3KSXA

The alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
b'AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
molecule tags Transport protein
source organism Xanthomonas axonopodis pv. citri
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
total genus 95
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA02
1MDP1 3E4RA 3OENA 4QRZA 3HPIA 2DS9A 3H06B 4YZZA 5TPAB 4F3SA 1MG1A 2XX9A 3C36A 1MXXA 3CI8A 4PE5B 2ZMBA 1FQCA 2W7YA 4ZEIA 5IKBA 3SEXA 1B58A 4GVOA 3H6UA 1A40A 3MP8A 1B5HA 5DVFA 3BBRA 4G8HA 3QAXA 5JTYB 1BTJA 1MY3A 2O84X 4JWOA 1VE4A 2I4CA 3DELB 2OLBA 3QYTA 4KYSA 4U1ZA 3TCHA 3TTLA 1EZOA 4HCWA 1VR5A 1ZKBA 4NF6A 3FV2A 5BUUA 2BJJX 3LSXA 4OFJA 5I2KB 5L9SA 3ONMA 4I1DA 2D3IA 2UVGA 3QUFA 3CFLA 2H98A 4I62A 4N13A 2AL4A 1II5A 1OVBA 2F97A 4XXUA 5I59A 2O68A 5B70A 3FGSA 2Y7WA 2F6PA 4BDNA 5F1QA 1I6QA 3TDJA 2Z22A 3OXNA 3MP6A 3W9WA 3KEIA 4LQ2A 3F11A 4YB6A 5ELVA 1UTHB 1B3GA 1I69A 4LUBA 5H8NA 3O29A 4GOTA 1FCKA 4NTLA 1B0HA 4R9FA 3PUYE 2QJEA 3E13X 4WEDA 3T93B 4DDDA 3FJ7A 4EXKA 3EF7A 4POXA 2GHBA 4FEBA 3OMBA 3M3LA 4F19A 1B5IA 4KD5A 4YICA 1ZJLA 5JEIA 1ELJA 5FHOA 2R71A 3KJTA 3FVGA 1FQDA 1N04A 1HSEA 1S7YA 1SW1A 2HCAA 3C33A 3RY3A 4H8IA 1US4A 4R73A 1WODA 2Q88A 4U4XA 3CR9A 1QW0A 4YB7A 3FJMA 3V8XB 5A5XA 5K2XA 5ICTA 3I3VA 4RY1A 2XXUA 1N7WA 3IOUA 4NE4A 3LSFB 1TXFA 1GV8A 1QUIA 3DLNA 4LZ5A 4LP2B 2Q9TA 3KBRA 1M5EA 1H43A 1URDA 5I56A 5J1DA 1SD3A 3N94A 2VP1A 1S50A 3I6VA 1B2HA 1M5DA 4O3BA 5CMCA 2DOJA 3G7WA 3K02A 2VD2A 4R72A 1LAXA 4WEPA 5CRYA 4GWOA 2GRVA 1DMBA 1Z7ME 3OSQA 2ANJA 4PFYA 3TKDA 3UORA 3SEWA 1NNTA 4FAJA 3E9XA 4JBZA 2I49A 1DPEA 1PBPA 2ONKE 1SDXA 2V3TA 2YPNA 1SYHA 2DVZA 3IB1A 1B40A 4IGTA 2OWSA 3L6HA 2NWJA 3K1PA 3IX1A 3KFMA 3ODBA 3VLUA 3ZS6A 3D4CA 2XX8A 4QFNA 4IO3A 5I84A 2FNCA 4R2FA 4OFLA 1FQBA 