A 2CFOA 4OFOA 3WAEA 3RY3A 4KI0E 2E1SA 1FTLA 4M0DA 4NF6A 4NF4B 2LWXA 3FVGA 3MSTA 3DLNA 3H6WA 3K00A 4FD2A 4B08A 3A98B 1NI9A 4PDHA 3U6LA 3QMFA 2G8LA 2PVUA 1L1TA 1LBZA 4ZPXA 1IN4A 3KW6A 3IOUA 5IGAA 3E21A 4EQ9A 4ZE9A 3PNYA 2DWMA 2CEXA 2I7PA 1ZIUA 3UGJA 1DTGA 4QFNA 4N8YA 4R75A 3RGSA 4MH0E 3V83A 4GITA 4JDFA 4L8RC 4Z0IA 4DXCA 4I1DA 1M5BA 4GWUA 2O84X 4M4GA 4AG6A 2KXEA 3B89A 5IZ7D 3SEWA 4NF6B 4DR6M 2DVWB 4PE5B 1LFIA 1OIBA 2F6GA 4KPTA 1N0TA 3HPIA 4ZEIA 3E3KA 5ITRA 3CFXA 4IBDA 1A8EA 1I6AA 2VDBB 3FYDA 1IN7A 3MJNA 2LAOA 1KWHA 4QXDA 1OVBA 4ELQA 2AYSA 3ISPA 2H1RA 2QJEA 2DOJA 4L15A 1SXJE 1MRPA 1T43A 4XGIA 3FZVA 4JVIA 4DI3D 3PPNA 4OMBA 2F97A 3PNVA 4IBIA 2I7NA 2HAVA 3N5LA 3SAUA 1PGYA 4W5WA 1LFHA 2ZYOA 1QDTA 3KDSE 3GLFB 1MXYA 3EHUA 2R6GE 4O7MA 4R72A 2DE3A 4Z7EA 2UXCM 4IGTA 1R9QA 4S12A 4NG7A 2OJTA 2CHGA 4N13A 1NV3A 3M3KA 4DR1M 4IBCA 3PGFA 1I6QA 2JZ1A 1OKSA 4OXVA 5ITUA 1D2NA 1BP5A 4FECA 4DXBA 3VV5A 2V84A 4LJ9A 2XZUA 1D4NA 4OVZB 4Q8RA 1GJSA 1LV7A 1TTEA 1IBMM 2CEAA 4O3CA 5EHMA 3IFCA 3K6VA 2DWNA 4F31B 3QYBA 4MEVA 2UVIA 2RRUA 2CZKA 4KHPM 3VDPA 4NSOB 2VT5A 4DR4M 1NV4A 4LF6M 2DKLA 4P0IA 3MPLA 1VDLA 2CZHA 4H6DA 2B3BA 2XXWA 1MY0A 3FUWA 4PFWA 3U6EA 4NX1A 3H06B 5ITXE 4F22A 4LRTA 2UUBM 1MQIA 3J2PB 1DGFA 1PB9A 3B50A 4FEBA 2V1UA 3TODA 1V92A 1YE9A 3G3GA 3MQ9A 4GOTA 2MH8A 4B3RM 3T1BA 2X7QA 2F7CA 2GQFA 2CWBA 4AG5A 3GQ4A 5J1DA 2D21A 2B4MA 4N81A 1K9ZA 3T38A 3QAUA 3FD3A 4ZS9A 4IBGA 4MFIA 2X8AA 4FORA 1N77A 1GKIA 3DP8A 3B7DA 1JW5A 2OWTA 1M5EA 2H99A 3S9MC 2EKKA 1LBXA 2CHVA 1FPFA 4HE0A 4JWYA 4JVCA 3O28A 4OZ9A 1B7HA 4E0XA 4NC6A 5ITPA 3AL0C 4F3BA 5IT9S 3IECA 4G4PA 1RU3A 3S9NC 5DYIA 3IORA 2V93A 4DR7M 4MNCA 5DVFA 3RGYA 3U6PA 1IMEA 3OELA 4RYAA 1IMFA 4R71A 1QKBA 4DZ1A 4PP0A 1HT1E 1DBZA 3O29A 1SXJB 4JI0M 1B4ZA 4HW8A 1SPIA 2Y7KA 5B70A 2QP9X 1TDHA 5KQDA 1ZMUA 3T22A 3TMGA 2QPQA 4PFIA 1W5SA 3SARA 1I6BA 3MZBA 3W9VA 4GWSA 1PC3A 3GLFE 2R8TA 1B5JA 3KZGA 5EP1A 2ONKE 1LSTA 3PVSA 2LNHC 4G4RA 3K02A 3L2AA 3VLFB 3J80S 2Y7IA 4U22A 5C1BA 1SG9A 2LBCA 3ILTB 5A5XB 2J7NA 1MY1A 4LJ7A 1XB2B 1IMCA 4YICA 3GLBA 3TTMA 3U6SA 1H44A 4MCOA 1DOTA 3OEMA 5E26A 3C35A 3MHVC 1R6BX 5DNYA 1JB0F 1DO2A 2Z8DA 4OQOA 1EE8A 5I2NA 2ZTDA 3U92A 4AKHA 1FPBA 4DCXA 4DIGA 4ELPA 4BDLA 2CMOA 4L6V6 3U5ZA 4Q5TA 4YU0A 3KOWE 3L29A 4H65A 4FAJA 2HCBA 1POTA 2O7UA 4OVPA 1NV7A 4NTLA 1SW5A 3KC0A 2C96A 1IXHA 3HU3A 4CISA 1FBEA 4IR8A 1B0HA 3U61B 5EYHA 1JR3D 3EQ1A 1FSAA 4GWXA 1IMBA 4I4LA 1TGUA 3GLGE 4ZZEA 3ILUB 2OK2A 4HE2A 2WBBA 1SXJC 1IN6A 1XXHB 2QPAA 2QHOB 2HAUA 3SEVA 5HM4B 5I2NB 4LJAA 4IO7A 1YAEA 2L4FA 4PFBA 3KSXA 2GHAA 4MNPA 2Y0QA 4QRZA 2D5WA 4PCDA 4KR5A 3IHPA 3KN7A 4UACA 3TPZA 4FWDA 3GRVA 3HHGA 2Z22A 3MK6A 4HS7A 4GIPA 1MDQA 1N3XA 1ZQ9A 4BDQA 4P9KA 2VP1A 1RKMA 3S9LC 1AL3A 1DGGA 4D81A 1B3EA 4AKGA 4AB6A 4G4NA 3RTWB 5LMNM 1XXHA 4REZA 4F1YA 1NNJA 4QSCA 2MKZA 3GRRA 2R46A 4LGYA 1WIVA 3U72A 2KZUA 4G3OA 1MY4A 2NOOA 3KN3A 2XXYA 4IO6A 4H8JA 2W82A 2R6FA 1WVJA 2F7BA 2JXNA 4QFLA 1J09A 4LJ5A 2ZANA 3IO4A 2DI0A 2OO9A 1PM5A 2VHAA 3RYDA 4WW0A 3ODBA 4JWOA 2Q8MA 1A8FA 1FCKA 5DFLA 3GLIB 1BVSA 4TQUQ 4XF5A 1Y4TA 2F35A 5H8FA
chains in the Genus database with same CATH topology
2XX8A 4PDIA 2M5ZA 2I3VA 1DGHA 1ATGA 3VE1B 1CB6A 1A55A 4IBFA 3VFJA 1JEVA 2O1LA 3FIRA 5BWJA 1B40A 4LJ6A 1B51A 4N6PA 3Q25A 1VR5A 3RNNA 5F7VA 5ISUA 1B32A 3GQ5A 4E0WA 2UU9M 4EUOA 3HO7A 1ZAEA 4K0KM 3RGPA 1B1XA 2UYEA 4F2QA 3KOZE 2UUCM 3FJGA 1MPBA 4YKIA 3N94A 3AV0A 2Z7JA 3PUWE 5H37D 3MPKA 1B6HA 1MG1A 1LAGE 1Q35A 2UVGA 4LF9M 3O6GA 3A45A 3K6WA 4DV2M 4GLIA 5EXTA 2O68A 4GVOA 4Z8XA 1GR2A 5AA4A 3GXAA 5ITTA 2DWLA 1NVMA 1ZJLA 3E13X 1UIVA 4Q30B 3TAJA 5ITOA 1H6UA 3FXRA 3GLGB 3M6AA 2RC8A 3EN3A 3CRBA 1UTHB 2OPFA 5JI3E 1QKAA 1OLAA 1IY0A 1Z5BA 1A40A 1Z7ME 4GRIA 4JYAM 3CIJA 2KW0A 2UVJA 4IO4A 4GMQA 4OFLA 3JR5A 1XNRM 3MVWA 1BLFA 3MP1A 1LAHE 4I9DA 3TWKA 2GFEA 3SC3A 4B3TM 3R9XB 3V89B 2R9JA 5LMUM 5FTIA 3OD7A 1N75A 3GLHB 3A09A 3PMVA 4R3DA 1NL5A 4MGZE 4F29A 1TH4A 1HQYE 3B9PA 3A46A 4EXLA 1ZMGA 5KPTA 3ZH9B 3H4MA 3OENA 4RPOA 4B3SM 4BBAA 2I0CA 4JWXA 2HZKA 3FKEA 3GLIA 3RE8A 3BBRA 1RYXA 5KO3A 2NUVA 2VD2A 4NF8B 3PD9A 1B3GA 1L2CA 1UQWA 4ZECA 2R4EA 3GPYA 3TDJA 5AA2B 2ZNUA 3K1JA 4LY6A 1QJMA 2V3UA 3MJ5A 1NKXA 4G4OA 4H1XA 3DA1A 3R6UA 5DTBA 1JVXA 5EP3A 3CSBA 2HKJA 4IJEA 5ICQA 1DSNA 3U1OA 1I69A 2Z8EA 5CRYA 3G3JA 4LF4M 3GPXA 4AKIA 1MDP1 4ESXA 1Q1KA 2Q2EB 4KFQA 4FATA 1P1WA 2NVUB 1PB7A 2Y7PA 3HJSA 2ZMBA 1TH2A 4JI7M 4X1DA 2XXIA 1AMFA 5AA2D 3D8BA 1LFGA 4IY6A 4LQ2A 4KLNA 1GL6A 3B6WA 1DPEA 2F4VM 3OO9A 2KA6B 1MXWA 4BDRA 4EXKA 1S50A 3EPEA 5FLXS 1BTJA 3GRYA 4XIGQ 5I59A 2XXXA 2D7EA 4LVQA 5I57A 3N6TA 1POY1 1L8QA 4LF5M 4R2BA 3QAXA 5KQ8A 4AW4A 5JTYA 2VD3A 1OQGA 3TQSA 4RXLA 4F1VA 4RK9A 2ONSA 2CUZA 4U23A 1IY1A 5EXXA 5FTKA 4G4QA 4NE4A 3KP0E 4DXUA 2XSZD 1OLCA 2DWJA 4JSOA 3ZKKA 5IKBA 2Y0TA 2FOIC 3KBRA 3KFMA 1G3IA 1C1KA 3UORA 4FEDA 4HTGA 4YKJA 2C99A 1M5CA 5KPRA 1MS7A 2EUCA 2ZAMA 2XXRA 1URDA 2XX9A 4GXSB 3K1MA 3GPUA 3L25A 1FQEA 5TP9B 4BDOA 1IN5A 1LBBA 1LGBC 3T9VA 5EP4A 2XXQA 1HNWM 1JW1A 4I8OA 5DYHA 5B7DA 4KCCA 1OFIA 4OEVA 4LJ8A 4QHTA 3ZKLA 1H3DA 1B46A 4B7FA 3KSJA 3H3GA 4ELRA 1Q39A 3T1YM 1IXIA 1HSLA 3U6MA 3L6HA 3GBAA 5ELVA 3FV1A 2QS4A 1WDNA 3CI8A 2H25A 5A5XA 2H98A 1MXUA 2F5SA 2F5NA 3TQWA 1MQDA 2OQ4A 1MQHA 2RF1A 3LQRA 3WHKA 4LG2A 4GD5A 4HCWA 3KVWA 4R6KA 2C9OA 4QNRA 2RCAA 3J7BA 1EH3A 3QUFA 2I0BA 2XXVA 1SW4A 1QUIA 1YUBA 4HL4A 2VIIA 1VSOA 1QAOA 5BPVA 3N6UA 1ORYB 2B65A 2P1SA 2DVZA 5GKNA 4MLQA 4GHLA 3PUVE 3ZCBB 4KODA 3SAWA 4YZZA 2UXBM 2X49A 3KEIA 4FIMA 4F39A 1IXZA 4NWCA 1QZMA 4GIZA 1Y3QA 3E4RA 5IWAM 3SETA 3TWLA 3KOSA 1N32M 4QSDA 1MH3A 1NY6A 1MXZA 4YKKA 4QOZC 4EQ7A 1G8PA 4ZZAA 4LFCM 4K3FA 2I3WA 3H03A 1IY2A 1IXRC 2AHMA 4D80A 3VVDA 5I2KA 4IO2A 4GHAA 4JI1M 2F78A 4LONB 3FUVA 3JAMS 8CATA 3A42A 4MB7A 1HQCA 1URSA 4FE8A 3I4VA 2DYXA 1T3TA 1LB8A 4OTEA 3VXCA 4PFUA 4XBOA 3VVEA 3RPWA 4FCTA 3SESA 1R2ZA 3GP1A 3MZ1A 2Q2AA 4PFYA 1ELJA 5FHOA 3K2DA 4R7GA 4F18A 1JQJC 3KGCA 3I6VA 4I81A 3K4UA 2ALUA 3VKGA 1GL7A 5H8FB 2XXPA 5I56B 5H8HA 1K3WA 5CM6A 2C9CA 5ITQA 4RY1A 2Q9TA 1II5A 4YY3M 3MP6A 5CMKA 2I58A 3NWLA 4QHSA 3U6CA 3LSWA 4LZ5A 5IREB 3ZSFA 4BB9A 3CFZA 3V8XB 4KO8A 5K2YA 1US4A 3CVGA 3FVNA 3GPPA 1ZBMA 1JEUA 4BDNA 2HFBA 1XC8A 3I4YA 1H76A 5HBCA 5F3WA 1UTBA 3SERA 4KD5A 2KLFA 2G29A 2RKOA 4H5GA 2XZFA 3O2AA 1N7XA 3TPAA 4O3AA 3AOGA 5FHNA 1B58A 1XHBA 3RTFB 5E6JA 1S7YA 4DV5M 2XH9A 1UM8A 3B6QA 1IBKM 4GRKA 1B2HA 3HHXA 4TUWA 2ZXTA 2ZM6M 3EIEA 2THIA 3LSLA 1TT1A 3VVFA 1MQJA 3FXUA 3FJMA 3HHYA 3KP1E 2OBGA 3IX1A 2Z8FA 4IB2A 2P0SA 1SW1A 4FW9A 4OFJA 4LF7M 3SMSA 1SBPA 5TU0A 2B3FA 4DV0M 3THGA 2XX7A 4L78A 2RC9A 3EF7A 2C5RA 5CI5A 4DCYA 3EIHA 3DELB 4G68B 2F34A 1Y1ZA 2HZLA 4ELOA 2X26A 3QYTA 3K92A 2NWJA 1JW4A 4EF2A 4FWHA 1FQFA 4GWOA 3MVZA 3CSGA 1NNUC 3MUQA 4GF8A 4NXMM 1MPCA 1R7RA 1N84A 3M3FA 3TE6A 2XFTA 4ZEDA 2F5XA 3KFUG 4HCYA 3Q27A 3TZAA 4ISUA 2F5OA 3KOTA 4YB5A 4I62A 3USDA 3IG5A 2AL4A 3UMMA 3HSTA 1IXCA 4OENA 4WEDA 4MBPA 3IOWA 1JQFA 3LSFB 3OXNA 4Z6YA 3W9WA 4C1TA 5TP9A 1B4HA 5FTMA 2H5YA 3WHLA 4MLVA 1PB8A 3S2VA 4U1ZA 4BLAA 3H7MA 4RNAA 3BKIB 4B7HA 3DP4A 4PDGA 4LZ8A 1IXGA 1A99A 4ZE8A 2E0SA 3GO8A 4JI3M 2GH9A 3LUYA 4DUYM 2V3TA 1B7UA 1JETA 1G4AE 2CV0A 1LAFE 4Q0CA 3U8QA 3GBBA 3OSRA 1FW0A 4PQJA 3SEXA 2YLNA 5FSWA 1MU5A 1SYIA 2DE2A 1L5TA 4YMBA 2A5YB 5KCJB 4IBEA 3OOAA 3NBIA 1GVCA 3EHSA 5I84A 3SAVA 1E9RA 3GLFA 2O69A 3JZJA 4DR2M 3HN0A 5CMCA 3UP9A 3UJNA 5CMBA 4I8CA 3RLFE 3FUUA 4MH5A 2DE4A 4XKPA 2D3IA 1P1NA 1P1UA 4G6ZA 4EF1A 3O9PA 3U6DA 4X1BA 2P5TA 1I94M 4NWDA 3U6QA 3FVKA 2REJA 3KJ7A 2PMSA 1HNZM 3PPRA 2BJJX 3G3IA 3T15A 3FV2A 2M60A 4JI2M 2R65A 2XD2A 3VFDA 2I4CA 4M1VA 2DZOB 3IO6A 2L6OA 1OQHA 3C34A 5BR8M 2R71A 4M0WA 3O6IA 2RCBA 1N7WA 4YAHX 3A3CA 3R7XA 1PDAA 3SASA 4DR5M 3T9HB 1XVYA 4IBKA 1XMOM 3L28A 1R2YA 4G68C 4F3PA 3W15C 2R62A 1XT8A 3UA8A 3FTFA 2F7AA 1Z7NE 1OVTA 1IBLM 2CV1A 3SEYA 2C98A 4B7GA 3GLHA 3KS8A 3K6UA 1YPNA 4FJPA 2V1CA 2VQEM 1N78A 4OVJA 1IZ1A 1AIVA 2L7HA 2PBWA 5F1QA 3EHTA 1O7TA 1QVRA 1XMQM 2OLBA 4ONYA 2J7OA 3PPOA 2KEBA 3TTNA 1QW0A 3ZC7B 4EDPA 4QFOA 2Z4RA 1QULA 4WKMA 1DO0A 1MQGA 2WKYA 4JXIA 4U4SA 3K01A 5I58B 1Z5CA 4NF5B 4LFAM 2RC7A 3AXFA 2HEUA 3LQQA 3HCQA 4G77A 3CF6E 1B5IA 3PUZE 3ECRA 3FUZA 2X4AA 3E9XA 2L09A 3TEPA 2XHDA 4NXNM 1N33M 5TPAB 2PX1A 2X7PA 3FUXA 5FHMA 5EP2A 5KCJA 3BFUA 3JYRA 1Z6TA 4DV4M 1Z5AA 2QCUA 5I58A 5DVJA 1FQBA 4NF5A 2DWAA 1TH3A 3SATA 3C36A 3THIA 2DSFA 3DFZA 4R2FA 1TXFA 5BUUA 3IOVA 2XLJA 2NXOA 3E9SA 3KOYE 1LBCA 2KRKA 5A2QS 5EXSA 4RNSA 4BLCA 1H45A 5C18A 2UXDM 3MC2A 2I48A 4X62M 3HWSA 4RF0A 2M8CA 1D9VA 4U21A 4LZJA 1S3SA 4TLMB 1D3KA 1A54A 1N34M 3LR1A 4U2RA 3J27B 2Y20A 4OWDA 5L8DA 1SXJA 3W0LB 3H6VA 3Q26A 3LSXA 4LUBA 5I59B 1G59A 2ANJA 4MM3B 2QBYA 5H8NA 4RK2A 4FCVA 4JI8M 1JR3A 4GXAA 2H4IA 1B3HA 4FVMA 4X66M 3WAFA 3G3FA 1KFVA 4IY5A 3AFHA 1FTKA 1EZ9A 2VQFM 1DGBA 1O63A 2QENA 4GC9A 5H8QA 4R9GA 3DZDA 1HSEA 1KYIA 1LCFA 3TTRA 2V6ZM 4D82A 2ERCA 3IL1B 3QK6A 4PETA 3F11A 4NMYA 1JNFA 2VGQA 3L26A 3CTWB 4YMAA 1D9YA 4PCZA 4NRWA 2BNKA 1IM2A 3IB1A 1YTVA 3ILKA 1SQYA 4C0RA 4OESA 3TQLA 3C33A 3SHGB 4JBZA 