3KSXA

The alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
molecule keywords Nitrate transport protein
total genus 95
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA02
2UYFA 4QFLA 4H6DA 3TAJA 3SEXA 4X1BA 3RN8A 1B7UA 3K00A 3LR1A 3MZBA 5CC2A 4YU0A 2F5XA 2X7PA 4FJPA 1LGBC 4KPTA 2LAOA 5CMCA 4ZEFA 3RTFB 2I48A 3MWBA 1JW5A 3ODBA 1B2HA 2I4BA 1RKMA 3GXAA 4UACA 3PMXA 5KCJB 2OZZA 4QFKA 4R6HA 4DXCA 4C1TA 5TP9A 3TEPA 3IL1B 4ELRA 1AIVA 4KYSA 3H6VA 3T9HB 2THIA 3OD7A 1OIBA 5I58A 4JB7A 4OFLA 4GD5A 1MXVA 1MY2A 3C36A 2DSFA 2W7YA 1Y3NA 1IXGA 1LAXA 2PMSA 1KWHA 3OOAA 3QXMA 5EYFA 4E0WA 1Y20A 2ZNUA 4FEBA 2A5SA 2H98A 3B6QA 3U72A 4KI0E 2D5WA 2QJEA 4IO5A 4XKRA 2Z8DA 3TFLA 3VFJA 3H3GA 4H67A 1UTBA 2HCAA 3LSFB 3T96B 5IAIA 5CMKA 3PUVE 5F7VA 1LBBA 2ZNSA 3HCQA 2O84X 1B32A 3HHFA 4NF5A 1GV8A 4RK2A 2XD3A 3VDFA 1JEUA 2DS9A 3G3JA 3HHGA 4PFTA 1Y4TA 1OVBA 5I2KA 2YPNA 3O29A 2DWAA 3JV9A 2XXQA 2E0SA 3FATA 2VHAA 4LONB 3CSGA 3MP6A 4XKNA 1POY1 1MS7A 1B0LA 2XX8A 3OEKA 3CI8A 5H8NB 4HTGA 3C9HA 1IXHA 1NMUA 3MVXA 4JWOA 3PMWA 3SEUA 3TMGA 5KZTA 3QYTA 4KCCA 3OMBA 3M3LA 5AA3A 3LSWA 2B3BA 2Q89A 4NTLA 1IITA 4FAJA 4PQJA 3TKDA 5TPAB 3W15C 1B58A 3QUFA 1QVSA 3IOUA 4EXKA 1DPEA 4R74A 2G29A 2B65A 5I56B 4H8IA 4F3GA 2DE3A 4F29A 1RYOA 4EXLA 5JK4A 4F1VA 1Y3PA 3IAZA 3BBRA 4LQ5A 1OMPA 1P1UA 4GL8A 2Q2AA 2ZNTA 1CB6A 1TWYA 3A3UA 1Q35A 3KZGA 5AA4B 1B3EA 3I6VA 2XXHA 5ITPA 5H8FA 1GTKA 1MH3A 4LZ5A 4JBZA 5H8HA 3IJXB 5B70A 2QL3A 4PETA 3LSLA 4DZ1A 3AXFA 3ILUB 4I1DA 4ELQA 3VVEA 2H25A 1D3KA 2P1SA 3IOWA 3DLNA 3Q29A 1QJMA 2HAVA 2Z8FA 4YB7A 1N04A 4ZE9A 1EZ9A 4QSDA 3ZS6A 3RNNA 1USYE 4EF2A 3I5OA 3IOVA 4GF8A 4GLIA 4MLVA 5I56A 5DVJA 4LA9A 4KQPA 1WDNA 2QS1A 1SW1A 4M4GA 3SEWA 3TTMA 2F7BA 2F35A 3V5AA 2Y7WA 3RGYA 3S9NC 4QSEA 1FTJA 4P0IA 4H1XA 3OSQA 1SYHA 1GR2A 1PEBA 4Q0CA 4IY5A 4RPOA 1YTVA 2DP8A 3W9VA 4XKQA 3MAMA 4QFOA 4F3PA 4U4SA 3G7WA 4YKPA 3FJGA 3K2DA 1VFDA 1XOCA 3KGCA 1B3HA 1SD3A 5CMMA 1H43A 3K6XA 4OMBA 1I6QA 3THIA 1MQDA 4U23A 1IZ1A 4YB5A 1DMBA 1XS5A 1MXXA 3SETA 4Q30B 1LB9A 4I9DA 3KOTA 1EZPA 1Y1MA 2DOJA 2O1MA 3FUZA 1URSA 4NF6A 2V3UA 1B9JA 2XX7A 3FJMA 1POTA 1H3DA 3S4UA 4OHNA 4ZZEA 1UTHA 1N76A 4NMYA 1PDAA 3RY3A 1CE2A 4GFRA 3TCFA 2AYSA 1B52A 4OEUA 4C1UA 3TUSA 5CRYA 4OTEA 2F8DA 1OLCA 4LUBA 4OENA 1QW0A 3C33A 5I2KB 3RQTA 5DTBA 1YPNA 4F1UA 1UIVA 5K2YA 4DDDA 1O63A 3VXBA 1B05A 1N0TA 2DYXA 4JWYA 3M3FA 1PB9A 2XHDA 1EU8A 5L8DA 1I69A 1P1QA 3T93B 1II5A 1FQBA 2CZLA 1N7WA 1JETA 3K4UA 4ZECA 3UA8A 1LBCA 1HSEA 3EHUA 3TQLA 1WVJA 4NWDA 3SKPA 3TTNA 4ELPA 3KN8A 3VVFA 4G68A 3U94A 3EPEA 2XXXA 4ZEBA 1PBQA 4GQOA 4PFUA 1MXYA 1LSTA 1UQWA 3PV0E 2RINA 3MZ1A 3TQWA 1URGA 3VE1B 2F6GA 1NNKA 3FVGA 3MVYA 4F1YA 4F18A 3U92A 4QF9A 1NNPA 4IO3A 2QS2A 3V83A 2ZMBA 5I2NB 1MPBA 3KG2A 4IGTA 1B3FA 1FW0A 3HPIA 3H4ZA 3MJNA 2NWJA 4DIGA 1R1NA 3B7DA 1B5IA 3G3GA 3TPAA 3VV5A 1B3GA 4MBPA 5FHNA 4ZZAA 3IK6B 4F19A 3BFUA 3DELB 4KHZE 2QSXA 2XXRA 2Y7RA 3H6TA 3IJOB 3PPNA 4H0WA 1FTLA 4ZEKA 3C35A 3SEYA 3KSJA 2O69A 4R2FA 2VGQA 3MW0A 4R72A 3H7MA 4ONYA 4BDNA 2ONRA 4QSCA 1A8EA 4WEPA 3FD3A 1B4ZA 2G93A 3DP4A 3PPQA 4IY6A 1GVCA 3EF7A 3CFZA 4F31B 2NOOA 3RT6B 4I8CA 3DM0A 2RCBA 3K6VA 3EHSA 3LSXA 1FTMA 3SERA 4U1OA 1HSJA 2GHBA 1LLSA 2XXUA 1B6HA 3EQ1A 4IO2A 3HV1A 1UTBB 3O6GA 2O68A 4U21A 4HCYA 3M8UA 2R71A 4NF6B 3O9PA 3IB2A 3C34A 1XHYA 3MBPA 3TDJA 3KN3A 5LOMA 1M5BA 1JEVA 2FYIA 4GXSB 1XVYA 3K01A 4YKIA 1US4A 1BIYA 1JW1A 1XT8A 4OWDA 1A55A 1N84A 1JVXA 1M5CA 3O66A 4NEDA 2O1LA 3JYRA 2NUVA 3OELA 1QKAA 3FIRA 3P7IA 1TFAA 4FECA 4H8JA 1YCJA 3SDFA 5IKBA 3S9LC 1S9TA 4RJZA 4LZ7A 2F34A 4OFJA 1P1NA 2I3WA 3UP9A 5I57B 3MQ9A 4GWOA 3KSXA 3N5LA 4OZ9A 4DE8A 4ECFA 2H4IA 1BTJA 1F9BA 3FXQA 3TTRA 4ELOA 3CFXA 5L9SA 3MP8A 2NVUB 2A5TB 4MH5A 4ND9A 3RUMA 1D9VA 3WAEA 2D3IA 4R2BA 3G3IA 2OK2A 4KYDA 2O7UA 3FZVA 4TQUQ 1LAGE 1SW5A 5CI5A 3BFTA 1VE4A 3SEVA 1SI1A 4K3FA 5I59A 2Q8JA 3OO8A 2AIXA 3QIMA 5FHMA 5HPQA 4ESWA 3W9WA 1M5DA 2PBWA 4KFQA 2DVZA 3TELA 3KN7A 1NH8A 3OO9A 1ZJLA 3FASA 4P11A 3H03A 2RCAA 3RPWA 2HZLA 5DT6A 4U22A 1MDP1 2H99A 4G8HA 4I62A 4WXJA 1FTOA 1SI0A 1MXZA 2I58A 4EQBA 3QSLA 3OSRA 3RTWB 2CMOA 1B1HA 4EQ9A 1B7ZA 5FTHA 4F3BA 4QFNA 1AMFA 3IB0A 1MDQA 4NWCA 2R9JA 1S50A 2O51A 1LFGA 2OJTA 4KYEA 4BDRA 3V8XB 4ZDMA 1MQIA 3VLUA 5AE4A 2ALUA 2XXYA 2DWIA 3PD8A 3Q25A 4OVJA 4OESA 3UORA 2M8CA 1XC1A 1VSOA 2Y7PA 3MVWA 1Z7ME 4MF3A 5DYHA 1DTZA 3FXUA 4HW8A 4LP2B 3C4MA 3B6TA 4IO6A 1DOTA 2PT2A 4G8MA 1MM7A 1LAHE 4RPNA 5L9OA 1PB8A 3O6HA 2A5TA 3N6TA 2FA7A 2OCUA 3N6UA 5I59B 3G3HA 4NE4A 3FV1A 1MY4A 4R9FA 5DEXB 4BDQA 1A40A 1BP5A 3FJ7A 3GLBA 4M1VA 5H8HB 3CIJA 4OXVA 2DXRA 3TTLA 1FCKA 5F1QA 4IB2A 1L5TA 4O3CA 4LVQA 1AOVA 3O6IA 1VFEA 1MPDA 4NF5B 1N3WA 4XKPA 2H9BA 4WKMA 4LQ2A 1LCFA 1A7LA 4R9GA 1B5JA 1MG1A 3G3FA 5I2NA 5FTIA 1MQJA 3K1NA 5H8SA 4RA1A 1A8FA 4OERA 2QS3A 5EHSA 2D21A 4JSOA 1B4HA 2F6PA 4OYVA 2HAUA 3DP8A 5ISUA 3MVZA 1JW4A 1FQEA 2F97A 3S9EA 2I49A 3MPKA 3LUYA 4THIA 3GBBA 2ZYOA 3PPOA 5J1DA 3T22A 3D4CA 3HO7A 2E1SA 1LAFE 1USYH 5EHMA 1GGGA 1FQCA 3MZ9A 1LFHA 2Y7KA 4GVOA 3U8QA 3OEMA 4FEDA 3IO4A 2UVGA 1QUKA 4P0GA 2DVCA 3K6UA 5ITOA 4DCXA 2P0SA 1QULA 2O7IA 2ZXTA 4WEDA 4ZEIA 2H5YA 4QRZA 4FATA 2ZYNA 2GH9A 4DXBA 3CSBA 1H76A 1M5FA 1SBPA 2FNCA 3FV2A 5ELVA 1LB8A 3PPPA 1MY1A 3UN6A 1OLAA 4Q8RA 3FVNA 1R9LA 2ESNA 1UTHB 3USDA 5JEIA 3Q28A 3N94A 3V89B 2QMXA 1SDXA 1TT1A 4E0XA 3DP6A 3OO6A 2OLBA 2IEEA 1PBPA 3H6UA 1BLFA 1IUDA 1MXWA 2PVUA 3K02A 4H65A 3D4GA 5JTYA 2ONKE 5TP9B 2HFBA 4RYAA 2I0BA 5ICTA 3S9MC 5H8NA 3TCGA 1VR5A 2Z8EA 2UXAA 4X48A 4U1ZA 3K6WA 4EF1A 5KCJA 3FVOA 1Q1KA 2ONSA 4GIZA 4G68C 4YKJA 4Q5TA 3T9UA 2UYEA 1QUJA 3ILTB 3PU5A 5M2VA 3UIFA 3LC8A 4F3SA 1B7HA 1ZMGA 2RC7A 4QHQA 1NNFA 1ELJA 4LZ8A 2P2AA 2XXTA 4BLAA 2UVJA 4X9TA 4X1DA 1B46A 2RKMA 2XXWA 3QK6A 3HSTA 1DPPA 1I6AA 1IXCA 2ZYKA 4GRKA 4R6YA 4JSDA 5AA4A 1AH5A 2QS4A 3KEIA 1LFIA 4R73A 2Q9TA 4ISUA 4TOZA 1R9QA 1MXUA 4O3BA 4YAHX 4JWXA 2DWHA 1P1OA 2V84A 2VD3A 4AB5A 3RT8A 3IX1A 3F11A 1ZU0A 3H06B 2ANJA 4NF4B 1HSLA 1PB7A 3CG1A 5JTYB 5BWJA 2Z22A 1URDA 2B3FA 3OENA 4IGRA 1ZKBA 2DE2A 3IB1A 4F39A 4H5GA 2I0CA 2QRYA 1MPCA 2IA4A 2GRVA 3LBSA 3TODA 1B0HA 1JNFA 1MY0A 4G8NA 5CMBA 1SW2A 3UK4A 1ATGA 1FQAA 4JXIA 4Z7EA 5KDTA 1TXFA 1H45A 4RK9A 2Q2CA 1MQHA 3A3CA 3CR9A 4QFPA 3FXRA 1TFDA 2X26A 3BKIB 1S7YA 3IR1A 1N7XA 1EZOA 1MM6A 2ZYMA 3K0VA 5CBRA 3PUWE 5AA2B 3PUXE 4KD5A 4UA8A 5BUUA 1IIWA 2V3QA 3SESA 3KFMA 1QKBA 1B40A 2GHAA 2I4CA 5CBSA 1BKAA 4PFWA 3L6GA 3G3KA 5K2XA 1Y4CA 1ZTYA 4NF4A 4OETA 1NKXA 2QMWA 3T9VA 5AA2D 1SQYA 4NF8B 3IOTA 3K1MA 3TTKA 3TCHA 1J1NA 2ABHA 1RYXA 4YB6A 1O7TA 3VXCA 4ESXA 3ZKLA 4BDLA 5HBCA 2AL4A 2PYYA 3CG3A 2PX1A 2V3TA 5A5XA 3CFLA 4HCWA 4POXA 1WODA 1Y1ZA 1ZBMA 5TPAA 1I6BA 2DXYA 3GZGA 3JZJA 3WAFA 4F22A 1P1WA 4RXLA 3KJ7A 3E3KA 4XTCQ 1N3XA 2AL5A 2RC8A 4L17A 4Z0IA 2I3VA 4C0RA 5I58B 3M3KA 3KOSA 4OEVA 2YLNA 3EN3A 2HXWA 1A99A 4MFIA 3OXNA 2HEUA 2Y7IA 4JDFA 4PE5B 5DVFA 3Q26A 1XVXA 1B3LA 1NH7A 1Y9UA 3EHTA 3R6UA 4BDOA 4YMBA 2XX9A 1H44A 4BDMA 4N07A 2REGA 1T0KA 4N13A 4GXAA 1B5HA 1Z7NE 1ZIUA 3MUQA 3K1PA 3PD9A 1FQFA 1B1XA 2XXVA 4YICA 3ECRA 2Q88A 4RNSA 1NFTA 4FE8A 4FIMA 4EQ7A 4TLLB 1SW4A 4DXUA 2YJPA 3KJTA 4YKKA 4ZEDA 4H5FA 3R7XA 2DWJA 4F2OA 5I57A 1A54A 3T66A 2RC9A 5HM4B 4PP0A 1DSNA 1UIUA 3A09A 3I3VA 5AA1A 3HN0A 3MPLA 3ONMA 4U4XA 5FHOA 1MY3A 4G77A 2O6AA 4ZS9A 3VLWA 3E13X 2F78A 2Y84A 3IORA 3O2AA 2V25A 3U93A 4HS7A 4F2QA 3L6HA 1IXIA 1M5EA 2VP1A 2WKYA 1MRPA 1IEJA 1FQDA 1O64A 2OWTA 3H6WA 4KR5A 5TU0A 4G4PA 4G68B 1US5A 1QUIA 4G2ZA 3QAXA 1OVTA 2DE4A 2QPQA 1MH4A 3O97A 3PPRA 2KLFA 4IO4A 2V93A 4RY1A 2VOZA 5DEXA 2F7CA 4YZZA 5AA2A 2XXIA 3TZAA 1SVXB 3FGSA 1JVYA 3B6WA 5KDTB 3PUZE 2XD2A 2DQVA 1Y3QA 3FVKA 2UVIA 1PC3A 4AQ4A 4R75A 5L9MA 2BJJX 3CRBA 4IO7A 4DLDA 5H8FB 2HZKA 1P99A 3CVGA 3S2VA 4OFOA 2R6GE 2GFEA 3VLVA 3KBRA 1YAEA 2OBGA 1SYIA 3R26A 4POWA 3Q27A 4U2RA 1R6ZA 1LCTA 1OQGA 3MC2A 4FORA 1MQGA 4ZE8A 4EUOA 5CM6A 4XIGQ 4DCYA 2HQ0A 1JQFA 2I6EA 3TYHA 2NXOA 3C31A 4N6PA 4TLMB 2OWSA 2F7AA 2RF1A 1DTGA 3PGFA 4NF8A 4OQOA 1B51A 3MP1A 3QUJA 4PFYA 4XXUA 1D9YA 1ANFA 1D4NA 2X7QA 3PMVA 5H8QA 5H8QB 5A5XB 3ZSFA 4EDPA 3VVDA 1AL3A 3PUYE 5DVIA 4LATA 3E4RA 4R6KA 1IQ7A 4MLQA 3UGWA 1NNTA 1ZLQA 3C32A 3U1OA 3T9XB 4GL0A 4YMAA 3N26A 3GBAA 3O28A 3OO7A 1FTKA 4GOTA 2Z23A 1OQHA 2VD2A 5I84A 2F36A 1EH3A 2PT1A 4O3AA 2REJA 3RLFE 3IO6A 4KCDA 5B7DA 5ICQA 3ZKKA 4AB6A 2XXPA 3E9XA 1NL5A 2UVHA
chains in the Genus database with same CATH superfamily
1QYRA 2UYFA 3KC1A 4H6DA 3TAJA 3K00A 3LR1A 5CC2A 4FJPA 3RTFB 4F19A 4RF0A 3H4MA 2I48A 1JW5A 1RKMA 5KCJB 1XI6A 4R6HA 3TEPA 4MNPA 4TUWA 4GRIA 3T9HB 3OD7A 5I58A 3THGA 4JB7A 5LTCA 1LBVA 1MXVA 1MY2A 3C36A 1Y3NA 1IXGA 1LAXA 3CF6E 4FEBA 1R7RA 3I51A 3B6QA 4KI0E 4XKRA 3VFJA 3MHVC 3T96B 5IAIA 1QUSA 1E9RA 2O84X 3U6CA 4UN2B 2XD3A 2Y21A 4OVQA 3G3JA 3WHKA 4PFTA 1OVBA 4A3VB 2DWAA 3IFCA 2X49A 3EKIA 2XXQA 3JV9A 3FATA 4LONB 4Z6YA 3I4VA 2VQEM 4OANA 4DV0M 2XX8A 4PTKA 2H1RA 1GL6A 3C9HA 1NMUA 4JWOA 1RDYA 3TMGA 5KZTA 3QYTA 4KCCA 5AA3A 2B3BA 2P3NA 4MCOA 2XF3A 3TKDA 5DYIA 1B58A 1JR3E 4B3SM 2H5XA 4DV2M 4F3GA 2DE3A 4F29A 4I3EA 1Y3PA 3IAZA 3BBRA 5ITXE 3A3UA 1Q35A 1B3EA 5H8FA 1J7KA 1GTKA 4AZFA 4LZ5A 3BIGA 4DZ1A 4GIPA 4JYAM 1INPA 4ELQA 3VVEA 3DLNA 2HAVA 1C1KA 1N04A 4ZE9A 3RNNA 1USYE 4AQYM 4GF8A 1GKIA 5DVJA 3HHZA 3TTMA 4KHPM 2F7BA 2NQ8C 3V5AA 2Y7WA 2DI0A 3S9NC 4P0IA 1GR2A 1PEBA 3W9VA 4B7HA 1YTVA 2DP8A 4XKQA 4U4SA 4YKPA 5J16A 3FJGA 3K2DA 4LRSA 5C18A 1VFDA 3KGCA 3AL0C 4OMBA 2HXRA 4LGYA 4WURA 3BIHA 1DMBA 3SETA 3SZPA 2LBCA 5ITRA 4JI6M 2JY6B 1EYJA 4NF6A 2V3UA 1B9JA 2XX7A 1L8QA 1LBWA 3PXGA 3S4UA 3GLIA 1N76A 2X8AA 5KQDA 4OEUA 3TUSA 4AKHA 1NV4A 4LUBA 5I2KB 4F1UA 4KLNA 2XHDA 2V6ZM 4LCBA 2CZLA 4N17A 1HSEA 1ZAEA 1WVJA 5E6JA 3SARA 3EPEA 3C3EA 4GQOA 1VG5A 3L26A 1MXYA 3FRHA 1UQWA 3MZ1A 1IMBA 3AOEA 3FUWA 4FCTA 2F6GA 1NV5A 4IO3A 3KG2A 4DIGA 2NWJA 2ZBKB 1R1NA 3VV5A 1SXJD 4ZZAA 3DOAA 3BFUA 4FCVA 5LMNM 3H6TA 1FTLA 3KSJA 2LHCA 2Z4SA 4R2FA 1GVNA 1OIZA 3MW0A 1Q02A 1VDWA 4BDNA 3I01M 1GVCA 5IZ7D 3E9SA 3R9XB 3EF7A 3CFZA 2NOOA 1N78A 4NQ8A 3K6VA 3EHSA 4U1OA 2JUJA 1K3WA 3HGIA 4IO2A 1NHGC 1UTBB 3O6GA 2O68A 4U21A 3O9PA 4HEOA 3KC0A 3C34A 3MBPA 3LCUA 3U6OA 2DWMA 2UXBM 4GXSB 1XVYA 1NV8A 1FRPA 4OWDA 1JW1A 1G59A 3VFDA 4DR1M 4MX6A 1QKAA 4FECA 3SDFA 1S9TA 4LZ7A 2F34A 3UP9A 4GWXA 1JR3D 2A5TB 4MH5A 3HKPA 4TQUQ 2RKOA 2LVAA 1SW5A 3QAUA 4GWYA 1SI1A 3OO8A 5FHMA 2CE7A 3W9WA 2PBWA 3TELA 4KFQA 2WX9A 2XSZD 3OO9A 3FASA 1HNWM 3T1BA 2H99A 4WXJA 5GKNA 1FTOA 1SI0A 3RPLB 1B1HA 1IXSB 4QFNA 4RNAA 1AMFA 3IB0A 3HFUA 1LFGA 1DBZA 2XGNA 4ZDMA 3VLUA 3Q25A 1FPKA 4OESA 1VSOA 2Y7PA 4MF3A 1DTZA 4OVZB 4IO6A 3B6TA 1MM7A 1Q3BA 1LAHE 2KDLA 3U6QA 2L5VA 3O6HA 2A5TA 1LBYA 4DI4B 1LV7A 3G3HA 4NE4A 1MY4A 4PD2A 1IM2A 3CIJA 5H8HB 7CATA 1L5TA 4FWDA 4LVQA 2XA5A 1VFEA 4MGHA 4NF5B 1N3WA 2H9BA 3M6AA 5EP2A 3G3FA 2JP7A 5FTIA 1MQJA 1A8FA 2QENA 1YYZA 2D21A 4JSOA 3LV0A 2L4EA 1DO0A 5IWAM 5FBPA 2F97A 4DR4M 1FBFA 5EXXA 3GBBA 2ZYOA 3PPOA 4M9SA 3T22A 4PDHA 1USYH 4JVDA 5EHMA 4OX9M 1FQCA 4DR6M 1D9QA 1FBGA 2KR0A 3U8QA 1P3QQ 4X66M 4P0GA 2FH0A 2UUCM 1FPDA 4ZEIA 1SPIA 4FATA 4DXBA 4PAKA 2FNCA 4Q8RA 2R45A 1R9LA 3GLIB 3USDA 1SG9A 3GPUA 5FTMA 2WEFA 3V89B 2KZSA 2MGWA 4LJ4A 4GWZA 1MXWA 2I0BA 3A42A 2Z8EA 5FTKA 2UXAA 4UABA 3K6WA 4AS5A 2Z3XA 2ONSA 4GIZA 2OPFA 4YY3M 4G68C 2UYEA 3KS8A 4F3SA 3QWLA 1ZMGA 4NOOB 4QHQA 1VQ1A 4AKGA 4LZ8A 4G4NA 1Q9DA 2CHQA 3QK6A 3C9PA 1N32M 1IBKM 4R6YA 1AH5A 2DXIA 2HAKA 2M5ZA 2QS4A 3NBXX 1N75A 5A2QS 2F3BA 1P1OA 2VD3A 4NXNM 3F11A 3H06B 4NF4B 2DNAA 4NF0A 3IFAA 2DZOB 5BWJA 4GC5A 2W82A 2B3FA 3OENA 4IGRA 1ZKBA 1YZ0A 2QRYA 3GLHB 5ET8A 3B8BA 1MY0A 2JA2A 5CMBA 4NAPA 2CUZA 1TXFA 1G71A 5I3SA 3CR9A 1D0MA 1NJGA 4P9KA 3FXRA 1QZMA 2X26A 4I40A 3L27A 1S7YA 2QBYA 4PT5A 1VEJA 1MM6A 2ZYMA 3K0VA 3PUWE 5AA2B 3PUXE 4CGYB 4LJAA 4Q7JA 2V3QA 3MK6A 3RGSA 3G3KA 