3RUMA 2HXWA 2O7UA 3D4GA 2H99A 3MP1A 3EHUA 3H6VA 5AE4A 1B1XA 3IR1A 1LAGE 2QS1A 1RYOA 2HZLA 3KN8A 4LATA 4MH5A 1LBCA 3KZGA 3S2VA 5I59B 2DWJA 1MPCA 3B6TA 1US5A 2R6GE 4FEDA 1N76A 4F18A 1B6HA 1FTJA 4GXAA 3O66A 1FW0A 2RCBA 3C9HA 3G3FA 3CVGA 5DT6A 1B9JA 2H25A 4XKNA 3MVWA 2DE2A 3C4MA 1B4HA 1SW5A 5I2NA 2A5TA 4O3CA 4Z0IA 2ZYOA 4OESA 3JV9A 1VFEA 1HSLA 3JYRA 2P1SA 1T0KA 2AIXA 1IXHA 1SVXB 1B4ZA 3VVDA 3A3UA 3RGYA 3HO7A 3K1MA 3BFTA 2D21A 2GFEA 1YTVA 2F34A 4JB7A 4NWDA 3PPNA 1FTOA 3C34A 5H8QB 5TU0A 4MLQA 3W9VA 1POTA 2DQVA 3KGCA 3IJXB 4OQOA 4C0RA 4U22A 2HQ0A 2V3UA 1LB8A 3CSGA 5CMBA 1JEVA 1P1WA 4PFTA 2Y84A 3LR1A 3A09A 1A99A 1KWHA 2A5SA 1B0LA 1EZ9A 2D5WA 2I58A 3EHSA 4G77A 5EHMA 5EYFA 1J1NA 3T96B 2X26A 1QJMA 3U94A 4BDOA 4ZE8A 4IB2A 1A8FA 4FJPA 4OXVA 4DXUA 3CSBA 3PGFA 2QPQA 3MZBA 4F2QA 2M8CA 3TCFA 3PD9A 4TLMB 1S9TA 1VFDA 3FV1A 5ITPA 2I4BA 1IIWA 4IO2A 2F6GA 4PETA 1QVSA 1N0TA 1B7ZA 3O97A 1B1HA 1H44A 1CE2A 1JVYA 2E1SA 2RC8A 2Y7RA 2I0CA 3FXQA 3HHGA 4KPTA 3LBSA 3ZSFA 2FA7A 3MQ9A 3C31A 4JDFA 4RXLA 2ONRA 4JSDA 3V89B 3SEUA 1MXZA 2VGQA 1M5CA 1DTGA 1EZPA 4QSDA 3O2AA 1R6ZA 4NF4B 4C1UA 2UVJA 2THIA 3RLFE 3TFLA 3IL1B 4ZEDA 1UTHA 4IO4A 5AA2B 5AA1A 1PEBA 4XIGQ 5H8SA 4U4SA 3SETA 2LAOA 1Y1MA 3TODA 3RTFB 4BDQA 5K2YA 2NVUB 1H3DA 1PB8A 3MZ1A 3QIMA 4ZEKA 2XXIA 3CG3A 2HEUA 1B3FA 3GBBA 5AA2D 4POWA 3U93A 1URGA 3LC8A 1D3KA 4FORA 4JSOA 4EQ7A 4R6HA 4Z7EA 5CBSA 1BIYA 4O3AA 5ISUA 3H03A 3U8QA 1Z7NE 4UA8A 3CFXA 3P7IA 4NF5A 4PQJA 5TP9A 3T9HB 1MPDA 2H9BA 1B3HA 5BWJA 1XOCA 5CMKA 1XHYA 3OO9A 4OMBA 1OQGA 4KQPA 5FTHA 5IAIA 4DXCA 4GRKA 5KZTA 1O7TA 1USYE 2DE4A 3PPRA 4LVQA 3S9MC 1FTKA 5AA4A 2ZYMA 4YKIA 5KCJB 5B7DA 3AXFA 2QMXA 4IY6A 1JW5A 2H4IA 3IOWA 3TELA 1OVTA 3FXUA 4XKQA 3KSXA 2QRYA 3G3HA 4GL8A 3SERA 1PB7A 3KN7A 5H8QA 5ICQA 4NWCA 3WAFA 2ZNSA 