4LA9A 2ZYKA 4UA8A 1XS5A 3TCFA 4R9FA 1MM7A 2DWIA 2ONRA 4H8IA 5IAIA 3CR9A 1SI0A 4LJ4A 4MGHA 3TCGA 1UIUA 4DUZM 3OEKA 3I51A 3V5AA 3FTDA 1NNTA 1HR0M 4JV5M 3UZUA 3RN8A 4IBJA 2H9BA 4MGKE 1B0LA 2A5SA 5KZTA 1O64A 1YSYA 4R73A 3OSQA 3T1HM 1MH4A 2YPNA 3UN6A 5ITXA 1P1OA 1LCTA 1SI1A 2XSZA 3TWMA 2L7IA 4O3BA 1NNFA 2AL5A 3JR4A 1SW2A 5KPZA 2HXWA 3LMMA 4X48A 2PT1A 1Q3BA 2P2AA 3TKDA 4CHTB 3T93B 2FFJA 1Y20A 3T9XB 5H8HB 4OYVA 1G41A 4KQPA 4POXA 1T0KA 1MXVA 3H6UA 5AE4A 4F3GA 1PBPA 2CZLA 4GL0A 2DXIA 5AA2A 4N07A 4LATA 1QQWA 5FTLA 3TTLA 3UGWA 3LVVA 5KDTB 4X65M 5DEXA 3FTEA 1XWIA 2FE8A 2QMWA 3PPQA 5EYFA 1Z59A 4L17A 4GH9A 4M9SA 4CGYB 3TUSA 5EJCA 4POWA 3I3VA 4R6YA 2DXYA 2Z3XA 4PD2A 2QBYB 1XVXA 4MGYE 3UIFA 2ZNSA 1B52A 5EHSA 5L9SA 3O66A 4GFRA 4QFPA 4DV3M 5DEXB 1QYRA 3KOXE 1TFAA 1USYE 2YR0A 4QOSA 1NNPA 2GRVA 3TYHA 2F6PA 2RGOA 4PT5A 2EO2A 4KYSA 1Y4CA 2I4BA 2RINA 3RQTA 3HJQA 1VFEA 2QS3A 2UUAM 2KRUA 1WXQA 1E9SA 4JI4M 2Q89A 1A7LA 1PBQA 3IB2A 3U93A 5AA4B 4MGIE 4ZEBA 2IA4A 4PFTA 5JTYB 1Y1MA 2Y84A 4RPNA 1NNKA 3FYCA 3SDFA 1MY2A 2I6EA 1L2DA 2G93A 3IAZA 4QFKA 1J5EM 4OHNA 3VDFA 4DV7M 2LH0A 1NMUA 1L1ZA 1NFTA 4BDMA 3SBJA 4KCDA 3H6TA 4C1UA 3D8LA 4LP2B 4II7A 4IO3A 3HHZA 4OEUA 1K82A 5H8SA 1P1QA 4ZDMA 1W5TA 1YCJA 2G5GX 3RT6B 1GV8A 2K47A 4IBBA 2O1MA 3TELA 3HGIA 4L4UA 2DP8A 1XC1A 3UK6A 3MWBA 2Z23A 1EZOA 1PEBA 1M5DA 2E5LM 1PJIA 3W0FA 1N36M 1L2BA 2O5RA 4AQ4A 2OCUA 2F5QA 4OERA 3PD8A 1BKAA 1IITA 4P0GA 3QWLA 1QUJA 3K1NA 2ZYMA 3Q29A 4X9TA 1IQPA 5LOMA 1DTZA 3O6HA 5EQTA 4QSEA 5JEIA 3AKZA 2Y7RA 4RA1A 4H0WA 1NH8A 4KYEA 2AIXA 4H67A 2R18A 1B5HA 3L27A 4NF4A 1MY3A 2QS2A 1JVYA 3KXEC 3TFLA 2ZAOA 3PUXE 1S9TA 3C9HA 1DPPA 4M9ZA 1HSJA 7CATA 4NF8A 4DV6M 1URGA 2F8DA 1FTOA 2VOZA 1ZU0A 3I5OA 3M0EA 4WXJA 3AOEC 3VDUA 2ZYNA 5ITYA 3OO8A 1OMPA 3VKHA 4XKQA 3OO7A 4F3SA 3FATA 2QS1A 3U6OA 3SYKA 5FTHA 4QHQA 3BOSA 3VXBA 4F2OA 3HU2A 5JK4A 4JI6M 1UTHA 3JV9A 3IR1A 2LXEA 3HKPA 4DLDA 4AQYM 3G3KA 1TWYA 2QMXA 3ONMA 4AZFA 2DWZB 4GC5A 4MF3A 2CV2A 4IO5A 3J7AS 3PU5A 1NJGA 3KS4A 4R74A 1AOVA 1F9BA 1N3WA 1NHWC 4XKRA 1VFDA 3HV1A 2FNCA 1QUKA 1VE4A 2Z4SA 4P11A 3PMWA 4LZ7A 2XEPA 4KYDA 1Q3CA 5I2KB 4FCWA 3TCHA 1FTJA 1Y9UA 4LF8M 4LCBA 2XXUA 3K0VA 3Q28A 3SMPA 5I57B 1E32A 4FWGA 2HQ0A 4U1OA 2XFSA 4WURA 3LC8A 3T66A 1J1NA 1Y3PA 3HHFA 1B05A 3UK4A 1FQAA 3MVXA 4THIA 4OW0A 1WODA 1FQCA 3R26A 4NOOB 4X64M 4IIWA 2UXAA 3CF0A 4ITQA 2BJVA 4F1UA 2Q8JA 3T9UA 1E94E 5L9OA 1IQ7A 4G2ZA 5I56A 2ESNA 3FXQA 4QNMA 2YQZA 1M5FA 4G8NA 4GKKM 1N76A 3VLVA 2Y7WA 3SHFA 3A3UA 1BIYA 3IK6B 3M7GA 3KJTA 3KN8A 3OMBA 1FTMA 4XTCQ 3C4MA 3CF2A 3TTKA 4ZEKA 3FASA 3K6XA 5CBSA 3G3HA 2FNAA 1IIWA 5TPAA 4JI5M 4JXJA 3VK7A 3IJOB 4G8MA 1FJGM 4AI6A 1B1HA 1ZLQA 1UTBB 3QSLA 1N04A 1SD3A 3Q8XA 2DQVA 4IJFA 3LVWA 4AB5A 3FJ7A 4LFBM 1IN8A 2EA0A 2BJWA 2QZ4A 2F5PA 4JN6A 2D7HA 3RUMA 5DYGA 1LAXA 5ICTA 4R6HA 1VDDA 1P99A 4ZEFA 3B6TA 2PT2A 3AJIB 3G7WA 5CBRA 3QUJA 1HT2E 3C31A 1NJFA 4NL4H 3GZGA 4IGRA 4EQBA 3PXGA 2Q88A 4LGMA 2ZNTA 2KZSA 3S4UA 5K2XA 3P7IA 1MPDA 3J81S 4GKJM 1CE2A 4QF9A 3HU1A 3S9EA 3MW0A 1QVSA 1X37A 2ZBKB 3SYLA 3BFTA 4DDDA 3RFWA 4ESWA 3HJ8A 3FGSA 5M2VA 2CHQA 3AOEA 1MM6A 1NHGC 4G68A 4A3VB 3U60B 1USYH 5AA3A 4EIWA 4YHHM 1R1NA 2OWSA 4DR3M 4OU7A 5H8NB 1OJLA 3M8UA 1SXJD 4H5FA 1SVXB 2O51A 4M9XA 2XD3A 1QAMA 4YB7A 1AH5A 2XXTA 2JA2A 3U5ZB 4JSDA 5H8QB 2DXRA 3C58A 1LB9A 5CMMA 1FNNA 3ZS6A 2UVHA 3H4ZA 1GTKA 1I4WA 3U61A 4NSRA 3SEUA 2A5TB 2PYYA 4ND9A 4U4XA 1J7KA 3GQ3A 4G8HA 2R45A 1EZPA 2QRYA 5L9MA 3FTCA 4ECFA 3MAMA 4B3MM 3PPPA 2ABHA 1XOCA 5AA1A 4XKNA 2DS9A 2DZNB 5CC2A 1OFHA 1SDXA 3VK8A 3QXMA 1NY5A 3TL4X 3U94A 2RKMA 2I49A 4TOZA 3N26A 3MVYA 3O97A 3R8FA 1KSFX 3VLUA 3CFLA 2YFQA 3PMXA 4KHZE 1SYHA 3QIMA 5FTJA 1GVNA 2F36A 1NH7A 1RYOA 1IXSB 1R9LA 3T96B 2QL3A 5DT6A 1IUDA 3KG2A 4LZZA 3DP6A 2CE7A 3VLWA 4WEPA 2GHBA 3PFIA 1R6ZA 2HCAA 1QANA 2IEEA 4GQOA 5JI2E 1ZKBA 1Y3NA 2YJPA 4L16A 1ZTYA 2O7IA 4RF1A 5HPQA 2YNMD 1MXXA 2HL7A 4JB7A 4TLLB 1DGHB 3IG8A 2XF3A 4I5SA 2D7GA 4RJZA 1DMBA 2QSXA 1XNQM 3PV0E 3MP8A 3D4GA 3K2LA 5KDTA 1TDZA 1B9JA 1QAQA 2UYFA 3K1PA 3FD9A 3K8ZA 2NQ8C 2Y21A 4OX9M 3IB0A 3PUYE 4OETA 4P16A 1H43A 3DM0A 2DWHA 4NRVA 1EU8A 4HLQA 3FUTA 5FTNA 1FQDA 3U60A 3GRUA 3OTOM 2HHHM 3MZ9A 3C32A 3DOAA 1US5A 1PJJA 2O6AA 3CG3A 4YKPA 4DV1M 3RT8A 2DHRA 3SFZA 2FYIA 4YB6A 2XXHA 3D4CA 4XXUA 3M3LA 1XHYA 1IEJA 2REGA 4OVZA 4LRSA 2FA7A 3IJXB 1HNXM 3HHWA 4F19A 5EXPA 2V3QA 3GLGA 4DE8A 3L6GA 2W7YA 2DVCA 1LLSA 2OZZA 3LBSA 1K3XA 1B3FA 3IOTA 1GGGA 3OO6A 2RGHA 2A5TA 4NEDA 1MX0A 1NSFA 2V25A 5DVIA 1B7ZA 1B3LA 2XGNA 1TFDA 1GLNA 2Q2CA 3SKPA 3MBPA 4LQ5A 2R4JA 3FVOA 1ANFA 3CG1A 4GL8A 2CFOA 4OFOA 3WAEA 3RY3A 4KI0E 2E1SA 1FTLA 4M0DA 4NF6A 4NF4B 2LWXA 3FVGA 3DLNA 3H6WA 3K00A 4FD2A 4B08A 3A98B 3U6LA 2G8LA 2PVUA 1L1TA 4ZPXA 1IN4A 3KW6A 3IOUA 4EQ9A 4ZE9A 3PNYA 2DWMA 2I7PA 1ZIUA 3UGJA 1DTGA 4QFNA 4R75A 3RGSA 4MH0E 3V83A 4GITA 4JDFA 4L8RC 4Z0IA 4DXCA 4I1DA 1M5BA 2O84X 4M4GA 4AG6A 2KXEA 5IZ7D 3SEWA 4NF6B 4DR6M 2DVWB 4PE5B 1LFIA 2F6GA 1OIBA 4KPTA 1N0TA 3HPIA 4ZEIA 3E3KA 5ITRA 3CFXA 4IBDA 1A8EA 1I6AA 3FYDA 1IN7A 3MJNA 2LAOA 1KWHA 1OVBA 4ELQA 2AYSA 2H1RA 2QJEA 2DOJA 4L15A 1SXJE 1MRPA 4XGIA 3FZVA 3PPNA 4OMBA 2F97A 3PNVA 4IBIA 2I7NA 2HAVA 3N5LA 3SAUA 4W5WA 1LFHA 2ZYOA 3KDSE 3GLFB 1MXYA 3EHUA 2R6GE 4R72A 2DE3A 4Z7EA 2UXCM 4IGTA 1R9QA 4S12A 2OJTA 2CHGA 4N13A 3M3KA 4DR1M 4IBCA 3PGFA 1I6QA 4OXVA 5ITUA 1D2NA 1BP5A 4FECA 4DXBA 3VV5A 2V84A 4LJ9A 2XZUA 1D4NA 4OVZB 4Q8RA 1LV7A 1IBMM 2CEAA 4O3CA 5EHMA 3K6VA 2DWNA 4F31B 2UVIA 4KHPM 3VDPA 4NSOB 4DR4M 4LF6M 4P0IA 3MPLA 4H6DA 2B3BA 2XXWA 1MY0A 3FUWA 4PFWA 3U6EA 3H06B 5ITXE 4F22A 4LRTA 2UUBM 1MQIA 3J2PB 1DGFA 1PB9A 4FEBA 2V1UA 3TODA 1YE9A 3G3GA 3MQ9A 4GOTA 4B3RM 2X7QA 2F7CA 4AG5A 3GQ4A 5J1DA 2D21A 3T38A 3QAUA 3FD3A 4ZS9A 4IBGA 4MFIA 2X8AA 4FORA 1N77A 1GKIA 3DP8A 3B7DA 1JW5A 2OWTA 1M5EA 2H99A 3S9MC 2CHVA 4JWYA 3O28A 4OZ9A 1B7HA 4E0XA 5ITPA 3AL0C 4F3BA 5IT9S 4G4PA 3S9NC 5DYIA 3IORA 2V93A 4DR7M 5DVFA 3RGYA 3U6PA 3OELA 4RYAA 1QKBA 4DZ1A 4PP0A 1HT1E 3O29A 1SXJB 4JI0M 1B4ZA 4HW8A 2Y7KA 5B70A 2QP9X 1TDHA 5KQDA 3T22A 3TMGA 2QPQA 1W5SA 3SARA 1I6BA 3MZBA 3W9VA 1PC3A 1B5JA 3KZGA 5EP1A 2ONKE 1LSTA 3PVSA 2LNHC 4G4RA 3K02A 3L2AA 3VLFB 3J80S 2Y7IA 4U22A 5C1BA 3ILTB 5A5XB 2J7NA 1MY1A 4LJ7A 4YICA 3GLBA 3TTMA 3U6SA 1H44A 1DOTA 3OEMA 5E26A 3C35A 3MHVC 1R6BX 5DNYA 1DO2A 2Z8DA 4OQOA 1EE8A 5I2NA 3U92A 4AKHA 4DCXA 4DIGA 4ELPA 4BDLA 2CMOA 3U5ZA 4Q5TA 4YU0A 3KOWE 3L29A 4H65A 4FAJA 2HCBA 1POTA 2O7UA 4NTLA 1SW5A 2C96A 1IXHA 3HU3A 4CISA 1B0HA 3U61B 1JR3D 3EQ1A 4I4LA 1TGUA 4ZZEA 3ILUB 2OK2A 1SXJC 1IN6A 1XXHB 2QPAA 2HAUA 3SEVA 5HM4B 5I2NB 4LJAA 4IO7A 1YAEA 3KSXA 2GHAA 2Y0QA 4QRZA 2D5WA 4KR5A 3KN7A 4UACA 3TPZA 4FWDA 3GRVA 3HHGA 2Z22A 3MK6A 4HS7A 4GIPA 1MDQA 1N3XA 1ZQ9A 4BDQA 2VP1A 1RKMA 3S9LC 1AL3A 1DGGA 4D81A 1B3EA 4AKGA 4AB6A 4G4NA 3RTWB 5LMNM 1XXHA 4REZA 4F1YA 1NNJA 4QSCA 3GRRA 2R46A 4LGYA 3U72A 2KZUA 1MY4A 2NOOA 3KN3A 2XXYA 4IO6A 4H8JA 2W82A 2F7BA 1WVJA 4QFLA 1J09A 4LJ5A 2ZANA 3IO4A 1PM5A 2VHAA 4WW0A 3ODBA 4JWOA 1A8FA 1FCKA 3GLIB 4TQUQ 1Y4TA 2F35A 5H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMX A;  1ZBM A;  4KHZ E;  3T9X B;  2XX8 A;  1JEU A;  5H8H B;  4OYV A;  1SYH A;  4BDN A;  2HFB A;  2I3V A;  1ATG A;  4GXS B;  3QIM A;  3VE1 B;  1CB6 A;  4KQP A;  1A55 A;  4POX A;  1T0K A;  1MXV A;  1H76 A;  5HBC A;  3H6U A;  5AE4 A;  2F36 A;  3VFJ A;  4F3G A;  1UTB A;  1NH7 A;  1JEV A;  1RYO A;  2O1L A;  1PBP A;  3FIR A;  3SER A;  4KD5 A;  5BWJ A;  1R9L A;  2CZL A;  3T96 B;  1B40 A;  2KLF A;  2QL3 A;  4GL0 A;  5DT6 A;  5AA2 A;  1B51 A;  1IUD A;  4LAT A;  3KG2 A;  4N07 A;  2G29 A;  1VR5 A;  3Q25 A;  4N6P A;  4H5G A;  3TTL A;  3DP6 A;  3RNN A;  3UGW A;  5F7V A;  5KDT B;  1B32 A;  5DEX A;  5ISU A;  3O2A A;  1N7X A;  4WEP A;  3TPA A;  3VLW A;  4E0W A;  2GHB A;  2QMW A;  3PPQ A;  4EUO A;  1R6Z A;  3HO7 A;  4O3A A;  5EYF A;  2HCA A;  4L17 A;  2IEE A;  5FHN A;  4GQO A;  1B1X A;  2UYE A;  1ZKB A;  1B58 A;  3RTF B;  4F2Q A;  1Y3N A;  2YJP A;  1ZTY A;  3TUS A;  3FJG A;  4POW A;  1MPB A;  1S7Y A;  2O7I A;  3I3V A;  5HPQ A;  4YKI A;  3B6Q A;  4R6Y A;  2DXY A;  4GRK A;  3N94 A;  1MXX A;  1B2H A;  3PUW E;  4JB7 A;  4TLL B;  3MPK A;  1XVX A;  1B6H A;  1MG1 A;  1LAG E;  1Q35 A;  2UVG A;  2ZXT A;  3O6G A;  4RJZ A;  3K6W A;  3UIF A;  1DMB A;  1B52 A;  2ZNS A;  2THI A;  2QSX A;  3LSL A;  5I56 A;  4GLI A;  2O68 A;  3PV0 E;  5EHS A;  1TT1 A;  3MP8 A;  3VVF A;  3D4G A;  1MQJ A;  4GVO A;  3FXU A;  5L9S A;  1GR2 A;  3O66 A;  5KDT A;  3FJM A;  4GFR A;  5AA4 A;  2OBG A;  3GXA A;  2Z8F A;  3IX1 A;  4IB2 A;  4QFP A;  2P0S A;  1SW1 A;  5DEX B;  1B9J A;  1TFA A;  1ZJL A;  3E13 X;  2UYF A;  3K1P A;  4OFJ A;  1UIV A;  1SBP A;  4Q30 B;  1USY E;  5ITO A;  5TU0 A;  2B3F A;  3PUY E;  3IB0 A;  3TAJ A;  2XX7 A;  1NNP A;  3FXR A;  4OET A;  2RC9 A;  2GRV A;  1H43 A;  3EF7 A;  5CI5 A;  3TYH A;  3DM0 A;  2DWH A;  1EU8 A;  4DCY A;  2RC8 A;  3EN3 A;  2F6P A;  3DEL B;  3CRB A;  1UTH B;  1FQD A;  4G68 B;  2F34 A;  3MZ9 A;  3C32 A;  1QKA A;  4KYS A;  1Y1Z A;  2HZL A;  1OLA