2DAIA 2QZ4A 2JNHA 4IBKA 2GQFA 3K1MA 4JI1M 3TCHA 3BBZA 1D2NA 3VXCA 1O7TA 2R8TA 3IG8A 4BDLA 1JQJC 3CG3A 2PX1A 3FBPA 3AOGA 5CBSA 4P47A 1NV7A 1BK4A 2CV2A 4F22A 5TPAA 2QHOB 1IFYA 1N3XA 3HJQA 4IR8A 2KXEA 5I58B 1LEVA 2R0IA 5FTLA 1QVRA 4MFIA 3FXBA 4JDFA 3BOSA 1XVXA 2O01F 1Y9UA 2DZLA 2VDBB 1NV1A 1AUAA 2REGA 2Z8YM 3PD9A 2WSCF 3W0LB 1B1XA 2MJ5B 2QVRA 4N8GA 4YKKA 2DWJA 2XLJA 3T66A 2RC9A 5HM4B 4II7A 5IT9S 5FHOA 4G77A 2O6AA 4ZS9A 3VLWA 3E13X 3LQQA 1TF0B 4HS7A 1WGNA 3L6HA 2WKYA 2EO2A 3H6WA 1IEJA 1O64A 1OKSA 4Z8XA 4G4PA 4MGZE 1R5LA 1IMDA 1US5A 1DK4A 3QAXA 3KW6A 2CV1A 2V93A 4IO4A 2K9DA 2XXIA 3LMMA 1NV9A 3PUZE 2XD2A 2DQVA 4AQ4A 3ZH9B 4BLCA 4GC9A 1P99A 1Z5CA 2F5SA 1XNQM 3KBRA 4D80A 4GEWA 2Y20A 3SHGB 2HQ0A 1QAOA 4L4UA 1VEGA 1DTGA 3GLHE 1ANFA 2LWXA 5H8QB 3KOXE 1ZLQA 3U1OA 1SXJB 2Y5LA 3GBAA 4GOTA 2FBPA 2F36A 3RLFE 1NNUC 3RGPA 3E9XA 4HL4A 2UVHA 5FLXS 3J27B 5IZ1A 3GLGA 4QFLA 2DWZB 4X1BA 3LVVA 3RN8A 3RYDA 3MZBA 1ZMVA 2F5XA 2X7PA 5CMCA 3Q8GA 4PDGA 1DCUA 4UACA 3GXAA 3B7QA 2OZZA 1FPGA 4C1TA 5TP9A 4DXCA 4ELRA 3PNYA 1AIVA 3SBJA 2Q74A 2KEBA 1V34A 2DSFA 4LF8M 2PMSA 3OOAA 3U72A 4NSOB 4N91A 5I56A 1RDZA 2QJEA 3TFLA 3H3GA 5EXSA 2HCAA 5CMKA 3HHFA 1T43A 3HHGA 2BWEA 5I2KA 4WP2A 3O29A 2E0SA 2XEPA 3KDSE 1POY1 4O8MA 3U6DA 1GO5A 1B0LA 3OEKA 1XXHB 4GH9A 1DGGA 2VPNA 3OTOM 4PQJA 3GPYA 5TPAB 2EKFA 4DV5M 1DPEA 1RYOA 2JZ0A 4LQ5A 1OMPA 1P1UA 3RFWA 2CZHA 1HT2E 1CB6A 5AA4B 4PDDA 3KZGA 4AW4A 1OIPA 1FBDA 2XXHA 3I6VA 3J80S 4JBZA 1DGBA 4GX3A 4PETA 3AXFA 4M0WA 4QHTA 5IZ3B 4I1DA 1D3KA 3F92A 4LY6A 3Q29A 2Z8FA 3KBZA 2CHGA 1EZ9A 3ZS6A 4MLVA 4L78A 2APLA 4LA9A 4KQPA 4M4GA 4PBHA 3SEWA 4DV6M 3FYDA 5BR8M 4LF9M 4N8YA 4Q0CA 4IY5A 4W5WA 1XMQM 1F4IA 3MAMA 3TWLA 4JI5M 1H43A 1MX0A 4DUZM 4OVRA 1MQDA 4P3LA 1XS5A 2JY5A 2D7GA 4Q30B 1HNZM 1SXJA 1YSYA 4IJFA 1URSA 4M0DA 4IBGA 4ZZEA 4NMYA 1CE2A 4GFRA 3TCFA 2AYSA 4OTEA 2L4FA 3GPPA 3VXBA 1B05A 2DYXA 4JWYA 1KZ8A 1V33A 3W68A 1EU8A 1P1QA 3MYUA 1IMCA 1N7WA 2CFOA 2FVZA 4NWDA 3SKPA 4N6DA 3KN8A 2GQ1A 3LCVB 2XXXA 1NV3A 1OAOC 4F2LA 1PRBA 3FVGA 3U92A 2HCBA 5EJCA 1NNPA 5ET7A 4PFRA 3W0FA 4L8RC 1MPBA 4IGTA 1B3FA 3H4ZA 3B7DA 3TPAA 3A98B 1JR3A 2DHYA 2QSFX 2HL7A 2QSXA 4H0WA 3KFUG 4M9XA 4ZEKA 3C35A 2O69A 3FD3A 1B4ZA 3PPQA 1J09A 4IY6A 4JI8M 3RT6B 4I8CA 3SAUA 4NN3A 3NWLA 1YLAA 1LLSA 4JXJA 3ZC7B 1FPIA 2R71A 3TDJA 1XHYA 4Y28F 3KN3A 1M5BA 1FNNA 1WJ7A 1L2BA 1DGHA 4P16A 3O66A 1L2CA 3P7IA 3S9LC 5IKBA 1QAQA 4RJZA 5I57B 1P1NA 2I3WA 4GWOA 3KSXA 3N5LA 4OZ9A 1NVMA 4ECFA 2H4IA 1BTJA 3TE6A 3CFXA 3MP8A 1HQYE 4ND9A 3WAEA 1HJPA 2D3IA 4NL4H 4KYDA 2HPGA 1LAGE 5CI5A 3PNVA 3BFTA 1GJTA 4JVCA 3LQRA 3A29A 4OU7A 2Q8JA 1VDDA 3QIMA 5HPQA 5LMUM 1CNQA 1ZJLA 3RPWA 4DR3M 1MDP1 2Y5KA 2I58A 4EQBA 1I94M 3OSRA 3RTWB 4EQ9A 4AI6A 1B7ZA 4F3BA 4GBVA 1JB0F 2R9JA 1S50A 2O51A 2BNKA 2K0BX 2R44A 2JJKA 3PD8A 2DWIA 2M8CA 3MVWA 5DYHA 1AIPC 1WXQA 4OVZA 2FE8A 1L2DA 1Q39A 2PT2A 1PJSA 4RPNA 1TH4A 3N6TA 3N6UA 1SXJE 5IGAA 1IMAA 4AKIA 5DEXB 4BDQA 5L8RF 1N33M 5KPTA 3RPLA 2BJWA 5F1QA 2CEYA 4IB2A 1HR0M 4NC6A 4WKMA 4LQ2A 2ZAOA 1A7LA 1B5JA 5I2NA 4FW9A 3K1NA 4RA1A 4MEVA 1B4HA 2XH9A 4OVPA 5KO3A 3DP8A 4NG7A 2ZZWA 3MPKA 4PF6A 4THIA 1T3TA 2I7PA 1PJJA 3JR4A 1XXHA 2C9CA 2FHYA 1GGGA 1LFHA 4KODA 1IMEA 2Y7KA 4PAFA 3UGJA 4LF4M 3K6UA 4KO8A 2H5YA 3CSBA 1VEKA 2K47A 1H76A 3PPPA 1MY1A 4HE2A 1NUZA 1IXSA 1UTHB 4X04A 2Q2EB 1ORYB 4K0KM 4PF8A 2P3VA 3EIHA 2QMXA 1SDXA 1TT1A 3DP6A 3H6UA 1IUDA 3K02A 2PVUA 3GQ3A 4H65A 2ONKE 5TP9B 3S9MC 5ICTA 2YFQA 4CHTB 3TCGA 3FVOA 1Q1KA 3T15A 1TDZA 3KS4A 4Q5TA 4LJ6A 1QUJA 2FIEA 2JXNA 1RDXA 3B74A 3LC8A 1QDTA 1GJSA 3QMFA 3PTYA 1NUXA 1NNFA 1ELJA 2CRUA 2XXTA 1EIJA 2UVJA 4BLAA 1B46A 1FBEA 2XXWA 1FTAA 3HSTA 1I6AA 1FPBA 2ZYKA 4IBDA 2O5RA 4O3BA 2V84A 2L09A 3RT8A 2JY8A 2ANJA 1PB7A 1IMFA 3CF0A 3E78A 3GLFB 2Z7JA 4F39A 4FWHA 3TWKA 3TODA 3J7BA 1B0HA 2LNHC 4G8NA 3UK4A 1KSFX 1MU5A 1H6UA 4JXIA 4Z7EA 4I81A 4QFPA 1TH3A 3IR1A 1N7XA 1DGHB 2JWSA 4LN5A 4KD5A 4P56A 1IIWA 3SESA 3KFMA 1QKBA 5EP3A 1IY1A 4DLDA 4PBQA 3L6GA 4PFWA 5LDZA 1ZTYA 1L1ZA 1SQYA 3SHFA 1XHBA 3TTKA 1J1NA 1RYXA 4D82A 3ZKLA 2R46A 3AJIB 4DI3D 1QZEA 3CFLA 4HCWA 1NV6A 1WODA 4POXA 5ET5A 5A5XA 2R4EA 2XFSA 2RC8A 4L17A 4Z0IA 4C0RA 3M3KA 1FBPA 3FTCA 4PCDA 4OEVA 1HT1E 3EN3A 2HXWA 5DVFA 2HEUA 2Y7IA 1FBHA 1B3LA 4MGYE 4YMBA 4BDMA 4N07A 3GQ5A 1Z7NE 5BPVA 1FQFA 2XXVA 3B7NA 4TLLB 2YJPA 5I57A 4ZEDA 4WW0A 4PP0A 4PGNA 3GO8A 3A09A 3HN0A 1FJ9A 1MY3A 1XXHE 3GLFE 1KFVA 1D0KA 2F78A 3O2AA 1W5SA 1M5EA 4KR5A 3VK7A 4G68B 1OVTA 2DE4A 3O97A 2HWJA 3PPRA 5DEXA 1EFUB 4H46A 3HZJA 2F7CA 5AA2A 4P1LA 2LVOC 3TZAA 1YXIA 1JVYA 3B6WA 2QBYB 3AOEC 3KOWE 3CRBA 4XF5A 5H8FB 3HX3A 3S2VA 4RF1A 4XEQA 4POWA 2JY7A 1SYIA 3R26A 4U2RA 4EUOA 1ZQ9A 3MC2A 4FORA 3GLHA 4DUYM 1VDLA 4XIGQ 4JI2M 1JQFA 2I6EA 4ANRA 4TLMB 4N6PA 3PGFA 2F7AA 2RF1A 4OQOA 3MP1A 3QUJA 3LUZA 4PFYA 1C7YA 4XXUA 3ZSFA 4EDPA 3VVDA 3KOYE 1IQ7A 2Z4RA 5ITTA 3N26A 1IN8A 3OO7A 1G0HA 1OQHA 1TR8A 4I5SA 4IBIA 5E26A 4LGMA 3FUVA 2REJA 4O3AA 3U6EA 1NL5A 4XFEA 2CWBA 1IY2A 1DGFA 2UUAM 3SEXA 5ITQA 1LGBC 4ZEFA 3MWBA 3KOZE 2I4BA 3GRUA 4QFKA 2F5OA 3IL1B 3SATA 1IXRC 3H6VA 2THIA 4OVTA 3SMSA 4OFLA 5EYFA 1KWHA 3QXMA 4E0WA 1Y20A 2ZNUA 2A5SA 1OJLA 2D5WA 2UXDM 4IO5A 1Z6TA 3LSFB 4LZJA 1IN5A 4GMQA 2ZNSA 3HCQA 1B32A 4NF5A 1GV8A 1JEUA 2DS9A 4GKKM 1RU3A 2ZZVA 4MB7A 4MAGA 4N15A 5EQAA 3MP6A 4XKNA 1MS7A 1QQWA 4XK8F 1IXHA 3MVXA 3SEUA 4PCZA 2DHRA 2YNMD 3M3LA 3OMBA 3LSWA 2XFTA 2Q89A 1IITA 3M0EA 3W15C 5EQ8A 3SMPA 4R74A 2G29A 2B65A 2C5RA 4NHBA 4EXLA 1UFZA 3EIEA 3GYYA 4GL8A 2Q2AA 2ZNTA 1UM8A 1MH3A 5H8HA 3IJXB 2KQZA 3D8BA 4LJ8A 2QL3A 4ITQA 5IM2A 2P1SA 3A46A 1QJMA 4HE1A 3Q8XA 3R8FA 4EF2A 3I5OA 3IOVA 3GLFA 1XC8A 4MH0E 1I4WA 1NNJA 1WDNA 2QS1A 1SW1A 2VPOA 5I5PA 2F35A 4IBCA 4QSEA 1FTJA 4RPOA 1EYIA 1L1TA 4F1IA 4F3PA 4QFOA 2DAEA 2PFYA 5ITYA 1FPFA 3U60A 1XOCA 4JI3M 2ERCA 1B3HA 4HLQA 4QHSA 1SD3A 3QYEA 1I6QA 1XMOM 4X62M 1GABA 2WYPA 4YB5A 5EQ7A 1LB9A 4DR5M 2ZAMA 3KOTA 4I9DA 1Y1MA 5EP4A 2F4VM 3FUZA 1QANA 4X65M 3FJMA 1KA0A 1POTA 1H3DA 4JI7M 3RY3A 1TH2A 2EKKA 5ITXA 1A5TA 5CRYA 3RQTA 1QW0A 3C33A 3CHGA 1YPNA 1UIVA 4LFBM 4DDDA 1O63A 4G61A 1E9SA 3IECA 1I69A 1FQBA 4GKJM 1IBLM 2L6OA 3K4UA 3UA8A 3EHUA 4ELPA 2JZ1A 4G68A 1CUKA 4PAIA 3PV0E 2RINA 3TQWA 1OFHA 1URGA 5IZZA 3MVYA 4QF9A 2ZZXA 2QS2A 3V83A 3HHXA 1S3SA 3HPIA 3MJNA 2WSEF 3G3GA 3W67A 1B5IA 4KHZE 2Y7RA 1Z5AA 3PPNA 3SEYA 2VGQA 3H7MA 2AHMA 2ONRA 4QSCA 1PJTA 2F3DA 3DP4A 2QVUA 2LVPC 2UXCM 3DM0A 3J7AS 3LSXA 1FTMA 5DW8A 3SERA 4JV5M 3L25A 4FBPA 2XXUA 1B6HA 3EQ1A 4LRTA 2K6BA 2BJVA 4NXMM 1DV0A 3M8UA 2CP8A 2D7EA 4NF6B 1IY0A 2F5QA 4CISA 1JEVA 3K01A 1BIYA 1XT8A 3WHLA 2CZKA 1N84A 1JVXA 1M5CA 1J5EM 1YE9A 4H8JA 4OA4A 1TFAA 1YCJA 1QDRA 3MQ9A 4LF6M 4DE8A 3FXQA 2RGOA 1F9BA 3TTRA 4ELOA 1R6BX 5F24A 2NVUB 3G3IA 4P1EA 3FZVA 1VE4A 3SEVA 2LXEA 4LG2A 2AIXA 4NRVA 1HQCA 2QFLA 3KN7A 4AS4A 2QVVA 4P11A 3D8LA 2RCAA 1EYKA 2MH8A 5DT6A 2KRUA 4G8HA 1MJGM 4LJ9A 4LZZA 2KHHA 3C58A 3U5ZA 4B3MM 1MXZA 1NY5A 2I7NA 3B7ZA 3I04M 4NWCA 1MDQA 4LF7M 1FSAA 4KXPA 5H37D 1PGYA 1MQIA 5AE4A 2ALUA 2XXYA 3NOHA 4OVJA 3UORA 1XC1A 1Z7ME 2B4MA 1WHCA 1FJGM 3B50A 4LP2B 3C4MA 4G8MA 5L9OA 2XSZA 1PB8A 2OCUA 1K9ZA 2R4JA 4R9FA 1A40A 4GWUA 1R4GA 3FJ7A 4M1VA 4OXVA 2DXRA 3TTLA 2L2DA 4O3CA 3O6IA 1MPDA 3JAMS 3C3DA 3HHYA 4R9GA 4GHLA 1ZMUA 2XWVA 5H8SA 2OOBA 4OVSA 3J2PB 2HAUA 5ISUA 3MVZA 2LHGA 2I49A 4JVIA 3LUYA 5J1DA 1LAFE 2LVQD 3MZ9A 4JN6A 4LF5M 3QYBA 3ISPA 4FEDA 3IO4A 2UVGA 5ITOA 2ZXTA 4WEDA 2N35A 2P5TA 4QRZA 2ZYNA 1M5FA 1Z5BA 1SBPA 5ELVA 1LB8A 4MJOA 1OLAA 3E79A 2CEAA 3Q28A 1IN4A 2C9OA 4QNRA 3N94A 2OOAA 2FOIC 2E5LM 4S12A 2RRUA 4E0XA 2ZTCA 1LTMA 3OO6A 2OLBA 3AV0A 1PBPA 5EXPA 4I3YA 1HNXM 3D4GA 1W5TA 2HFBA 2A5YB 1KYIA 1VR5A 3MSTA 4X48A 4U1ZA 4REZA 5KCJA 4GHAA 3HJ8A 1G41A 4YKJA 3UIFA 2HKJA 1SXJC 1B7HA 3GRYA 2RC7A 4AG6A 2FIXA 4X9TA 4X1DA 1FPLA 3TPZA 3UK6A 3FTFA 2FFJA 1IXCA 3CF2A 1IQPA 5AA4A 3FUUA 4QXDA 4R73A 3KEIA 3E46A 3GP1A 4YAHX 3L2AA 1R9QA 4JWXA 4N4UA 1TDHA 3AFHA 2LTUA 3ILKA 3I4YA 1URDA 3BXWA 5ET6A 2I0CA 2FNAA 1MPCA 5DNYA 5KDTA 2Q2CA 1MQHA 3A3CA 2CEXA 4H45A 3BKIB 4LFCM 1EZOA 2C98A 5CBRA 1X37A 4IIWA 4JI0M 5F3WA 2WBDA 3GPXA 5K2XA 3KXEC 1Y4CA 2VF8A 2MKZA 2QMWA 4OETA 3T9VA 3IOTA 4N81A 1XNRM 2ABHA 2VF7A 2AL4A 2PYYA 1ZBMA 1Y1ZA 3FUXA 3TWMA 2DXYA 3JZJA 3CGWA 3MJ5A 4KT0F 3E3KA 3KJ7A 4CIZA 1NY6A 2X4AA 4MMPA 2I3VA 1N34M 3KOSA 2YLNA 3M7GA 1A99A 3OXNA 3U61B 1GL7A 3R6UA 1NH7A 5KPRA 5JI2E 2XWOA 2XX9A 1H44A 1T0KA 4N13A 4GXAA 1ZIUA 3MUQA 2MROB 4YICA 3FKEA 4EQ7A 4RNSA 8CATA 1NFTA 4FE8A 4FIMA 4DXUA 4F2OA 1A54A 2QPAA 2PCRA 1WGLA 1DSNA 1UIUA 5AA1A 3MPLA 3VKGA 3IORA 2V25A 4F2QA 1MRPA 2OWTA 1FQDA 5TU0A 3GLGE 4MHFA 1QUIA 1D0LA 4L15A 2KLFA 2VOZA 4IBJA 5C1BA 1SVXB 3FGSA 5KQ8A 3TQSA 1Y3QA 4R75A 5L9MA 1T6OA 4IO7A 1E32A 3K9OA 3B89A 4OFOA 2QP9X 4L6V6 2OBGA 1G4AE 1R6ZA 1LCTA 5IZ3A 2DWNA 4ZE8A 4M9ZA 1PM5A 4DCYA 4XGIA 3C31A 2DDKA 2OWSA 4OW0A 4NF8A 1B51A 3DA1A 2VT5A 5A5XB 3SC3A 3PMVA 1E94E 2C96A 2DAMA 1QAMA 4QNMA 2XWKA 4LATA 4NRWA 3E4RA 4MLQA 4R6KA 3UGWA 3T9XB 4GL0A 4YMAA 2CZIA 3O28A 5I84A 2DENA 2VD2A 4HE0A 2ZTDA 5B7DA 1IN7A 3HWSA 4KCDA 4AB6A 2XXPA 4AG5A 2Q8MA 1B7UA 2QCUA 4YU0A 4KPTA 2LAOA 2GNOA 2G5GX 4FCWA 1B2HA 3ODBA 3PMXA 4BBAA 4KYSA 2V1CA 2R6FA 1OIBA 4GD5A 3GLIE 4G4QA 4D81A 4NGUA 1XWIA 3LVWA 2W7YA 1NUWA 4P17A 2H98A 3DFZA 2J5YA 3K92A 2Z8DA 4H67A 5DYGA 1UTBA 2DVWB 3PUVE 5F7VA 4CJ6A 1LBBA 2KNVA 4RK2A 3VDFA 1FJ6A 1Y4TA 3FE3A 4X64M 2YPNA 4G4OA 5KPZA 2VHAA 2OX3A 3CSGA 3GRVA 4HXVA 2VQFM 3ZQJA 3JR5A 3CI8A 4R7GA 5H8NB 4HTGA 2YQZA 3TL4X 3PMWA 2B3TA 2PFZA 1N36M 4NTLA 3UMMA 4FAJA 1Z59A 3KP1E 3QUFA 1QVSA 3IOUA 4FWGA 1NUYA 4EXKA 4GWSA 5I56B 4FD2A 4H8IA 2DAGA 3U60B 1AWBA 5JK4A 4F1VA 4DV3M 1R2YA 1Q3CA 2BJIA 3UZUA 4LFAM 1TWYA 5ITPA 1IXZA 5B70A 3LSLA 3ILUB 3NBIA 2H25A 3IOWA 4YB7A 4QSDA 4GLIA 4GITA 1YUBA 4B3RM 3L29A 1OFIA 2KW0A 2LH0A 5ESYA 3RGYA 4H1XA 3OSQA 3HY5A 1SYHA 2EJSA 3SYLA 3G7WA 2KZUA 2ZANA 1KA1A 5CMMA 3K6XA 2OWZA 3THIA 4U23A 1IZ1A 1MXXA 2MR9A 4JI4M 1EZPA 2DOJA 2O1MA 2EUCA 1FPEA 1WR1B 2XXKA 4OHNA 2VIIA 3VLFB 4I4LA 1UTHA 1PDAA 4FVMA 3UJNA 1B52A 4C1UA 3HU3A 2F8DA 2DWLA 1R2ZA 1OLCA 4OENA 1BVSA 5DTBA 5K2YA 2WZJA 1N0TA 2R62A 3M3FA 1PB9A 3VK8A 5L8DA 3T93B 1II5A 4PFIA 1JETA 4ZECA 4IBBA 2Y0QA 1LBCA 3TQLA 3TTNA 4DR7M 4MGKE 3VVFA 3U94A 4DBGB 4ZEBA 2F5PA 1PBQA 4PFUA 2V4CA 3U6SA 1LSTA 1ZMWA 4PC9A 1OQYA 3VE1B 4F1YA 1NNKA 1NV2A 4F18A 5JI3E 1DO2A 4B08A 5EQTA 3SYKA 1GLNA 2OQ4A 2ZMBA 5I2NB 1QUTA 4IJEA 1FW0A 3T0JA 3FRIA 2QQ8A 1XB2B 1MN3A 2BWBA 1B3GA 2KNAA 1QGXA 4MBPA 1NHWC 3IK6B 5FHNA 5EYGA 1WIVA 3DELB 2XXRA 3IJOB 3T6PA 3J81S 1ZV1A 3AKZA 4R72A 1NJFA 2RGHA 4ONYA 1A8EA 4WEPA 2G93A 3ZCBB 4F31B 4MM3B 2RCBA 4G3OA 4NX1A 1G3IA 2OO9A 3LW5F 1HSJA 2GHBA 1NO1A 1LBZA 3HV1A 4HCYA 3U6MA 1OTRA 3IB2A 5LOMA 2V1UA 2FYIA 4YKIA 1US4A 4G4RA 1A55A 4NEDA 4ZPXA 2O1LA 3JYRA 2NUVA 5EXTA 3OELA 3FIRA 4OFJA 4QBAA 3HU1A 3K2LA 2UU9M 1OAIA 3K9PA 5L9SA 3RUMA 3GQ4A 1D9VA 4R2BA 2OK2A 2O7UA 4R3DA 3L28A 1FPJA 4K3FA 5I59A 4DV1M 4ESWA 1M5DA 2R18A 1G0IA 2DVZA 1NH8A 3H03A 4DV4M 2HZLA 4U22A 4I62A 4BB9A 3QSLA 2CMOA 5FTHA 4BDRA 2OJTA 1G8PA 4KYEA 3V8XB 3PVSA 4O7MA 2XZUA 4X8RA 2D7HA 4HW8A 3FXUA 4DV7M 1DOTA 2WBBA 4O7IA 4IBEA 2FS1A 2FA7A 4L16A 5I59B 3FV1A 3D1RA 1IBMM 1BP5A 3GLBA 1FCKA 1AOVA 4XKPA 1LCFA 4B7GA 1K9YA 2KNZA 4N6KA 1MG1A 2ZM6M 4OERA 2QS3A 4I8OA 5EHSA 4QOZC 2F6PA 4OYVA 1JW4A 1FQEA 3S9EA 2M60A 3D4CA 1FBCA 3HO7A 2E1SA 3FD9A 4LJ5A 5FTJA 4GVOA 4MIJA 3OEMA 2XZFA 1PJQA 4MNCA 1QUKA 2DVCA 2CV0A 4DCXA 4DR2M 1QULA 2O7IA 2P0SA 4G6ZA 2GH9A 3T1YM 4R71A 3FV2A 4YHHM 3UN6A 5EQ9A 3FVNA 2ESNA 4QOSA 5JEIA 1PJIA 3HHWA 2DKLA 2CHVA 2R65A 2IEEA 2UUBM 1BLFA 2WSFF 5JTYA 4RYAA 5H8NA 2J7NA 4EF1A 3T9UA 3IHPA 3ILTB 3PU5A 5M2VA 2HHMA 2P2AA 4B3TM 4O94A 4GX6A 2RKMA 3A45A 4GX4A 4PFBA 3VDUA 1DPPA 4GRKA 4JSDA 2DAKA 5ITUA 1LFIA 3U6LA 2Q9TA 4ISUA 4TOZA 1MXUA 3SASA 2G8LA 2DWHA 4AB5A 3IX1A 4PGPA 1ZU0A 1N77A 1HSLA 3CG1A 2WYKA 5JTYB 1NI9A 2Z22A 2DE2A 3ROJA 3IB1A 4H5GA 2IA4A 2GRVA 3LBSA 3KVWA 1JNFA 1SW2A 1ATGA 1FQAA 1H45A 4RK9A 1NSFA 2YR0A 1TFDA 3VDPA 3HJSA 5EYHA 1TTEA 1JP4A 3T38A 4UA8A 5BUUA 2LVNC 1B40A 2GHAA 2I4CA 1BKAA 5ICQA 3KP0E 4NF4A 3CTWB 1NKXA 5AA2D 4NF8B 3GRRA 3K8ZA 4YB6A 4ESXA 5HBCA 3V76A 2V3TA 3FTEA 3RE8A 3WAFA 1I6BA 1LBXA 3GZGA 3FTDA 1P1WA 4RXLA 4XTCQ 3PFIA 2B4LA 2AL5A 4MNIA 3H4JA 4PE5B 3SAVA 3Q26A 3U61A 3VKHA 3EHTA 4MGIE 4BDOA 4XBOA 2C99A 1B5HA 3K1PA 3ECRA 2Q88A 1SW4A 1Y8GA 5DFLA 3KJTA 4H5FA 3R7XA 4GWWA 3I3VA 4B7FA 1TGUA 3FUTA 3ONMA 3SFZA 4U4XA 1K3XA 2G3QA 3HU2A 3B9PA 5FSWA 2Y84A 3U6PA 3U93A 1NV0A 1IXIA 2VP1A 3VLVA 1IN6A 4G2ZA 2QPQA 3FYCA 1MH4A 4RY1A 3IG5A 1V92A 2DZNB 1K82A 3MMPA 4YZZA 2KA6B 5KDTB 5EP1A 3GLGB 5T3JA 3FVKA 4GBWA 2UVIA 1PC3A 3U5ZB 2BJJX 2L7HA 2HZKA 3CVGA 5A5LA 5I7IA 2R6GE 2GFEA 4PE3A 1YAEA 2O25A 4IBFA 3Q27A 5CM6A 2F5NA 1OQGA 2J7OA 1MQGA 2QNJA 3U65A 3TYHA 4P8BA 2NXOA 3SAWA 4PDIA 1D9YA 1D4NA 2X7QA 5FTNA 5H8QA 3T1HM 1AL3A 3PUYE 5DVIA 1EE8A 3DZDA 3E21A 5IREB 3K1JA 2Y0TA 2HHHM 1NNTA 3C32A 1FTKA 4NSRA 2Z23A 2EA0A 1EH3A 2PT1A 4EIWA 3IO6A 2XWIA 3ZKKA 2L7IA 2KRKA 4RKUF 4LJ7A