5AA2A 3G3JA 2ALUA 3O28A 4R9GA 4XTCQ 2QMWA 3FVOA 2WKYA 4F39A 4GD5A 3K1NA 1B3LA 1LAFE 4OEUA 4RK9A 4WKMA 3MPLA 1MQDA 5EHSA 3THIA 1QKAA 1JVXA 4G68C 4BDMA 4EQ9A 1Y3QA 4ZEBA 3MJNA 3MWBA 4BLAA 1MRPA 2QSXA 1GR2A 2Y7KA 4OVJA 4ZDMA 4YMAA 3LSLA 2I6EA 2QS3A 3EPEA 4KHZE 1MS7A 4G4PA 4LZ7A 1P1QA 2FYIA 3K00A 2XD3A 3PUZE 1LFGA 1IEJA 4FECA 4HS7A 4ZEFA 2OK2A 5I58A 4LZ8A 2XXPA 3PV0E 1D9YA 4IY5A 2DXRA 2UVIA 2I3WA 1LSTA 4U23A 4DE8A 3GXAA 3PMVA 3PPOA 4DZ1A 2B3BA 4GLIA 1NKXA 4EXLA 1AIVA 4H1XA 1MM6A 4I9DA 2XXTA 3FVKA 3KSJA 3IAZA 4JXIA 3N6UA 4KFQA 5FHMA 4X1DA 1B51A 4ZZEA 3TYHA 3U1OA 1LFIA 3ECRA 5ITOA 2F36A 2DP8A 1FQFA 3CIJA 2AL5A 2CZLA 4OTEA 4MLVA 1Y4TA 5I2NB 4R75A 4X1BA 1Y3NA 3PUXE 4Q0CA 2ZNUA 2G29A 3G3IA 2F7CA 4E0XA 1B3EA 2B65A 4M1VA 1D9VA 1ZMGA 4GQOA 2RF1A 4L17A 4RK2A 1L5TA 3TZAA 1IXCA 3G3GA 4OENA 1FQEA 2HFBA 3MW0A 5KDTB 1MH3A 1PBQA 2F7BA 4QFOA 3KOTA 3H4ZA 3Q27A 3SEVA 1AH5A 2X7PA 4RNSA 3Q29A 4QSCA 4FATA 5I57A 2VD3A 2QL3A 3HCQA 3VVFA 3MVXA 3VXBA 4R2BA 1D4NA 1B32A 1DPPA 3GZGA 5L9OA 4RPNA 3FASA 3HV1A 5I58B 1A8EA 2NOOA 3DP4A 3G3KA 2DWAA 3ZKLA 2F35A 1P1NA 1BLFA 3OELA 4XKPA 1N3WA 3O6IA 1PDAA 2V3QA 3CG1A 3EHTA 4YAHX 1IXGA 1A7LA 3K6UA 3VLWA 4BDRA 4H5FA 5LOMA 2DVCA 3IJOB 4MBPA 4E0WA 1JNFA 3T9XB 4X9TA 1AMFA 3V5AA 4H67A 4OYVA 1SBPA 4Q8RA 4GF8A 5JK4A 4F1VA 3N6TA 5CBRA 1MY1A 4OZ9A 2Q2AA 3IB2A 3SEYA 1LCTA 1N7XA 1Y1ZA 3MUQA 2CMOA 1MQHA 1YAEA 4PP0A 4EDPA 2PT2A 1POY1 2B3FA 3R6UA 4PFWA 3W15C 3BKIB 1R9LA 4MF3A 5H8FA 1NH7A 3QSLA 3FIRA 1QUJA 3CFZA 4LA9A 2Z8DA 4ZZAA 1AOVA 2Z8EA 2O69A 3OO8A 3S9EA 4ESWA 3B6WA 3MVYA 3PUWE 3FZVA 5FHNA 4ECFA 5A5XB 4IO5A 3KOSA 1MY4A 2F8DA 4RYAA 4NF6B 1Q1KA 2XXRA 2DWIA 1EU8A 1JW1A 2HAUA 3CRBA 1NL5A 4NF5B 1CB6A 2GH9A 2Y7IA 4QFPA 5DVJA 1TFDA 4ELRA 1IITA 3O6HA 3MPKA 3TPAA 4EUOA 3SDFA 3TAJA 4HCYA 4IGRA 