A;  4ELO A;  2X26 A;  1Y4C A;  2I4B A;  1US5 A;  3QYT A;  2RIN A;  2NWJ A;  2O6A A;  3CG3 A;  1JW4 A;  4YKP A;  1A40 A;  1Z7M E;  4EF2 A;  3CIJ A;  3RQT A;  3RT8 A;  1FQF A;  1VFE A;  4GWO A;  2QS3 A;  2UVJ A;  2FYI A;  4IO4 A;  4YB6 A;  2XXH A;  3D4C A;  4XXU A;  3M3L A;  1XHY A;  2Q89 A;  4OFL A;  1A7L A;  1PBQ A;  3IB2 A;  3CSG A;  3MVZ A;  3U93 A;  5AA4 B;  5ICQ A;  1IEJ A;  3MVW A;  3MUQ A;  4GF8 A;  1BLF A;  2REG A;  4ZEB A;  2IA4 A;  4PFT A;  2FA7 A;  1MPC A;  3IJX B;  3MP1 A;  5JTY B;  1LAH E;  1Y1M A;  2Y84 A;  1N84 A;  1NNK A;  4I9D A;  4RPN A;  4F19 A;  3M3F A;  2V3Q A;  3SDF A;  2GFE A;  1MY2 A;  2I6E A;  4DE8 A;  3L6G A;  2W7Y A;  4ZED A;  2DVC A;  1LLS A;  2OZZ A;  3LBS A;  3V89 B;  2R9J A;  2G93 A;  1B3F A;  3IAZ A;  4QFK A;  3IOT A;  1GGG A;  2F5X A;  3OD7 A;  4HCY A;  4OHN A;  3OO6 A;  3Q27 A;  5FTI A;  3VDF A;  3TZA A;  2A5T A;  4NED A;  3A09 A;  3PMV A;  4ISU A;  1NMU A;  2V25 A;  3KOT A;  1NFT A;  4BDM A;  5DVI A;  4KCD A;  1NL5 A;  4YB5 A;  4I62 A;  4F29 A;  1B7Z A;  1B3L A;  3H6T A;  3USD A;  4EXL A;  4C1U A;  1ZMG A;  4LP2 B;  1TFD A;  2AL4 A;  4IO3 A;  2Q2C A;  3HST A;  1IXC A;  4OEU A;  3SKP A;  3MBP A;  4OEN A;  5H8S A;  4LQ5 A;  4WED A;  1P1Q A;  4MBP A;  4ZDM A;  3FVO A;  1ANF A;  1YCJ A;  3CG1 A;  3IOW A;  3OEN A;  3RT6 B;  1JQF A;  3LSF B;  3OXN A;  4GL8 A;  4RPO A;  1GV8 A;  4OFO A;  3WAE A;  2O1M A;  3RY3 A;  2I0C A;  4KI0 E;  3TEL A;  2E1S A;  1FTL A;  3W9W A;  4C1T A;  2DP8 A;  1XC1 A;  5TP9 A;  1B4H A;  4NF6 A;  4NF4 B;  4JWX A;  3FVG A;  3MWB A;  2H5Y A;  3DLN A;  3H6W A;  2Z23 A;  3K00 A;  1PB8 A;  4MLV A;  4U1Z A;  1PEB A;  2HZK A;  1M5D A;  3H7M A;  3S2V A;  3BKI B;  4BLA A;  3BBR A;  3DP4 A;  1RYX A;  2PVU A;  4LZ8 A;  2NUV A;  1IXG A;  1A99 A;  4ZE8 A;  2E0S A;  2OCU A;  4AQ4 A;  2GH9 A;  4OER A;  3PD8 A;  1BKA A;  2VD2 A;  4NF8 B;  3IOU A;  3PD9 A;  1B3G A;  1IIT A;  3LUY A;  1UQW A;  4EQ9 A;  4P0G A;  4ZE9 A;  4ZEC A;  1QUJ A;  3K1N A;  2ZYM A;  3Q29 A;  2V3T A;  1ZIU A;  4X9T A;  1DTG A;  1B7U A;  1JET A;  4QFN A;  1DTZ A;  3TDJ A;  5IAI A;  5LOM A;  3O6H A;  4R75 A;  1LAF E;  4Q0C A;  4QSE A;  5JEI A;  5AA2 B;  2Y7R A;  3V83 A;  2ZNU A;  3U8Q A;  4JDF A;  4RA1 A;  4Z0I A;  3GBB A;  1QJM A;  1FW0 A;  3CFL A;  1M5B A;  3OSR A;  4H0W A;  2O84 X;  4I1D A;  2V3U A;  4PQJ A;  4M4G A;  2YLN A;  1NH8 A;  1NKX A;  4H1X A;  4KYE A;  1SYI A;  2AIX A;  3SEX A;  3R6U A;  2DE2 A;  4H67 A;  5DTB A;  1L5T A;  4YMB A;  1JVX A;  3SEW A;  1B5H A;  3OOA A;  5KCJ B;  4NF6 B;  4NF4 A;  4PE5 B;  3CSB A;  3EHS A;  1LFI A;  1MY3 A;  1OIB A;  2F6G A;  2O69 A;  2QS2 A;  4KPT A;  1N0T A;  1DSN A;  1JVY A;  3HPI A;  3HN0 A;  3JZJ A;  3PPP A;  4ZEI A;  1I69 A;  2Z8E A;  3E3K A;  5CMC A;  3CFX A;  3TFL A;  3U1O A;  5CRY A;  3PUX E;  1S9T A;  1A8E A;  1I6A A;  3G3J A;  3C9H A;  1DPP A;  4I8C A;  1MDP 1;  5CMB A;  4MH5 A;  3RLF E;  4ESX A;  1EZO A;  1Q1K A;  2DE4 A;  1HSJ A;  3MJN A;  2LAO A;  2D3I A;  1P1N A;  1P1U A;  4NF8 A;  4KFQ A;  4XKP A;  4FAT A;  1P1W A;  2NVU B;  1KWH A;  1URG A;  3O9P A;  1OVB A;  4EF1 A;  1PB7 A;  2F8D A;  1FTO A;  4X1B A;  2VOZ A;  2Y7P A;  1ZU0 A;  4ELQ A;  2AYS A;  2ZMB A;  3I5O A;  3FVK A;  4NWD A;  2REJ A;  3KJ7 A;  4WXJ A;  2PMS A;  2QJE A;  3PPR A;  2DOJ A;  2BJJ X;  3G3I A;  1MRP A;  2ZYN A;  4X1D A;  2XXI A;  3OO8 A;  3FZV A;  1AMF A;  3FV2 A;  1OMP A;  5AA2 D;  3PPN A;  4F3S A;  4XKQ A;  1LFG A;  3OO7 A;  4OMB A;  4IY6 A;  4LQ2 A;  2F97 A;  2HAV A;  3FAT A;  3N5L A;  2QS1 A;  1LFH A;  3B6W A;  2XD2 A;  2ZYO A;  5FTH A;  3VXB A;  4QHQ A;  2I4C A;  1DPE A;  1MXY A;  3EHU A;  2R6G E;  4M1V A;  3IO6 A;  1OQH A;  3C34 A;  4R72 A;  4F2O A;  5JK4 A;  3OO9 A;  1MXW A;  1UTH A;  2R71 A;  1GVC A;  2DE3 A;  4BDR A;  4Z7E A;  3JV9 A;  3O6I A;  4EXK A;  3IR1 A;  4IGT A;  1R9Q A;  3T66 A;  2OJT A;  2RCB A;  4N13 A;  1S50 A;  4DLD A;  1N7W A;  3G3K A;  3M3K A;  4YAH X;  3PGF A;  1TWY A;  3A3C A;  2QMX A;  3EPE A;  1I6Q A;  1BTJ A;  4OXV A;  4XIG Q;  3ONM A;  5I59 A;  3R7X A;  2XXX A;  1PDA A;  4MF3 A;  3T9H B;  4IO5 A;  4LVQ A;  1BP5 A;  1XVY A;  3N6T A;  5I57 A;  1POY 1;  3PU5 A;  4DZ1 A;  4FEC A;  3QAX A;  4R2B A;  4G68 C;  2V84 A;  1D4N A;  4R74 A;  1F9B A;  3VV5 A;  4DXB A;  3W15 C;  4F3P A;  4Q8R A;  1AOV A;  1N3W A;  5JTY A;  1XT8 A;  2VD3 A;  3UA8 A;  1OQG A;  4RXL A;  4XKR A;  4O3C A;  5EHM A;  4RK9 A;  4F1V A;  2F7A A;  1Z7N E;  1OVT A;  2ONS A;  3K6V A;  3SEY A;  1VFD A;  3HV1 A;  2FNC A;  4U23 A;  1QUK A;  1VE4 A;  4F31 B;  2UVI A;  4NE4 A;  4P11 A;  4DXU A;  3PMW A;  3K6U A;  4LZ7 A;  1YPN A;  1OLC A;  2DWJ A;  3MPL A;  4KYD A;  4P0I A;  4FJP A;  4H6D A;  4JSO A;  3ZKK A;  5IKB A;  5I2K B;  3KBR A;  3KFM A;  3TCH A;  2B3B A;  1FTJ A;  4OVJ A;  2XXW A;  1MY0 A;  1IZ1 A;  3UOR A;  1Y9U A;  1AIV A;  4PFW A;  2PBW A;  2XXU A;  3EHT A;  4FED A;  4HTG A;  5F1Q A;  1O7T A;  3H06 B;  3K0V A;  3Q28 A;  4YKJ A;  4F22 A;  1M5C A;  1MQI A;  2OLB A;  5I57 B;  4ONY A;  3PPO A;  1MS7 A;  1PB9 A;  1QW0 A;  2HQ0 A;  4U1O A;  3TTN A;  4EDP A;  4QFO A;  2XXR A;  1URD A;  2XX9 A;  1QUL A;  3LC8 A;  4FEB A;  3K1M A;  1MQG A;  1J1N A;  1Y3P A;  1FQE A;  3HHF A;  1B05 A;  4WKM A;  1FQA A;  3MQ9 A;  3G3G A;  2WKY A;  4GOT A;  4JXI A;  4U4S A;  3UK4 A;  4BDO A;  3K01 A;  3MVX A;  5I58 B;  2X7Q A;  1LBB A;  1LGB C;  2F7C A;  4THI A;  1WOD A;  3T9V A;  4NF5 B;  1FQC A;  3R26 A;  2D21 A;  2XXQ A;  5J1D A;  1JW1 A;  2RC7 A;  5DYH A;  5B7D A;  2UXA A;  3AXF A;  4KCC A;  2HEU A;  4OEV A;  3HCQ A;  4F1U A;  3FD3 A;  4G77 A;  4ZS9 A;  2Q8J A;  3ZKL A;  1H3D A;  4MFI A;  1B46 A;  3T9U A;  3TOD A;  4FOR A;  5L9O A;  1B5I A;  1IQ7 A;  3DP8 A;  4G2Z A;  3KSJ A;  3B7D A;  3PUZ E;  3ECR A;  3FUZ A;  3H3G A;  1JW5 A;  2OWT A;  2ESN A;  3E9X A;  1M5E A;  2H99 A;  1IXI A;  3FXQ A;  2XHD A;  1HSL A;  4ELR A;  4JWY A;  3S9M C;  3TEP A;  5TPA B;  2PX1 A;  3O28 A;  1M5F A;  2X7P A;  3L6H A;  1B7H A;  4G8N A;  4OZ9 A;  3GBA A;  5ELV A;  4E0X A;  3FV1 A;  5ITP A;  2QS4 A;  5FHM A;  1N76 A;  1WDN A;  3VLV A;  4F3B A;  2Y7W A;  5KCJ A;  3BFU A;  3JYR A;  4G4P A;  3S9N C;  3A3U A;  3IOR A;  1BIY A;  2V93 A;  5DVF A;  3IK6 B;  5DVJ A;  5I58 A;  3CI8 A;  3RGY A;  1FQB A;  2H25 A;  3OEL A;  4RYA A;  4NF5 A;  2DWA A;  1QKB A;  5A5X A;  3KJT A;  3KN8 A;  2H98 A;  1MXU A;  3C36 A;  1FTM A;  3OMB A;  4PP0 A;  2DSF A;  4XTC Q;  3THI A;  3C4M A;  4R2F A;  1TXF A;  3TQW A;  5BUU A;  3IOV A;  3O29 A;  1MQD A;  1MQH A;  2RF1 A;  3TTK A;  4ZEK A;  2NXO A;  1B4Z A;  4HW8 A;  1LBC A;  2Y7K A;  3FAS A;  5B70 A;  3K6X A;  4GD5 A;  4HCW A;  4RNS A;  5CBS A;  4R6K A;  3T22 A;  1H45 A;  3G3H A;  3TMG A;  2QPQ A;  1IIW A;  5TPA A;  2RCA A;  1I6B A;  3MZB A;  3MC2 A;  3IJO B;  1EH3 A;  3W9V A;  4G8M A;  1B1H A;  3QUF A;  1PC3 A;  1ZLQ A;  2I0B A;  2I48 A;  1UTB B;  2XXV A;  3QSL A;  1B5J A;  2M8C A;  1SW4 A;  3KZG A;  1D9V A;  1N04 A;  1SD3 A;  1QUI A;  1LST A;  2ONK E;  3K02 A;  1VSO A;  4U21 A;  2DQV A;  4AB5 A;  3N6U A;  3FJ7 A;  2B65 A;  4TLM B;  2Y7I A;  4U22 A;  1D3K A;  2P1S A;  1A54 A;  2DVZ A;  3ILT B;  5A5X B;  3LR1 A;  4MLQ A;  4U2R A;  3PUV E;  1MY1 A;  4YIC A;  3RUM A;  1LAX A;  3GLB A;  4OWD A;  4R6H A;  4YZZ A;  5L8D A;  3TTM A;  5ICT A;  1H44 A;  1P99 A;  3KEI A;  1DOT A;  4FIM A;  3OEM A;  3H6V A;  3C35 A;  3Q26 A;  4ZEF A;  3B6T A;  3LSX A;  2PT2 A;  3G7W A;  5CBR A;  3QUJ A;  4LUB A;  4F39 A;  3C31 A;  3GZG A;  4IGR A;  5I59 B;  4EQB A;  2ANJ A;  5TP9 B;  2Z8D A;  2Q88 A;  4OQO A;  4NWC A;  5H8N A;  4RK2 A;  4DXC A;  5I2N A;  2ZNT A;  4GIZ A;  1Y3Q A;  3U92 A;  4GXA A;  2H4I A;  1B3H A;  3E4R A;  3S4U A;  5K2X A;  3SET A;  3P7I A;  3KOS A;  4QSD A;  3WAF A;  4DCX A;  4DIG A;  1MPD A;  3G3F A;  1MH3 A;  4ELP A;  1MXZ A;  4BDL A;  4IY5 A;  1CE2 A;  4YKK A;  1FTK A;  2CMO A;  4QF9 A;  1EZ9 A;  4Q5T A;  4YU0 A;  4EQ7 A;  1O63 A;  4H65 A;  4ZZA A;  4FAJ A;  1POT A;  3S9E A;  2O7U A;  5H8Q A;  3MW0 A;  4R9G A;  1QVS A;  1HSE A;  4K3F A;  4NTL A;  1SW5 A;  3BFT A;  4DDD A;  1LCF A;  2I3W A;  3TTR A;  4ESW A;  5I84 A;  1IXH A;  3IL1 B;  3QK6 A;  3H03 A;  3FGS A;  4PET A;  3F11 A;  4NMY A;  5M2V A;  1JNF A;  2VGQ A;  1B0H A;  3VVD A;  5I2K A;  4IO2 A;  3EQ1 A;  2F78 A;  4LON B;  1MM6 A;  4G68 A;  4YMA A;  1D9Y A;  1USY H;  5AA3 A;  4ZZE A;  1R1N A;  3ILU B;  2OWS A;  1URS A;  2OK2 A;  4FE8 A;  3SEV A;  5H8N B;  2HAU A;  5HM4 B;  5I2N B;  2DYX A;  3IB1 A;  3M8U A;  1YTV A;  4IO7 A;  1LB8 A;  4OTE A;  1SQY A;  4H5F A;  3VXC A;  1YAE A;  4PFU A;  1SVX B;  4OES A;  3VVE A;  3RPW A;  4C0R A;  3KSX A;  2O51 A;  3TQL A;  2GHA A;  3UP9 A;  2XD3 A;  3C33 A;  3SES A;  4YB7 A;  1AH5 A;  4JBZ A;  4QRZ A;  2XXT A;  4JSD A;  4LA9 A;  2D5W A;  4KR5 A;  2ZYK A;  4UA8 A;  2DXR A;  5H8Q B;  1XS5 A;  3KN7 A;  3MZ1 A;  4UAC A;  5CMM A;  1LB9 A;  2Q2A A;  4PFY A;  1ELJ A;  4R9F A;  5FHO A;  3TCF A;  3K2D A;  1MM7 A;  2DWI A;  2ONR A;  4H8I A;  3HHG A;  2Z22 A;  4HS7 A;  3ZS6 A;  1MDQ A;  2UVH A;  1N3X A;  1SI0 A;  3CR9 A;  3H4Z A;  4BDQ A;  3KGC A;  1GTK A;  2VP1 A;  3TCG A;  1RKM A;  1UIU A;  1AL3 A;  3I6V A;  3OEK A;  3SEU A;  4F18 A;  3S9L C;  1B3E A;  3K4U A;  2ALU A;  3V5A A;  4AB6 A;  1NNT A;  2A5T B;  5H8F B;  3RTW B;  2PYY A;  4ND9 A;  2XXP A;  4U4X A;  3RN8 A;  4F1Y A;  5H8H A;  5I56 B;  4QSC A;  5CM6 A;  4G8H A;  2H9B A;  1B0L A;  5KZT A;  2A5S A;  3U72 A;  1O64 A;  1EZP A;  2QRY A;  4R73 A;  3OSQ A;  4RY1 A;  5L9M A;  4ECF A;  1MH4 A;  1MY4 A;  2YPN A;  3MAM A;  3UN6 A;  2NOO A;  2ABH A;  2Q9T A;  1XOC A;  2XXY A;  1P1O A;  1II5 A;  2DS9 A;  3KN3 A;  1LCT A;  4IO6 A;  4XKN A;  3MP6 A;  5AA1 A;  1SI1 A;  2I58 A;  4H8J A;  5CC2 A;  2F7B A;  1SDX A;  1WVJ A;  5CMK A;  4QFL A;  3LSW A;  4LZ5 A;  3IO4 A;  3QXM A;  3U94 A;  4O3B A;  1NNF A;  2RKM A;  3ZSF A;  3CFZ A;  2I49 A;  4TOZ A;  3N26 A;  3V8X B;  2AL5 A;  3MVY A;  1SW2 A;  2HXW A;  5K2Y A;  2VHA A;  3O97 A;  3ODB A;  1US4 A;  4JWO A;  2PT1 A;  4X48 A;  1A8F A;  1FCK A;  2P2A A;  3CVG A;  3TKD A;  4TQU Q;  3FVN A;  1Y4T A;  2F35 A;  3T93 B;  3VLU A;  5H8F A;  1Y20 A; 