chains in the Genus database with same CATH topology
1QYRA 2UYFA 4H6DA 3TAJA 3K00A 3LR1A 5CC2A 4FJPA 3RTFB 4F19A 4RF0A 3H4MA 2I48A 1JW5A 1RKMA 5KCJB 4R6HA 3TEPA 4TUWA 4GRIA 3T9HB 3OD7A 5I58A 3THGA 4JB7A 1MXVA 1MY2A 3C36A 1Y3NA 1IXGA 1LAXA 3CF6E 4FEBA 1R7RA 3I51A 3B6QA 4KI0E 4XKRA 3VFJA 3MHVC 3T96B 5IAIA 1E9RA 2O84X 3U6CA 2XD3A 2Y21A 3G3JA 3WHKA 4PFTA 1OVBA 4A3VB 2DWAA 2X49A 3JV9A 2XXQA 3FATA 4LONB 4Z6YA 3I4VA 2VQEM 4DV0M 2XX8A 2H1RA 1GL6A 3C9HA 1NMUA 4JWOA 3TMGA 5KZTA 3QYTA 4KCCA 5AA3A 2B3BA 2XF3A 3TKDA 5DYIA 1B58A 4B3SM 4DV2M 4F3GA 2DE3A 4F29A 1Y3PA 3IAZA 3BBRA 5ITXE 3A3UA 1Q35A 1B3EA 5H8FA 1J7KA 1GTKA 4AZFA 4LZ5A 4DZ1A 4GIPA 4JYAM 4ELQA 3VVEA 3DLNA 2HAVA 1C1KA 1N04A 4ZE9A 3RNNA 1USYE 4AQYM 4GF8A 1GKIA 5DVJA 3HHZA 3TTMA 4KHPM 2F7BA 2NQ8C 3V5AA 2Y7WA 3S9NC 4P0IA 1GR2A 1PEBA 3W9VA 4B7HA 1YTVA 2DP8A 4XKQA 4U4SA 4YKPA 3FJGA 3K2DA 4LRSA 5C18A 1VFDA 3KGCA 3AL0C 4OMBA 4LGYA 4WURA 1DMBA 3SETA 5ITRA 4JI6M 4NF6A 2V3UA 1B9JA 2XX7A 1L8QA 3PXGA 3S4UA 3GLIA 1N76A 2X8AA 5KQDA 4OEUA 3TUSA 4AKHA 4LUBA 5I2KB 4F1UA 4KLNA 2XHDA 2V6ZM 4LCBA 2CZLA 1HSEA 1ZAEA 1WVJA 5E6JA 3SARA 3EPEA 4GQOA 3L26A 1MXYA 1UQWA 3MZ1A 3AOEA 3FUWA 4FCTA 2F6GA 4IO3A 3KG2A 4DIGA 2NWJA 2ZBKB 1R1NA 3VV5A 1SXJD 4ZZAA 3DOAA 3BFUA 4FCVA 5LMNM 3H6TA 1FTLA 3KSJA 2Z4SA 4R2FA 1GVNA 3MW0A 4BDNA 1GVCA 5IZ7D 3E9SA 3R9XB 3EF7A 3CFZA 2NOOA 1N78A 3K6VA 3EHSA 4U1OA 1K3WA 3HGIA 4IO2A 1NHGC 1UTBB 3O6GA 2O68A 4U21A 3O9PA 3MBPA 3C34A 3U6OA 2DWMA 2UXBM 4GXSB 1XVYA 4OWDA 1JW1A 1G59A 3VFDA 4DR1M 1QKAA 4FECA 3SDFA 1S9TA 4LZ7A 2F34A 3UP9A 1JR3D 2A5TB 4MH5A 3HKPA 4TQUQ 2RKOA 1SW5A 3QAUA 1SI1A 3OO8A 5FHMA 2CE7A 3W9WA 2PBWA 3TELA 4KFQA 2XSZD 3OO9A 3FASA 1HNWM 2H99A 4WXJA 5GKNA 1FTOA 1SI0A 1B1HA 1IXSB 4QFNA 4RNAA 1AMFA 3IB0A 1LFGA 2XGNA 4ZDMA 3VLUA 3Q25A 4OESA 1VSOA 2Y7PA 4MF3A 1DTZA 4OVZB 4IO6A 3B6TA 1MM7A 1Q3BA 1LAHE 3U6QA 3O6HA 2A5TA 1LV7A 3G3HA 4NE4A 1MY4A 4PD2A 1IM2A 3CIJA 5H8HB 7CATA 1L5TA 4FWDA 4LVQA 1VFEA 4MGHA 4NF5B 1N3WA 2H9BA 3M6AA 5EP2A 3G3FA 5FTIA 1MQJA 1A8FA 2QENA 2D21A 4JSOA 1DO0A 5IWAM 2F97A 4DR4M 5EXXA 3GBBA 2ZYOA 3PPOA 4M9SA 3T22A 1USYH 5EHMA 4OX9M 1FQCA 4DR6M 3U8QA 4X66M 4P0GA 2UUCM 4ZEIA 4FATA 4DXBA 2FNCA 4Q8RA 2R45A 1R9LA 3GLIB 3USDA 3GPUA 5FTMA 3V89B 2KZSA 4LJ4A 1MXWA 2I0BA 3A42A 2Z8EA 5FTKA 2UXAA 3K6WA 2Z3XA 2ONSA 4GIZA 2OPFA 4YY3M 4G68C 2UYEA 3KS8A 4F3SA 3QWLA 1ZMGA 4NOOB 4QHQA 4AKGA 4LZ8A 4G4NA 2CHQA 3QK6A 1N32M 1IBKM 4R6YA 1AH5A 2DXIA 2M5ZA 2QS4A 1N75A 5A2QS 1P1OA 2VD3A 4NXNM 3F11A 3H06B 4NF4B 2DZOB 5BWJA 4GC5A 2W82A 2B3FA 3OENA 4IGRA 1ZKBA 2QRYA 3GLHB 1MY0A 2JA2A 5CMBA 2CUZA 1TXFA 3CR9A 1NJGA 3FXRA 1QZMA 2X26A 3L27A 1S7YA 2QBYA 4PT5A 1MM6A 2ZYMA 3K0VA 3PUWE 5AA2B 3PUXE 4CGYB 4LJAA 2V3QA 3MK6A 3RGSA 3G3KA 2QZ4A 4IBKA 3K1MA 4JI1M 3TCHA 1D2NA 3VXCA 1O7TA 3IG8A 4BDLA 1JQJC 3CG3A 2PX1A 3AOGA 5CBSA 2CV2A 4F22A 5TPAA 1N3XA 3HJQA 2KXEA 5I58B 5FTLA 1QVRA 4MFIA 4JDFA 3BOSA 1XVXA 1Y9UA 2REGA 3PD9A 3W0LB 1B1XA 4YKKA 2DWJA 2XLJA 3T66A 2RC9A 5HM4B 4II7A 5IT9S 5FHOA 4G77A 2O6AA 4ZS9A 3VLWA 3E13X 3LQQA 4HS7A 3L6HA 2WKYA 2EO2A 3H6WA 1IEJA 1O64A 4Z8XA 4G4PA 4MGZE 1US5A 3QAXA 3KW6A 2CV1A 2V93A 4IO4A 2XXIA 3LMMA 3PUZE 2XD2A 2DQVA 4AQ4A 3ZH9B 4BLCA 4GC9A 1P99A 1Z5CA 2F5SA 1XNQM 3KBRA 4D80A 2Y20A 3SHGB 2HQ0A 1QAOA 4L4UA 1DTGA 1ANFA 2LWXA 5H8QB 3KOXE 1ZLQA 3U1OA 1SXJB 3GBAA 4GOTA 2F36A 3RLFE 1NNUC 3RGPA 3E9XA 4HL4A 2UVHA 5FLXS 3J27B 3GLGA 4QFLA 2DWZB 4X1BA 3LVVA 3RN8A 3MZBA 2F5XA 2X7PA 5CMCA 4PDGA 4UACA 3GXAA 2OZZA 4DXCA 4C1TA 5TP9A 4ELRA 3PNYA 1AIVA 3SBJA 2KEBA 2DSFA 4LF8M 2PMSA 3OOAA 3U72A 4NSOB 5I56A 2QJEA 3TFLA 3H3GA 5EXSA 2HCAA 5CMKA 3HHFA 3HHGA 5I2KA 3O29A 2E0SA 2XEPA 3KDSE 1POY1 3U6DA 1B0LA 3OEKA 1XXHB 4GH9A 1DGGA 3OTOM 4PQJA 3GPYA 5TPAB 4DV5M 1DPEA 1RYOA 4LQ5A 1OMPA 1P1UA 3RFWA 1HT2E 1CB6A 5AA4B 3KZGA 4AW4A 3I6VA 2XXHA 3J80S 4JBZA 1DGBA 4PETA 3AXFA 4M0WA 4QHTA 4I1DA 1D3KA 3Q29A 4LY6A 2Z8FA 2CHGA 1EZ9A 3ZS6A 4MLVA 4L78A 4LA9A 4KQPA 4M4GA 3SEWA 4DV6M 3FYDA 5BR8M 4LF9M 4Q0CA 4IY5A 4W5WA 1XMQM 3MAMA 3TWLA 4JI5M 1H43A 1MX0A 4DUZM 1MQDA 1XS5A 2D7GA 4Q30B 1HNZM 1SXJA 1YSYA 4IJFA 1URSA 4M0DA 4IBGA 4ZZEA 4NMYA 1CE2A 4GFRA 3TCFA 2AYSA 4OTEA 3GPPA 3VXBA 1B05A 2DYXA 4JWYA 1EU8A 1P1QA 1N7WA 2CFOA 4NWDA 3SKPA 3KN8A 2XXXA 3FVGA 3U92A 2HCBA 5EJCA 1NNPA 3W0FA 4L8RC 1MPBA 4IGTA 1B3FA 3H4ZA 3B7DA 3TPAA 3A98B 1JR3A 2HL7A 2QSXA 4H0WA 3KFUG 4M9XA 4ZEKA 3C35A 2O69A 3FD3A 1B4ZA 3PPQA 1J09A 4IY6A 4JI8M 3RT6B 4I8CA 3SAUA 3NWLA 1LLSA 4JXJA 3ZC7B 2R71A 3TDJA 1XHYA 3KN3A 1FNNA 1M5BA 1L2BA 1DGHA 4P16A 3O66A 1L2CA 3P7IA 3S9LC 5IKBA 1QAQA 4RJZA 5I57B 1P1NA 2I3WA 4GWOA 3KSXA 3N5LA 4OZ9A 1NVMA 4ECFA 2H4IA 1BTJA 3TE6A 3CFXA 3MP8A 1HQYE 4ND9A 3WAEA 2D3IA 4NL4H 4KYDA 1LAGE 5CI5A 3PNVA 3BFTA 3LQRA 4OU7A 2Q8JA 1VDDA 3QIMA 5HPQA 5LMUM 1ZJLA 3RPWA 4DR3M 1MDP1 2I58A 4EQBA 1I94M 3OSRA 3RTWB 4EQ9A 4AI6A 1B7ZA 4F3BA 2R9JA 1S50A 2O51A 2BNKA 3PD8A 2DWIA 2M8CA 3MVWA 5DYHA 1WXQA 4OVZA 2FE8A 1L2DA 1Q39A 2PT2A 4RPNA 1TH4A 3N6TA 3N6UA 1SXJE 4AKIA 5DEXB 4BDQA 1N33M 5KPTA 2BJWA 5F1QA 4IB2A 1HR0M 4WKMA 4LQ2A 2ZAOA 1A7LA 1B5JA 5I2NA 4FW9A 3K1NA 4RA1A 1B4HA 2XH9A 5KO3A 3DP8A 3MPKA 4THIA 1T3TA 2I7PA 1PJJA 3JR4A 1XXHA 2C9CA 1GGGA 1LFHA 4KODA 2Y7KA 3UGJA 4LF4M 3K6UA 4KO8A 2H5YA 3CSBA 2K47A 1H76A 3PPPA 1MY1A 1UTHB 2Q2EB 1ORYB 4K0KM 3EIHA 2QMXA 1SDXA 1TT1A 3DP6A 3H6UA 1IUDA 3K02A 2PVUA 3GQ3A 4H65A 2ONKE 5TP9B 3S9MC 5ICTA 2YFQA 4CHTB 3TCGA 3FVOA 1Q1KA 3T15A 1TDZA 3KS4A 4Q5TA 4LJ6A 1QUJA 3LC8A 1NNFA 1ELJA 2XXTA 4BLAA 2UVJA 1B46A 2XXWA 3HSTA 1I6AA 2ZYKA 4IBDA 2O5RA 4O3BA 2V84A 2L09A 3RT8A 2ANJA 1PB7A 3CF0A 3GLFB 2Z7JA 4F39A 4FWHA 3TWKA 3TODA 3J7BA 1B0HA 2LNHC 4G8NA 3UK4A 1KSFX 1MU5A 1H6UA 4JXIA 4Z7EA 4I81A 4QFPA 1TH3A 3IR1A 1N7XA 1DGHB 4KD5A 1IIWA 3SESA 3KFMA 1QKBA 5EP3A 1IY1A 4DLDA 4PFWA 3L6GA 1ZTYA 1L1ZA 1SQYA 3SHFA 1XHBA 3TTKA 1J1NA 1RYXA 4D82A 3ZKLA 2R46A 3AJIB 5A5XA 3CFLA 4HCWA 4POXA 1WODA 2R4EA 2XFSA 2RC8A 4L17A 4Z0IA 4C0RA 3M3KA 3FTCA 4OEVA 1HT1E 3EN3A 2HXWA 5DVFA 2HEUA 2Y7IA 1B3LA 4MGYE 4YMBA 4BDMA 4N07A 3GQ5A 1Z7NE 5BPVA 1FQFA 2XXVA 4TLLB 2YJPA 5I57A 4ZEDA 4WW0A 4PP0A 3GO8A 3A09A 3HN0A 1MY3A 1KFVA 2F78A 3O2AA 1W5SA 1M5EA 4KR5A 3VK7A 4G68B 1OVTA 2DE4A 3O97A 3PPRA 5DEXA 2F7CA 5AA2A 3TZAA 1JVYA 3B6WA 2QBYB 3AOEC 3KOWE 3CRBA 5H8FB 3S2VA 4RF1A 4POWA 1SYIA 3R26A 4U2RA 4EUOA 1ZQ9A 3MC2A 4FORA 3GLHA 4DUYM 4XIGQ 4JI2M 1JQFA 2I6EA 4TLMB 4N6PA 3PGFA 2F7AA 2RF1A 4OQOA 3MP1A 3QUJA 4PFYA 4XXUA 3ZSFA 4EDPA 3VVDA 3KOYE 1IQ7A 2Z4RA 5ITTA 3N26A 1IN8A 3OO7A 1OQHA 4I5SA 4IBIA 5E26A 4LGMA 3FUVA 2REJA 4O3AA 3U6EA 1NL5A 1IY2A 1DGFA 2UUAM 3SEXA 5ITQA 1LGBC 4ZEFA 3MWBA 3KOZE 2I4BA 3GRUA 4QFKA 2F5OA 3IL1B 3SATA 1IXRC 3H6VA 2THIA 3SMSA 4OFLA 5EYFA 1KWHA 3QXMA 4E0WA 1Y20A 2ZNUA 2A5SA 1OJLA 2D5WA 2UXDM 4IO5A 1Z6TA 3LSFB 4LZJA 1IN5A 4GMQA 2ZNSA 3HCQA 1B32A 4NF5A 1GV8A 1JEUA 2DS9A 4GKKM 4MB7A 3MP6A 4XKNA 1MS7A 1QQWA 1IXHA 3MVXA 3SEUA 4PCZA 2DHRA 2YNMD 3M3LA 3OMBA 3LSWA 2XFTA 2Q89A 1IITA 3M0EA 3W15C 3SMPA 4R74A 2G29A 2B65A 2C5RA 4EXLA 3EIEA 4GL8A 2Q2AA 2ZNTA 1UM8A 1MH3A 5H8HA 3IJXB 3D8BA 4LJ8A 2QL3A 4ITQA 2P1SA 3A46A 1QJMA 3Q8XA 3R8FA 4EF2A 3I5OA 3IOVA 3GLFA 1XC8A 4MH0E 1I4WA 1NNJA 1WDNA 2QS1A 1SW1A 2F35A 4IBCA 4QSEA 1FTJA 4RPOA 1L1TA 4F3PA 4QFOA 5ITYA 3U60A 1XOCA 4JI3M 2ERCA 1B3HA 4HLQA 4QHSA 1SD3A 1I6QA 1XMOM 4X62M 4YB5A 1LB9A 4DR5M 2ZAMA 3KOTA 4I9DA 1Y1MA 5EP4A 2F4VM 3FUZA 1QANA 4X65M 3FJMA 1POTA 1H3DA 4JI7M 3RY3A 1TH2A 5ITXA 5CRYA 3RQTA 1QW0A 3C33A 1YPNA 1UIVA 4LFBM 4DDDA 1O63A 1E9SA 1I69A 1FQBA 4GKJM 1IBLM 2L6OA 3K4UA 3UA8A 3EHUA 4ELPA 4G68A 3PV0E 2RINA 3TQWA 1OFHA 1URGA 3MVYA 4QF9A 2QS2A 3V83A 3HHXA 1S3SA 3HPIA 3MJNA 3G3GA 1B5IA 4KHZE 2Y7RA 1Z5AA 3PPNA 3SEYA 2VGQA 3H7MA 2AHMA 2ONRA 4QSCA 3DP4A 2UXCM 3DM0A 3J7AS 3LSXA 1FTMA 3SERA 4JV5M 3L25A 2XXUA 1B6HA 3EQ1A 4LRTA 2BJVA 4NXMM 3M8UA 2D7EA 4NF6B 1IY0A 2F5QA 4CISA 1JEVA 3K01A 1BIYA 1XT8A 3WHLA 1N84A 1JVXA 1M5CA 1J5EM 1YE9A 4H8JA 1TFAA 1YCJA 3MQ9A 4LF6M 4DE8A 3FXQA 2RGOA 1F9BA 3TTRA 4ELOA 1R6BX 2NVUB 3G3IA 3FZVA 1VE4A 3SEVA 2LXEA 4LG2A 2AIXA 4NRVA 1HQCA 3KN7A 4P11A 3D8LA 2RCAA 5DT6A 2KRUA 4G8HA 4LJ9A 4LZZA 3C58A 3U5ZA 4B3MM 1MXZA 1NY5A 2I7NA 4NWCA 1MDQA 4LF7M 5H37D 1MQIA 5AE4A 2ALUA 2XXYA 4OVJA 3UORA 1XC1A 1Z7ME 1FJGM 4LP2B 3C4MA 4G8MA 5L9OA 2XSZA 1PB8A 2OCUA 2R4JA 4R9FA 1A40A 3FJ7A 4M1VA 4OXVA 2DXRA 3TTLA 4O3CA 3O6IA 1MPDA 3JAMS 3HHYA 4R9GA 4GHLA 5H8SA 3J2PB 2HAUA 5ISUA 3MVZA 2I49A 3LUYA 5J1DA 1LAFE 3MZ9A 4JN6A 4LF5M 4FEDA 3IO4A 2UVGA 5ITOA 2ZXTA 4WEDA 2P5TA 4QRZA 2ZYNA 1M5FA 1Z5BA 1SBPA 5ELVA 1LB8A 1OLAA 2CEAA 3Q28A 1IN4A 2C9OA 4QNRA 3N94A 2FOIC 2E5LM 4S12A 4E0XA 3OO6A 2OLBA 3AV0A 1PBPA 5EXPA 1HNXM 3D4GA 1W5TA 2HFBA 2A5YB 1KYIA 1VR5A 4X48A 5KCJA 4U1ZA 4REZA 4GHAA 3HJ8A 1G41A 4YKJA 3UIFA 2HKJA 1SXJC 1B7HA 3GRYA 2RC7A 4AG6A 4X9TA 4X1DA 3TPZA 3UK6A 3FTFA 2FFJA 1IXCA 3CF2A 1IQPA 5AA4A 3FUUA 4R73A 3KEIA 3GP1A 4YAHX 3L2AA 1R9QA 4JWXA 1TDHA 3AFHA 3ILKA 3I4YA 1URDA 2I0CA 2FNAA 1MPCA 5DNYA 5KDTA 2Q2CA 1MQHA 3A3CA 3BKIB 4LFCM 1EZOA 2C98A 5CBRA 1X37A 4IIWA 4JI0M 5F3WA 3GPXA 5K2XA 3KXEC 1Y4CA 4OETA 2QMWA 3T9VA 3IOTA 1XNRM 2ABHA 2AL4A 2PYYA 1Y1ZA 1ZBMA 3FUXA 3TWMA 2DXYA 3JZJA 3MJ5A 3E3KA 3KJ7A 1NY6A 2X4AA 2I3VA 1N34M 3KOSA 2YLNA 3M7GA 1A99A 3OXNA 3U61B 1GL7A 3R6UA 1NH7A 5KPRA 5JI2E 2XX9A 1H44A 1T0KA 4N13A 4GXAA 1ZIUA 3MUQA 4YICA 3FKEA 4EQ7A 4RNSA 8CATA 1NFTA 4FE8A 4FIMA 4DXUA 4F2OA 1A54A 2QPAA 1DSNA 1UIUA 5AA1A 3MPLA 3VKGA 3IORA 2V25A 4F2QA 1MRPA 2OWTA 1FQDA 5TU0A 1QUIA 4L15A 2KLFA 2VOZA 4IBJA 5C1BA 1SVXB 3FGSA 5KQ8A 3TQSA 1Y3QA 4R75A 5L9MA 4IO7A 1E32A 4OFOA 2QP9X 2OBGA 1G4AE 1R6ZA 1LCTA 2DWNA 4ZE8A 4M9ZA 1PM5A 4DCYA 4XGIA 3C31A 2OWSA 4OW0A 4NF8A 1B51A 3DA1A 5A5XB 3SC3A 3PMVA 1E94E 2C96A 1QAMA 4QNMA 4LATA 3E4RA 4NRWA 4MLQA 4R6KA 3UGWA 3T9XB 4GL0A 4YMAA 3O28A 5I84A 2VD2A 5B7DA 1IN7A 3HWSA 4KCDA 4AB6A 2XXPA 4AG5A 1B7UA 2QCUA 4YU0A 4KPTA 2LAOA 2G5GX 4FCWA 1B2HA 3ODBA 3PMXA 4BBAA 4KYSA 2V1CA 1OIBA 4GD5A 4G4QA 4D81A 1XWIA 3LVWA 2W7YA 2H98A 3DFZA 3K92A 2Z8DA 4H67A 5DYGA 1UTBA 2DVWB 3PUVE 5F7VA 1LBBA 4RK2A 3VDFA 1Y4TA 4X64M 2YPNA 4G4OA 5KPZA 2VHAA 3CSGA 3GRVA 2VQFM 3JR5A 3CI8A 4R7GA 5H8NB 4HTGA 2YQZA 3TL4X 3PMWA 1N36M 4NTLA 3UMMA 4FAJA 1Z59A 3KP1E 3QUFA 1QVSA 3IOUA 4FWGA 4EXKA 5I56B 4FD2A 4H8IA 3U60B 5JK4A 4F1VA 4DV3M 1R2YA 1Q3CA 3UZUA 4LFAM 1TWYA 5ITPA 1IXZA 5B70A 3LSLA 3ILUB 3NBIA 2H25A 3IOWA 4YB7A 4QSDA 4GLIA 4GITA 1YUBA 4B3RM 3L29A 1OFIA 2KW0A 2LH0A 3RGYA 4H1XA 3OSQA 1SYHA 3SYLA 3G7WA 2KZUA 2ZANA 5CMMA 3K6XA 3THIA 4U23A 1IZ1A 1MXXA 4JI4M 1EZPA 2DOJA 2O1MA 2EUCA 4OHNA 