3K0VA 3TQWA 4AQ4A 4YMBA 2OWTA 3KG2A 1ATGA 4I8CA 3GLBA 1QUKA 1F9BA 3TCGA 1XVXA 4RJZA 5HPQA 1MDQA 3LUYA 2IEEA 5DTBA 4H6DA 1USYH 4IO7A 4ISUA 5F7VA 2Q89A 5L9MA 4F3BA 5KCJA 1N3XA 1VSOA 2DWHA 3K6WA 3VVEA 1QULA 3TMGA 4KI0E 1P99A 2KLFA 3IOVA 3ILUB 1BP5A 1OIBA 2RC7A 3LSWA 2XXVA 1UIVA 3PPPA 2G93A 4NF8A 2XHDA 3IO4A 4G8NA 3T9UA 1PC3A 3RT6B 3TQLA 3PPQA 4QF9A 3OSRA 3VXCA 5TP9B 3MBPA 1GGGA 3O6GA 4G2ZA 5DYHA 4KCDA 1MPBA 4F3GA 1MQJA 2RC9A 4R6YA 2ABHA 2ZNTA 1UQWA 3OEKA 5CI5A 2Q2CA 3S9LC 2F5XA 1LB9A 2GHAA 5HM4B 3RQTA 3VDFA 4ELOA 1RYXA 3IB0A 3U72A 3UK4A 1IQ7A 4F3PA 4ZS9A 3PMXA 1MY0A 2X7QA 4M4GA 1Q35A 3TTMA 1SI1A 1UIUA 5TPAA 3K4UA 1NNFA 2HZKA 2OCUA 2RINA 3TTRA 3VLVA 2DXYA 3L6GA 3PMWA 2O7IA 4DCYA 3S9NC 1NNKA 4ZE9A 4QFLA 3H6TA 2I48A 4N07A 1P1UA 3ILTB 1H76A 2HAVA 1TFAA 3H6WA 1MXUA 3S4UA 3SESA 4YKPA 2XXQA 4AB6A 3PU5A 4H5GA 4C1TA 1JEUA 5CMMA 1QKBA 4RPOA 3VV5A 4TLLB 4P11A 3HN0A 4TQUQ 5DEXB 4F2OA 4QFKA 4GFRA 1YPNA 2QS2A 4P0IA 2XXXA 2XXHA 3BFUA 1DTZA 3KJ7A 2OZZA 4IO6A 1MXVA 4LQ5A 4U2RA 4ZECA 3EQ1A 4HTGA 3USDA 2P2AA 2Z23A 1WVJA 5CC2A 1LFHA 3RTWB 1OLAA 1R1NA 4G8MA 1FQAA 1I6BA 5M2VA 4NMYA 5AA4B 5DVIA 4OWDA 2ZYKA 1SYIA 2ZXTA 4KR5A 4R6KA 1Y20A 4XKRA 1TWYA 4QHQA 1B7HA 2REGA 4K3FA 2REJA 4PFUA 4OETA 4R74A 1FTLA 1EH3A 3UGWA 2PYYA 3TTNA 3B7DA 3K6VA 2A5TB 4NEDA 2XX7A 1IXIA 4Q30B 3PUVE 2AYSA 5JTYA 3E3KA 3N5LA 2O51A 2R9JA 3OO6A 4Q5TA 3EN3A 3OEMA 2VOZA 1LCFA 2F7AA 1OMPA 2I0BA 2PX1A 3KN3A 3C32A 4F1UA 3JZJA 3QXMA 1B7UA 3FJGA 2H5YA 4N6PA 1ZTYA 4U1OA 3OD7A 4GXSB 4DIGA 4EF2A 3U92A 2RKMA 3MAMA 3Q25A 5I57B 1SW4A 2UYFA 1B5JA 1MM7A 4MFIA 4YB5A 3T9VA 4DXBA 1I6AA 1RKMA 3MVZA 1XC1A 3M8UA 4UACA 2XD2A 5H8HA 1ZLQA 4FE8A 4EF1A 1OQHA 3K6XA 2UYEA 2XXYA 2NUVA 3DP8A 3RN8A 1XS5A 3UN6A 3IO6A 1WDNA 4OHNA 1N84A 1NMUA 1R9QA 3IK6B 4KYDA 3I5OA 