#chains in the Genus database with same CATH topology
 2XX8 A;  4PDI A;  2M5Z A;  2I3V A;  1DGH A;  1ATG A;  3VE1 B;  1CB6 A;  1A55 A;  1G0H A;  3MMP A;  4IBF A;  3VFJ A;  1JEV A;  2O1L A;  3FIR A;  5BWJ A;  2LVQ D;  1B40 A;  4LJ6 A;  1B51 A;  4N6P A;  2QVU A;  2GQ1 A;  3Q25 A;  1VR5 A;  3RNN A;  5F7V A;  2JNH A;  1B32 A;  5ISU A;  3GQ5 A;  2JY7 A;  4E0W A;  2UU9 M;  4EUO A;  3HO7 A;  1ZAE A;  4K0K M;  3RGP A;  1B1X A;  2UYE A;  4F2Q A;  3KOZ E;  2UUC M;  3FJG A;  1MPB A;  1WR1 B;  4NF0 A;  4YKI A;  1OTR A;  3N94 A;  3AV0 A;  2Z7J A;  3PUW E;  5H37 D;  3MPK A;  1B6H A;  1MG1 A;  1LAG E;  1Q35 A;  2DAK A;  4LF9 M;  2UVG A;  3O6G A;  3A45 A;  3K6W A;  1FBD A;  4DV2 M;  4GLI A;  4MIJ A;  4X8R A;  5EXT A;  2O68 A;  4GVO A;  4Z8X A;  1GR2 A;  5AA4 A;  3GXA A;  5ITT A;  2DWL A;  1NVM A;  1ZJL A;  3E13 X;  4I3Y A;  1KA0 A;  2JY8 A;  3GLH E;  4F2L A;  1UIV A;  4Q30 B;  3TAJ A;  5ITO A;  1H6U A;  3GLG B;  3M6A A;  3FXR A;  1QDR A;  2RC8 A;  3EN3 A;  3CRB A;  1UTH B;  2OPF A;  5JI3 E;  1QKA A;  1FBG A;  1OLA A;  2HPG A;  1PJQ A;  1IY0 A;  1Z5B A;  1A40 A;  1Z7M E;  5ET6 A;  4GRI A;  4JYA M;  3CIJ A;  2KW0 A;  3FRH A;  2UVJ A;  4IO4 A;  4GMQ A;  4OFL A;  3JR5 A;  1XNR M;  3MVW A;  2XA5 A;  1BLF A;  4PAF A;  3MP1 A;  1LAH E;  4I9D A;  3TWK A;  2GFE A;  3SC3 A;  4B3T M;  3R9X B;  3V89 B;  2R9J A;  5LMU M;  5FTI A;  3OD7 A;  1N75 A;  3GLH B;  3A09 A;  3PMV A;  4R3D A;  3FBP A;  2KQZ A;  4PAK A;  1NL5 A;  4MGZ E;  4F29 A;  1TH4 A;  1HQY E;  3B9P A;  3A46 A;  1OIZ A;  3BXW A;  1ZMG A;  4EXL A;  5LDZ A;  5KPT A;  3ZH9 B;  1AWB A;  4P8B A;  3H4M A;  3OEN A;  3ZQJ A;  4RPO A;  1OQY A;  4B3S M;  4BBA A;  2I0C A;  2JUJ A;  4JWX A;  3NBX X;  3HFU A;  2HZK A;  3B7Q A;  3FKE A;  3GLI A;  3RE8 A;  1FBH A;  3BBR A;  1RYX A;  4GBV A;  5KO3 A;  5EQ8 A;  2NUV A;  5EQ7 A;  2VD2 A;  4NF8 B;  3PD9 A;  1B3G A;  4JVD A;  1L2C A;  1UQW A;  3I01 M;  4ZEC A;  2R4E A;  3GPY A;  3TDJ A;  1DCU A;  5AA2 B;  2ZNU A;  3K1J A;  4LY6 A;  3FXB A;  1QJM A;  2V3U A;  3MJ5 A;  1NKX A;  4G4O A;  1VEK A;  3DA1 A;  4H1X A;  3R6U A;  1FPJ A;  5DTB A;  1JVX A;  5EP3 A;  3CSB A;  2HKJ A;  4IJE A;  1P3Q Q;  1DSN A;  5ICQ A;  3U1O A;  1I69 A;  2Z8E A;  4PBQ A;  5CRY A;  2KDL A;  3G3J A;  4LF4 M;  3GPX A;  4AKI A;  1MDP 1;  4ESX A;  4PBH A;  1Q1K A;  2Q2E B;  4KFQ A;  4FAT A;  1P1W A;  1G0I A;  2NVU B;  3KBZ A;  1PB7 A;  2Y7P A;  3HJS A;  2ZMB A;  1NUY A;  1TH2 A;  4JI7 M;  1EYI A;  4X1D A;  3C9P A;  2XXI A;  1AMF A;  5AA2 D;  3D8B A;  4P47 A;  1LFG A;  4IY6 A;  4LQ2 A;  1OAI A;  4KLN A;  3D1R A;  1GL6 A;  3B6W A;  4PGP A;  1JP4 A;  1DPE A;  2F4V M;  3OO9 A;  2KA6 B;  1MXW A;  4BDR A;  2LVO C;  4EXK A;  1S50 A;  1QUS A;  3LCV B;  3EPE A;  4DBG B;  5FLX S;  1BTJ A;  3GRY A;  4XIG Q;  5I59 A;  4UN2 B;  2XXX A;  2DDK A;  2D7E A;  4LVQ A;  5I57 A;  3N6T A;  2BWB A;  1POY 1;  1L8Q A;  4LF5 M;  4KXP A;  4R2B A;  3QAX A;  5KQ8 A;  1QZE A;  4AW4 A;  2LTU A;  5JTY A;  2VD3 A;  1OQG A;  3TQS A;  4RXL A;  4F1V A;  4RK9 A;  2ONS A;  4N6K A;  2CUZ A;  2MJ5 B;  4U23 A;  1IY1 A;  5EXX A;  5FTK A;  3H4J A;  3CHG A;  4G4Q A;  4NE4 A;  3KP0 E;  4DXU A;  2XSZ D;  1OLC A;  2DWJ A;  4JSO A;  3ZKK A;  5IKB A;  2Y0T A;  2FOI C;  3KBR A;  3KFM A;  1G3I A;  1C1K A;  3UOR A;  4OAN A;  1BK4 A;  1RDX A;  4FED A;  4HTG A;  4YKJ A;  2C99 A;  5L8R F;  1M5C A;  4P56 A;  5KPR A;  1MS7 A;  4PF6 A;  2EUC A;  2ZAM A;  2WYK A;  2XXR A;  1URD A;  2XX9 A;  4GXS B;  3K1M A;  3GPU A;  3L25 A;  1FQE A;  5TP9 B;  2WSF F;  4BDO A;  1IN5 A;  1FBF A;  1LBB A;  1LGB C;  3GYY A;  3T9V A;  5EP4 A;  2XXQ A;  1HNW M;  1D0M A;  4I8O A;  1JW1 A;  5DYH A;  2OWZ A;  4GWZ A;  5B7D A;  2N35 A;  4KCC A;  1OFI A;  4OEV A;  2F3D A;  2FHY A;  4LJ8 A;  4QHT A;  3ZKL A;  1H3D A;  1B46 A;  1HJP A;  4B7F A;  3KSJ A;  3H3G A;  4ELR A;  1Q39 A;  3T1Y M;  1IXI A;  1FPD A;  1HSL A;  3U6M A;  2LVP C;  1TF0 B;  3L6H A;  5F24 A;  3GBA A;  5ELV A;  4F1I A;  3FV1 A;  2QS4 A;  1WDN A;  2KNV A;  3CI8 A;  2H25 A;  2XWI A;  5A5X A;  1NV2 A;  3T6P A;  3RPL A;  2H98 A;  1MXU A;  3FRI A;  2F5S A;  2F5N A;  3TQW A;  1CUK A;  1MQD A;  2OQ4 A;  1MQH A;  2RF1 A;  3LQR A;  5EQA A;  5EYG A;  3WHK A;  4LG2 A;  4GD5 A;  4HCW A;  3KVW A;  4R6K A;  2C9O A;  4QNR A;  2RCA A;  2QVR A;  3J7B A;  1EH3 A;  3QUF A;  2I0B A;  2XXV A;  1SW4 A;  1QUI A;  1YUB A;  4HL4 A;  1LBW A;  2VII A;  1VSO A;  1JR3 E;  1QAO A;  5BPV A;  3N6U A;  1ORY B;  2B65 A;  5EQ9 A;  2P1S A;  2DVZ A;  5GKN A;  4MLQ A;  4GHL A;  3PUV E;  3ZCB B;  4KOD A;  3SAW A;  4YZZ A;  2UXB M;  1AIP C;  2X49 A;  3KEI A;  4FIM A;  3FE3 A;  4F39 A;  1IXZ A;  5ESY A;  4NWC A;  1QZM A;  4GIZ A;  1Y3Q A;  2L2D A;  3Q8G A;  2JJK A;  3E4R A;  5IWA M;  3SET A;  3TWL A;  4ANR A;  1LEV A;  1N32 M;  3KOS A;  1PJS A;  4NQ8 A;  4QSD A;  1MH3 A;  2PFZ A;  3K9P A;  1NY6 A;  1MXZ A;  4YKK A;  4QOZ C;  4EQ7 A;  1G8P A;  3BIG A;  4ZZA A;  4LFC M;  4K3F A;  3I04 M;  1R4G A;  2I3W A;  3H03 A;  1IY2 A;  1IXR C;  2AHM A;  4D80 A;  3VVD A;  5I2K A;  4IO2 A;  4GHA A;  4XEQ A;  4JI1 M;  2F78 A;  4LON B;  3FUV A;  3JAM S;  8CAT A;  3A42 A;  4MB7 A;  1HQC A;  1URS A;  1G71 A;  4FE8 A;  2JP7 A;  3I4V A;  2DYX A;  1NV8 A;  1T3T A;  1LB8 A;  4OTE A;  3VXC A;  4PFU A;  4XBO A;  3VVE A;  3RPW A;  4FCT A;  3SES A;  1R2Z A;  2KHH A;  1FPK A;  3GP1 A;  1V34 A;  3MZ1 A;  4N15 A;  2Q2A A;  3EKI A;  4PFY A;  2JZ0 A;  1ELJ A;  1NO1 A;  5FHO A;  3K2D A;  4R7G A;  4F18 A;  1JQJ C;  3KGC A;  3I6V A;  4I81 A;  3K4U A;  2ALU A;  1FPL A;  3VKG A;  1GL7 A;  5H8F B;  2FIE A;  2XXP A;  5I56 B;  5H8H A;  1K3W A;  5CM6 A;  2C9C A;  5ITQ A;  2HWJ A;  4NAP A;  2WYP A;  1YXI A;  4H46 A;  4RY1 A;  2Q9T A;  3KC1 A;  1II5 A;  4YY3 M;  3MP6 A;  5CMK A;  2I58 A;  3NWL A;  4QHS A;  3U6C A;  3LSW A;  4LZ5 A;  5IRE B;  3ZSF A;  4BB9 A;  3CFZ A;  3V8X B;  4KO8 A;  5K2Y A;  1WHC A;  1US4 A;  3CVG A;  4LN5 A;  3FVN A;  2FS1 A;  3GPP A;  1ZBM A;  1JEU A;  4BDN A;  1XI6 A;  2HFB A;  1XC8 A;  3I4Y A;  1H76 A;  5HBC A;  2EJS A;  2G3Q A;  5F3W A;  1UTB A;  3SER A;  4KD5 A;  2KLF A;  2G29 A;  2RKO A;  4H5G A;  2XZF A;  3O2A A;  4P17 A;  1N7X A;  3TPA A;  4X04 A;  4O3A A;  2APL A;  3AOG A;  1FTA A;  5FHN A;  4I3E A;  1B58 A;  1XHB A;  3RTF B;  4N91 A;  5E6J A;  1D0L A;  1S7Y A;  4DV5 M;  2XH9 A;  1UM8 A;  3B6Q A;  1IBK M;  4GRK A;  1B2H A;  3HHX A;  4TUW A;  2ZXT A;  2ZM6 M;  3EIE A;  2THI A;  3LSL A;  1TT1 A;  3VVF A;  1MQJ A;  3FXU A;  2CP8 A;  3FJM A;  3HHY A;  3KP1 E;  2OBG A;  3IX1 A;  2Z8F A;  4IB2 A;  2P0S A;  1SW1 A;  4FW9 A;  2GNO A;  4OFJ A;  4LF7 M;  3SMS A;  1SBP A;  5TU0 A;  2B3F A;  4DV0 M;  3THG A;  2XX7 A;  1LBY A;  4L78 A;  2RC9 A;  3EF7 A;  2C5R A;  2LVA A;  5CI5 A;  4DCY A;  3EIH A;  3DEL B;  4G68 B;  2F34 A;  3PTY A;  1Y1Z A;  2HZL A;  5ET7 A;  4ELO A;  2X26 A;  3QYT A;  3K92 A;  3C3D A;  2NWJ A;  1JW4 A;  4EF2 A;  4FWH A;  3F92 A;  1FQF A;  4GWO A;  2DNA A;  3MVZ A;  2HXR A;  4GX6 A;  3CSG A;  1NNU C;  3MUQ A;  1LBV A;  4GF8 A;  4NXM M;  5I7I A;  1MPC A;  1R7R A;  4OVR A;  1N84 A;  3M3F A;  4DI4 B;  3TE6 A;  1NUX A;  2XFT A;  4ZED A;  4HXV A;  1IMD A;  2F5X A;  3KFU G;  4HCY A;  2DAG A;  3Q27 A;  3TZA A;  1DK4 A;  4ISU A;  2F5O A;  3KOT A;  2J5Y A;  4YB5 A;  4I62 A;  2CZI A;  3USD A;  3IG5 A;  2AL4 A;  3UMM A;  3HST A;  4GX3 A;  1IXC A;  4OEN A;  4WED A;  4MBP A;  1YLA A;  3IOW A;  2LVN C;  1JQF A;  3LSF B;  3OXN A;  4Z6Y A;  5IZ3 A;  3B7N A;  3W9W A;  4C1T A;  5TP9 A;  1B4H A;  5FTM A;  2H5Y A;  3WHL A;  4MLV A;  1PB8 A;  3S2V A;  4U1Z A;  2FIX A;  1Q02 A;  3H7M A;  4RNA A;  3BKI B;  4BLA A;  4B7H A;  3DP4 A;  2OOB A;  4PDG A;  4LZ8 A;  5IZ1 A;  1IXG A;  1A99 A;  4ZE8 A;  2E0S A;  3GO8 A;  4JI3 M;  2GH9 A;  5J16 A;  1MN3 A;  3LUY