2VIIA 3VLFB 4I4LA 1UTHA 1PDAA 4FVMA 3UJNA 1B52A 4C1UA 3HU3A 2F8DA 2DWLA 1R2ZA 1OLCA 4OENA 5DTBA 5K2YA 1N0TA 2R62A 3M3FA 1PB9A 3VK8A 5L8DA 3T93B 1II5A 1JETA 4ZECA 4IBBA 2Y0QA 1LBCA 3TQLA 3TTNA 4DR7M 4MGKE 3VVFA 3U94A 4ZEBA 2F5PA 1PBQA 4PFUA 3U6SA 1LSTA 3VE1B 4F1YA 1NNKA 4F18A 5JI3E 1DO2A 4B08A 5EQTA 3SYKA 1GLNA 2OQ4A 2ZMBA 5I2NB 4IJEA 1FW0A 1B3GA 4MBPA 5FHNA 1NHWC 3IK6B 3DELB 2XXRA 3IJOB 3J81S 3AKZA 4R72A 1NJFA 2RGHA 4ONYA 1A8EA 4WEPA 2G93A 3ZCBB 4F31B 4MM3B 2RCBA 1G3IA 1HSJA 2GHBA 3HV1A 4HCYA 3U6MA 3IB2A 5LOMA 2V1UA 2FYIA 4YKIA 1US4A 4G4RA 1A55A 4NEDA 4ZPXA 2O1LA 3JYRA 2NUVA 5EXTA 3OELA 3FIRA 4OFJA 3HU1A 3K2LA 2UU9M 5L9SA 3RUMA 3GQ4A 1D9VA 4R2BA 2OK2A 2O7UA 4R3DA 3L28A 4K3FA 5I59A 4DV1M 4ESWA 1M5DA 2R18A 2DVZA 1NH8A 3H03A 4DV4M 2HZLA 4U22A 4I62A 4BB9A 3QSLA 2CMOA 5FTHA 4BDRA 2OJTA 1G8PA 4KYEA 3V8XB 3PVSA 2XZUA 2D7HA 4HW8A 3FXUA 4DV7M 1DOTA 4IBEA 2FA7A 4L16A 5I59B 3FV1A 1IBMM 1BP5A 3GLBA 1FCKA 1AOVA 4XKPA 1LCFA 4B7GA 1MG1A 2ZM6M 4OERA 2QS3A 4I8OA 5EHSA 4QOZC 2F6PA 4OYVA 1JW4A 1FQEA 3S9EA 2M60A 3D4CA 3HO7A 2E1SA 3FD9A 4LJ5A 5FTJA 4GVOA 3OEMA 2XZFA 1QUKA 2DVCA 2CV0A 4DCXA 4DR2M 1QULA 2O7IA 2P0SA 4G6ZA 2GH9A 3T1YM 3FV2A 4YHHM 3UN6A 3FVNA 2ESNA 4QOSA 5JEIA 1PJIA 3HHWA 2CHVA 2R65A 2IEEA 2UUBM 1BLFA 5JTYA 4RYAA 5H8NA 2J7NA 4EF1A 3T9UA 3ILTB 3PU5A 5M2VA 2P2AA 4B3TM 2RKMA 3A45A 3VDUA 1DPPA 4GRKA 4JSDA 5ITUA 1LFIA 3U6LA 2Q9TA 4ISUA 4TOZA 1MXUA 3SASA 2G8LA 2DWHA 4AB5A 3IX1A 1ZU0A 1N77A 1HSLA 3CG1A 5JTYB 2Z22A 2DE2A 3IB1A 4H5GA 2IA4A 2GRVA 3LBSA 3KVWA 1JNFA 1SW2A 1ATGA 1FQAA 1H45A 4RK9A 2YR0A 1NSFA 1TFDA 3VDPA 3HJSA 3T38A 4UA8A 5BUUA 2GHAA 1B40A 2I4CA 1BKAA 5ICQA 3KP0E 4NF4A 3CTWB 1NKXA 5AA2D 4NF8B 3GRRA 3K8ZA 4YB6A 4ESXA 5HBCA 2V3TA 3FTEA 3RE8A 3WAFA 1I6BA 3GZGA 3FTDA 1P1WA 4RXLA 4XTCQ 3PFIA 2AL5A 4PE5B 3SAVA 3Q26A 3U61A 3VKHA 3EHTA 4MGIE 4BDOA 4XBOA 2C99A 1B5HA 3K1PA 3ECRA 2Q88A 1SW4A 3KJTA 4H5FA 3R7XA 3I3VA 4B7FA 1TGUA 3FUTA 3ONMA 3SFZA 4U4XA 1K3XA 3HU2A 3B9PA 5FSWA 2Y84A 3U6PA 3U93A 1IXIA 2VP1A 3VLVA 1IN6A 4G2ZA 2QPQA 3FYCA 1MH4A 4RY1A 3IG5A 1K82A 2DZNB 4YZZA 2KA6B 5KDTB 5EP1A 3GLGB 3FVKA 2UVIA 1PC3A 3U5ZB 2BJJX 2L7HA 2HZKA 3CVGA 2R6GE 2GFEA 1YAEA 4IBFA 3Q27A 5CM6A 2F5NA 1OQGA 2J7OA 1MQGA 3TYHA 2NXOA 3SAWA 4PDIA 1D9YA 1D4NA 2X7QA 5FTNA 5H8QA 3T1HM 1AL3A 3PUYE 5DVIA 1EE8A 3DZDA 5IREB 2HHHM 3K1JA 2Y0TA 1NNTA 3C32A 1FTKA 4NSRA 2Z23A 2EA0A 1EH3A 2PT1A 4EIWA 3IO6A 3ZKKA 2L7IA 2KRKA 4LJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYF A;  4QFL A;  4H6D A;  3TAJ A;  3SEX A;  4X1B A;  3RN8 A;  1B7U A;  3K00 A;  3LR1 A;  3MZB A;  5CC2 A;  4YU0 A;  2F5X A;  2X7P A;  4FJP A;  1LGB C;  4KPT A;  2LAO A;  5CMC A;  4ZEF A;  3RTF B;  2I48 A;  3MWB A;  1JW5 A;  3ODB A;  1B2H A;  2I4B A;  1RKM A;  3GXA A;  4UAC A;  3PMX A;  5KCJ B;  2OZZ A;  4QFK A;  4R6H A;  4DXC A;  4C1T A;  5TP9 A;  3TEP A;  3IL1 B;  4ELR A;  1AIV A;  4KYS A;  3H6V A;  3T9H B;  2THI A;  3OD7 A;  1OIB A;  5I58 A;  4JB7 A;  4OFL A;  4GD5 A;  1MXV A;  1MY2 A;  3C36 A;  2DSF A;  2W7Y A;  1Y3N A;  1IXG A;  1LAX A;  2PMS A;  1KWH A;  3OOA A;  3QXM A;  5EYF A;  4E0W A;  1Y20 A;  2ZNU A;  4FEB A;  2A5S A;  2H98 A;  3B6Q A;  3U72 A;  4KI0 E;  2D5W A;  2QJE A;  4IO5 A;  4XKR A;  2Z8D A;  3TFL A;  3VFJ A;  3H3G A;  4H67 A;  1UTB A;  2HCA A;  3LSF B;  3T96 B;  5IAI A;  5CMK A;  3PUV E;  5F7V A;  1LBB A;  2ZNS A;  3HCQ A;  2O84 X;  1B32 A;  3HHF A;  4NF5 A;  1GV8 A;  4RK2 A;  2XD3 A;  3VDF A;  1JEU A;  2DS9 A;  3G3J A;  3HHG A;  4PFT A;  1Y4T A;  1OVB A;  5I2K A;  2YPN A;  3O29 A;  2DWA A;  3JV9 A;  2XXQ A;  2E0S A;  3FAT A;  2VHA A;  4LON B;  3CSG A;  3MP6 A;  4XKN A;  1POY 1;  1MS7 A;  1B0L A;  2XX8 A;  3OEK A;  3CI8 A;  5H8N B;  4HTG A;  3C9H A;  1IXH A;  1NMU A;  3MVX A;  4JWO A;  3PMW A;  3SEU A;  3TMG A;  5KZT A;  3QYT A;  4KCC A;  3OMB A;  3M3L A;  5AA3 A;  3LSW A;  2B3B A;  2Q89 A;  4NTL A;  1IIT A;  4FAJ A;  4PQJ A;  3TKD A;  5TPA B;  3W15 C;  1B58 A;  3QUF A;  1QVS A;  3IOU A;  4EXK A;  1DPE A;  4R74 A;  2G29 A;  2B65 A;  5I56 B;  4H8I A;  4F3G A;  2DE3 A;  4F29 A;  1RYO A;  4EXL A;  5JK4 A;  4F1V A;  1Y3P A;  3IAZ A;  3BBR A;  4LQ5 A;  1OMP A;  1P1U A;  4GL8 A;  2Q2A A;  2ZNT A;  1CB6 A;  1TWY A;  3A3U A;  1Q35 A;  3KZG A;  5AA4 B;  1B3E A;  3I6V A;  2XXH A;  5ITP A;  5H8F A;  1GTK A;  1MH3 A;  4LZ5 A;  4JBZ A;  5H8H A;  3IJX B;  5B70 A;  2QL3 A;  4PET A;  3LSL A;  4DZ1 A;  3AXF A;  3ILU B;  4I1D A;  4ELQ A;  3VVE A;  2H25 A;  1D3K A;  2P1S A;  3IOW A;  3DLN A;  3Q29 A;  1QJM A;  2HAV A;  2Z8F A;  4YB7 A;  1N04 A;  4ZE9 A;  1EZ9 A;  4QSD A;  3ZS6 A;  3RNN A;  1USY E;  4EF2 A;  3I5O A;  3IOV A;  4GF8 A;  4GLI A;  4MLV A;  5I56 A;  5DVJ A;  4LA9 A;  4KQP A;  1WDN A;  2QS1 A;  1SW1 A;  4M4G A;  3SEW A;  3TTM A;  2F7B A;  2F35 A;  3V5A A;  2Y7W A;  3RGY A;  3S9N C;  4QSE A;  1FTJ A;  4P0I A;  4H1X A;  3OSQ A;  1SYH A;  1GR2 A;  1PEB A;  4Q0C A;  4IY5 A;  4RPO A;  1YTV A;  2DP8 A;  3W9V A;  4XKQ A;  3MAM A;  4QFO A;  4F3P A;  4U4S A;  3G7W A;  4YKP A;  3FJG A;  3K2D A;  1VFD A;  1XOC A;  3KGC A;  1B3H A;  1SD3 A;  5CMM A;  1H43 A;  3K6X A;  4OMB A;  1I6Q A;  3THI A;  1MQD A;  4U23 A;  1IZ1 A;  4YB5 A;  1DMB A;  1XS5 A;  1MXX A;  3SET A;  4Q30 B;  1LB9 A;  4I9D A;  3KOT A;  1EZP A;  1Y1M A;  2DOJ A;  2O1M A;  3FUZ A;  1URS A;  4NF6 A;  2V3U A;  1B9J A;  2XX7 A;  3FJM A;  1POT A;  1H3D A;  3S4U A;  4OHN A;  4ZZE A;  1UTH A;  1N76 A;  4NMY A;  1PDA A;  3RY3 A;  1CE2 A;  4GFR A;  3TCF A;  2AYS A;  1B52 A;  4OEU A;  4C1U A;  3TUS A;  5CRY A;  4OTE A;  2F8D A;  1OLC A;  4LUB A;  4OEN A;  1QW0 A;  3C33 A;  5I2K B;  3RQT A;  5DTB A;  1YPN A;  4F1U A;  1UIV A;  5K2Y A;  4DDD A;  1O63 A;  3VXB A;  1B05 A;  1N0T A;  2DYX A;  4JWY A;  3M3F A;  1PB9 A;  2XHD A;  1EU8 A;  5L8D A;  1I69 A;  1P1Q A;  3T93 B;  1II5 A;  1FQB A;  2CZL A;  1N7W A;  1JET A;  3K4U A;  4ZEC A;  3UA8 A;  1LBC A;  1HSE A;  3EHU A;  3TQL A;  1WVJ A;  4NWD A;  3SKP A;  3TTN A;  4ELP A;  3KN8 A;  3VVF A;  4G68 A;  3U94 A;  3EPE A;  2XXX A;  4ZEB A;  1PBQ A;  4GQO A;  4PFU A;  1MXY A;  1LST A;  1UQW A;  3PV0 E;  2RIN A;  3MZ1 A;  3TQW A;  1URG A;  3VE1 B;  2F6G A;  1NNK A;  3FVG A;  3MVY A;  4F1Y A;  4F18 A;  3U92 A;  4QF9 A;  1NNP A;  4IO3 A;  2QS2 A;  3V83 A;  2ZMB A;  5I2N B;  1MPB A;  3KG2 A;  4IGT A;  1B3F A;  1FW0 A;  3HPI A;  3H4Z A;  3MJN A;  2NWJ A;  4DIG A;  1R1N A;  3B7D A;  1B5I A;  3G3G A;  3TPA A;  3VV5 A;  1B3G A;  4MBP A;  5FHN A;  4ZZA A;  3IK6 B;  4F19 A;  3BFU A;  3DEL B;  4KHZ E;  2QSX A;  2XXR A;  2Y7R A;  3H6T A;  3IJO B;  3PPN A;  4H0W A;  1FTL A;  4ZEK A;  3C35 A;  3SEY A;  3KSJ A;  2O69 A;  4R2F A;  2VGQ A;  3MW0 A;  4R72 A;  3H7M A;  4ONY A;  4BDN A;  2ONR A;  4QSC A;  1A8E A;  4WEP A;  3FD3 A;  1B4Z A;  2G93 A;  3DP4 A;  3PPQ A;  4IY6 A;  1GVC A;  3EF7 A;  3CFZ A;  4F31 B;  2NOO A;  3RT6 B;  4I8C A;  3DM0 A;  2RCB A;  3K6V A;  3EHS A;  3LSX A;  1FTM A;  3SER A;  4U1O A;  1HSJ A;  2GHB A;  1LLS A;  2XXU A;  1B6H A;  3EQ1 A;  4IO2 A;  3HV1 A;  1UTB B;  3O6G A;  2O68 A;  4U21 A;  4HCY A;  3M8U A;  2R71 A;  4NF6 B;  3O9P A;  3IB2 A;  3C34 A;  1XHY A;  3MBP A;  3TDJ A;  3KN3 A;  5LOM A;  1M5B A;  1JEV A;  2FYI A;  4GXS B;  1XVY A;  3K01 A;  4YKI A;  1US4 A;  1BIY A;  1JW1 A;  1XT8 A;  4OWD A;  1A55 A;  1N84 A;  1JVX A;  1M5C A;  3O66 A;  4NED A;  2O1L A;  3JYR A;  2NUV A;  3OEL A;  1QKA A;  3FIR A;  3P7I A;  1TFA A;  4FEC A;  4H8J A;  1YCJ A;  3SDF A;  5IKB A;  3S9L C;  1S9T A;  4RJZ A;  4LZ7 A;  2F34 A;  4OFJ A;  1P1N A;  2I3W A;  3UP9 A;  5I57 B;  3MQ9 A;  4GWO A;  3KSX A;  3N5L A;  4OZ9 A;  4DE8 A;  4ECF A;  2H4I A;  1BTJ A;  1F9B A;  3FXQ A;  3TTR A;  4ELO A;  3CFX A;  5L9S A;  3MP8 A;  2NVU B;  2A5T B;  4MH5 A;  4ND9 A;  3RUM A;  1D9V A;  3WAE A;  2D3I A;  4R2B A;  3G3I A;  2OK2 A;  4KYD A;  2O7U A;  3FZV A;  4TQU Q;  1LAG E;  1SW5 A;  5CI5 A;  3BFT A;  1VE4 A;  3SEV A;  1SI1 A;  4K3F A;  5I59 A;  2Q8J A;  3OO8 A;  2AIX A;  3QIM A;  5FHM A;  5HPQ A;  4ESW A;  3W9W A;  1M5D A;  2PBW A;  4KFQ A;  2DVZ A;  3TEL A;  3KN7 A;  1NH8 A;  3OO9 A;  1ZJL A;  3FAS A;  4P11 A;  3H03 A;  2RCA A;  3RPW A;  2HZL A;  5DT6 A;  4U22 A;  1MDP 1;  2H99 A;  4G8H A;  4I62 A;  4WXJ A;  1FTO A;  1SI0 A;  1MXZ A;  2I58 A;  4EQB A;  3QSL A;  3OSR A;  3RTW B;  2CMO A;  1B1H A;  4EQ9 A;  1B7Z A;  5FTH A;  4F3B A;  4QFN A;  1AMF A;  3IB0 A;  1MDQ A;  4NWC A;  2R9J A;  1S50 A;  2O51 A;  1LFG A;  2OJT A;  4KYE A;  4BDR A;  3V8X B;  4ZDM A;  1MQI A;  3VLU A;  5AE4 A;  2ALU A;  2XXY A;  2DWI A;  3PD8 A;  3Q25 A;  4OVJ A;  4OES A;  3UOR A;  2M8C A;  1XC1 A;  1VSO A;  2Y7P A;  3MVW A;  1Z7M E;  4MF3 A;  5DYH A;  1DTZ A;  3FXU A;  4HW8 A;  4LP2 B;  3C4M A;  3B6T A;  4IO6 A;  1DOT A;  2PT2 A;  4G8M A;  1MM7 A;  1LAH E;  4RPN A;  5L9O A;  1PB8 A;  3O6H A;  2A5T A;  3N6T A;  2FA7 A;  2OCU A;  3N6U A;  5I59 B;  3G3H A;  4NE4 A;  3FV1 A;  1MY4 A;  4R9F A;  5DEX B;  4BDQ A;  1A40 A;  1BP5 A;  3FJ7 A;  3GLB A;  4M1V A;  5H8H B;  3CIJ A;  4OXV A;  2DXR A;  3TTL A;  1FCK A;  5F1Q A;  4IB2 A;  1L5T A;  4O3C A;  4LVQ A;  1AOV A;  3O6I A;  1VFE A;  1MPD A;  4NF5 B;  1N3W A;  4XKP A;  2H9B A;  4WKM A;  4LQ2 A;  1LCF A;  1A7L A;  4R9G A;  1B5J A;  1MG1 A;  3G3F A;  5I2N A;  5FTI A;  1MQJ A;  3K1N A;  5H8S A;  4RA1 A;  1A8F A;  4OER A;  2QS3 A;  5EHS A;  2D21 A;  4JSO A;  1B4H A;  2F6P A;  4OYV A;  2HAU A;  3DP8 A;  5ISU A;  3MVZ A;  1JW4 A;  1FQE A;  2F97 A;  3S9E A;  2I49 A;  3MPK A;  3LUY A;  4THI A;  3GBB A;  2ZYO A;  3PPO A;  5J1D A;  3T22 A;  3D4C A;  3HO7 A;  2E1S A;  1LAF E;  1USY H;  5EHM A;  1GGG A;  1FQC A;  3MZ9 A;  1LFH A;  2Y7K A;  4GVO A;  3U8Q A;  3OEM A;  4FED A;  3IO4 A;  2UVG A;  1QUK A;  4P0G A;  2DVC A;  3K6U A;  5ITO A;  4DCX A;  2P0S A;  1QUL A;  2O7I A;  2ZXT A;  4WED A;  4ZEI A;  2H5Y A;  4QRZ A;  4FAT A;  2ZYN A;  2GH9 A;  4DXB A;  3CSB A;  1H76 A;  1M5F A;  1SBP A;  2FNC A;  3FV2 A;  5ELV A;  1LB8 A;  3PPP A;  1MY1 A;  3UN6 A;  1OLA A;  4Q8R A;  3FVN A;  1R9L A;  2ESN A;  1UTH B;  3USD A;  5JEI A;  3Q28 A;  3N94 A;  3V89 B;  2QMX A;  1SDX A;  1TT1 A;  4E0X A;  3DP6 A;  3OO6 A;  2OLB A;  2IEE A;  1PBP A;  3H6U A;  1BLF A;  1IUD A;  1MXW A;  2PVU A;  3K02 A;  4H65 A;  3D4G A;  5JTY A;  2ONK E;  5TP9 B;  2HFB A;  4RYA A;  2I0B A;  5ICT A;  3S9M C;  5H8N A;  3TCG A;  1VR5 A;  2Z8E A;  2UXA A;  4X48 A;  4U1Z A;  3K6W A;  4EF1 A;  5KCJ A;  3FVO A;  1Q1K A;  2ONS A;  4GIZ A;  4G68 C;  4YKJ A;  4Q5T A;  3T9U A;  2UYE A;  1QUJ A;  3ILT B;  3PU5 A;  5M2V A;  3UIF A;  3LC8 A;  4F3S A;  1B7H A;  1ZMG A;  2RC7 A;  4QHQ A;  1NNF A;  1ELJ A;  4LZ8 A;  2P2A A;  2XXT A;  4BLA A;  2UVJ A;  4X9T A;  4X1D A;  1B46 A;  2RKM A;  2XXW A;  3QK6 A;  3HST A;  1DPP A;  1I6A A;  1IXC A;  2ZYK A;  4GRK A;  4R6Y A;  4JSD A;  5AA4 A;  1AH5 A;  2QS4 A;  3KEI A;  1LFI A;  4R73 A;  2Q9T A;  4ISU A;  4TOZ A;  1R9Q A;  1MXU A;  4O3B A;  4YAH X;  4JWX A;  2DWH A;  1P1O A;  2V84 A;  2VD3 A;  4AB5 A;  3RT8 A;  3IX1 A;  3F11 A;  1ZU0 A;  3H06 B;  2ANJ A;  4NF4 B;  1HSL A;  1PB7 A;  3CG1 A;  5JTY B;  5BWJ A;  2Z22 A;  1URD A;  2B3F A;  3OEN A;  4IGR A;  1ZKB A;  2DE2 A;  3IB1 A;  4F39 A;  4H5G A;  2I0C A;  2QRY A;  1MPC A;  2IA4 A;  2GRV A;  3LBS A;  3TOD A;  1B0H A;  1JNF A;  1MY0 A;  4G8N A;  5CMB A;  1SW2 A;  3UK4 A;  1ATG A;  1FQA A;  4JXI A;  4Z7E A;  5KDT A;  1TXF A;  1H45 A;  4RK9 A;  2Q2C A;  1MQH A;  3A3C A;  3CR9 A;  4QFP A;  3FXR A;  1TFD A;  2X26 A;  3BKI B;  1S7Y A;  3IR1 A;  1N7X A;  1EZO A;  1MM6 A;  2ZYM A;  3K0V A;  5CBR A;  3PUW E;  5AA2 B;  3PUX E;  4KD5 A;  4UA8 A;  5BUU A;  1IIW A;  2V3Q A;  3SES A;  3KFM A;  1QKB A;  