4OERA 4H8JA 2PT1A 2Y7PA 2Q8JA 1O64A 4F22A 4YKKA 3GBAA 4JWXA 3SKPA 2O1LA 1MQGA 4NF8B 1A55A 1HSJA 2OJTA 2Z8FA 3H3GA 1XVYA 3R7XA 2V93A 2NXOA 4HW8A 2PVUA 1O63A 1P1OA 1TT1A 3C35A 2P0SA 5HBCA 3MZ9A 2VHAA 5H8FB 1JW4A 1ANFA 3Q28A 4OEVA 1SI0A 2IA4A 3TEPA 3RPWA 2V84A 3IORA 4YKJA 1LGBC 3FVNA 4LONB 1ZU0A 1IUDA 2XXWA 1ZIUA 3DP6A 1DOTA 1MQIA 3FXRA 3PD8A 4H0WA 4P0GA 4ONYA 4NF4A 1DSNA 4X48A 3T66A 2YJPA 4EQBA 5KDTA 4QSEA 2UXAA 1UTBB 4ND9A 4YU0A 4KYEA 1SW2A 1XT8A 1YCJA 2DE3A 3DM0A 3IOTA 3OO7A 3QUJA 3R26A 4G68B 4GIZA 4OFOA 1UTBA 1NH8A 1Y4CA 4U21A 3A3CA 3M3KA 2PBWA 1M5FA 3K01A 1BKAA 4H65A 3UP9A 4G68A 4F1YA 1B52A 2I3VA 1JETA 3B6QA 3FD3A 5H8NB 3ZKKA 3QK6A 1NFTA 3FUZA 3TUSA 2E0SA 3MC2A 4TOZA 3VFJA 1JQFA 1GTKA 1GVCA 4BDLA 1Y3PA 1Y9UA 1B46A 4JWYA 4KCCA 4ELPA 1MXWA 2YLNA 2F78A 3M3FA 4WXJA 1A54A 1B05A 1LLSA 2ZYNA 1ZBMA 3OOAA 1URSA 2QS4A 2V25A 3FATA 5FTIA 1MXYA 1PB9A 4ESXA 3V83A 4AB5A 3UA8A 2RCAA 2ESNA 3HHFA 1IZ1A 3HSTA 2O1MA 2ONSA 5I2KA 2OBGA 4DLDA 3UIFA 3RT8A 3WAEA 4ELQA 1SQYA 3Q26A 1FTMA 4F29A 1AL3A 3TTKA 1M5BA 5DEXA 1OLCA 2DYXA 1MY2A 1MH4A 3VE1B 3K2DA 4F31B 3O9PA 4RA1A 3T22A 5L8DA 2UVHA 5AA3A 1LAHE 5CM6A 1LBBA 4THIA 1NNPA 3N26A 4FIMA 5I56B 4DCXA 3RNNA 2DSFA 3H7MA 1H45A 5H8HB 2PMSA 4GL0A 2O6AA
chains in the Genus database with same CATH superfamily
1DCUA 4FWHA 1H6UA 4OVZA 1XXHB 2HKJA 3LMMA 3C36A 3CI8A 4MNPA 2ZMBA 4ZEIA 4LF5M 4GVOA 5I5PA 5DVFA 4MMPA 3K1JA 4JWOA 2I4CA 3QYTA 1N78A 3K8ZA 2J7NA 3L2AA 1VR5A 2EO2A 3FV2A 4OFJA 4MM3B 2WSCF 3ONMA 3SHFA 4I1DA 5EXTA 4I62A 4N13A 2AL4A 1K82A 4LY6A 2O68A 2MR9A 3HGIA 3FGSA 3B9PA 4I3EA 5F1QA 1I6QA 1PM5A 1OJLA 1HT1E 3KEIA 4LQ2A 3F11A 1G0IA 3O29A 3T1YM 2QJEA 2XLJA 1IN4A 3W67A 2GHBA 3OMBA 4MEVA 1D2NA 3SYKA 4KD5A 4YICA 4GIPA 2R71A 1SPIA 2L4FA 4REZA 2LWXA 2XFSA 2Q88A 3RGPA 1NNUC 