A;  2R44 A;  4DUY M;  2WZJ A;  2V3T A;  1B7U A;  1JET A;  1G4A E;  2CV0 A;  1LAF E;  2WEF A;  4Q0C A;  3U8Q A;  3GBB A;  3OSR A;  1FW0 A;  4PQJ A;  3SEX A;  2YLN A;  5FSW A;  1MU5 A;  1SYI A;  3NOH A;  2DE2 A;  1L5T A;  4YMB A;  2A5Y B;  5KCJ B;  4IBE A;  3OOA A;  3NBI A;  4PAI A;  1GVC A;  3EHS A;  5I84 A;  3SAV A;  1E9R A;  3GLF A;  2O69 A;  2MGW A;  3JZJ A;  4DR2 M;  3HN0 A;  5CMC A;  3UP9 A;  3UJN A;  2WBD A;  5CMB A;  4I8C A;  3RLF E;  3FUU A;  4MH5 A;  4MMP A;  2DE4 A;  4XKP A;  2D3I A;  1P1N A;  1P1U A;  2F3B A;  4G6Z A;  4EF1 A;  3O9P A;  4AS4 A;  3U6D A;  4X1B A;  2P5T A;  3E46 A;  1I94 M;  1TR8 A;  4NWD A;  3U6Q A;  3FVK A;  1ZMV A;  2REJ A;  3KJ7 A;  2PMS A;  1HNZ M;  3PPR A;  4UAB A;  2BJJ X;  3G3I A;  3T15 A;  1V33 A;  3FV2 A;  2M60 A;  4JI2 M;  4MHF A;  2R65 A;  2QVV A;  2XD2 A;  3VFD A;  2I4C A;  4M1V A;  2DZO B;  3IO6 A;  2L6O A;  1OQH A;  3C34 A;  2LHG A;  5BR8 M;  1C7Y A;  2R71 A;  4M0W A;  3O6I A;  2RCB A;  2K6B A;  1N7W A;  4YAH X;  4OA4 A;  1NUZ A;  3A3C A;  3R7X A;  1PDA A;  3SAS A;  4DR5 M;  3T9H B;  1XVY A;  4IBK A;  1XMO M;  1GAB A;  3L28 A;  1R2Y A;  4G68 C;  1GO5 A;  4F3P A;  3W15 C;  2R62 A;  4N4U A;  1XT8 A;  3UA8 A;  3FTF A;  1D0K A;  2F7A A;  1Z7N E;  1OVT A;  1KZ8 A;  1IBL M;  2CV1 A;  3SEY A;  2C98 A;  4B7G A;  1PJT A;  3GLH A;  3KS8 A;  1FPE A;  3K6U A;  1YPN A;  4FJP A;  2V1C A;  5LTC A;  2VQE M;  1N78 A;  4OVJ A;  1IZ1 A;  1AIV A;  2L7H A;  2PBW A;  5F1Q A;  3EHT A;  1O7T A;  1QVR A;  1XMQ M;  2OLB A;  4ONY A;  2J7O A;  3PPO A;  2KEB A;  3HX3 A;  1CNQ A;  1QW0 A;  3B8B A;  3TTN A;  3ZC7 B;  4EDP A;  4QFO A;  1VDW A;  2Z4R A;  1QUL A;  4WKM A;  1DO0 A;  1MQG A;  3LUZ A;  1Y8G A;  2WKY A;  4JXI A;  4U4S A;  3K01 A;  5I58 B;  1Z5C A;  4NF5 B;  5DW8 A;  4LFA M;  2RC7 A;  1RDY A;  3AXF A;  2HEU A;  3LQQ A;  2B4L A;  3HCQ A;  4G77 A;  3CF6 E;  3BBZ A;  1B5I A;  3PUZ E;  3ECR A;  3FUZ A;  2X4A A;  2L09 A;  3E9X A;  3TEP A;  2XHD A;  4NXN M;  1N33 M;  5TPA B;  2PX1 A;  2X7P A;  1RDZ A;  3W67 A;  2P3V A;  3FUX A;  5FHM A;  3E78 A;  5EP2 A;  4GX4 A;  5KCJ A;  3BFU A;  3JYR A;  1Z6T A;  1IFY A;  4DV4 M;  1Z5A A;  2QCU A;  5I58 A;  5DVJ A;  3HY5 A;  1FQB A;  4NF5 A;  2DWA A;  4P1E A;  2P3N A;  1TH3 A;  3SAT A;  3C36 A;  3THI A;  2DSF A;  3DFZ A;  4R2F A;  1TXF A;  5BUU A;  3IOV A;  2DEN A;  2XLJ A;  2NXO A;  3E9S A;  3KOY E;  1LBC A;  3B74 A;  2KRK A;  5A2Q S;  5EXS A;  4RNS A;  4BLC A;  1H45 A;  1VQ1 A;  2EKF A;  5C18 A;  2UXD M;  3MC2 A;  4GWY A;  2I48 A;  2PCR A;  4X62 M;  1IXS A;  1QUT A;  1WGL A;  3HWS A;  4RF0 A;  2M8C A;  1D9V A;  4U21 A;  1YZ0 A;  4LZJ A;  3LCU A;  2O01 F;  1S3S A;  4PE3 A;  4TLM B;  1D3K A;  1A54 A;  1N34 M;  3LR1 A;  4U2R A;  3J27 B;  4GWW A;  2DAE A;  2XWK A;  2HHM A;  2Y20 A;  2MR9 A;  4OWD A;  5L8D A;  1SXJ A;  3W0L B;  3H6V A;  3Q26 A;  3LSX A;  2DAI A;  4LUB A;  5I59 B;  2VPN A;  1G59 A;  2WX9 A;  2ANJ A;  4MM3 B;  2QBY A;  5H8N A;  4RK2 A;  4FCV A;  4JI8 M;  1JR3 A;  4GXA A;  2H4I A;  1B3H A;  4QBA A;  4FVM A;  4X66 M;  3WAF A;  3G3F A;  3ROJ A;  1KFV A;  4H45 A;  4HEO A;  4IY5 A;  3AFH A;  1FTK A;  4Q7J A;  4MAG A;  1EZ9 A;  2VQF M;  1DGB A;  1NV1 A;  2QEN A;  1O63 A;  4GC9 A;  5H8Q A;  4R9G A;  3DZD A;  1HSE A;  1KYI A;  1LCF A;  3TTR A;  2V6Z M;  4D82 A;  2ERC A;  3IL1 B;  3QK6 A;  4PET A;  3F11 A;  4NMY A;  1JNF A;  2VGQ A;  3L26 A;  3CTW B;  4YMA A;  1D9Y A;  4PCZ A;  2ZZW A;  4NRW A;  2BNK A;  1NV9 A;  1IM2 A;  3IB1 A;  1YTV A;  2KNA A;  3ILK A;  1SQY A;  4C0R A;  2OOA A;  4OES A;  1EYJ A;  3TQL A;  3C33 A;  3SHG B;  4JBZ A;  4LA9 A;  2ZYK A;  4UA8 A;  1XS5 A;  3TCF A;  4R9F A;  3BIH A;  1MM7 A;  2DWI A;  2ONR A;  4H8I A;  5IAI A;  3CR9 A;  1SI0 A;  4AS5 A;  4LJ4 A;  4MGH A;  3TCG A;  1UIU A;  4DUZ M;  3OEK A;  3I51 A;  3V5A A;  3FTD A;  4XFE A;  1NNT A;  1HR0 M;  4JV5 M;  4N8G A;  3UZU A;  3RN8 A;  4FBP A;  1OIP A;  4IBJ A;  2H9B A;  4MGK E;  1B0L A;  2A5S A;  5KZT A;  1O64 A;  2KNZ A;  1YSY A;  4R73 A;  3OSQ A;  3T1H M;  1MH4 A;  2YPN A;  3UN6 A;  5ITX A;  1P1O A;  1LCT A;  1ZV1 A;  2PFY A;  1SI1 A;  2XSZ A;  3TWM A;  2L7I A;  4O3B A;  1NNF A;  2FBP A;  2AL5 A;  3JR4 A;  1SW2 A;  5KPZ A;  2HXW A;  3RPL B;  3LMM A;  4X48 A;  2PT1 A;  3MYU A;  1Q3B A;  2P2A A;  3TKD A;  4CHT B;  3T93 B;  2FFJ A;  1Y20 A;  3T9X B;  5H8H B;  4OYV A;  1G41 A;  3GLI E;  4KQP A;  2BJI A;  4POX A;  1T0K A;  1MXV A;  2XWO A;  3H6U A;  5AE4 A;  4PFR A;  4F3G A;  1PBP A;  2CZL A;  4Y28 F;  4GL0 A;  2DXI A;  5AA2 A;  4N07 A;  4LAT A;  1QQW A;  5FTL A;  3TTL A;  3UGW A;  3LVV A;  5KDT B;  4X65 M;  5DEX A;  3FTE A;  4P1L A;  1XWI A;  2FE8 A;  1NUW A;  2QMW A;  3PPQ A;  5IZZ A;  5EYF A;  1Z59 A;  4L17 A;  4GH9 A;  3CGW A;  4M9S A;  4NN3 A;  4CGY B;  3TUS A;  5EJC A;  4POW A;  3I3V A;  4R6Y A;  2DXY A;  2Z3X A;  4GEW A;  4PD2 A;  2QBY B;  1XVX A;  4MGY E;  3UIF A;  2ZNS A;  1B52 A;  5EHS A;  5L9S A;  3O66 A;  2R0I A;  4GFR A;  1EFU B;  4DV3 M;  4QFP A;  5DEX B;  2DAM A;  1QYR A;  3KOX E;  1TFA A;  1YYZ A;  2OX3 A;  1USY E;  2YR0 A;  4QOS A;  1NNP A;  2Z8Y M;  2GRV A;  3TYH A;  2F6P A;  2RGO A;  4PT5 A;  2O25 A;  3HZJ A;  2EO2 A;  4KYS A;  1Y4C A;  2I4B A;  5FBP A;  2RIN A;  3RQT A;  3HJQ A;  2JY5 A;  1VFE A;  2QS3 A;  2L4E A;  2UUA M;  2KRU A;  1WXQ A;  2VF8 A;  1E9S A;  4JI4 M;  2Q89 A;  1A7L A;  1PBQ A;  3IB2 A;  3U93 A;  5AA4 B;  4N17 A;  4MGI E;  4ZEB A;  2IA4 A;  4PFT A;  5ET8 A;  2H5X A;  5JTY B;  1Y1M A;  2Y84 A;  1Q9D A;  4RPN A;  1NNK A;  3FYC A;  3SDF A;  1MY2 A;  2I6E A;  3U65 A;  1L2D A;  1UFZ A;  2G93 A;  3IAZ A;  4QFK A;  1J5E M;  4OHN A;  3VDF A;  4DV7 M;  2LH0 A;  1NMU A;  1L1Z A;  1NFT A;  4BDM A;  3SBJ A;  4KCD A;  3H6T A;  2QQ8 A;  4C1U A;  3D8L A;  2ZZX A;  4II7 A;  4LP2 B;  4IO3 A;  1NV5 A;  2ZZV A;  3HHZ A;  4OEU A;  1K82 A;  5H8S A;  1P1Q A;  2V4C A;  4ZDM A;  5IM2 A;  1W5T A;  1YCJ A;  2G5G X;  3RT6 B;  5ET5 A;  4I40 A;  1GV8 A;  2K47 A;  4IBB A;  1EIJ A;  2O1M A;  3TEL A;  3HGI A;  4L4U A;  2DP8 A;  1XC1 A;  3UK6 A;  1IMA A;  3MWB A;  2Z23 A;  1EZO A;  1PEB A;  1M5D A;  2E5L M;  1PJI A;  3W0F A;  1N36 M;  1L2B A;  2O5R A;  4AQ4 A;  2OCU A;  2F5Q A;  4OER A;  3PD8 A;  1BKA A;  1IIT A;  4P0G A;  3QWL A;  1QUJ A;  3K1N A;  2ZYM A;  3Q29 A;  4X9T A;  1IQP A;  5LOM A;  1DTZ A;  3O6H A;  5EQT A;  4QSE A;  5JEI A;  1XXH E;  3AKZ A;  2Y7R A;  4MJO A;  4RA1 A;  4CIZ A;  1FBC A;  4H0W A;  4MNI A;  1NH8 A;  4KYE A;  2AIX A;  4H67 A;  4PDD A;  2R18 A;  1B5H A;  3L27 A;  4NF4 A;  1MY3 A;  1D9Q A;  2QS2 A;  1JVY A;  3KXE C;  3TFL A;  2ZAO A;  3PUX E;  1S9T A;  3C9H A;  1DPP A;  3E79 A;  1T6O A;  4M9Z A;  1HSJ A;  7CAT A;  4NF8 A;  3B7Z A;  4DV6 M;  3IFA A;  4PC9 A;  1KA1 A;  1URG A;  2F8D A;  1FTO A;  2VOZ A;  1ZU0 A;  3I5O A;  3M0E A;  4WXJ A;  3AOE C;  3VDU A;  2ZYN A;  5ITY A;  3OO8 A;  1OMP A;  1VEG A;  3VKH A;  4NGU A;  3OO7 A;  4XKQ A;  4F3S A;  3FAT A;  2QS1 A;  3U6O A;  2MRO B;  3SYK A;  5FTH A;  4QHQ A;  3BOS A;  3VXB A;  4F2O A;  3HU2 A;  5JK4 A;  1OAO C;  4JI6 M;  1UTH A;  3JV9 A;  4O7I A;  3IR1 A;  2LXE A;  3HKP A;  4DLD A;  5A5L A;  4AQY M;  1WJ7 A;  3G3K A;  4GBW A;  1TWY A;  2QMX A;  3ONM A;  4AZF A;  2DWZ B;  4GC5 A;  4MF3 A;  2CV2 A;  4IO5 A;  3J7A S;  3PU5 A;  1NJG A;  3KS4 A;  4R74 A;  1AOV A;  1F9B A;  1NV0 A;  5I3S A;  1N3W A;  5I5P A;  1NHW C;  4XKR A;  1VFD A;  3HV1 A;  2FNC A;  1QUK A;  1VE4 A;  2Z4S A;  4P11 A;  3PMW A;  4LZ7 A;  2JWS A;  2XEP A;  4KYD A;  1Q3C A;  2FH0 A;  5I2K B;  1AUA A;  4FCW A;  3TCH A;  1FTJ A;  1Y9U A;  4LF8 M;  4LCB A;  2XXU A;  3K0V A;  3Q28 A;  3SMP A;  5I57 B;  1E32 A;  4FWG A;  4P3L A;  2HQ0 A;  4U1O A;  2XFS A;  4WUR A;  3LV0 A;  3LC8 A;  3T66 A;  1J1N A;  1Y3P A;  3HHF A;  1B05 A;  3UK4 A;  1FQA A;  2WSE F;  3MVX A;  4G61 A;  4THI A;  4OW0 A;  1WOD A;  1DV0 A;  1FQC A;  1FJ9 A;  3R26 A;  4NOO B;  4X64 M;  4IIW A;  2UXA A;  3CF0 A;  4ITQ A;  2BJV A;  4F1U A;  3V76 A;  2Q8J A;  3T9U A;  1E94 E;  5L9O A;  1IQ7 A;  4G2Z A;  5I56 A;  2ESN A;  3FXQ A;  1K9Y A;  4QNM A;  2YQZ A;  1M5F A;  4G8N A;  4GKK M;  1N76 A;  3VLV A;  1LTM A;  2Y7W A;  3SHF A;  3A3U A;  1BIY A;  3IK6 B;  3M7G A;  1MJG M;  3KJT A;  3KN8 A;  3OMB A;  1FTM A;  4XTC Q;  3C4M A;  3CF2 A;  3TTK A;  4ZEK A;  2Q74 A;  3FAS A;  3K6X A;  5CBS A;  3G3H A;  2FNA A;  1IIW A;  2KR0 A;  5TPA A;  4JI5 M;  4JXJ A;  3VK7 A;  3IJO B;  4G8M A;  1FJG M;  4AI6 A;  1B1H A;  1ZLQ A;  1UTB B;  3QSL A;  1N04 A;  1SD3 A;  4O8M A;  3Q8X A;  2DQV A;  4IJF A;  3LVW A;  3SZP A;  4AB5 A;  1A5T A;  3FJ7 A;  5T3J A;  4LFB M;  1IN8 A;  2EA0 A;  2BJW A;  2QZ4 A;  2F5P A;  4JN6 A;  2D7H A;  3RUM A;  5DYG A;  1LAX A;  5ICT A;  4R6H A;  1VDD A;  2JY6 B;  1FRP A;  1P99 A;  4ZEF A;  3B6T A;  2PT2 A;  3AJI B;  3G7W A;  5CBR A;  3QUJ A;  1HT2 E;  4OVS A;  3C31 A;  1NJF A;  4NL4 H;  1FBP A;  3GZG A;  4IGR A;  4EQB A;  3PXG A;  2Q88 A;  4LGM A;  2ZNT A;  2KZS A;  3S4U A;  