1B40 A;  2GHA A;  2I4C A;  5CBS A;  1BKA A;  4PFW A;  3L6G A;  3G3K A;  5K2X A;  1Y4C A;  1ZTY A;  4NF4 A;  4OET A;  1NKX A;  2QMW A;  3T9V A;  5AA2 D;  1SQY A;  4NF8 B;  3IOT A;  3K1M A;  3TTK A;  3TCH A;  1J1N A;  2ABH A;  1RYX A;  4YB6 A;  1O7T A;  3VXC A;  4ESX A;  3ZKL A;  4BDL A;  5HBC A;  2AL4 A;  2PYY A;  3CG3 A;  2PX1 A;  2V3T A;  5A5X A;  3CFL A;  4HCW A;  4POX A;  1WOD A;  1Y1Z A;  1ZBM A;  5TPA A;  1I6B A;  2DXY A;  3GZG A;  3JZJ A;  3WAF A;  4F22 A;  1P1W A;  4RXL A;  3KJ7 A;  3E3K A;  4XTC Q;  1N3X A;  2AL5 A;  2RC8 A;  4L17 A;  4Z0I A;  2I3V A;  4C0R A;  5I58 B;  3M3K A;  3KOS A;  4OEV A;  2YLN A;  3EN3 A;  2HXW A;  1A99 A;  4MFI A;  3OXN A;  2HEU A;  2Y7I A;  4JDF A;  4PE5 B;  5DVF A;  3Q26 A;  1XVX A;  1B3L A;  1NH7 A;  1Y9U A;  3EHT A;  3R6U A;  4BDO A;  4YMB A;  2XX9 A;  1H44 A;  4BDM A;  4N07 A;  2REG A;  1T0K A;  4N13 A;  4GXA A;  1B5H A;  1Z7N E;  1ZIU A;  3MUQ A;  3K1P A;  3PD9 A;  1FQF A;  1B1X A;  2XXV A;  4YIC A;  3ECR A;  2Q88 A;  4RNS A;  1NFT A;  4FE8 A;  4FIM A;  4EQ7 A;  4TLL B;  1SW4 A;  4DXU A;  2YJP A;  3KJT A;  4YKK A;  4ZED A;  4H5F A;  3R7X A;  2DWJ A;  4F2O A;  5I57 A;  1A54 A;  3T66 A;  2RC9 A;  5HM4 B;  4PP0 A;  1DSN A;  1UIU A;  3A09 A;  3I3V A;  5AA1 A;  3HN0 A;  3MPL A;  3ONM A;  4U4X A;  5FHO A;  1MY3 A;  4G77 A;  2O6A A;  4ZS9 A;  3VLW A;  3E13 X;  2F78 A;  2Y84 A;  3IOR A;  3O2A A;  2V25 A;  3U93 A;  4HS7 A;  4F2Q A;  3L6H A;  1IXI A;  1M5E A;  2VP1 A;  2WKY A;  1MRP A;  1IEJ A;  1FQD A;  1O64 A;  2OWT A;  3H6W A;  4KR5 A;  5TU0 A;  4G4P A;  4G68 B;  1US5 A;  1QUI A;  4G2Z A;  3QAX A;  1OVT A;  2DE4 A;  2QPQ A;  1MH4 A;  3O97 A;  3PPR A;  2KLF A;  4IO4 A;  2V93 A;  4RY1 A;  2VOZ A;  5DEX A;  2F7C A;  4YZZ A;  5AA2 A;  2XXI A;  3TZA A;  1SVX B;  3FGS A;  1JVY A;  3B6W A;  5KDT B;  3PUZ E;  2XD2 A;  2DQV A;  1Y3Q A;  3FVK A;  2UVI A;  1PC3 A;  4AQ4 A;  4R75 A;  5L9M A;  2BJJ X;  3CRB A;  4IO7 A;  4DLD A;  5H8F B;  2HZK A;  1P99 A;  3CVG A;  3S2V A;  4OFO A;  2R6G E;  2GFE A;  3VLV A;  3KBR A;  1YAE A;  2OBG A;  1SYI A;  3R26 A;  4POW A;  3Q27 A;  4U2R A;  1R6Z A;  1LCT A;  1OQG A;  3MC2 A;  4FOR A;  1MQG A;  4ZE8 A;  4EUO A;  5CM6 A;  4XIG Q;  4DCY A;  2HQ0 A;  1JQF A;  2I6E A;  3TYH A;  2NXO A;  3C31 A;  4N6P A;  4TLM B;  2OWS A;  2F7A A;  2RF1 A;  1DTG A;  3PGF A;  4NF8 A;  4OQO A;  1B51 A;  3MP1 A;  3QUJ A;  4PFY A;  4XXU A;  1D9Y A;  1ANF A;  1D4N A;  2X7Q A;  3PMV A;  5H8Q A;  5H8Q B;  5A5X B;  3ZSF A;  4EDP A;  3VVD A;  1AL3 A;  3PUY E;  5DVI A;  4LAT A;  3E4R A;  4R6K A;  1IQ7 A;  4MLQ A;  3UGW A;  1NNT A;  1ZLQ A;  3C32 A;  3U1O A;  3T9X B;  4GL0 A;  4YMA A;  3N26 A;  3GBA A;  3O28 A;  3OO7 A;  1FTK A;  4GOT A;  2Z23 A;  1OQH A;  2VD2 A;  5I84 A;  2F36 A;  1EH3 A;  2PT1 A;  4O3A A;  2REJ A;  3RLF E;  3IO6 A;  4KCD A;  5B7D A;  5ICQ A;  3ZKK A;  4AB6 A;  2XXP A;  3E9X A;  1NL5 A;  2UVH A; 
#chains in the Genus database with same CATH topology
 1QYR A;  2UYF A;  3KC1 A;  4H6D A;  3TAJ A;  3K00 A;  3LR1 A;  5CC2 A;  4FJP A;  3RTF B;  4F19 A;  4RF0 A;  3H4M A;  2I48 A;  1JW5 A;  1RKM A;  5KCJ B;  1XI6 A;  4R6H A;  3TEP A;  4MNP A;  4TUW A;  4GRI A;  3T9H B;  3OD7 A;  5I58 A;  3THG A;  4JB7 A;  5LTC A;  1LBV A;  1MXV A;  1MY2 A;  3C36 A;  1Y3N A;  1IXG A;  1LAX A;  3CF6 E;  4FEB A;  1R7R A;  3I51 A;  3B6Q A;  4KI0 E;  4XKR A;  3VFJ A;  3MHV C;  3T96 B;  5IAI A;  1QUS A;  1E9R A;  2O84 X;  3U6C A;  4UN2 B;  2XD3 A;  2Y21 A;  4OVQ A;  3G3J A;  3WHK A;  4PFT A;  1OVB A;  4A3V B;  2DWA A;  3IFC A;  2X49 A;  3EKI A;  2XXQ A;  3JV9 A;  3FAT A;  4LON B;  4Z6Y A;  3I4V A;  2VQE M;  4OAN A;  4DV0 M;  2XX8 A;  4PTK A;  2H1R A;  1GL6 A;  3C9H A;  1NMU A;  4JWO A;  1RDY A;  3TMG A;  5KZT A;  3QYT A;  4KCC A;  5AA3 A;  2B3B A;  2P3N A;  4MCO A;  2XF3 A;  3TKD A;  5DYI A;  1B58 A;  1JR3 E;  4B3S M;  2H5X A;  4DV2 M;  4F3G A;  2DE3 A;  4F29 A;  4I3E A;  1Y3P A;  3IAZ A;  3BBR A;  5ITX E;  3A3U A;  1Q35 A;  1B3E A;  5H8F A;  1J7K A;  1GTK A;  4AZF A;  4LZ5 A;  3BIG A;  4DZ1 A;  4GIP A;  4JYA M;  1INP A;  4ELQ A;  3VVE A;  3DLN A;  2HAV A;  1C1K A;  1N04 A;  4ZE9 A;  3RNN A;  1USY E;  4AQY M;  4GF8 A;  1GKI A;  5DVJ A;  3HHZ A;  3TTM A;  4KHP M;  2F7B A;  2NQ8 C;  3V5A A;  2Y7W A;  2DI0 A;  3S9N C;  4P0I A;  1GR2 A;  1PEB A;  3W9V A;  4B7H A;  1YTV A;  2DP8 A;  4XKQ A;  4U4S A;  4YKP A;  5J16 A;  3FJG A;  3K2D A;  4LRS A;  5C18 A;  1VFD A;  3KGC A;  3AL0 C;  4OMB A;  2HXR A;  4LGY A;  4WUR A;  3BIH A;  1DMB A;  3SET A;  3SZP A;  2LBC A;  5ITR A;  4JI6 M;  2JY6 B;  1EYJ A;  4NF6 A;  2V3U A;  1B9J A;  2XX7 A;  1L8Q A;  1LBW A;  3PXG A;  3S4U A;  3GLI A;  1N76 A;  2X8A A;  5KQD A;  4OEU A;  3TUS A;  4AKH A;  1NV4 A;  4LUB A;  5I2K B;  4F1U A;  4KLN A;  2XHD A;  2V6Z M;  4LCB A;  2CZL A;  4N17 A;  1HSE A;  1ZAE A;  1WVJ A;  5E6J A;  3SAR A;  3EPE A;  3C3E A;  4GQO A;  1VG5 A;  3L26 A;  1MXY A;  3FRH A;  1UQW A;  3MZ1 A;  1IMB A;  3AOE A;  3FUW A;  4FCT A;  2F6G A;  1NV5 A;  4IO3 A;  3KG2 A;  4DIG A;  2NWJ A;  2ZBK B;  1R1N A;  3VV5 A;  1SXJ D;  4ZZA A;  3DOA A;  3BFU A;  4FCV A;  5LMN M;  3H6T A;  1FTL A;  3KSJ A;  2LHC A;  2Z4S A;  4R2F A;  1GVN A;  1OIZ A;  3MW0 A;  1Q02 A;  1VDW A;  4BDN A;  3I01 M;  1GVC A;  5IZ7 D;  3E9S A;  3R9X B;  3EF7 A;  3CFZ A;  2NOO A;  1N78 A;  4NQ8 A;  3K6V A;  3EHS A;  4U1O A;  2JUJ A;  1K3W A;  3HGI A;  4IO2 A;  1NHG C;  1UTB B;  3O6G A;  2O68 A;  4U21 A;  3O9P A;  4HEO A;  3KC0 A;  3C34 A;  3MBP A;  3LCU A;  3U6O A;  2DWM A;  2UXB M;  4GXS B;  1XVY A;  1NV8 A;  1FRP A;  4OWD A;  1JW1 A;  1G59 A;  3VFD A;  4DR1 M;  4MX6 A;  1QKA A;  4FEC A;  3SDF A;  1S9T A;  4LZ7 A;  2F34 A;  3UP9 A;  4GWX A;  1JR3 D;  2A5T B;  4MH5 A;  3HKP A;  4TQU Q;  2RKO A;  2LVA A;  1SW5 A;  3QAU A;  4GWY A;  1SI1 A;  3OO8 A;  5FHM A;  2CE7 A;  3W9W A;  2PBW A;  3TEL A;  4KFQ A;  2WX9 A;  2XSZ D;  3OO9 A;  3FAS A;  1HNW M;  3T1B A;  2H99 A;  4WXJ A;  5GKN A;  1FTO A;  1SI0 A;  3RPL B;  1B1H A;  1IXS B;  4QFN A;  4RNA A;  1AMF A;  3IB0 A;  3HFU A;  1LFG A;  1DBZ A;  2XGN A;  4ZDM A;  3VLU A;  3Q25 A;  1FPK A;  4OES A;  1VSO A;  2Y7P A;  4MF3 A;  1DTZ A;  4OVZ B;  4IO6 A;  3B6T A;  1MM7 A;  1Q3B A;  1LAH E;  2KDL A;  3U6Q A;  2L5V A;  3O6H A;  2A5T A;  1LBY A;  4DI4 B;  1LV7 A;  3G3H A;  4NE4 A;  1MY4 A;  4PD2 A;  1IM2 A;  3CIJ A;  5H8H B;  7CAT A;  1L5T A;  4FWD A;  4LVQ A;  2XA5 A;  1VFE A;  4MGH A;  4NF5 B;  1N3W A;  2H9B A;  3M6A A;  5EP2 A;  3G3F A;  2JP7 A;  5FTI A;  1MQJ A;  1A8F A;  2QEN A;  1YYZ A;  2D21 A;  4JSO A;  3LV0 A;  2L4E A;  1DO0 A;  5IWA M;  5FBP A;  2F97 A;  4DR4 M;  1FBF A;  5EXX A;  3GBB A;  2ZYO A;  3PPO A;  4M9S A;  3T22 A;  4PDH A;  1USY H;  4JVD A;  5EHM A;  4OX9 M;  1FQC A;  4DR6 M;  1D9Q A;  1FBG A;  2KR0 A;  3U8Q A;  1P3Q Q;  4X66 M;  4P0G A;  2FH0 A;  2UUC M;  1FPD A;  4ZEI A;  1SPI A;  4FAT A;  4DXB A;  4PAK A;  2FNC A;  4Q8R A;  2R45 A;  1R9L A;  3GLI B;  3USD A;  1SG9 A;  3GPU A;  5FTM A;  2WEF A;  3V89 B;  2KZS A;  2MGW A;  4LJ4 A;  4GWZ A;  1MXW A;  2I0B A;  3A42 A;  2Z8E A;  5FTK A;  2UXA A;  4UAB A;  3K6W A;  4AS5 A;  2Z3X A;  2ONS A;  4GIZ A;  2OPF A;  4YY3 M;  4G68 C;  2UYE A;  3KS8 A;  4F3S A;  3QWL A;  1ZMG A;  4NOO B;  4QHQ A;  1VQ1 A;  4AKG A;  4LZ8 A;  4G4N A;  1Q9D A;  2CHQ A;  3QK6 A;  3C9P A;  1N32 M;  1IBK M;  4R6Y A;  1AH5 A;  2DXI A;  2HAK A;  2M5Z A;  2QS4 A;  3NBX X;  1N75 A;  5A2Q S;  2F3B A;  1P1O A;  2VD3 A;  4NXN M;  3F11 A;  3H06 B;  4NF4 B;  2DNA A;  4NF0 A;  3IFA A;  2DZO B;  5BWJ A;  4GC5 A;  2W82 A;  2B3F A;  3OEN A;  4IGR A;  1ZKB A;  1YZ0 A;  2QRY A;  3GLH B;  5ET8 A;  3B8B A;  1MY0 A;  2JA2 A;  5CMB A;  4NAP A;  2CUZ A;  1TXF A;  1G71 A;  5I3S A;  3CR9 A;  1D0M A;  1NJG A;  4P9K A;  3FXR A;  1QZM A;  2X26 A;  4I40 A;  3L27 A;  1S7Y A;  2QBY A;  4PT5 A;  1VEJ A;  1MM6 A;  2ZYM A;  3K0V A;  3PUW E;  5AA2 B;  3PUX E;  4CGY B;  4LJA A;  4Q7J A;  2V3Q A;  3MK6 A;  3RGS A;  3G3K A;  2DAI A;  2QZ4 A;  2JNH A;  4IBK A;  2GQF A;  3K1M A;  4JI1 M;  3TCH A;  3BBZ A;  1D2N A;  3VXC A;  1O7T A;  2R8T A;  3IG8 A;  4BDL A;  1JQJ C;  3CG3 A;  2PX1 A;  3FBP A;  3AOG A;  5CBS A;  4P47 A;  1NV7 A;  1BK4 A;  2CV2 A;  4F22 A;  5TPA A;  2QHO B;  1IFY A;  1N3X A;  3HJQ A;  4IR8 A;  2KXE A;  5I58 B;  1LEV A;  2R0I A;  5FTL A;  1QVR A;  4MFI A;  3FXB A;  4JDF A;  3BOS A;  1XVX A;  2O01 F;  1Y9U A;  2DZL A;  2VDB B;  1NV1 A;  1AUA A;  2REG A;  2Z8Y M;  3PD9 A;  2WSC F;  3W0L B;  1B1X A;  2MJ5 B;  2QVR A;  4N8G A;  4YKK A;  2DWJ A;  2XLJ A;  3T66 A;  2RC9 A;  5HM4 B;  4II7 A;  5IT9 S;  5FHO A;  4G77 A;  2O6A A;  4ZS9 A;  3VLW A;  3E13 X;  3LQQ A;  1TF0 B;  4HS7 A;  1WGN A;  3L6H A;  2WKY A;  2EO2 A;  3H6W A;  1IEJ A;  1O64 A;  1OKS A;  4Z8X A;  4G4P A;  4MGZ E;  1R5L A;  1IMD A;  1US5 A;  1DK4 A;  3QAX A;  3KW6 A;  2CV1 A;  2V93 A;  4IO4 A;  2K9D A;  2XXI A;  3LMM A;  1NV9 A;  3PUZ E;  2XD2 A;  2DQV A;  4AQ4 A;  3ZH9 B;  4BLC A;  4GC9 A;  1P99 A;  1Z5C A;  2F5S A;  1XNQ M;  3KBR A;  4D80 A;  4GEW A;  2Y20 A;  3SHG B;  2HQ0 A;  1QAO A;  4L4U A;  1VEG A;  1DTG A;  3GLH E;  1ANF A;  2LWX A;  5H8Q B;  3KOX E;  1ZLQ A;  3U1O A;  1SXJ B;  2Y5L A;  3GBA A;  4GOT A;  2FBP A;  2F36 A;  3RLF E;  1NNU C;  3RGP A;  3E9X A;  4HL4 A;  2UVH A;  5FLX S;  3J27 B;  5IZ1 A;  3GLG A;  4QFL A;  2DWZ B;  4X1B A;  3LVV A;  3RN8 A;  3RYD A;  3MZB A;  1ZMV A;  2F5X A;  2X7P A;  5CMC A;  3Q8G A;  4PDG A;  1DCU A;  4UAC A;  3GXA A;  3B7Q A;  2OZZ A;  1FPG A;  4C1T A;  5TP9 A;  4DXC A;  4ELR A;  3PNY A;  1AIV A;  3SBJ A;  2Q74 A;  2KEB A;  1V34 A;  2DSF A;  4LF8 M;  2PMS A;  3OOA A;  3U72 A;  4NSO B;  4N91 A;  5I56 A;  1RDZ A;  2QJE A;  3TFL A;  3H3G A;  5EXS A;  2HCA A;  5CMK A;  3HHF A;  1T43 A;  3HHG A;  2BWE A;  5I2K A;  4WP2 A;  3O29 A;  2E0S A;  2XEP A;  3KDS E;  1POY 1;  4O8M A;  3U6D A;  1GO5 A;  1B0L A;  3OEK A;  1XXH B;  4GH9 A;  1DGG A;  2VPN A;  3OTO M;  4PQJ A;  3GPY A;  5TPA B;  2EKF A;  4DV5 M;  1DPE A;  1RYO A;  2JZ0 A;  4LQ5 A;  1OMP A;  1P1U A;  3RFW A;  2CZH A;  1HT2 E;  1CB6 A;  5AA4 B;  4PDD A;  3KZG A;  4AW4 A;  1OIP A;  1FBD A;  2XXH A;  3I6V A;  3J80 S;  4JBZ A;  1DGB A;  4GX3 A;  4PET A;  3AXF A;  4M0W A;  4QHT A;  5IZ3 B;  4I1D A;  1D3K A;  3F92 A;  4LY6 A;  3Q29 A;  2Z8F A;  3KBZ A;  2CHG A;  1EZ9 A;  3ZS6 A;  4MLV A;  4L78 A;  2APL A;  4LA9 A;  4KQP A;  4M4G A;  4PBH A;  3SEW A;  4DV6 M;  3FYD A;  5BR8 M;  4LF9 M;  4N8Y A;  4Q0C A;  4IY5 A;  4W5W A;  1XMQ M;  1F4I A;  3MAM A;  3TWL A;  4JI5 M;  1H43 A;  1MX0 A;  4DUZ M;  4OVR A;  1MQD A;  4P3L A;  1XS5 A;  2JY5 A;  2D7G A;  4Q30 B;  1HNZ M;  1SXJ A;  1YSY A;  4IJF A;  1URS A;  4M0D A;  4IBG A;  4ZZE A;  4NMY A;  1CE2 A;  4GFR A;  3TCF A;  2AYS A;  4OTE A;  2L4F A;  3GPP A;  3VXB A;  1B05 A;  2DYX A;  4JWY A;  1KZ8 A;  1V33 A;  3W68 A;  1EU8 A;  1P1Q A;  3MYU A;  1IMC A;  1N7W A;  2CFO A;  2FVZ A;  4NWD A;  3SKP A;  4N6D A;  3KN8 A;  2GQ1 A;  3LCV B;  2XXX A;  1NV3 A;  1OAO C;  4F2L A;  1PRB A;  3FVG A;  3U92 A;  2HCB A;  5EJC A;  1NNP A;  5ET7 A;  4PFR A;  3W0F A;  4L8R C;  1MPB A;  4IGT A;  1B3F A;  3H4Z A;  3B7D A;  3TPA A;  3A98 B;  1JR3 A;  2DHY A;  2QSF X;  2HL7 A;  2QSX A;  4H0W A;  3KFU G;  4M9X A;  4ZEK A;  3C35 A;  2O69 A;  3FD3 A;  1B4Z A;  3PPQ A;  1J09 A;  4IY6 A;  4JI8 M;  3RT6 B;  4I8C A;  3SAU A;  4NN3 A;  3NWL A;  1YLA A;  1LLS A;  4JXJ A;  3ZC7 B;  1FPI A;  2R71 A;  3TDJ A;  1XHY A;  4Y28 F;  3KN3 A;  1M5B A;  1FNN A;  1WJ7 A;  1L2B A;  1DGH A;  4P16 A;  3O66 A;  1L2C A;  3P7I A;  3S9L C;  5IKB A;  1QAQ A;  4RJZ A;  5I57 B;  1P1N A;  2I3W A;  4GWO A;  3KSX A;  3N5L