5A5XA 4X8RA 5ICTA 2XXUA 2WZJA 3IOUA 1BVSA 3DLNA 4LZ5A 5LMUM 5J1DA 3I6VA 4GWZA 5EQTA 2D7GA 1HNXM 2VPNA 3K02A 1PGYA 4WEPA 4GWOA 2GRVA 4PFYA 3UZUA 4FAJA 4PGNA 1GO5A 2I49A 2G8LA 2ONKE 2YPNA 4IGTA 4KT0F 3IX1A 4S12A 2KR0A 3D4CA 3NBXX 5I84A 5LTCA 4R2FA 2OWZA 1EFUB 1FQBA 2H99A 2XWKA 1VEGA 2KEBA 2XSZD 1QGXA 1OIPA 1RYOA 3KN8A 4LATA 1WGNA 5FTKA 3KZGA 2KNAA 4DR3M 2R6GE 4FEDA 1N76A 1TDZA 3D8LA 1FW0A 2EKFA 1VG5A 5EJCA 1B9JA 5E6JA 2ZYOA 4OESA 4JI5M 3KOYE 3MMPA 1QANA 2GFEA 1IY2A 2F34A 3PPNA 1FTOA 5H8QB 3KGCA 5EQ9A 1LB8A 3CSGA 3UGWA 4PE3A 4U1ZA 2D5WA 5EHMA 1B0LA 4G77A 2KW0A 1G0HA 4PF6A 3T96B 2RRUA 1INPA 2KRKA 4IB2A 4LRTA 4OXVA 3SC3A 3MZBA 2FFJA 1S9TA 2Y5KA 4IO2A 1B1HA 3HHGA 2Y7RA 3FTCA 3KBZA 1NV0A 1QAMA 3C31A 3MQ9A 4JDFA 2ONRA 4JSDA 5ESYA 2F5QA 1MXZA 2KZSA 4O8MA 1EZPA 4C1UA 3TFLA 3IL1B 4OVZB 1UTHA 1P3QQ 3NOHA 3SETA 5J16A 3SARA 2NVUB 3MZ1A 2CHGA 1RDZA 2XXIA 4NOOB 2DVWB 5AA2D 4PDDA 4POWA 3U93A 1XNRM 4EQ7A 5CBSA 4LZJA 4O3AA 3QYBA 3U6MA 1MPDA 3I51A 2CHQA 1D0LA 5GKNA 3OO9A 2KXEA 1OQGA 2XZFA 4DXCA 5KZTA 3S9MC 3UK6A 4YKIA 5B7DA 1FPDA 2H4IA 3IOWA 1OVTA 3FXUA 4GL8A 4PBQA 2OO9A 1V92A 4XGIA 2DAEA 3O28A 3U6EA 3FVOA 1FJGM 3K1NA 4L78A 2ZZVA 1DV0A 1MQDA 3B50A 4DUZM 1FBFA 1Y3QA 3MJNA 3MWBA 1WHCA 2QSXA 3SMSA 4LZ7A 1P1QA 2FYIA 4HS7A 1LBYA 3HJ8A 4LZ8A 3I04M 2WYPA 2XXPA 1D9YA 4IY5A 2DXRA 2I3WA 4LF4M 1MM6A 4I9DA 5EP2A 3FVKA 5FHMA 3U1OA 1B51A 2CV1A 1OIZA 2AL5A 3FTEA 4MLVA 1Y4TA 4X1BA 2G29A 4M1VA 1YLAA 1D9VA 1ZMGA 2RF1A 2VT5A 4OVQA 4OENA 2HFBA 3MW0A 1MH3A 2D7EA 2F7BA 1NV7A 1N33M 2BNKA 1AH5A 5I57A 4LF7M 4FATA 2VD3A 4JVIA 2LHCA 1D4NA 3GZGA 1DGFA 2HCBA 3HV1A 3ZKLA 1IY0A 4G3OA 2F35A 1BLFA 5HBCA 4GKJM 3UJNA 4F2LA 4YAHX 1Q3CA 3CG1A 1IXGA 1ZMWA 3VLWA 5JI3E 3V5AA 2ZM6M 1UFZA 3W0LB 1DK4A 4H46A 1Y1ZA 3MUQA 4LF9M 1IFYA 3ZC7B 3D1RA 