5K2X A;  2DZL A;  2Y5K A;  3P7I A;  4PF8 A;  1MPD A;  1PRB A;  3J81 S;  4GKJ M;  1CE2 A;  4QF9 A;  4PTK A;  3HU1 A;  2FVZ A;  3S9E A;  3MW0 A;  1QVS A;  1X37 A;  2ZBK B;  3SYL A;  3BFT A;  4DDD A;  2CEY A;  2QFL A;  3RFW A;  4ESW A;  3HJ8 A;  3FGS A;  5M2V A;  2CHQ A;  3AOE A;  1MM6 A;  1NHG C;  4G68 A;  3U60 B;  4A3V B;  2B3T A;  1USY H;  5AA3 A;  4EIW A;  4YHH M;  1R1N A;  2OWS A;  4DR3 M;  4OU7 A;  5H8N B;  1OJL A;  4O94 A;  3M8U A;  1EYK A;  1SXJ D;  1WGN A;  4H5F A;  2LHC A;  1SVX B;  2O51 A;  4M9X A;  1QGX A;  2XD3 A;  4OVQ A;  1QAM A;  4YB7 A;  1AH5 A;  2XXT A;  2JA2 A;  3U5Z B;  4JSD A;  2K0B X;  5H8Q B;  2DXR A;  3C58 A;  1LB9 A;  5CMM A;  1FNN A;  4MX6 A;  3ZS6 A;  2UVH A;  3H4Z A;  1GTK A;  1I4W A;  3U61 A;  4NSR A;  3SEU A;  4HE1 A;  2A5T B;  2Y5L A;  2PYY A;  4ND9 A;  4U4X A;  1J7K A;  1ZMW A;  1NV6 A;  3GQ3 A;  4G8H A;  2R45 A;  1EZP A;  2QRY A;  3C3E A;  5L9M A;  3FTC A;  4ECF A;  3MAM A;  1R5L A;  4B3M M;  2ABH A;  3PPP A;  1XOC A;  5AA1 A;  4XKN A;  2DS9 A;  2DZN B;  4KT0 F;  5CC2 A;  1OFH A;  1SDX A;  5IZ3 B;  3VK8 A;  3QXM A;  1NY5 A;  2CRU A;  3TL4 X;  2RKM A;  3U94 A;  2I49 A;  2K9D A;  1FJ6 A;  3N26 A;  4TOZ A;  3MVY A;  3O97 A;  3R8F A;  1VG5 A;  1KSF X;  3VLU A;  3T0J A;  3K9O A;  2YFQ A;  3CFL A;  3PMX A;  4KHZ E;  1SYH A;  3QIM A;  5FTJ A;  1GVN A;  4RKU F;  2F36 A;  1NH7 A;  1RYO A;  1IXS B;  4XK8 F;  1R9L A;  3T96 B;  2QL3 A;  5DT6 A;  1IUD A;  3KG2 A;  4LZZ A;  3DP6 A;  3A29 A;  2CE7 A;  2ZTC A;  3VLW A;  4WEP A;  2GHB A;  3PFI A;  1R6Z A;  2XWV A;  2HAK A;  2HCA A;  1QAN A;  2IEE A;  4NHB A;  4GQO A;  5JI2 E;  1ZKB A;  1FPG A;  4PGN A;  1Y3N A;  2YJP A;  4L16 A;  1ZTY A;  1F4I A;  4CJ6 A;  2O7I A;  4RF1 A;  5HPQ A;  2YNM D;  1MXX A;  2HL7 A;  4JB7 A;  4TLL B;  2XXK A;  1DGH B;  2VF7 A;  3IG8 A;  2XF3 A;  4I5S A;  2D7G A;  4RJZ A;  1DMB A;  2QSX A;  1XNQ M;  3PV0 E;  1FPI A;  2L5V A;  3MP8 A;  3D4G A;  3K2L A;  5KDT A;  2VPO A;  1TDZ A;  1B9J A;  1QAQ A;  2UYF A;  3K1P A;  2WSC F;  3FD9 A;  3K8Z A;  2NQ8 C;  2Y21 A;  4OX9 M;  3IB0 A;  3PUY E;  1INP A;  4OET A;  4P16 A;  1H43 A;  4OVT A;  3DM0 A;  2DWH A;  4NRV A;  1EU8 A;  4HLQ A;  3FUT A;  5FTN A;  1FQD A;  3U60 A;  3GRU A;  3OTO M;  2HHH M;  3MZ9 A;  3C32 A;  3DOA A;  1US5 A;  1PJJ A;  2O6A A;  3CG3 A;  1VEJ A;  4YKP A;  3W68 A;  4DV1 M;  4WP2 A;  2DHR A;  3RT8 A;  3SFZ A;  2FYI A;  4YB6 A;  2XXH A;  3D4C A;  4XXU A;  3M3L A;  1XHY A;  3QYE A;  4N6D A;  1IEJ A;  2REG A;  4OVZ A;  4LRS A;  2FA7 A;  3IJX B;  2BWE A;  1HNX M;  3HHW A;  4F19 A;  5EXP A;  2V3Q A;  3GLG A;  4DE8 A;  3L6G A;  2W7Y A;  2DVC A;  1LLS A;  2OZZ A;  3LBS A;  3LW5 F;  1K3X A;  2QSF X;  1B3F A;  3IOT A;  1GGG A;  3OO6 A;  2RGH A;  2A5T A;  4NED A;  1GJT A;  2DHY A;  1MX0 A;  1NSF A;  2QNJ A;  2V25 A;  5DVI A;  1B7Z A;  1B3L A;  2XGN A;  1TFD A;  1GLN A;  2Q2C A;  3SKP A;  3MBP A;  4LQ5 A;  2R4J A;  3FVO A;  1ANF A;  3CG1 A;  4GL8 A;  2CFO A;  4OFO A;  3WAE A;  3RY3 A;  4KI0 E;  2E1S A;  1FTL A;  4M0D A;  4NF6 A;  4NF4 B;  2LWX A;  3FVG A;  3MST A;  3DLN A;  3H6W A;  3K00 A;  4FD2 A;  4B08 A;  3A98 B;  1NI9 A;  4PDH A;  3U6L A;  3QMF A;  2G8L A;  2PVU A;  1L1T A;  1LBZ A;  4ZPX A;  1IN4 A;  3KW6 A;  3IOU A;  5IGA A;  3E21 A;  4EQ9 A;  4ZE9 A;  3PNY A;  2DWM A;  2CEX A;  2I7P A;  1ZIU A;  3UGJ A;  1DTG A;  4QFN A;  4N8Y A;  4R75 A;  3RGS A;  4MH0 E;  3V83 A;  4GIT A;  4JDF A;  4L8R C;  4Z0I A;  4DXC A;  4I1D A;  1M5B A;  4GWU A;  2O84 X;  4M4G A;  4AG6 A;  2KXE A;  3B89 A;  5IZ7 D;  3SEW A;  4NF6 B;  4DR6 M;  2DVW B;  4PE5 B;  1LFI A;  1OIB A;  2F6G A;  4KPT A;  1N0T A;  3HPI A;  4ZEI A;  3E3K A;  5ITR A;  3CFX A;  4IBD A;  1A8E A;  1I6A A;  2VDB B;  3FYD A;  1IN7 A;  3MJN A;  2LAO A;  1KWH A;  4QXD A;  1OVB A;  4ELQ A;  2AYS A;  3ISP A;  2H1R A;  2QJE A;  2DOJ A;  4L15 A;  1SXJ E;  1MRP A;  1T43 A;  4XGI A;  3FZV A;  4JVI A;  4DI3 D;  3PPN A;  4OMB A;  2F97 A;  3PNV A;  4IBI A;  2I7N A;  2HAV A;  3N5L A;  3SAU A;  1PGY A;  4W5W A;  1LFH A;  2ZYO A;  1QDT A;  3KDS E;  3GLF B;  1MXY A;  3EHU A;  2R6G E;  4O7M A;  4R72 A;  2DE3 A;  4Z7E A;  2UXC M;  4IGT A;  1R9Q A;  4S12 A;  4NG7 A;  2OJT A;  2CHG A;  4N13 A;  1NV3 A;  3M3K A;  4DR1 M;  4IBC A;  3PGF A;  1I6Q A;  2JZ1 A;  1OKS A;  4OXV A;  5ITU A;  1D2N A;  1BP5 A;  4FEC A;  4DXB A;  3VV5 A;  2V84 A;  4LJ9 A;  2XZU A;  1D4N A;  4OVZ B;  4Q8R A;  1GJS A;  1LV7 A;  1TTE A;  1IBM M;  2CEA A;  4O3C A;  5EHM A;  3IFC A;  3K6V A;  2DWN A;  4F31 B;  3QYB A;  4MEV A;  2UVI A;  2RRU A;  2CZK A;  4KHP M;  3VDP A;  4NSO B;  2VT5 A;  4DR4 M;  1NV4 A;  4LF6 M;  2DKL A;  4P0I A;  3MPL A;  1VDL A;  2CZH A;  4H6D A;  2B3B A;  2XXW A;  1MY0 A;  3FUW A;  4PFW A;  3U6E A;  4NX1 A;  3H06 B;  5ITX E;  4F22 A;  4LRT A;  2UUB M;  1MQI A;  3J2P B;  1DGF A;  1PB9 A;  3B50 A;  4FEB A;  2V1U A;  3TOD A;  1V92 A;  1YE9 A;  3G3G A;  3MQ9 A;  4GOT A;  2MH8 A;  4B3R M;  3T1B A;  2X7Q A;  2F7C A;  2GQF A;  2CWB A;  4AG5 A;  3GQ4 A;  5J1D A;  2D21 A;  2B4M A;  4N81 A;  1K9Z A;  3T38 A;  3QAU A;  3FD3 A;  4ZS9 A;  4IBG A;  4MFI A;  2X8A A;  4FOR A;  1N77 A;  1GKI A;  3DP8 A;  3B7D A;  1JW5 A;  2OWT A;  1M5E A;  2H99 A;  3S9M C;  2EKK A;  1LBX A;  2CHV A;  1FPF A;  4HE0 A;  4JWY A;  4JVC A;  3O28 A;  4OZ9 A;  1B7H A;  4E0X A;  4NC6 A;  5ITP A;  3AL0 C;  4F3B A;  5IT9 S;  3IEC A;  4G4P A;  1RU3 A;  3S9N C;  5DYI A;  3IOR A;  2V93 A;  4DR7 M;  4MNC A;  5DVF A;  3RGY A;  3U6P A;  1IME A;  3OEL A;  4RYA A;  1IMF A;  4R71 A;  1QKB A;  4DZ1 A;  4PP0 A;  1HT1 E;  1DBZ A;  3O29 A;  1SXJ B;  4JI0 M;  1B4Z A;  4HW8 A;  1SPI A;  2Y7K A;  5B70 A;  2QP9 X;  1TDH A;  5KQD A;  1ZMU A;  3T22 A;  3TMG A;  2QPQ A;  4PFI A;  1W5S A;  3SAR A;  1I6B A;  3MZB A;  3W9V A;  4GWS A;  1PC3 A;  3GLF E;  2R8T A;  1B5J A;  3KZG A;  5EP1 A;  2ONK E;  1LST A;  3PVS A;  2LNH C;  4G4R A;  3K02 A;  3L2A A;  3VLF B;  3J80 S;  2Y7I A;  4U22 A;  5C1B A;  1SG9 A;  2LBC A;  3ILT B;  5A5X B;  2J7N A;  1MY1 A;  4LJ7 A;  1XB2 B;  1IMC A;  4YIC A;  3GLB A;  3TTM A;  3U6S A;  1H44 A;  4MCO A;  1DOT A;  3OEM A;  5E26 A;  3C35 A;  3MHV C;  1R6B X;  5DNY A;  1JB0 F;  1DO2 A;  2Z8D A;  4OQO A;  1EE8 A;  5I2N A;  2ZTD A;  3U92 A;  4AKH A;  1FPB A;  4DCX A;  4DIG A;  4ELP A;  4BDL A;  2CMO A;  4L6V 6;  3U5Z A;  4Q5T A;  4YU0 A;  3KOW E;  3L29 A;  4H65 A;  4FAJ A;  2HCB A;  1POT A;  2O7U A;  4OVP A;  1NV7 A;  4NTL A;  1SW5 A;  3KC0 A;  2C96 A;  1IXH A;  3HU3 A;  4CIS A;  1FBE A;  4IR8 A;  1B0H A;  3U61 B;  5EYH A;  1JR3 D;  3EQ1 A;  1FSA A;  4GWX A;  1IMB A;  4I4L A;  1TGU A;  3GLG E;  4ZZE A;  3ILU B;  2OK2 A;  4HE2 A;  2WBB A;  1SXJ C;  1IN6 A;  1XXH B;  2QPA A;  2QHO B;  2HAU A;  3SEV A;  5HM4 B;  5I2N B;  4LJA A;  4IO7 A;  1YAE A;  2L4F A;  4PFB A;  3KSX A;  2GHA A;  4MNP A;  2Y0Q A;  4QRZ A;  2D5W A;  4PCD A;  4KR5 A;  3IHP A;  3KN7 A;  4UAC A;  3TPZ A;  4FWD A;  3GRV A;  3HHG A;  2Z22 A;  3MK6 A;  4HS7 A;  4GIP A;  1MDQ A;  1N3X A;  1ZQ9 A;  4BDQ A;  4P9K A;  2VP1 A;  1RKM A;  3S9L C;  1AL3 A;  1DGG A;  4D81 A;  1B3E A;  4AKG A;  4AB6 A;  4G4N A;  3RTW B;  5LMN M;  1XXH A;  4REZ A;  4F1Y A;  1NNJ A;  4QSC A;  2MKZ A;  3GRR A;  2R46 A;  4LGY A;  1WIV A;  3U72 A;  2KZU A;  4G3O A;  1MY4 A;  2NOO A;  3KN3 A;  2XXY A;  4IO6 A;  4H8J A;  2W82 A;  2R6F A;  1WVJ A;  2F7B A;  2JXN A;  4QFL A;  1J09 A;  4LJ5 A;  2ZAN A;  3IO4 A;  2DI0 A;  2OO9 A;  1PM5 A;  2VHA A;  3RYD A;  4WW0 A;  3ODB A;  4JWO A;  2Q8M A;  1A8F A;  1FCK A;  5DFL A;  3GLI B;  1BVS A;  4TQU Q;  4XF5 A;  1Y4T A;  2F35 A;  5H8F A; 
#chains in the Genus database with same CATH homology