A;  4OZ9 A;  1NVM A;  4ECF A;  2H4I A;  1BTJ A;  3TE6 A;  3CFX A;  3MP8 A;  1HQY E;  4ND9 A;  3WAE A;  1HJP A;  2D3I A;  4NL4 H;  4KYD A;  2HPG A;  1LAG E;  5CI5 A;  3PNV A;  3BFT A;  1GJT A;  4JVC A;  3LQR A;  3A29 A;  4OU7 A;  2Q8J A;  1VDD A;  3QIM A;  5HPQ A;  5LMU M;  1CNQ A;  1ZJL A;  3RPW A;  4DR3 M;  1MDP 1;  2Y5K A;  2I58 A;  4EQB A;  1I94 M;  3OSR A;  3RTW B;  4EQ9 A;  4AI6 A;  1B7Z A;  4F3B A;  4GBV A;  1JB0 F;  2R9J A;  1S50 A;  2O51 A;  2BNK A;  2K0B X;  2R44 A;  2JJK A;  3PD8 A;  2DWI A;  2M8C A;  3MVW A;  5DYH A;  1AIP C;  1WXQ A;  4OVZ A;  2FE8 A;  1L2D A;  1Q39 A;  2PT2 A;  1PJS A;  4RPN A;  1TH4 A;  3N6T A;  3N6U A;  1SXJ E;  5IGA A;  1IMA A;  4AKI A;  5DEX B;  4BDQ A;  5L8R F;  1N33 M;  5KPT A;  3RPL A;  2BJW A;  5F1Q A;  2CEY A;  4IB2 A;  1HR0 M;  4NC6 A;  4WKM A;  4LQ2 A;  2ZAO A;  1A7L A;  1B5J A;  5I2N A;  4FW9 A;  3K1N A;  4RA1 A;  4MEV A;  1B4H A;  2XH9 A;  4OVP A;  5KO3 A;  3DP8 A;  4NG7 A;  2ZZW A;  3MPK A;  4PF6 A;  4THI A;  1T3T A;  2I7P A;  1PJJ A;  3JR4 A;  1XXH A;  2C9C A;  2FHY A;  1GGG A;  1LFH A;  4KOD A;  1IME A;  2Y7K A;  4PAF A;  3UGJ A;  4LF4 M;  3K6U A;  4KO8 A;  2H5Y A;  3CSB A;  1VEK A;  2K47 A;  1H76 A;  3PPP A;  1MY1 A;  4HE2 A;  1NUZ A;  1IXS A;  1UTH B;  4X04 A;  2Q2E B;  1ORY B;  4K0K M;  4PF8 A;  2P3V A;  3EIH A;  2QMX A;  1SDX A;  1TT1 A;  3DP6 A;  3H6U A;  1IUD A;  3K02 A;  2PVU A;  3GQ3 A;  4H65 A;  2ONK E;  5TP9 B;  3S9M C;  5ICT A;  2YFQ A;  4CHT B;  3TCG A;  3FVO A;  1Q1K A;  3T15 A;  1TDZ A;  3KS4 A;  4Q5T A;  4LJ6 A;  1QUJ A;  2FIE A;  2JXN A;  1RDX A;  3B74 A;  3LC8 A;  1QDT A;  1GJS A;  3QMF A;  3PTY A;  1NUX A;  1NNF A;  1ELJ A;  2CRU A;  2XXT A;  1EIJ A;  2UVJ A;  4BLA A;  1B46 A;  1FBE A;  2XXW A;  1FTA A;  3HST A;  1I6A A;  1FPB A;  2ZYK A;  4IBD A;  2O5R A;  4O3B A;  2V84 A;  2L09 A;  3RT8 A;  2JY8 A;  2ANJ A;  1PB7 A;  1IMF A;  3CF0 A;  3E78 A;  3GLF B;  2Z7J A;  4F39 A;  4FWH A;  3TWK A;  3TOD A;  3J7B A;  1B0H A;  2LNH C;  4G8N A;  3UK4 A;  1KSF X;  1MU5 A;  1H6U A;  4JXI A;  4Z7E A;  4I81 A;  4QFP A;  1TH3 A;  3IR1 A;  1N7X A;  1DGH B;  2JWS A;  4LN5 A;  4KD5 A;  4P56 A;  1IIW A;  3SES A;  3KFM A;  1QKB A;  5EP3 A;  1IY1 A;  4DLD A;  4PBQ A;  3L6G A;  4PFW A;  5LDZ A;  1ZTY A;  1L1Z A;  1SQY A;  3SHF A;  1XHB A;  3TTK A;  1J1N A;  1RYX A;  4D82 A;  3ZKL A;  2R46 A;  3AJI B;  4DI3 D;  1QZE A;  3CFL A;  4HCW A;  1NV6 A;  1WOD A;  4POX A;  5ET5 A;  5A5X A;  2R4E A;  2XFS A;  2RC8 A;  4L17 A;  4Z0I A;  4C0R A;  3M3K A;  1FBP A;  3FTC A;  4PCD A;  4OEV A;  1HT1 E;  3EN3 A;  2HXW A;  5DVF A;  2HEU A;  2Y7I A;  1FBH A;  1B3L A;  4MGY E;  4YMB A;  4BDM A;  4N07 A;  3GQ5 A;  1Z7N E;  5BPV A;  1FQF A;  2XXV A;  3B7N A;  4TLL B;  2YJP A;  5I57 A;  4ZED A;  4WW0 A;  4PP0 A;  4PGN A;  3GO8 A;  3A09 A;  3HN0 A;  1FJ9 A;  1MY3 A;  1XXH E;  3GLF E;  1KFV A;  1D0K A;  2F78 A;  3O2A A;  1W5S A;  1M5E A;  4KR5 A;  3VK7 A;  4G68 B;  1OVT A;  2DE4 A;  3O97 A;  2HWJ A;  3PPR A;  5DEX A;  1EFU B;  4H46 A;  3HZJ A;  2F7C A;  5AA2 A;  4P1L A;  2LVO C;  3TZA A;  1YXI A;  1JVY A;  3B6W A;  2QBY B;  3AOE C;  3KOW E;  3CRB A;  4XF5 A;  5H8F B;  3HX3 A;  3S2V A;  4RF1 A;  4XEQ A;  4POW A;  2JY7 A;  1SYI A;  3R26 A;  4U2R A;  4EUO A;  1ZQ9 A;  3MC2 A;  4FOR A;  3GLH A;  4DUY M;  1VDL A;  4XIG Q;  4JI2 M;  1JQF A;  2I6E A;  4ANR A;  4TLM B;  4N6P A;  3PGF A;  2F7A A;  2RF1 A;  4OQO A;  3MP1 A;  3QUJ A;  3LUZ A;  4PFY A;  1C7Y A;  4XXU A;  3ZSF A;  4EDP A;  3VVD A;  3KOY E;  1IQ7 A;  2Z4R A;  5ITT A;  3N26 A;  1IN8 A;  3OO7 A;  1G0H A;  1OQH A;  1TR8 A;  4I5S A;  4IBI A;  5E26 A;  4LGM A;  3FUV A;  2REJ A;  4O3A A;  3U6E A;  1NL5 A;  4XFE A;  2CWB A;  1IY2 A;  1DGF A;  2UUA M;  3SEX A;  5ITQ A;  1LGB C;  4ZEF A;  3MWB A;  3KOZ E;  2I4B A;  3GRU A;  4QFK A;  2F5O A;  3IL1 B;  3SAT A;  1IXR C;  3H6V A;  2THI A;  4OVT A;  3SMS A;  4OFL A;  5EYF A;  1KWH A;  3QXM A;  4E0W A;  1Y20 A;  2ZNU A;  2A5S A;  1OJL A;  2D5W A;  2UXD M;  4IO5 A;  1Z6T A;  3LSF B;  4LZJ A;  1IN5 A;  4GMQ A;  2ZNS A;  3HCQ A;  1B32 A;  4NF5 A;  1GV8 A;  1JEU A;  2DS9 A;  4GKK M;  1RU3 A;  2ZZV A;  4MB7 A;  4MAG A;  4N15 A;  5EQA A;  3MP6 A;  4XKN A;  1MS7 A;  1QQW A;  4XK8 F;  1IXH A;  3MVX A;  3SEU A;  4PCZ A;  2DHR A;  2YNM D;  3M3L A;  3OMB A;  3LSW A;  2XFT A;  2Q89 A;  1IIT A;  3M0E A;  3W15 C;  5EQ8 A;  3SMP A;  4R74 A;  2G29 A;  2B65 A;  2C5R A;  4NHB A;  4EXL A;  1UFZ A;  3EIE A;  3GYY A;  4GL8 A;  2Q2A A;  2ZNT A;  1UM8 A;  1MH3 A;  5H8H A;  3IJX B;  2KQZ A;  3D8B A;  4LJ8 A;  2QL3 A;  4ITQ A;  5IM2 A;  2P1S A;  3A46 A;  1QJM A;  4HE1 A;  3Q8X A;  3R8F A;  4EF2 A;  3I5O A;  3IOV A;  3GLF A;  1XC8 A;  4MH0 E;  1I4W A;  1NNJ A;  1WDN A;  2QS1 A;  1SW1 A;  2VPO A;  5I5P A;  2F35 A;  4IBC A;  4QSE A;  1FTJ A;  4RPO A;  1EYI A;  1L1T A;  4F1I A;  4F3P A;  4QFO A;  2DAE A;  2PFY A;  5ITY A;  1FPF A;  3U60 A;  1XOC A;  4JI3 M;  2ERC A;  1B3H A;  4HLQ A;  4QHS A;  1SD3 A;  3QYE A;  1I6Q A;  1XMO M;  4X62 M;  1GAB A;  2WYP A;  4YB5 A;  5EQ7 A;  1LB9 A;  4DR5 M;  2ZAM A;  3KOT A;  4I9D A;  1Y1M A;  5EP4 A;  2F4V M;  3FUZ A;  1QAN A;  4X65 M;  3FJM A;  1KA0 A;  1POT A;  1H3D A;  4JI7 M;  3RY3 A;  1TH2 A;  2EKK A;  5ITX A;  1A5T A;  5CRY A;  3RQT A;  1QW0 A;  3C33 A;  3CHG A;  1YPN A;  1UIV A;  4LFB M;  4DDD A;  1O63 A;  4G61 A;  1E9S A;  3IEC A;  1I69 A;  1FQB A;  4GKJ M;  1IBL M;  2L6O A;  3K4U A;  3UA8 A;  3EHU A;  4ELP A;  2JZ1 A;  4G68 A;  1CUK A;  4PAI A;  3PV0 E;  2RIN A;  3TQW A;  1OFH A;  1URG A;  5IZZ A;  3MVY A;  4QF9 A;  2ZZX A;  2QS2 A;  3V83 A;  3HHX A;  1S3S A;  3HPI A;  3MJN A;  2WSE F;  3G3G A;  3W67 A;  1B5I A;  4KHZ E;  2Y7R A;  1Z5A A;  3PPN A;  3SEY A;  2VGQ A;  3H7M A;  2AHM A;  2ONR A;  4QSC A;  1PJT A;  2F3D A;  3DP4 A;  2QVU A;  2LVP C;  2UXC M;  3DM0 A;  3J7A S;  3LSX A;  1FTM A;  5DW8 A;  3SER A;  4JV5 M;  3L25 A;  4FBP A;  2XXU A;  1B6H A;  3EQ1 A;  4LRT A;  2K6B A;  2BJV A;  4NXM M;  1DV0 A;  3M8U A;  2CP8 A;  2D7E A;  4NF6 B;  1IY0 A;  2F5Q A;  4CIS A;  1JEV A;  3K01 A;  1BIY A;  1XT8 A;  3WHL A;  2CZK A;  1N84 A;  1JVX A;  1M5C A;  1J5E M;  1YE9 A;  4H8J A;  4OA4 A;  1TFA A;  1YCJ A;  1QDR A;  3MQ9 A;  4LF6 M;  4DE8 A;  3FXQ A;  2RGO A;  1F9B A;  3TTR A;  4ELO A;  1R6B X;  5F24 A;  2NVU B;  3G3I A;  4P1E A;  3FZV A;  1VE4 A;  3SEV A;  2LXE A;  4LG2 A;  2AIX A;  4NRV A;  1HQC A;  2QFL A;  3KN7 A;  4AS4 A;  2QVV A;  4P11 A;  3D8L A;  2RCA A;  1EYK A;  2MH8 A;  5DT6 A;  2KRU A;  4G8H A;  1MJG M;  4LJ9 A;  4LZZ A;  2KHH A;  3C58 A;  3U5Z A;  4B3M M;  1MXZ A;  1NY5 A;  2I7N A;  3B7Z A;  3I04 M;  4NWC A;  1MDQ A;  4LF7 M;  1FSA A;  4KXP A;  5H37 D;  1PGY A;  1MQI A;  5AE4 A;  2ALU A;  2XXY A;  3NOH A;  4OVJ A;  3UOR A;  1XC1 A;  1Z7M E;  2B4M A;  1WHC A;  1FJG M;  3B50 A;  4LP2 B;  3C4M A;  4G8M A;  5L9O A;  2XSZ A;  1PB8 A;  2OCU A;  1K9Z A;  2R4J A;  4R9F A;  1A40 A;  4GWU A;  1R4G A;  3FJ7 A;  4M1V A;  4OXV A;  2DXR A;  3TTL A;  2L2D A;  4O3C A;  3O6I A;  1MPD A;  3JAM S;  3C3D A;  3HHY A;  4R9G A;  4GHL A;  1ZMU A;  2XWV A;  5H8S A;  2OOB A;  4OVS A;  3J2P B;  2HAU A;  5ISU A;  3MVZ A;  2LHG A;  2I49 A;  4JVI A;  3LUY A;  5J1D A;  1LAF E;  2LVQ D;  3MZ9 A;  4JN6 A;  4LF5 M;  3QYB A;  3ISP A;  4FED A;  3IO4 A;  2UVG A;  5ITO A;  2ZXT A;  4WED A;  2N35 A;  2P5T A;  4QRZ A;  2ZYN A;  1M5F A;  1Z5B A;  1SBP A;  5ELV A;  1LB8 A;  4MJO A;  1OLA A;  3E79 A;  2CEA A;  3Q28 A;  1IN4 A;  2C9O A;  4QNR A;  3N94 A;  2OOA A;  2FOI C;  2E5L M;  4S12 A;  2RRU A;  4E0X A;  2ZTC A;  1LTM A;  3OO6 A;  2OLB A;  3AV0 A;  1PBP A;  5EXP A;  4I3Y A;  1HNX M;  3D4G A;  1W5T A;  2HFB A;  2A5Y B;  1KYI A;  1VR5 A;  3MST A;  4X48 A;  4U1Z A;  4REZ A;  5KCJ A;  4GHA A;  3HJ8 A;  1G41 A;  4YKJ A;  3UIF A;  2HKJ A;  1SXJ C;  1B7H A;  3GRY A;  2RC7 A;  4AG6 A;  2FIX A;  4X9T A;  4X1D A;  1FPL A;  3TPZ A;  3UK6 A;  3FTF A;  2FFJ A;  1IXC A;  3CF2 A;  1IQP A;  5AA4 A;  3FUU A;  4QXD A;  4R73 A;  3KEI A;  3E46 A;  3GP1 A;  4YAH X;  3L2A A;  1R9Q A;  4JWX A;  4N4U A;  1TDH A;  3AFH A;  2LTU A;  3ILK A;  3I4Y A;  1URD A;  3BXW A;  5ET6 A;  2I0C A;  2FNA A;  1MPC A;  5DNY A;  5KDT A;  2Q2C A;  1MQH A;  3A3C A;  2CEX A;  4H45 A;  3BKI B;  4LFC M;  1EZO A;  2C98 A;  5CBR A;  1X37 A;  4IIW A;  4JI0 M;  5F3W A;  2WBD A;  3GPX A;  5K2X A;  3KXE C;  1Y4C A;  2VF8 A;  2MKZ A;  2QMW A;  4OET A;  3T9V A;  3IOT A;  4N81 A;  1XNR M;  2ABH A;  2VF7 A;  2AL4 A;  2PYY A;  1ZBM A;  1Y1Z A;  3FUX A;  3TWM A;  2DXY A;  3JZJ A;  3CGW A;  3MJ5 A;  4KT0 F;  3E3K A;  3KJ7 A;  4CIZ A;  1NY6 A;  2X4A A;  4MMP A;  2I3V A;  1N34 M;  3KOS A;  2YLN A;  3M7G A;  1A99 A;  3OXN A;  3U61 B;  1GL7 A;  3R6U A;  1NH7 A;  5KPR A;  5JI2 E;  2XWO A;  2XX9 A;  1H44 A;  1T0K A;  4N13 A;  4GXA A;  1ZIU A;  3MUQ A;  2MRO B;  4YIC A;  3FKE A;  4EQ7 A;  4RNS A;  8CAT A;  1NFT A;  4FE8 A;  4FIM A;  4DXU A;  4F2O A;  1A54 A;  2QPA A;  2PCR A;  1WGL A;  1DSN A;  1UIU A;  5AA1 A;  3MPL A;  3VKG A;  3IOR A;  2V25 A;  4F2Q A;  1MRP A;  2OWT A;  1FQD A;  5TU0 A;  3GLG E;  4MHF A;  1QUI A;  1D0L A;  4L15 A;  2KLF A;  2VOZ A;  4IBJ A;  5C1B A;  1SVX B;  3FGS A;  5KQ8 A;  3TQS A;  1Y3Q A;  4R75 A;  5L9M A;  1T6O A;  4IO7 A;  1E32 A;  3K9O A;  3B89 A;  4OFO A;  2QP9 X;  4L6V 6;  2OBG A;  1G4A E;  1R6Z A;  1LCT A;  5IZ3 A;  2DWN A;  4ZE8 A;  4M9Z A;  1PM5 A;  4DCY A;  4XGI A;  3C31 A;  2DDK A;  2OWS A;  4OW0 A;  4NF8 A;  1B51 A;  3DA1 A;  2VT5 A;  5A5X B;  3SC3 A;  3PMV A;  1E94 E;  2C96 A;  2DAM A;  1QAM A;  4QNM A;  2XWK A;  4LAT A;  4NRW A;  3E4R A;  4MLQ A;  4R6K A;  3UGW A;  3T9X B;  4GL0 A;  4YMA A;  2CZI A;  3O28 A;  5I84 A;  2DEN A;  2VD2 A;  4HE0 A;  2ZTD A;  5B7D A;  1IN7 A;  3HWS A;  4KCD A;  4AB6 A;  2XXP A;  4AG5 A;  2Q8M A;  1B7U A;  2QCU A;  4YU0 A;  4KPT A;  2LAO A;  2GNO A;  2G5G X;  4FCW A;  1B2H A;  3ODB A;  3PMX A;  4BBA A;  4KYS A;  2V1C A;  2R6F A;  1OIB A;  4GD5 A;  3GLI E;  4G4Q A;  4D81 A;  4NGU A;  1XWI A;  3LVW A;  2W7Y A;  1NUW A;  4P17 A;  2H98 A;  3DFZ A;  2J5Y A;  3K92 A;  2Z8D A;  4H67 A;  5DYG A;  1UTB A;  2DVW B;  3PUV E;  5F7V A;  4CJ6 A;  1LBB A;  2KNV A;  4RK2 A;  3VDF A;  1FJ6 A;  1Y4T A;  3FE3 A;  4X64 M;  2YPN A;  4G4O A;  5KPZ A;  2VHA A;  2OX3 A;  3CSG A;  3GRV A;  4HXV A;  2VQF M;  3ZQJ A;  3JR5 A;  3CI8 A;  4R7G A;  5H8N B;  4HTG A;  2YQZ A;  3TL4 X;  3PMW A;  2B3T A;  2PFZ A;  1N36 M;  4NTL A;  3UMM A;  4FAJ A;  1Z59 A;  3KP1 E;  3QUF A;  1QVS A;  3IOU A;  4FWG A;  1NUY A;  4EXK A;  4GWS A;  5I56 B;  4FD2 A;  4H8I A;  2DAG A;  3U60 B;  1AWB A;  5JK4 A;  4F1V A;  4DV3 M;  1R2Y A;  1Q3C A;  2BJI A;  3UZU A;  4LFA M;  1TWY A;  5ITP A;  1IXZ A;  5B70 A;  3LSL A;  3ILU B;  3NBI A;  2H25 A;  3IOW A;  4YB7 A;  4QSD A;  4GLI A;  4GIT A;  1YUB A;  4B3R M;  3L29 A;  1OFI A;  2KW0 A;  2LH0 A;  5ESY A;  3RGY A;  4H1X A;  3OSQ A;  3HY5 A;  1SYH A;  2EJS A;  3SYL A;  3G7W A;  2KZU A;  2ZAN A;  1KA1 A;  5CMM A;  3K6X A;  2OWZ A;  3THI A;  4U23 A;  1IZ1 A;  1MXX A;  2MR9 A;  4JI4 M;  1EZP A;  2DOJ A;  2O1M A;  2EUC A;  1FPE A;  1WR1 B;  2XXK A;  4OHN A;  2VII A;  3VLF B;  4I4L A;  1UTH A;  1PDA A;  4FVM A;  3UJN A;  1B52 A;  4C1U A;  3HU3 A;  2F8D A;  2DWL A;  1R2Z A;  1OLC A;  4OEN A;  1BVS A;  5DTB A;  5K2Y A;  2WZJ A;  1N0T A;  2R62 A;  3M3F A;  1PB9 A;  3VK8 A;  5L8D A;  3T93 B;  1II5 A;  4PFI A;  1JET A;  4ZEC A;  4IBB A;  2Y0Q A;  1LBC A;  3TQL A;  3TTN A;  4DR7 M;  4MGK E;  3VVF A;  3U94 A;  4DBG B;  4ZEB A;  2F5P A;  1PBQ A;  4PFU A;  2V4C A;  3U6S A;  1LST A;  1ZMW A;  4PC9 A;  1OQY A;  3VE1 B;  4F1Y A;  1NNK A;  1NV2 