2PT2A 4MGKE 5IZ7D 4PFWA 4DI3D 4MF3A 3RE8A 1PJQA 1FPGA 3QSLA 3FIRA 4LA9A 4HLQA 4ZZAA 2Z8EA 2O69A 3OO8A 3MVYA 3PUWE 4ECFA 4D80A 2XXRA 1NJFA 4MGYE 4JI6M 2DWIA 2HAUA 4NF5B 4AS5A 4I5SA 2GNOA 2GH9A 4QFPA 5DVJA 4ELRA 4Q7JA 3PFIA 1IITA 3MPKA 3TPAA 2K9DA 4HCYA 4AQ4A 3ROJA 5IZZA 5ET8A 3KG2A 1FPJA 4R7GA 1F9BA 1XVXA 5A2QS 2IEEA 4H6DA 1USYH 4IO7A 4X04A 2Z4RA 2Q89A 4F3BA 1WXQA 2DWHA 1AIPC 3E78A 5KQDA 3BIGA 4LJ4A 4KI0E 3IOVA 3TMGA 3ILUB 1BP5A 4NF8A 3IO4A 4JXJA 3C3DA 4AKGA 2C9OA 2RC9A 3OEKA 2Q2CA 5EQ7A 2DENA 1DO0A 1GL6A 4AZFA 2Z4SA 4ELOA 3BBZA 2QZ4A 1RYXA 4B7HA 1SI1A 3VKGA 2VDBB 3HJQA 4RF0A 5TPAA 2LVQD 2O7IA 4DCYA 5KPTA 3S9NC 3FRIA 2I48A 4N07A 4B3MM 1H76A 3PVSA 2XXQA 1G4AE 2V1CA 4FWGA 1JEUA 3PU5A 4H5GA 4RPOA 3VV5A 1LBWA 1TGUA 2WBDA 1YPNA 2QS2A 3BFUA 2EUCA 3GLFE 3HKPA 3SZPA 3U6PA 5CC2A 3SAVA 1WVJA 1R1NA 1FQAA 5AA4B 8CATA 2QP9X 3AV0A 3DFZA 1Y20A 4QHQA 4K3FA 2REJA 3TTNA 1X37A 3B7DA 2QVRA 2XX7A 5JTYA 3N5LA 5IM2A 2O51A 2R9JA 2VOZA 3VK8A 1QVRA 1HT2E 3U6OA 3C32A 4F1UA 3JZJA 3FYDA 1QUTA 3OD7A 4JI3M 5ET7A 4KO8A 4YB5A 4MIJA 4PT5A 2XD2A 2KA6B 5EYHA 1ZLQA 2R18A 4BLCA 2XXYA 3DP8A 2XZUA 3UN6A 3IO6A 1R9QA 4OERA 2Q8JA 2Y7PA 1NV1A 1MQGA 4HW8A 2Q2EB 2PVUA 5KO3A 1TT1A 3C35A 5FTNA 3GYYA 2VQEM 2VHAA 1JW4A 2Y0TA 1ANFA 3KC0A 1WGLA 2V84A 3IORA 4YKJA 3FVNA 1ZIUA 4H0WA 3AKZA 3AJIB 4ONYA 3JAMS 3T1HM 3EIHA 4PDGA 4B7GA 1MX0A 1XT8A 3DM0A 3OO7A 3RPLA 3UA8A 4UACA 4G68B 4OFOA 4GIZA 4EXKA 1NH8A 4F1YA 4D81A 3GLFA 1NFTA 2CEYA 3SASA 3MC2A 4TOZA 4JWYA 4ELPA 3M3FA 1B05A 2MGWA 2ZYNA 3OOAA 4ESXA 3FATA 1PB9A 1L8QA 1EYKA 2DHYA 3E79A 2ZBKB 3HHFA 3HSTA 3LV0A 5I2KA 4DLDA 1OFHA 1NV3A 1RDYA 3Q26A 1AL3A 1ZV1A 5IWAM 1OLCA 3VE1B 4F31B 3K2DA 5EP1A 3GQ4A 4IBJA 1EIJA 1NNPA 2PFZA 3N26A 4FIMA 2V6ZM 2L7HA 4B3RM 2PMSA 2HAKA 4GL0A 1J5EM 1MDP1 2WX9A 2DS9A 