 2XX8 A;  4PDI A;  2M5Z A;  2I3V A;  1DGH A;  1ATG A;  3VE1 B;  1CB6 A;  1A55 A;  4IBF A;  3VFJ A;  1JEV A;  2O1L A;  3FIR A;  5BWJ A;  1B40 A;  4LJ6 A;  1B51 A;  4N6P A;  3Q25 A;  1VR5 A;  3RNN A;  5F7V A;  5ISU A;  1B32 A;  3GQ5 A;  4E0W A;  2UU9 M;  4EUO A;  3HO7 A;  1ZAE A;  4K0K M;  3RGP A;  1B1X A;  2UYE A;  4F2Q A;  3KOZ E;  2UUC M;  3FJG A;  1MPB A;  4YKI A;  3N94 A;  3AV0 A;  2Z7J A;  3PUW E;  5H37 D;  3MPK A;  1B6H A;  1MG1 A;  1LAG E;  1Q35 A;  2UVG A;  4LF9 M;  3O6G A;  3A45 A;  3K6W A;  4DV2 M;  4GLI A;  5EXT A;  2O68 A;  4GVO A;  4Z8X A;  1GR2 A;  5AA4 A;  3GXA A;  5ITT A;  2DWL A;  1NVM A;  1ZJL A;  3E13 X;  1UIV A;  4Q30 B;  3TAJ A;  5ITO A;  1H6U A;  3FXR A;  3GLG B;  3M6A A;  2RC8 A;  3EN3 A;  3CRB A;  1UTH B;  2OPF A;  5JI3 E;  1QKA A;  1OLA A;  1IY0 A;  1Z5B A;  1A40 A;  1Z7M E;  4GRI A;  4JYA M;  3CIJ A;  2KW0 A;  2UVJ A;  4IO4 A;  4GMQ A;  4OFL A;  3JR5 A;  1XNR M;  3MVW A;  1BLF A;  3MP1 A;  1LAH E;  4I9D A;  3TWK A;  2GFE A;  3SC3 A;  4B3T M;  3R9X B;  3V89 B;  2R9J A;  5LMU M;  5FTI A;  3OD7 A;  1N75 A;  3GLH B;  3A09 A;  3PMV A;  4R3D A;  1NL5 A;  4MGZ E;  4F29 A;  1TH4 A;  1HQY E;  3B9P A;  3A46 A;  4EXL A;  1ZMG A;  5KPT A;  3ZH9 B;  3H4M A;  3OEN A;  4RPO A;  4B3S M;  4BBA A;  2I0C A;  4JWX A;  2HZK A;  3FKE A;  3GLI A;  3RE8 A;  3BBR A;  1RYX A;  5KO3 A;  2NUV A;  2VD2 A;  4NF8 B;  3PD9 A;  1B3G A;  1L2C A;  1UQW A;  4ZEC A;  2R4E A;  3GPY A;  3TDJ A;  5AA2 B;  2ZNU A;  3K1J A;  4LY6 A;  1QJM A;  2V3U A;  3MJ5 A;  1NKX A;  4G4O A;  4H1X A;  3DA1 A;  3R6U A;  5DTB A;  1JVX A;  5EP3 A;  3CSB A;  2HKJ A;  4IJE A;  5ICQ A;  1DSN A;  3U1O A;  1I69 A;  2Z8E A;  5CRY A;  3G3J A;  4LF4 M;  3GPX A;  4AKI A;  1MDP 1;  4ESX A;  1Q1K A;  2Q2E B;  4KFQ A;  4FAT A;  1P1W A;  2NVU B;  1PB7 A;  2Y7P A;  3HJS A;  2ZMB A;  1TH2 A;  4JI7 M;  4X1D A;  2XXI A;  1AMF A;  5AA2 D;  3D8B A;  1LFG A;  4IY6 A;  4LQ2 A;  4KLN A;  1GL6 A;  3B6W A;  1DPE A;  2F4V M;  3OO9 A;  2KA6 B;  1MXW A;  4BDR A;  4EXK A;  1S50 A;  3EPE A;  5FLX S;  1BTJ A;  3GRY A;  4XIG Q;  5I59 A;  2XXX A;  2D7E A;  4LVQ A;  5I57 A;  3N6T A;  1POY 1;  1L8Q A;  4LF5 M;  4R2B A;  3QAX A;  5KQ8 A;  4AW4 A;  5JTY A;  2VD3 A;  1OQG A;  3TQS A;  4RXL A;  4F1V A;  4RK9 A;  2ONS A;  2CUZ A;  4U23 A;  1IY1 A;  5EXX A;  5FTK A;  4G4Q A;  4NE4 A;  3KP0 E;  4DXU A;  2XSZ D;  1OLC A;  2DWJ A;  4JSO A;  3ZKK A;  5IKB A;  2Y0T A;  2FOI C;  3KBR A;  3KFM A;  1G3I A;  1C1K A;  3UOR A;  4FED A;  4HTG A;  4YKJ A;  2C99 A;  1M5C A;  5KPR A;  1MS7 A;  2EUC A;  2ZAM A;  2XXR A;  1URD A;  2XX9 A;  4GXS B;  3K1M A;  3GPU A;  3L25 A;  1FQE A;  5TP9 B;  4BDO A;  1IN5 A;  1LBB A;  1LGB C;  3T9V A;  5EP4 A;  2XXQ A;  1HNW M;  1JW1 A;  4I8O A;  5DYH A;  5B7D A;  4KCC A;  1OFI A;  4OEV A;  4LJ8 A;  4QHT A;  3ZKL A;  1H3D A;  1B46 A;  4B7F A;  3KSJ A;  3H3G A;  4ELR A;  1Q39 A;  3T1Y M;  1IXI A;  1HSL A;  3U6M A;  3L6H A;  3GBA A;  5ELV A;  3FV1 A;  2QS4 A;  1WDN A;  3CI8 A;  2H25 A;  5A5X A;  2H98 A;  1MXU A;  2F5S A;  2F5N A;  3TQW A;  1MQD A;  2OQ4 A;  1MQH A;  2RF1 A;  3LQR A;  3WHK A;  4LG2 A;  4GD5 A;  4HCW A;  3KVW A;  4R6K A;  2C9O A;  4QNR A;  2RCA A;  3J7B A;  1EH3 A;  3QUF A;  2I0B A;  2XXV A;  1SW4 A;  1QUI A;  1YUB A;  4HL4 A;  2VII A;  1VSO A;  1QAO A;  5BPV A;  3N6U A;  1ORY B;  2B65 A;  2P1S A;  2DVZ A;  5GKN A;  4MLQ A;  4GHL A;  3PUV E;  3ZCB B;  4KOD A;  3SAW A;  4YZZ A;  2UXB M;  2X49 A;  3KEI A;  4FIM A;  4F39 A;  1IXZ A;  4NWC A;  1QZM A;  4GIZ A;  1Y3Q A;  3E4R A;  5IWA M;  3SET A;  3TWL A;  3KOS A;  1N32 M;  4QSD A;  1MH3 A;  1NY6 A;  1MXZ A;  4YKK A;  4QOZ C;  4EQ7 A;  1G8P A;  4ZZA A;  4LFC M;  4K3F A;  2I3W A;  3H03 A;  1IY2 A;  1IXR C;  2AHM A;  4D80 A;  3VVD A;  5I2K A;  4IO2 A;  4GHA A;  4JI1 M;  2F78 A;  4LON B;  3FUV A;  3JAM S;  8CAT A;  3A42 A;  4MB7 A;  1HQC A;  1URS A;  4FE8 A;  3I4V A;  2DYX A;  1T3T A;  1LB8 A;  4OTE A;  3VXC A;  4PFU A;  4XBO A;  3VVE A;  3RPW A;  4FCT A;  3SES A;  1R2Z A;  3GP1 A;  3MZ1 A;  2Q2A A;  4PFY A;  1ELJ A;  5FHO A;  3K2D A;  4R7G A;  4F18 A;  1JQJ C;  3KGC A;  3I6V A;  4I81 A;  3K4U A;  2ALU A;  3VKG A;  1GL7 A;  5H8F B;  2XXP A;  5I56 B;  5H8H A;  1K3W A;  5CM6 A;  2C9C A;  5ITQ A;  4RY1 A;  2Q9T A;  1II5 A;  4YY3 M;  3MP6 A;  5CMK A;  2I58 A;  3NWL A;  4QHS A;  3U6C A;  3LSW A;  4LZ5 A;  5IRE B;  3ZSF A;  4BB9 A;  3CFZ A;  3V8X B;  4KO8 A;  5K2Y A;  1US4 A;  3CVG A;  3FVN A;  3GPP A;  1ZBM A;  1JEU A;  4BDN A;  2HFB A;  1XC8 A;  3I4Y A;  1H76 A;  5HBC A;  5F3W A;  1UTB A;  3SER A;  4KD5 A;  2KLF A;  2G29 A;  2RKO A;  4H5G A;  2XZF A;  3O2A A;  1N7X A;  3TPA A;  4O3A A;  3AOG A;  5FHN A;  1B58 A;  1XHB A;  3RTF B;  5E6J A;  1S7Y A;  4DV5 M;  2XH9 A;  1UM8 A;  3B6Q A;  1IBK M;  4GRK A;  1B2H A;  3HHX A;  4TUW A;  2ZXT A;  2ZM6 M;  3EIE A;  2THI A;  3LSL A;  1TT1 A;  3VVF A;  1MQJ A;  3FXU A;  3FJM A;  3HHY A;  3KP1 E;  2OBG A;  3IX1 A;  2Z8F A;  4IB2 A;  2P0S A;  1SW1 A;  4FW9 A;  4OFJ A;  4LF7 M;  3SMS A;  1SBP A;  5TU0 A;  2B3F A;  4DV0 M;  3THG A;  2XX7 A;  4L78 A;  2RC9 A;  3EF7 A;  2C5R A;  5CI5 A;  4DCY A;  3EIH A;  3DEL B;  4G68 B;  2F34 A;  1Y1Z A;  2HZL A;  4ELO A;  2X26 A;  3QYT A;  3K92 A;  2NWJ A;  1JW4 A;  4EF2 A;  4FWH A;  1FQF A;  4GWO A;  3MVZ A;  3CSG A;  1NNU C;  3MUQ A;  4GF8 A;  4NXM M;  1MPC A;  1R7R A;  1N84 A;  3M3F A;  3TE6 A;  2XFT A;  4ZED A;  2F5X A;  3KFU G;  4HCY A;  3Q27 A;  3TZA A;  4ISU A;  2F5O A;  3KOT A;  4YB5 A;  4I62 A;  3USD A;  3IG5 A;  2AL4 A;  3UMM A;  3HST A;  1IXC A;  4OEN A;  4WED A;  4MBP A;  3IOW A;  1JQF A;  3LSF B;  3OXN A;  4Z6Y A;  3W9W A;  4C1T A;  5TP9 A;  1B4H A;  5FTM A;  2H5Y A;  3WHL A;  4MLV A;  1PB8 A;  3S2V A;  4U1Z A;  4BLA A;  3H7M A;  4RNA A;  3BKI B;  4B7H A;  3DP4 A;  4PDG A;  4LZ8 A;  1IXG A;  1A99 A;  4ZE8 A;  2E0S A;  3GO8 A;  4JI3 M;  2GH9 A;  3LUY A;  4DUY M;  2V3T A;  1B7U A;  1JET A;  1G4A E;  2CV0 A;  1LAF E;  4Q0C A;  3U8Q A;  3GBB A;  3OSR A;  1FW0 A;  4PQJ A;  3SEX A;  2YLN A;  5FSW A;  1MU5 A;  1SYI A;  2DE2 A;  1L5T A;  4YMB A;  2A5Y B;  5KCJ B;  4IBE A;  3OOA A;  3NBI A;  1GVC A;  3EHS A;  5I84 A;  3SAV A;  1E9R A;  3GLF A;  2O69 A;  3JZJ A;  4DR2 M;  3HN0 A;  5CMC A;  3UP9 A;  3UJN A;  5CMB A;  4I8C A;  3RLF E;  3FUU A;  4MH5 A;  2DE4 A;  4XKP A;  2D3I A;  1P1N A;  1P1U A;  4G6Z A;  4EF1 A;  3O9P A;  3U6D A;  4X1B A;  2P5T A;  1I94 M;  4NWD A;  3U6Q A;  3FVK A;  2REJ A;  3KJ7 A;  2PMS A;  1HNZ M;  3PPR A;  2BJJ X;  3G3I A;  3T15 A;  3FV2 A;  2M60 A;  4JI2 M;  2R65 A;  2XD2 A;  3VFD A;  2I4C A;  4M1V A;  2DZO B;  3IO6 A;  2L6O A;  1OQH A;  3C34 A;  5BR8 M;  2R71 A;  4M0W A;  3O6I A;  2RCB A;  1N7W A;  4YAH X;  3A3C A;  3R7X A;  1PDA A;  3SAS A;  4DR5 M;  3T9H B;  1XVY A;  4IBK A;  1XMO M;  3L28 A;  1R2Y A;  4G68 C;  4F3P A;  3W15 C;  2R62 A;  1XT8 A;  3UA8 A;  3FTF A;  2F7A A;  1Z7N E;  1OVT A;  1IBL M;  2CV1 A;  3SEY A;  2C98 A;  4B7G A;  3GLH A;  3KS8 A;  3K6U A;  1YPN A;  4FJP A;  2V1C A;  2VQE M;  1N78 A;  4OVJ A;  1IZ1 A;  1AIV A;  2L7H A;  2PBW A;  5F1Q A;  3EHT A;  1O7T A;  1QVR A;  1XMQ M;  2OLB A;  4ONY A;  2J7O A;  3PPO A;  2KEB A;  3TTN A;  1QW0 A;  3ZC7 B;  4EDP A;  4QFO A;  2Z4R A;  1QUL A;  4WKM A;  1DO0 A;  1MQG A;  2WKY A;  4JXI A;  4U4S A;  3K01 A;  5I58 B;  1Z5C A;  4NF5 B;  4LFA M;  2RC7 A;  3AXF A;  2HEU A;  3LQQ A;  3HCQ A;  4G77 A;  3CF6 E;  1B5I A;  3PUZ E;  3ECR A;  3FUZ A;  2X4A A;  3E9X A;  2L09 A;  3TEP A;  2XHD A;  4NXN M;  1N33 M;  5TPA B;  2PX1 A;  2X7P A;  3FUX A;  5FHM A;  5EP2 A;  5KCJ A;  3BFU A;  3JYR A;  1Z6T A;  4DV4 M;  1Z5A A;  2QCU A;  5I58 A;  5DVJ A;  1FQB A;  4NF5 A;  2DWA A;  1TH3 A;  3SAT A;  3C36 A;  3THI A;  2DSF A;  3DFZ A;  4R2F A;  1TXF A;  5BUU A;  3IOV A;  2XLJ A;  2NXO A;  3E9S A;  3KOY E;  1LBC A;  2KRK A;  5A2Q S;  5EXS A;  4RNS A;  4BLC A;  1H45 A;  5C18 A;  2UXD M;  3MC2 A;  2I48 A;  4X62 M;  3HWS A;  4RF0 A;  2M8C A;  1D9V A;  4U21 A;  4LZJ A;  1S3S A;  4TLM B;  1D3K A;  1A54 A;  1N34 M;  3LR1 A;  4U2R A;  3J27 B;  2Y20 A;  4OWD A;  5L8D A;  1SXJ A;  3W0L B;  3H6V A;  3Q26 A;  3LSX A;  4LUB A;  5I59 B;  1G59 A;  2ANJ A;  4MM3 B;  2QBY A;  5H8N A;  4RK2 A;  4FCV A;  4JI8 M;  1JR3 A;  4GXA A;  2H4I A;  1B3H A;  4FVM A;  4X66 M;  3WAF A;  3G3F A;  1KFV A;  4IY5 A;  3AFH A;  1FTK A;  1EZ9 A;  2VQF M;  1DGB A;  1O63 A;  2QEN A;  4GC9 A;  5H8Q A;  4R9G A;  3DZD A;  1HSE A;  1KYI A;  1LCF A;  3TTR A;  2V6Z M;  4D82 A;  2ERC A;  3IL1 B;  3QK6 A;  4PET A;  3F11 A;  4NMY A;  1JNF A;  2VGQ A;  3L26 A;  3CTW B;  4YMA A;  1D9Y A;  4PCZ A;  4NRW A;  2BNK A;  1IM2 A;  3IB1 A;  1YTV A;  3ILK A;  1SQY A;  4C0R A;  4OES A;  3TQL A;  3C33 A;  3SHG B;  4JBZ A;  4LA9 A;  2ZYK A;  4UA8 A;  1XS5 A;  3TCF A;  4R9F A;  1MM7 A;  2DWI A;  2ONR A;  4H8I A;  5IAI A;  3CR9 A;  1SI0 A;  4LJ4 A;  4MGH A;  3TCG A;  1UIU A;  4DUZ M;  3OEK A;  3I51 A;  3V5A A;  3FTD A;  1NNT A;  1HR0 M;  4JV5 M;  3UZU A;  3RN8 A;  4IBJ A;  2H9B A;  4MGK E;  1B0L A;  2A5S A;  5KZT A;  1O64 A;  1YSY A;  4R73 A;  3OSQ A;  3T1H M;  1MH4 A;  2YPN A;  3UN6 A;  5ITX A;  1P1O A;  1LCT A;  1SI1 A;  2XSZ A;  3TWM A;  2L7I A;  4O3B A;  1NNF A;  2AL5 A;  3JR4 A;  1SW2 A;  5KPZ A;  2HXW A;  3LMM A;  4X48 A;  2PT1 A;  1Q3B A;  2P2A A;  3TKD A;  4CHT B;  3T93 B;  2FFJ A;  1Y20 A;  3T9X B;  5H8H B;  4OYV A;  1G41 A;  4KQP A;  4POX A;  1T0K A;  1MXV A;  3H6U A;  5AE4 A;  4F3G A;  1PBP A;  2CZL A;  4GL0 A;  2DXI A;  5AA2 A;  4N07 A;  4LAT A;  1QQW A;  5FTL A;  3TTL A;  3UGW A;  3LVV A;  5KDT B;  4X65 M;  5DEX A;  3FTE A;  1XWI A;  2FE8 A;  2QMW A;  3PPQ A;  5EYF A;  1Z59 A;  4L17 A;  4GH9 A;  4M9S A;  4CGY B;  3TUS A;  5EJC A;  4POW A;  3I3V A;  4R6Y A;  2DXY A;  2Z3X A;  4PD2 A;  2QBY B;  1XVX A;  4MGY E;  3UIF A;  2ZNS A;  1B52 A;  5EHS A;  5L9S A;  3O66 A;  4GFR A;  4QFP A;  4DV3 M;  5DEX B;  1QYR A;  3KOX E;  1TFA A;  1USY E;  2YR0 A;  4QOS A;  1NNP A;  2GRV A;  3TYH A;  2F6P A;  2RGO A;  4PT5 A;  2EO2 A;  4KYS A;  1Y4C A;  2I4B A;  2RIN A;  3RQT A;  3HJQ A;  1VFE A;  2QS3 A;  2UUA M;  2KRU A;  1WXQ A;  1E9S A;  4JI4 M;  2Q89 A;  1A7L A;  1PBQ A;  3IB2 A;  3U93 A;  5AA4 B;  4MGI E;  4ZEB A;  2IA4 A;  4PFT A;  5JTY B;  1Y1M A;  2Y84 A;  4RPN A;  