A;  4F18 A;  5JI3 E;  1DO2 A;  4B08 A;  5EQT A;  3SYK A;  1GLN A;  2OQ4 A;  2ZMB A;  5I2N B;  1QUT A;  4IJE A;  1FW0 A;  3T0J A;  3FRI A;  2QQ8 A;  1XB2 B;  1MN3 A;  2BWB A;  1B3G A;  2KNA A;  1QGX A;  4MBP A;  1NHW C;  3IK6 B;  5FHN A;  5EYG A;  1WIV A;  3DEL B;  2XXR A;  3IJO B;  3T6P A;  3J81 S;  1ZV1 A;  3AKZ A;  4R72 A;  1NJF A;  2RGH A;  4ONY A;  1A8E A;  4WEP A;  2G93 A;  3ZCB B;  4F31 B;  4MM3 B;  2RCB A;  4G3O A;  4NX1 A;  1G3I A;  2OO9 A;  3LW5 F;  1HSJ A;  2GHB A;  1NO1 A;  1LBZ A;  3HV1 A;  4HCY A;  3U6M A;  1OTR A;  3IB2 A;  5LOM A;  2V1U A;  2FYI A;  4YKI A;  1US4 A;  4G4R A;  1A55 A;  4NED A;  4ZPX A;  2O1L A;  3JYR A;  2NUV A;  5EXT A;  3OEL A;  3FIR A;  4OFJ A;  4QBA A;  3HU1 A;  3K2L A;  2UU9 M;  1OAI A;  3K9P A;  5L9S A;  3RUM A;  3GQ4 A;  1D9V A;  4R2B A;  2OK2 A;  2O7U A;  4R3D A;  3L28 A;  1FPJ A;  4K3F A;  5I59 A;  4DV1 M;  4ESW A;  1M5D A;  2R18 A;  1G0I A;  2DVZ A;  1NH8 A;  3H03 A;  4DV4 M;  2HZL A;  4U22 A;  4I62 A;  4BB9 A;  3QSL A;  2CMO A;  5FTH A;  4BDR A;  2OJT A;  1G8P A;  4KYE A;  3V8X B;  3PVS A;  4O7M A;  2XZU A;  4X8R A;  2D7H A;  4HW8 A;  3FXU A;  4DV7 M;  1DOT A;  2WBB A;  4O7I A;  4IBE A;  2FS1 A;  2FA7 A;  4L16 A;  5I59 B;  3FV1 A;  3D1R A;  1IBM M;  1BP5 A;  3GLB A;  1FCK A;  1AOV A;  4XKP A;  1LCF A;  4B7G A;  1K9Y A;  2KNZ A;  4N6K A;  1MG1 A;  2ZM6 M;  4OER A;  2QS3 A;  4I8O A;  5EHS A;  4QOZ C;  2F6P A;  4OYV A;  1JW4 A;  1FQE A;  3S9E A;  2M60 A;  3D4C A;  1FBC A;  3HO7 A;  2E1S A;  3FD9 A;  4LJ5 A;  5FTJ A;  4GVO A;  4MIJ A;  3OEM A;  2XZF A;  1PJQ A;  4MNC A;  1QUK A;  2DVC A;  2CV0 A;  4DCX A;  4DR2 M;  1QUL A;  2O7I A;  2P0S A;  4G6Z A;  2GH9 A;  3T1Y M;  4R71 A;  3FV2 A;  4YHH M;  3UN6 A;  5EQ9 A;  3FVN A;  2ESN A;  4QOS A;  5JEI A;  1PJI A;  3HHW A;  2DKL A;  2CHV A;  2R65 A;  2IEE A;  2UUB M;  1BLF A;  2WSF F;  5JTY A;  4RYA A;  5H8N A;  2J7N A;  4EF1 A;  3T9U A;  3IHP A;  3ILT B;  3PU5 A;  5M2V A;  2HHM A;  2P2A A;  4B3T M;  4O94 A;  4GX6 A;  2RKM A;  3A45 A;  4GX4 A;  4PFB A;  3VDU A;  1DPP A;  4GRK A;  4JSD A;  2DAK A;  5ITU A;  1LFI A;  3U6L A;  2Q9T A;  4ISU A;  4TOZ A;  1MXU A;  3SAS A;  2G8L A;  2DWH A;  4AB5 A;  3IX1 A;  4PGP A;  1ZU0 A;  1N77 A;  1HSL A;  3CG1 A;  2WYK A;  5JTY B;  1NI9 A;  2Z22 A;  2DE2 A;  3ROJ A;  3IB1 A;  4H5G A;  2IA4 A;  2GRV A;  3LBS A;  3KVW A;  1JNF A;  1SW2 A;  1ATG A;  1FQA A;  1H45 A;  4RK9 A;  1NSF A;  2YR0 A;  1TFD A;  3VDP A;  3HJS A;  5EYH A;  1TTE A;  1JP4 A;  3T38 A;  4UA8 A;  5BUU A;  2LVN C;  1B40 A;  2GHA A;  2I4C A;  1BKA A;  5ICQ A;  3KP0 E;  4NF4 A;  3CTW B;  1NKX A;  5AA2 D;  4NF8 B;  3GRR A;  3K8Z A;  4YB6 A;  4ESX A;  5HBC A;  3V76 A;  2V3T A;  3FTE A;  3RE8 A;  3WAF A;  1I6B A;  1LBX A;  3GZG A;  3FTD A;  1P1W A;  4RXL A;  4XTC Q;  3PFI A;  2B4L A;  2AL5 A;  4MNI A;  3H4J A;  4PE5 B;  3SAV A;  3Q26 A;  3U61 A;  3VKH A;  3EHT A;  4MGI E;  4BDO A;  4XBO A;  2C99 A;  1B5H A;  3K1P A;  3ECR A;  2Q88 A;  1SW4 A;  1Y8G A;  5DFL A;  3KJT A;  4H5F A;  3R7X A;  4GWW A;  3I3V A;  4B7F A;  1TGU A;  3FUT A;  3ONM A;  3SFZ A;  4U4X A;  1K3X A;  2G3Q A;  3HU2 A;  3B9P A;  5FSW A;  2Y84 A;  3U6P A;  3U93 A;  1NV0 A;  1IXI A;  2VP1 A;  3VLV A;  1IN6 A;  4G2Z A;  2QPQ A;  3FYC A;  1MH4 A;  4RY1 A;  3IG5 A;  1V92 A;  2DZN B;  1K82 A;  3MMP A;  4YZZ A;  2KA6 B;  5KDT B;  5EP1 A;  3GLG B;  5T3J A;  3FVK A;  4GBW A;  2UVI A;  1PC3 A;  3U5Z B;  2BJJ X;  2L7H A;  2HZK A;  3CVG A;  5A5L A;  5I7I A;  2R6G E;  2GFE A;  4PE3 A;  1YAE A;  2O25 A;  4IBF A;  3Q27 A;  5CM6 A;  2F5N A;  1OQG A;  2J7O A;  1MQG A;  2QNJ A;  3U65 A;  3TYH A;  4P8B A;  2NXO A;  3SAW A;  4PDI A;  1D9Y A;  1D4N A;  2X7Q A;  5FTN A;  5H8Q A;  3T1H M;  1AL3 A;  3PUY E;  5DVI A;  1EE8 A;  3DZD A;  3E21 A;  5IRE B;  3K1J A;  2Y0T A;  2HHH M;  1NNT A;  3C32 A;  1FTK A;  4NSR A;  2Z23 A;  2EA0 A;  1EH3 A;  2PT1 A;  4EIW A;  3IO6 A;  2XWI A;  3ZKK A;  2L7I A;  2KRK A;  4RKU F;  4LJ7 A; 
#chains in the Genus database with same CATH homology
 1QYR A;  2UYF A;  4H6D A;  3TAJ A;  3K00 A;  3LR1 A;  5CC2 A;  4FJP A;  3RTF B;  4F19 A;  4RF0 A;  3H4M A;  2I48 A;  1JW5 A;  1RKM A;  5KCJ B;  4R6H A;  3TEP A;  4TUW A;  4GRI A;  3T9H B;  3OD7 A;  5I58 A;  3THG A;  4JB7 A;  1MXV A;  1MY2 A;  3C36 A;  1Y3N A;  1IXG A;  1LAX A;  3CF6 E;  4FEB A;  1R7R A;  3I51 A;  3B6Q A;  4KI0 E;  4XKR A;  3VFJ A;  3MHV C;  3T96 B;  5IAI A;  1E9R A;  2O84 X;  3U6C A;  2XD3 A;  2Y21 A;  3G3J A;  3WHK A;  4PFT A;  1OVB A;  4A3V B;  2DWA A;  2X49 A;  3JV9 A;  2XXQ A;  3FAT A;  4LON B;  4Z6Y A;  3I4V A;  2VQE M;  4DV0 M;  2XX8 A;  2H1R A;  1GL6 A;  3C9H A;  1NMU A;  4JWO A;  3TMG A;  5KZT A;  3QYT A;  4KCC A;  5AA3 A;  2B3B A;  2XF3 A;  3TKD A;  5DYI A;  1B58 A;  4B3S M;  4DV2 M;  4F3G A;  2DE3 A;  4F29 A;  1Y3P A;  3IAZ A;  3BBR A;  5ITX E;  3A3U A;  1Q35 A;  1B3E A;  5H8F A;  1J7K A;  1GTK A;  4AZF A;  4LZ5 A;  4DZ1 A;  4GIP A;  4JYA M;  4ELQ A;  3VVE A;  3DLN A;  2HAV A;  1C1K A;  1N04 A;  4ZE9 A;  3RNN A;  1USY E;  4AQY M;  4GF8 A;  1GKI A;  5DVJ A;  3HHZ A;  3TTM A;  4KHP M;  2F7B A;  2NQ8 C;  3V5A A;  2Y7W A;  3S9N C;  4P0I A;  1GR2 A;  1PEB A;  3W9V A;  4B7H A;  1YTV A;  2DP8 A;  4XKQ A;  4U4S A;  4YKP A;  3FJG A;  3K2D A;  4LRS A;  5C18 A;  1VFD A;  3KGC A;  3AL0 C;  4OMB A;  4LGY A;  4WUR A;  1DMB A;  3SET A;  5ITR A;  4JI6 M;  4NF6 A;  2V3U A;  1B9J A;  2XX7 A;  1L8Q A;  3PXG A;  3S4U A;  3GLI A;  1N76 A;  2X8A A;  5KQD A;  4OEU A;  3TUS A;  4AKH A;  4LUB A;  5I2K B;  4F1U A;  4KLN A;  2XHD A;  2V6Z M;  4LCB A;  2CZL A;  1HSE A;  1ZAE A;  1WVJ A;  5E6J A;  3SAR A;  3EPE A;  4GQO A;  3L26 A;  1MXY A;  1UQW A;  3MZ1 A;  3AOE A;  3FUW A;  4FCT A;  2F6G A;  4IO3 A;  3KG2 A;  4DIG A;  2NWJ A;  2ZBK B;  1R1N A;  3VV5 A;  1SXJ D;  4ZZA A;  3DOA A;  3BFU A;  4FCV A;  5LMN M;  3H6T A;  1FTL A;  3KSJ A;  2Z4S A;  4R2F A;  1GVN A;  3MW0 A;  4BDN A;  1GVC A;  5IZ7 D;  3E9S A;  3R9X B;  3EF7 A;  3CFZ A;  2NOO A;  1N78 A;  3K6V A;  3EHS A;  4U1O A;  1K3W A;  3HGI A;  4IO2 A;  1NHG C;  1UTB B;  3O6G A;  2O68 A;  4U21 A;  3O9P A;  3MBP A;  3C34 A;  3U6O A;  2DWM A;  2UXB M;  4GXS B;  1XVY A;  4OWD A;  1JW1 A;  1G59 A;  3VFD A;  4DR1 M;  1QKA A;  4FEC A;  3SDF A;  1S9T A;  4LZ7 A;  2F34 A;  3UP9 A;  1JR3 D;  2A5T B;  4MH5 A;  3HKP A;  4TQU Q;  2RKO A;  1SW5 A;  3QAU A;  1SI1 A;  3OO8 A;  5FHM A;  2CE7 A;  3W9W A;  2PBW A;  3TEL A;  4KFQ A;  2XSZ D;  3OO9 A;  3FAS A;  1HNW M;  2H99 A;  4WXJ A;  5GKN A;  1FTO A;  1SI0 A;  1B1H A;  1IXS B;  4QFN A;  4RNA A;  1AMF A;  3IB0 A;  1LFG A;  2XGN A;  4ZDM A;  3VLU A;  3Q25 A;  4OES A;  1VSO A;  2Y7P A;  4MF3 A;  1DTZ A;  4OVZ B;  4IO6 A;  3B6T A;  1MM7 A;  1Q3B A;  1LAH E;  3U6Q A;  3O6H A;  2A5T A;  1LV7 A;  3G3H A;  4NE4 A;  1MY4 A;  4PD2 A;  1IM2 A;  3CIJ A;  5H8H B;  7CAT A;  1L5T A;  4FWD A;  4LVQ A;  1VFE A;  4MGH A;  4NF5 B;  1N3W A;  2H9B A;  3M6A A;  5EP2 A;  3G3F A;  5FTI A;  1MQJ A;  1A8F A;  2QEN A;  2D21 A;  4JSO A;  1DO0 A;  5IWA M;  2F97 A;  4DR4 M;  5EXX A;  3GBB A;  2ZYO A;  3PPO A;  4M9S A;  3T22 A;  1USY H;  5EHM A;  4OX9 M;  1FQC A;  4DR6 M;  3U8Q A;  4X66 M;  4P0G A;  2UUC M;  4ZEI A;  4FAT A;  4DXB A;  2FNC A;  4Q8R A;  2R45 A;  1R9L A;  3GLI B;  3USD A;  3GPU A;  5FTM A;  3V89 B;  2KZS A;  4LJ4 A;  1MXW A;  2I0B A;  3A42 A;  2Z8E A;  5FTK A;  2UXA A;  3K6W A;  2Z3X A;  2ONS A;  4GIZ A;  2OPF A;  4YY3 M;  4G68 C;  2UYE A;  3KS8 A;  4F3S A;  3QWL A;  1ZMG A;  4NOO B;  4QHQ A;  4AKG A;  4LZ8 A;  4G4N A;  2CHQ A;  3QK6 A;  1N32 M;  1IBK M;  4R6Y A;  1AH5 A;  2DXI A;  2M5Z A;  2QS4 A;  1N75 A;  5A2Q S;  1P1O A;  2VD3 A;  4NXN M;  3F11 A;  3H06 B;  4NF4 B;  2DZO B;  5BWJ A;  4GC5 A;  2W82 A;  2B3F A;  3OEN A;  4IGR A;  1ZKB A;  2QRY A;  3GLH B;  1MY0 A;  2JA2 A;  5CMB A;  2CUZ A;  1TXF A;  3CR9 A;  1NJG A;  3FXR A;  1QZM A;  2X26 A;  3L27 A;  1S7Y A;  2QBY A;  4PT5 A;  1MM6 A;  2ZYM A;  3K0V A;  3PUW E;  5AA2 B;  3PUX E;  4CGY B;  4LJA A;  2V3Q A;  3MK6 A;  3RGS A;  3G3K A;  2QZ4 A;  4IBK A;  3K1M A;  4JI1 M;  3TCH A;  1D2N A;  3VXC A;  1O7T A;  3IG8 A;  4BDL A;  1JQJ C;  3CG3 A;  2PX1 A;  3AOG A;  5CBS A;  2CV2 A;  4F22 A;  5TPA A;  1N3X A;  3HJQ A;  2KXE A;  5I58 B;  5FTL A;  1QVR A;  4MFI A;  4JDF A;  3BOS A;  1XVX A;  1Y9U A;  2REG A;  3PD9 A;  3W0L B;  1B1X A;  4YKK A;  2DWJ A;  2XLJ A;  3T66 A;  2RC9 A;  5HM4 B;  4II7 A;  5IT9 S;  5FHO A;  4G77 A;  2O6A A;  4ZS9 A;  3VLW A;  3E13 X;  3LQQ A;  4HS7 A;  3L6H A;  2WKY A;  2EO2 A;  3H6W A;  1IEJ A;  1O64 A;  4Z8X A;  4G4P A;  4MGZ E;  1US5 A;  3QAX A;  3KW6 A;  2CV1 A;  2V93 A;  4IO4 A;  2XXI A;  3LMM A;  3PUZ E;  2XD2 A;  2DQV A;  4AQ4 A;  3ZH9 B;  4BLC A;  4GC9 A;  1P99 A;  1Z5C A;  2F5S A;  1XNQ M;  3KBR A;  4D80 A;  2Y20 A;  3SHG B;  2HQ0 A;  1QAO A;  4L4U A;  1DTG A;  1ANF A;  2LWX A;  5H8Q B;  3KOX E;  1ZLQ A;  3U1O A;  1SXJ B;  3GBA A;  4GOT A;  2F36 A;  3RLF E;  1NNU C;  3RGP A;  3E9X A;  4HL4 A;  2UVH A;  5FLX S;  3J27 B;  3GLG A;  4QFL A;  2DWZ B;  4X1B A;  3LVV A;  3RN8 A;  3MZB A;  2F5X A;  2X7P A;  5CMC A;  4PDG A;  4UAC A;  3GXA A;  2OZZ A;  4DXC A;  4C1T A;  5TP9 A;  4ELR A;  3PNY A;  1AIV A;  3SBJ A;  2KEB A;  2DSF A;  4LF8 M;  2PMS A;  3OOA A;  3U72 A;  4NSO B;  5I56 A;  2QJE A;  3TFL A;  3H3G A;  5EXS A;  2HCA A;  5CMK A;  3HHF A;  3HHG A;  5I2K A;  3O29 A;  2E0S A;  2XEP A;  3KDS E;  1POY 1;  3U6D A;  1B0L A;  3OEK A;  1XXH B;  4GH9 A;  1DGG A;  3OTO M;  4PQJ A;  3GPY A;  5TPA B;  4DV5 M;  1DPE A;  1RYO A;  4LQ5 A;  1OMP A;  1P1U A;  3RFW A;  1HT2 E;  1CB6 A;  5AA4 B;  3KZG A;  4AW4 A;  3I6V A;  2XXH A;  3J80 S;  4JBZ A;  1DGB A;  4PET A;  3AXF A;  4M0W A;  4QHT A;  4I1D A;  1D3K A;  3Q29 A;  4LY6 A;  2Z8F A;  2CHG A;  1EZ9 A;  3ZS6 A;  4MLV A;  4L78 A;  4LA9 A;  4KQP A;  4M4G A;  3SEW A;  4DV6 M;  3FYD A;  5BR8 M;  4LF9 M;  4Q0C A;  4IY5 A;  4W5W A;  1XMQ M;  3MAM A;  3TWL A;  4JI5 M;  1H43 A;  1MX0 A;  4DUZ M;  1MQD A;  1XS5 A;  2D7G A;  4Q30 B;  1HNZ M;  1SXJ A;  1YSY A;  4IJF A;  1URS A;  4M0D A;  4IBG A;  4ZZE A;  4NMY A;  1CE2 A;  4GFR A;  3TCF A;  2AYS A;  4OTE A;  3GPP A;  3VXB A;  1B05 A;  2DYX A;  4JWY A;  1EU8 A;  1P1Q A;  1N7W A;  2CFO A;  4NWD A;  3SKP A;  3KN8 A;  2XXX A;  3FVG A;  3U92 A;  2HCB A;  5EJC A;  1NNP A;  3W0F A;  4L8R C;  1MPB A;  4IGT A;  1B3F A;  3H4Z A;  3B7D A;  3TPA A;  3A98 B;  1JR3 A;  2HL7 A;  2QSX A;  4H0W A;  3KFU G;  4M9X A;  4ZEK A;  3C35 A;  2O69 A;  3FD3 A;  1B4Z A;  3PPQ A;  1J09 A;  4IY6 A;  4JI8 M;  3RT6 B;  4I8C A;  3SAU A;  3NWL A;  1LLS A;  4JXJ A;  3ZC7 B;  2R71 A;  3TDJ A;  1XHY A;  3KN3 A;  1FNN A;  1M5B A;  1L2B A;  1DGH A;  4P16 A;  3O66 A;  1L2C A;  3P7I A;  3S9L C;  5IKB A;  1QAQ A;  4RJZ A;  5I57 B;  1P1N A;  2I3W A;  4GWO A;  3KSX A;  3N5L A;  4OZ9 A;  1NVM A;  4ECF A;  2H4I A;  1BTJ A;  3TE6 A;  3CFX A;  3MP8 A;  1HQY E;  4ND9 A;  3WAE A;  2D3I A;  4NL4 H;  4KYD A;  1LAG E;  5CI5 A;  3PNV A;  3BFT A;  3LQR A;  4OU7 A;  2Q8J A;  1VDD A;  3QIM A;  5HPQ A;  5LMU M;  1ZJL A;  3RPW A;  4DR3 M;  1MDP 1;  2I58 A;  4EQB A;  1I94 M;  3OSR A;  3RTW B;  4EQ9 A;  4AI6 A;  1B7Z A;  4F3B A;  2R9J A;  1S50 A;  2O51 A;  2BNK A;  3PD8 A;  2DWI A;  2M8C A;  3MVW A;  5DYH A;  1WXQ A;  4OVZ A;  2FE8 A;  1L2D A;  1Q39 A;  2PT2 A;  4RPN A;  1TH4 A;  3N6T A;  3N6U A;  1SXJ E;  4AKI A;  5DEX B;  4BDQ A;  1N33 M;  5KPT A;  2BJW A;  5F1Q A;  4IB2 A;  1HR0 M;  4WKM A;  4LQ2 A;  2ZAO A;  1A7L A;  1B5J A;  5I2N A;  4FW9 A;  3K1N A;  4RA1 A;  1B4H A;  2XH9 A;  5KO3 A;  3DP8 A;  3MPK A;  4THI A;  1T3T A;  2I7P A;  1PJJ A;  3JR4 A;  1XXH A;  