1NNK A;  3FYC A;  3SDF A;  1MY2 A;  2I6E A;  1L2D A;  2G93 A;  3IAZ A;  4QFK A;  1J5E M;  4OHN A;  3VDF A;  4DV7 M;  2LH0 A;  1NMU A;  1L1Z A;  1NFT A;  4BDM A;  3SBJ A;  4KCD A;  3H6T A;  4C1U A;  3D8L A;  4LP2 B;  4II7 A;  4IO3 A;  3HHZ A;  4OEU A;  1K82 A;  5H8S A;  1P1Q A;  4ZDM A;  1W5T A;  1YCJ A;  2G5G X;  3RT6 B;  1GV8 A;  2K47 A;  4IBB A;  2O1M A;  3TEL A;  3HGI A;  4L4U A;  2DP8 A;  1XC1 A;  3UK6 A;  3MWB A;  2Z23 A;  1EZO A;  1PEB A;  1M5D A;  2E5L M;  1PJI A;  3W0F A;  1N36 M;  1L2B A;  2O5R A;  4AQ4 A;  2OCU A;  2F5Q A;  4OER A;  3PD8 A;  1BKA A;  1IIT A;  4P0G A;  3QWL A;  1QUJ A;  3K1N A;  2ZYM A;  3Q29 A;  4X9T A;  1IQP A;  5LOM A;  1DTZ A;  3O6H A;  5EQT A;  4QSE A;  5JEI A;  3AKZ A;  2Y7R A;  4RA1 A;  4H0W A;  1NH8 A;  4KYE A;  2AIX A;  4H67 A;  2R18 A;  1B5H A;  3L27 A;  4NF4 A;  1MY3 A;  2QS2 A;  1JVY A;  3KXE C;  3TFL A;  2ZAO A;  3PUX E;  1S9T A;  3C9H A;  1DPP A;  4M9Z A;  1HSJ A;  7CAT A;  4NF8 A;  4DV6 M;  1URG A;  2F8D A;  1FTO A;  2VOZ A;  1ZU0 A;  3I5O A;  3M0E A;  4WXJ A;  3AOE C;  3VDU A;  2ZYN A;  5ITY A;  3OO8 A;  1OMP A;  3VKH A;  4XKQ A;  3OO7 A;  4F3S A;  3FAT A;  2QS1 A;  3U6O A;  3SYK A;  5FTH A;  4QHQ A;  3BOS A;  3VXB A;  4F2O A;  3HU2 A;  5JK4 A;  4JI6 M;  1UTH A;  3JV9 A;  3IR1 A;  2LXE A;  3HKP A;  4DLD A;  4AQY M;  3G3K A;  1TWY A;  2QMX A;  3ONM A;  4AZF A;  2DWZ B;  4GC5 A;  4MF3 A;  2CV2 A;  4IO5 A;  3J7A S;  3PU5 A;  1NJG A;  3KS4 A;  4R74 A;  1AOV A;  1F9B A;  1N3W A;  1NHW C;  4XKR A;  1VFD A;  3HV1 A;  2FNC A;  1QUK A;  1VE4 A;  2Z4S A;  4P11 A;  3PMW A;  4LZ7 A;  2XEP A;  4KYD A;  1Q3C A;  5I2K B;  4FCW A;  3TCH A;  1FTJ A;  1Y9U A;  4LF8 M;  4LCB A;  2XXU A;  3K0V A;  3Q28 A;  3SMP A;  5I57 B;  1E32 A;  4FWG A;  2HQ0 A;  4U1O A;  2XFS A;  4WUR A;  3LC8 A;  3T66 A;  1J1N A;  1Y3P A;  3HHF A;  1B05 A;  3UK4 A;  1FQA A;  3MVX A;  4THI A;  4OW0 A;  1WOD A;  1FQC A;  3R26 A;  4NOO B;  4X64 M;  4IIW A;  2UXA A;  3CF0 A;  4ITQ A;  2BJV A;  4F1U A;  2Q8J A;  3T9U A;  1E94 E;  5L9O A;  1IQ7 A;  4G2Z A;  5I56 A;  2ESN A;  3FXQ A;  4QNM A;  2YQZ A;  1M5F A;  4G8N A;  4GKK M;  1N76 A;  3VLV A;  2Y7W A;  3SHF A;  3A3U A;  1BIY A;  3IK6 B;  3M7G A;  3KJT A;  3KN8 A;  3OMB A;  1FTM A;  4XTC Q;  3C4M A;  3CF2 A;  3TTK A;  4ZEK A;  3FAS A;  3K6X A;  5CBS A;  3G3H A;  2FNA A;  1IIW A;  5TPA A;  4JI5 M;  4JXJ A;  3VK7 A;  3IJO B;  4G8M A;  1FJG M;  4AI6 A;  1B1H A;  1ZLQ A;  1UTB B;  3QSL A;  1N04 A;  1SD3 A;  3Q8X A;  2DQV A;  4IJF A;  3LVW A;  4AB5 A;  3FJ7 A;  4LFB M;  1IN8 A;  2EA0 A;  2BJW A;  2QZ4 A;  2F5P A;  4JN6 A;  2D7H A;  3RUM A;  5DYG A;  1LAX A;  5ICT A;  4R6H A;  1VDD A;  1P99 A;  4ZEF A;  3B6T A;  2PT2 A;  3AJI B;  3G7W A;  5CBR A;  3QUJ A;  1HT2 E;  3C31 A;  1NJF A;  4NL4 H;  3GZG A;  4IGR A;  4EQB A;  3PXG A;  2Q88 A;  4LGM A;  2ZNT A;  2KZS A;  3S4U A;  5K2X A;  3P7I A;  1MPD A;  3J81 S;  4GKJ M;  1CE2 A;  4QF9 A;  3HU1 A;  3S9E A;  3MW0 A;  1QVS A;  1X37 A;  2ZBK B;  3SYL A;  3BFT A;  4DDD A;  3RFW A;  4ESW A;  3HJ8 A;  3FGS A;  5M2V A;  2CHQ A;  3AOE A;  1MM6 A;  1NHG C;  4G68 A;  4A3V B;  3U60 B;  1USY H;  5AA3 A;  4EIW A;  4YHH M;  1R1N A;  2OWS A;  4DR3 M;  4OU7 A;  5H8N B;  1OJL A;  3M8U A;  1SXJ D;  4H5F A;  1SVX B;  2O51 A;  4M9X A;  2XD3 A;  1QAM A;  4YB7 A;  1AH5 A;  2XXT A;  2JA2 A;  3U5Z B;  4JSD A;  5H8Q B;  2DXR A;  3C58 A;  1LB9 A;  5CMM A;  1FNN A;  3ZS6 A;  2UVH A;  3H4Z A;  1GTK A;  1I4W A;  3U61 A;  4NSR A;  3SEU A;  2A5T B;  2PYY A;  4ND9 A;  4U4X A;  1J7K A;  3GQ3 A;  4G8H A;  2R45 A;  1EZP A;  2QRY A;  5L9M A;  3FTC A;  4ECF A;  3MAM A;  4B3M M;  3PPP A;  2ABH A;  1XOC A;  5AA1 A;  4XKN A;  2DS9 A;  2DZN B;  5CC2 A;  1OFH A;  1SDX A;  3VK8 A;  3QXM A;  1NY5 A;  3TL4 X;  3U94 A;  2RKM A;  2I49 A;  4TOZ A;  3N26 A;  3MVY A;  3O97 A;  3R8F A;  1KSF X;  3VLU A;  3CFL A;  2YFQ A;  3PMX A;  4KHZ E;  1SYH A;  3QIM A;  5FTJ A;  1GVN A;  2F36 A;  1NH7 A;  1RYO A;  1IXS B;  1R9L A;  3T96 B;  2QL3 A;  5DT6 A;  1IUD A;  3KG2 A;  4LZZ A;  3DP6 A;  2CE7 A;  3VLW A;  4WEP A;  2GHB A;  3PFI A;  1R6Z A;  2HCA A;  1QAN A;  2IEE A;  4GQO A;  5JI2 E;  1ZKB A;  1Y3N A;  2YJP A;  4L16 A;  1ZTY A;  2O7I A;  4RF1 A;  5HPQ A;  2YNM D;  1MXX A;  2HL7 A;  4JB7 A;  4TLL B;  1DGH B;  3IG8 A;  2XF3 A;  4I5S A;  2D7G A;  4RJZ A;  1DMB A;  2QSX A;  1XNQ M;  3PV0 E;  3MP8 A;  3D4G A;  3K2L A;  5KDT A;  1TDZ A;  1B9J A;  1QAQ A;  2UYF A;  3K1P A;  3FD9 A;  3K8Z A;  2NQ8 C;  2Y21 A;  4OX9 M;  3IB0 A;  3PUY E;  4OET A;  4P16 A;  1H43 A;  3DM0 A;  2DWH A;  4NRV A;  1EU8 A;  4HLQ A;  3FUT A;  5FTN A;  1FQD A;  3U60 A;  3GRU A;  3OTO M;  2HHH M;  3MZ9 A;  3C32 A;  3DOA A;  1US5 A;  1PJJ A;  2O6A A;  3CG3 A;  4YKP A;  4DV1 M;  3RT8 A;  2DHR A;  3SFZ A;  2FYI A;  4YB6 A;  2XXH A;  3D4C A;  4XXU A;  3M3L A;  1XHY A;  1IEJ A;  2REG A;  4OVZ A;  4LRS A;  2FA7 A;  3IJX B;  1HNX M;  3HHW A;  4F19 A;  5EXP A;  2V3Q A;  3GLG A;  4DE8 A;  3L6G A;  2W7Y A;  2DVC A;  1LLS A;  2OZZ A;  3LBS A;  1K3X A;  1B3F A;  3IOT A;  1GGG A;  3OO6 A;  2RGH A;  2A5T A;  4NED A;  1MX0 A;  1NSF A;  2V25 A;  5DVI A;  1B7Z A;  1B3L A;  2XGN A;  1TFD A;  1GLN A;  2Q2C A;  3SKP A;  3MBP A;  4LQ5 A;  2R4J A;  3FVO A;  1ANF A;  3CG1 A;  4GL8 A;  2CFO A;  4OFO A;  3WAE A;  3RY3 A;  4KI0 E;  2E1S A;  1FTL A;  4M0D A;  4NF6 A;  4NF4 B;  2LWX A;  3FVG A;  3DLN A;  3H6W A;  3K00 A;  4FD2 A;  4B08 A;  3A98 B;  3U6L A;  2G8L A;  2PVU A;  1L1T A;  4ZPX A;  1IN4 A;  3KW6 A;  3IOU A;  4EQ9 A;  4ZE9 A;  3PNY A;  2DWM A;  2I7P A;  1ZIU A;  3UGJ A;  1DTG A;  4QFN A;  4R75 A;  3RGS A;  4MH0 E;  3V83 A;  4GIT A;  4JDF A;  4L8R C;  4Z0I A;  4DXC A;  4I1D A;  1M5B A;  2O84 X;  4M4G A;  4AG6 A;  2KXE A;  5IZ7 D;  3SEW A;  4NF6 B;  4DR6 M;  2DVW B;  4PE5 B;  1LFI A;  2F6G A;  1OIB A;  4KPT A;  1N0T A;  3HPI A;  4ZEI A;  3E3K A;  5ITR A;  3CFX A;  4IBD A;  1A8E A;  1I6A A;  3FYD A;  1IN7 A;  3MJN A;  2LAO A;  1KWH A;  1OVB A;  4ELQ A;  2AYS A;  2H1R A;  2QJE A;  2DOJ A;  4L15 A;  1SXJ E;  1MRP A;  4XGI A;  3FZV A;  3PPN A;  4OMB A;  2F97 A;  3PNV A;  4IBI A;  2I7N A;  2HAV A;  3N5L A;  3SAU A;  4W5W A;  1LFH A;  2ZYO A;  3KDS E;  3GLF B;  1MXY A;  3EHU A;  2R6G E;  4R72 A;  2DE3 A;  4Z7E A;  2UXC M;  4IGT A;  1R9Q A;  4S12 A;  2OJT A;  2CHG A;  4N13 A;  3M3K A;  4DR1 M;  4IBC A;  3PGF A;  1I6Q A;  4OXV A;  5ITU A;  1D2N A;  1BP5 A;  4FEC A;  4DXB A;  3VV5 A;  2V84 A;  4LJ9 A;  2XZU A;  1D4N A;  4OVZ B;  4Q8R A;  1LV7 A;  1IBM M;  2CEA A;  4O3C A;  5EHM A;  3K6V A;  2DWN A;  4F31 B;  2UVI A;  4KHP M;  3VDP A;  4NSO B;  4DR4 M;  4LF6 M;  4P0I A;  3MPL A;  4H6D A;  2B3B A;  2XXW A;  1MY0 A;  3FUW A;  4PFW A;  3U6E A;  3H06 B;  5ITX E;  4F22 A;  4LRT A;  2UUB M;  1MQI A;  3J2P B;  1DGF A;  1PB9 A;  4FEB A;  2V1U A;  3TOD A;  1YE9 A;  3G3G A;  3MQ9 A;  4GOT A;  4B3R M;  2X7Q A;  2F7C A;  4AG5 A;  3GQ4 A;  5J1D A;  2D21 A;  3T38 A;  3QAU A;  3FD3 A;  4ZS9 A;  4IBG A;  4MFI A;  2X8A A;  4FOR A;  1N77 A;  1GKI A;  3DP8 A;  3B7D A;  1JW5 A;  2OWT A;  1M5E A;  2H99 A;  3S9M C;  2CHV A;  4JWY A;  3O28 A;  4OZ9 A;  1B7H A;  4E0X A;  5ITP A;  3AL0 C;  4F3B A;  5IT9 S;  4G4P A;  3S9N C;  5DYI A;  3IOR A;  2V93 A;  4DR7 M;  5DVF A;  3RGY A;  3U6P A;  3OEL A;  4RYA A;  1QKB A;  4DZ1 A;  4PP0 A;  1HT1 E;  3O29 A;  1SXJ B;  4JI0 M;  1B4Z A;  4HW8 A;  2Y7K A;  5B70 A;  2QP9 X;  1TDH A;  5KQD A;  3T22 A;  3TMG A;  2QPQ A;  1W5S A;  3SAR A;  1I6B A;  3MZB A;  3W9V A;  1PC3 A;  1B5J A;  3KZG A;  5EP1 A;  2ONK E;  1LST A;  3PVS A;  2LNH C;  4G4R A;  3K02 A;  3L2A A;  3VLF B;  3J80 S;  2Y7I A;  4U22 A;  5C1B A;  3ILT B;  5A5X B;  2J7N A;  1MY1 A;  4LJ7 A;  4YIC A;  3GLB A;  3TTM A;  3U6S A;  1H44 A;  1DOT A;  3OEM A;  5E26 A;  3C35 A;  3MHV C;  1R6B X;  5DNY A;  1DO2 A;  2Z8D A;  4OQO A;  1EE8 A;  5I2N A;  3U92 A;  4AKH A;  4DCX A;  4DIG A;  4ELP A;  4BDL A;  2CMO A;  3U5Z A;  4Q5T A;  4YU0 A;  3KOW E;  3L29 A;  4H65 A;  4FAJ A;  2HCB A;  1POT A;  2O7U A;  4NTL A;  1SW5 A;  2C96 A;  1IXH A;  3HU3 A;  4CIS A;  1B0H A;  3U61 B;  1JR3 D;  3EQ1 A;  4I4L A;  1TGU A;  4ZZE A;  3ILU B;  2OK2 A;  1SXJ C;  1IN6 A;  1XXH B;  2QPA A;  2HAU A;  3SEV A;  5HM4 B;  5I2N B;  4LJA A;  4IO7 A;  1YAE A;  3KSX A;  2GHA A;  2Y0Q A;  4QRZ A;  2D5W A;  4KR5 A;  3KN7 A;  4UAC A;  3TPZ A;  4FWD A;  3GRV A;  3HHG A;  2Z22 A;  3MK6 A;  4HS7 A;  4GIP A;  1MDQ A;  1N3X A;  1ZQ9 A;  4BDQ A;  2VP1 A;  1RKM A;  3S9L C;  1AL3 A;  1DGG A;  4D81 A;  1B3E A;  4AKG A;  4AB6 A;  4G4N A;  3RTW B;  5LMN M;  1XXH A;  4REZ A;  4F1Y A;  1NNJ A;  4QSC A;  3GRR A;  2R46 A;  4LGY A;  3U72 A;  2KZU A;  1MY4 A;  2NOO A;  3KN3 A;  2XXY A;  4IO6 A;  4H8J A;  2W82 A;  2F7B A;  1WVJ A;  4QFL A;  1J09 A;  4LJ5 A;  2ZAN A;  3IO4 A;  1PM5 A;  2VHA A;  4WW0 A;  3ODB A;  4JWO A;  1A8F A;  1FCK A;  3GLI B;  4TQU Q;  1Y4T A;  2F35 A;  5H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...