2C9C A;  1GGG A;  1LFH A;  4KOD A;  2Y7K A;  3UGJ A;  4LF4 M;  3K6U A;  4KO8 A;  2H5Y A;  3CSB A;  2K47 A;  1H76 A;  3PPP A;  1MY1 A;  1UTH B;  2Q2E B;  1ORY B;  4K0K M;  3EIH A;  2QMX A;  1SDX A;  1TT1 A;  3DP6 A;  3H6U A;  1IUD A;  3K02 A;  2PVU A;  3GQ3 A;  4H65 A;  2ONK E;  5TP9 B;  3S9M C;  5ICT A;  2YFQ A;  4CHT B;  3TCG A;  3FVO A;  1Q1K A;  3T15 A;  1TDZ A;  3KS4 A;  4Q5T A;  4LJ6 A;  1QUJ A;  3LC8 A;  1NNF A;  1ELJ A;  2XXT A;  4BLA A;  2UVJ A;  1B46 A;  2XXW A;  3HST A;  1I6A A;  2ZYK A;  4IBD A;  2O5R A;  4O3B A;  2V84 A;  2L09 A;  3RT8 A;  2ANJ A;  1PB7 A;  3CF0 A;  3GLF B;  2Z7J A;  4F39 A;  4FWH A;  3TWK A;  3TOD A;  3J7B A;  1B0H A;  2LNH C;  4G8N A;  3UK4 A;  1KSF X;  1MU5 A;  1H6U A;  4JXI A;  4Z7E A;  4I81 A;  4QFP A;  1TH3 A;  3IR1 A;  1N7X A;  1DGH B;  4KD5 A;  1IIW A;  3SES A;  3KFM A;  1QKB A;  5EP3 A;  1IY1 A;  4DLD A;  4PFW A;  3L6G A;  1ZTY A;  1L1Z A;  1SQY A;  3SHF A;  1XHB A;  3TTK A;  1J1N A;  1RYX A;  4D82 A;  3ZKL A;  2R46 A;  3AJI B;  5A5X A;  3CFL A;  4HCW A;  4POX A;  1WOD A;  2R4E A;  2XFS A;  2RC8 A;  4L17 A;  4Z0I A;  4C0R A;  3M3K A;  3FTC A;  4OEV A;  1HT1 E;  3EN3 A;  2HXW A;  5DVF A;  2HEU A;  2Y7I A;  1B3L A;  4MGY E;  4YMB A;  4BDM A;  4N07 A;  3GQ5 A;  1Z7N E;  5BPV A;  1FQF A;  2XXV A;  4TLL B;  2YJP A;  5I57 A;  4ZED A;  4WW0 A;  4PP0 A;  3GO8 A;  3A09 A;  3HN0 A;  1MY3 A;  1KFV A;  2F78 A;  3O2A A;  1W5S A;  1M5E A;  4KR5 A;  3VK7 A;  4G68 B;  1OVT A;  2DE4 A;  3O97 A;  3PPR A;  5DEX A;  2F7C A;  5AA2 A;  3TZA A;  1JVY A;  3B6W A;  2QBY B;  3AOE C;  3KOW E;  3CRB A;  5H8F B;  3S2V A;  4RF1 A;  4POW A;  1SYI A;  3R26 A;  4U2R A;  4EUO A;  1ZQ9 A;  3MC2 A;  4FOR A;  3GLH A;  4DUY M;  4XIG Q;  4JI2 M;  1JQF A;  2I6E A;  4TLM B;  4N6P A;  3PGF A;  2F7A A;  2RF1 A;  4OQO A;  3MP1 A;  3QUJ A;  4PFY A;  4XXU A;  3ZSF A;  4EDP A;  3VVD A;  3KOY E;  1IQ7 A;  2Z4R A;  5ITT A;  3N26 A;  1IN8 A;  3OO7 A;  1OQH A;  4I5S A;  4IBI A;  5E26 A;  4LGM A;  3FUV A;  2REJ A;  4O3A A;  3U6E A;  1NL5 A;  1IY2 A;  1DGF A;  2UUA M;  3SEX A;  5ITQ A;  1LGB C;  4ZEF A;  3MWB A;  3KOZ E;  2I4B A;  3GRU A;  4QFK A;  2F5O A;  3IL1 B;  3SAT A;  1IXR C;  3H6V A;  2THI A;  3SMS A;  4OFL A;  5EYF A;  1KWH A;  3QXM A;  4E0W A;  1Y20 A;  2ZNU A;  2A5S A;  1OJL A;  2D5W A;  2UXD M;  4IO5 A;  1Z6T A;  3LSF B;  4LZJ A;  1IN5 A;  4GMQ A;  2ZNS A;  3HCQ A;  1B32 A;  4NF5 A;  1GV8 A;  1JEU A;  2DS9 A;  4GKK M;  4MB7 A;  3MP6 A;  4XKN A;  1MS7 A;  1QQW A;  1IXH A;  3MVX A;  3SEU A;  4PCZ A;  2DHR A;  2YNM D;  3M3L A;  3OMB A;  3LSW A;  2XFT A;  2Q89 A;  1IIT A;  3M0E A;  3W15 C;  3SMP A;  4R74 A;  2G29 A;  2B65 A;  2C5R A;  4EXL A;  3EIE A;  4GL8 A;  2Q2A A;  2ZNT A;  1UM8 A;  1MH3 A;  5H8H A;  3IJX B;  3D8B A;  4LJ8 A;  2QL3 A;  4ITQ A;  2P1S A;  3A46 A;  1QJM A;  3Q8X A;  3R8F A;  4EF2 A;  3I5O A;  3IOV A;  3GLF A;  1XC8 A;  4MH0 E;  1I4W A;  1NNJ A;  1WDN A;  2QS1 A;  1SW1 A;  2F35 A;  4IBC A;  4QSE A;  1FTJ A;  4RPO A;  1L1T A;  4F3P A;  4QFO A;  5ITY A;  3U60 A;  1XOC A;  4JI3 M;  2ERC A;  1B3H A;  4HLQ A;  4QHS A;  1SD3 A;  1I6Q A;  1XMO M;  4X62 M;  4YB5 A;  1LB9 A;  4DR5 M;  2ZAM A;  3KOT A;  4I9D A;  1Y1M A;  5EP4 A;  2F4V M;  3FUZ A;  1QAN A;  4X65 M;  3FJM A;  1POT A;  1H3D A;  4JI7 M;  3RY3 A;  1TH2 A;  5ITX A;  5CRY A;  3RQT A;  1QW0 A;  3C33 A;  1YPN A;  1UIV A;  4LFB M;  4DDD A;  1O63 A;  1E9S A;  1I69 A;  1FQB A;  4GKJ M;  1IBL M;  2L6O A;  3K4U A;  3UA8 A;  3EHU A;  4ELP A;  4G68 A;  3PV0 E;  2RIN A;  3TQW A;  1OFH A;  1URG A;  3MVY A;  4QF9 A;  2QS2 A;  3V83 A;  3HHX A;  1S3S A;  3HPI A;  3MJN A;  3G3G A;  1B5I A;  4KHZ E;  2Y7R A;  1Z5A A;  3PPN A;  3SEY A;  2VGQ A;  3H7M A;  2AHM A;  2ONR A;  4QSC A;  3DP4 A;  2UXC M;  3DM0 A;  3J7A S;  3LSX A;  1FTM A;  3SER A;  4JV5 M;  3L25 A;  2XXU A;  1B6H A;  3EQ1 A;  4LRT A;  2BJV A;  4NXM M;  3M8U A;  2D7E A;  4NF6 B;  1IY0 A;  2F5Q A;  4CIS A;  1JEV A;  3K01 A;  1BIY A;  1XT8 A;  3WHL A;  1N84 A;  1JVX A;  1M5C A;  1J5E M;  1YE9 A;  4H8J A;  1TFA A;  1YCJ A;  3MQ9 A;  4LF6 M;  4DE8 A;  3FXQ A;  2RGO A;  1F9B A;  3TTR A;  4ELO A;  1R6B X;  2NVU B;  3G3I A;  3FZV A;  1VE4 A;  3SEV A;  2LXE A;  4LG2 A;  2AIX A;  4NRV A;  1HQC A;  3KN7 A;  4P11 A;  3D8L A;  2RCA A;  5DT6 A;  2KRU A;  4G8H A;  4LJ9 A;  4LZZ A;  3C58 A;  3U5Z A;  4B3M M;  1MXZ A;  1NY5 A;  2I7N A;  4NWC A;  1MDQ A;  4LF7 M;  5H37 D;  1MQI A;  5AE4 A;  2ALU A;  2XXY A;  4OVJ A;  3UOR A;  1XC1 A;  1Z7M E;  1FJG M;  4LP2 B;  3C4M A;  4G8M A;  5L9O A;  2XSZ A;  1PB8 A;  2OCU A;  2R4J A;  4R9F A;  1A40 A;  3FJ7 A;  4M1V A;  4OXV A;  2DXR A;  3TTL A;  4O3C A;  3O6I A;  1MPD A;  3JAM S;  3HHY A;  4R9G A;  4GHL A;  5H8S A;  3J2P B;  2HAU A;  5ISU A;  3MVZ A;  2I49 A;  3LUY A;  5J1D A;  1LAF E;  3MZ9 A;  4JN6 A;  4LF5 M;  4FED A;  3IO4 A;  2UVG A;  5ITO A;  2ZXT A;  4WED A;  2P5T A;  4QRZ A;  2ZYN A;  1M5F A;  1Z5B A;  1SBP A;  5ELV A;  1LB8 A;  1OLA A;  2CEA A;  3Q28 A;  1IN4 A;  2C9O A;  4QNR A;  3N94 A;  2FOI C;  2E5L M;  4S12 A;  4E0X A;  3OO6 A;  2OLB A;  3AV0 A;  1PBP A;  5EXP A;  1HNX M;  3D4G A;  1W5T A;  2HFB A;  2A5Y B;  1KYI A;  1VR5 A;  4X48 A;  5KCJ A;  4U1Z A;  4REZ A;  4GHA A;  3HJ8 A;  1G41 A;  4YKJ A;  3UIF A;  2HKJ A;  1SXJ C;  1B7H A;  3GRY A;  2RC7 A;  4AG6 A;  4X9T A;  4X1D A;  3TPZ A;  3UK6 A;  3FTF A;  2FFJ A;  1IXC A;  3CF2 A;  1IQP A;  5AA4 A;  3FUU A;  4R73 A;  3KEI A;  3GP1 A;  4YAH X;  3L2A A;  1R9Q A;  4JWX A;  1TDH A;  3AFH A;  3ILK A;  3I4Y A;  1URD A;  2I0C A;  2FNA A;  1MPC A;  5DNY A;  5KDT A;  2Q2C A;  1MQH A;  3A3C A;  3BKI B;  4LFC M;  1EZO A;  2C98 A;  5CBR A;  1X37 A;  4IIW A;  4JI0 M;  5F3W A;  3GPX A;  5K2X A;  3KXE C;  1Y4C A;  4OET A;  2QMW A;  3T9V A;  3IOT A;  1XNR M;  2ABH A;  2AL4 A;  2PYY A;  1Y1Z A;  1ZBM A;  3FUX A;  3TWM A;  2DXY A;  3JZJ A;  3MJ5 A;  3E3K A;  3KJ7 A;  1NY6 A;  2X4A A;  2I3V A;  1N34 M;  3KOS A;  2YLN A;  3M7G A;  1A99 A;  3OXN A;  3U61 B;  1GL7 A;  3R6U A;  1NH7 A;  5KPR A;  5JI2 E;  2XX9 A;  1H44 A;  1T0K A;  4N13 A;  4GXA A;  1ZIU A;  3MUQ A;  4YIC A;  3FKE A;  4EQ7 A;  4RNS A;  8CAT A;  1NFT A;  4FE8 A;  4FIM A;  4DXU A;  4F2O A;  1A54 A;  2QPA A;  1DSN A;  1UIU A;  5AA1 A;  3MPL A;  3VKG A;  3IOR A;  2V25 A;  4F2Q A;  1MRP A;  2OWT A;  1FQD A;  5TU0 A;  1QUI A;  4L15 A;  2KLF A;  2VOZ A;  4IBJ A;  5C1B A;  1SVX B;  3FGS A;  5KQ8 A;  3TQS A;  1Y3Q A;  4R75 A;  5L9M A;  4IO7 A;  1E32 A;  4OFO A;  2QP9 X;  2OBG A;  1G4A E;  1R6Z A;  1LCT A;  2DWN A;  4ZE8 A;  4M9Z A;  1PM5 A;  4DCY A;  4XGI A;  3C31 A;  2OWS A;  4OW0 A;  4NF8 A;  1B51 A;  3DA1 A;  5A5X B;  3SC3 A;  3PMV A;  1E94 E;  2C96 A;  1QAM A;  4QNM A;  4LAT A;  3E4R A;  4NRW A;  4MLQ A;  4R6K A;  3UGW A;  3T9X B;  4GL0 A;  4YMA A;  3O28 A;  5I84 A;  2VD2 A;  5B7D A;  1IN7 A;  3HWS A;  4KCD A;  4AB6 A;  2XXP A;  4AG5 A;  1B7U A;  2QCU A;  4YU0 A;  4KPT A;  2LAO A;  2G5G X;  4FCW A;  1B2H A;  3ODB A;  3PMX A;  4BBA A;  4KYS A;  2V1C A;  1OIB A;  4GD5 A;  4G4Q A;  4D81 A;  1XWI A;  3LVW A;  2W7Y A;  2H98 A;  3DFZ A;  3K92 A;  2Z8D A;  4H67 A;  5DYG A;  1UTB A;  2DVW B;  3PUV E;  5F7V A;  1LBB A;  4RK2 A;  3VDF A;  1Y4T A;  4X64 M;  2YPN A;  4G4O A;  5KPZ A;  2VHA A;  3CSG A;  3GRV A;  2VQF M;  3JR5 A;  3CI8 A;  4R7G A;  5H8N B;  4HTG A;  2YQZ A;  3TL4 X;  3PMW A;  1N36 M;  4NTL A;  3UMM A;  4FAJ A;  1Z59 A;  3KP1 E;  3QUF A;  1QVS A;  3IOU A;  4FWG A;  4EXK A;  5I56 B;  4FD2 A;  4H8I A;  3U60 B;  5JK4 A;  4F1V A;  4DV3 M;  1R2Y A;  1Q3C A;  3UZU A;  4LFA M;  1TWY A;  5ITP A;  1IXZ A;  5B70 A;  3LSL A;  3ILU B;  3NBI A;  2H25 A;  3IOW A;  4YB7 A;  4QSD A;  4GLI A;  4GIT A;  1YUB A;  4B3R M;  3L29 A;  1OFI A;  2KW0 A;  2LH0 A;  3RGY A;  4H1X A;  3OSQ A;  1SYH A;  3SYL A;  3G7W A;  2KZU A;  2ZAN A;  5CMM A;  3K6X A;  3THI A;  4U23 A;  1IZ1 A;  1MXX A;  4JI4 M;  1EZP A;  2DOJ A;  2O1M A;  2EUC A;  4OHN A;  2VII A;  3VLF B;  4I4L A;  1UTH A;  1PDA A;  4FVM A;  3UJN A;  1B52 A;  4C1U A;  3HU3 A;  2F8D A;  2DWL A;  1R2Z A;  1OLC A;  4OEN A;  5DTB A;  5K2Y A;  1N0T A;  2R62 A;  3M3F A;  1PB9 A;  3VK8 A;  5L8D A;  3T93 B;  1II5 A;  1JET A;  4ZEC A;  4IBB A;  2Y0Q A;  1LBC A;  3TQL A;  3TTN A;  4DR7 M;  4MGK E;  3VVF A;  3U94 A;  4ZEB A;  2F5P A;  1PBQ A;  4PFU A;  3U6S A;  1LST A;  3VE1 B;  4F1Y A;  1NNK A;  4F18 A;  5JI3 E;  1DO2 A;  4B08 A;  5EQT A;  3SYK A;  1GLN A;  2OQ4 A;  2ZMB A;  5I2N B;  4IJE A;  1FW0 A;  1B3G A;  4MBP A;  5FHN A;  1NHW C;  3IK6 B;  3DEL B;  2XXR A;  3IJO B;  3J81 S;  3AKZ A;  4R72 A;  1NJF A;  2RGH A;  4ONY A;  1A8E A;  4WEP A;  2G93 A;  3ZCB B;  4F31 B;  4MM3 B;  2RCB A;  1G3I A;  1HSJ A;  2GHB A;  3HV1 A;  4HCY A;  3U6M A;  3IB2 A;  5LOM A;  2V1U A;  2FYI A;  4YKI A;  1US4 A;  4G4R A;  1A55 A;  4NED A;  4ZPX A;  2O1L A;  3JYR A;  2NUV A;  5EXT A;  3OEL A;  3FIR A;  4OFJ A;  3HU1 A;  3K2L A;  2UU9 M;  5L9S A;  3RUM A;  3GQ4 A;  1D9V A;  4R2B A;  2OK2 A;  2O7U A;  4R3D A;  3L28 A;  4K3F A;  5I59 A;  4DV1 M;  4ESW A;  1M5D A;  2R18 A;  2DVZ A;  1NH8 A;  3H03 A;  4DV4 M;  2HZL A;  4U22 A;  4I62 A;  4BB9 A;  3QSL A;  2CMO A;  5FTH A;  4BDR A;  2OJT A;  1G8P A;  4KYE A;  3V8X B;  3PVS A;  2XZU A;  2D7H A;  4HW8 A;  3FXU A;  4DV7 M;  1DOT A;  4IBE A;  2FA7 A;  4L16 A;  5I59 B;  3FV1 A;  1IBM M;  1BP5 A;  3GLB A;  1FCK A;  1AOV A;  4XKP A;  1LCF A;  4B7G A;  1MG1 A;  2ZM6 M;  4OER A;  2QS3 A;  4I8O A;  5EHS A;  4QOZ C;  2F6P A;  4OYV A;  1JW4 A;  1FQE A;  3S9E A;  2M60 A;  3D4C A;  3HO7 A;  2E1S A;  3FD9 A;  4LJ5 A;  5FTJ A;  4GVO A;  3OEM A;  2XZF A;  1QUK A;  2DVC A;  2CV0 A;  4DCX A;  4DR2 M;  1QUL A;  2O7I A;  2P0S A;  4G6Z A;  2GH9 A;  3T1Y M;  3FV2 A;  4YHH M;  3UN6 A;  3FVN A;  2ESN A;  4QOS A;  5JEI A;  1PJI A;  3HHW A;  2CHV A;  2R65 A;  2IEE A;  2UUB M;  1BLF A;  5JTY A;  4RYA A;  5H8N A;  2J7N A;  4EF1 A;  3T9U A;  3ILT B;  3PU5 A;  5M2V A;  2P2A A;  4B3T M;  2RKM A;  3A45 A;  3VDU A;  1DPP A;  4GRK A;  4JSD A;  5ITU A;  1LFI A;  3U6L A;  2Q9T A;  4ISU A;  4TOZ A;  1MXU A;  3SAS A;  2G8L A;  2DWH A;  4AB5 A;  3IX1 A;  1ZU0 A;  1N77 A;  1HSL A;  3CG1 A;  5JTY B;  2Z22 A;  2DE2 A;  3IB1 A;  4H5G A;  2IA4 A;  2GRV A;  3LBS A;  3KVW A;  1JNF A;  1SW2 A;  1ATG A;  1FQA A;  1H45 A;  4RK9 A;  2YR0 A;  1NSF A;  1TFD A;  3VDP A;  3HJS A;  3T38 A;  4UA8 A;  5BUU A;  2GHA A;  1B40 A;  2I4C A;  1BKA A;  5ICQ A;  3KP0 E;  4NF4 A;  3CTW B;  1NKX A;  5AA2 D;  4NF8 B;  3GRR A;  3K8Z A;  4YB6 A;  4ESX A;  5HBC A;  2V3T A;  3FTE A;  3RE8 A;  3WAF A;  1I6B A;  3GZG A;  3FTD A;  1P1W A;  4RXL A;  4XTC Q;  3PFI A;  2AL5 A;  4PE5 B;  3SAV A;  3Q26 A;  3U61 A;  3VKH A;  3EHT A;  4MGI E;  4BDO A;  4XBO A;  2C99 A;  1B5H A;  3K1P A;  3ECR A;  2Q88 A;  1SW4 A;  3KJT A;  4H5F A;  3R7X A;  3I3V A;  4B7F A;  1TGU A;  3FUT A;  3ONM A;  3SFZ A;  4U4X A;  1K3X A;  3HU2 A;  3B9P A;  5FSW A;  2Y84 A;  3U6P A;  3U93 A;  1IXI A;  2VP1 A;  3VLV A;  1IN6 A;  4G2Z A;  2QPQ A;  3FYC A;  1MH4 A;  4RY1 A;  3IG5 A;  1K82 A;  2DZN B;  4YZZ A;  2KA6 B;  5KDT B;  5EP1 A;  3GLG B;  3FVK A;  2UVI A;  1PC3 A;  3U5Z B;  2BJJ X;  2L7H A;  2HZK A;  3CVG A;  2R6G E;  2GFE A;  1YAE A;  4IBF A;  3Q27 A;  5CM6 A;  2F5N A;  1OQG A;  2J7O A;  1MQG A;  3TYH A;  2NXO A;  3SAW A;  4PDI A;  1D9Y A;  1D4N A;  2X7Q A;  5FTN A;  5H8Q A;  3T1H M;  1AL3 A;  3PUY E;  5DVI A;  1EE8 A;  3DZD A;  5IRE B;  2HHH M;  3K1J A;  2Y0T A;  1NNT A;  3C32 A;  1FTK A;  4NSR A;  2Z23 A;  2EA0 A;  1EH3 A;  2PT1 A;  4EIW A;  3IO6 A;  3ZKK A;  2L7I A;  2KRK A;  4LJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...