4LJ5A 1MG1A 2XX9A 5T3JA 1MXXA 3E9SA 1OFIA 2JWSA 2XXKA 2BWEA 3SEXA 3H6UA 1A40A 3BBRA 3KS4A 1DGHA 5JTYB 2JXNA 4M0WA 1FPIA 2DWZB 4R3DA 2OLBA 4KYSA 1T3TA 3TTLA 4HCWA 2JJKA 3VDUA 4NF6A 3LSXA 1JR3D 5I2KB 5L9SA 3L27A 2D3IA 3QUFA 3CFLA 2H98A 1OVBA 2ZAMA 1K9ZA 4DI4B 1NV6A 1T6OA 2Z22A 3OXNA 3MP6A 4P47A 4LUBA 4WEDA 3T93B 3FJ7A 3T38A 3A45A 4F19A 5JEIA 1ELJA 2DZNB 4N8GA 2Z7JA 1HSEA 3QAUA 1N04A 3MHVC 4H8IA 1NY6A 1WODA 2WEFA 4U4XA 3CR9A 5DNYA 3FJMA 4MH0E 5K2XA 4RY1A 3LSFB 1TXFA 4WW0A 1URDA 5I56A 1SD3A 4PDHA 1S50A 5EXSA 1PJJA 2R45A 5CMCA 2DNAA 4LGMA 1LAXA 4JYAM 3OSQA 3UORA 3SEWA 2R62A 1SDXA 2MROB 2NWJA 2OWSA 5H37D 3ZS6A 4AG6A 3KFMA 5ET6A 4PDIA 5DFLA 2M5ZA 3TWKA 4OFLA 2QVUA 3H6VA 3U5ZB 1DGGA 3JR4A 2HZLA 3GQ5A 4MH5A 1LBCA 2I7NA 3C9PA 4F18A 1B6HA 1FTJA 4GXAA 4IJFA 2QPAA 3C9HA 5DT6A 3CVGA 4JI4M 4XKNA 3MVWA 1B4HA 1HNWM 2A5TA 5EQ8A 4HE0A 2R6FA 3K1MA 3BFTA 1CNQA 4ANRA 3C34A 1N32M 4C0RA 3J7AS 2QCUA 5CMBA 2V3UA 5EP4A 1P1WA 3A09A 2A5SA 1EZ9A 2G5GX 4NXNM 1J1NA 3U94A 4ZE8A 4FJPA 2V4CA 3PGFA 4II7A 4F2QA 2M8CA 3TCFA 1GVNA 1ZMVA 4PETA 1QVSA 5I2NB 3ZSFA 3IFCA 4GX3A 3FXQA 4KPTA 1HR0M 2FA7A 2JUJA 3V89B 2F3BA 3VKHA 3RLFE 4ZEDA 3LVWA 2LH0A 2HL7A 2UXCM 3E46A 2GQ1A 4XIGQ 2CHVA 1IXRC 1NNJA 4RKUF 4BDQA 1H3DA 4OVTA 1HJPA 2ZANA 4FVMA 3FUXA 4JSOA 4FORA 4Z7EA 3H03A 4UA8A 3CFXA 3P7IA 5TP9A 2H9BA 5BWJA 5CMKA 4OMBA 5IAIA 3LCVB 1IM2A 3GLGB 2DE4A 3PPRA 2P3VA 3GPUA 2KRUA 4PCZA 1JW5A 3TELA 4XKQA 3QMFA 5H8QA 5KPRA 2X8AA 2WSFF 2ZNSA 3G3JA 5ITYA 4F39A 3KOWE 2WKYA 1B3LA 1LAFE 4RK9A 4WKMA 3KOZE 4FBPA 4MGZE 1XHBA 2JY6B 4NC6A 2I6EA 1G3IA 4G4PA 3K00A 4FECA 2OK2A 2G3QA 4G4RA 2B3BA 2ERCA 1NKXA 2FVZA 3Q8XA 4X1DA 3ECRA 2K6BA 4LJ9A 1FQFA 5I3SA 4LJ8A 1QAQA 3PUXE 4Q0CA 2F7CA 3KDSE 4NSOB 4GQOA 4I3YA 1Y8GA 1IXCA 4FCWA 1FPLA 5KDTB 3H4ZA 3Q27A 3SEVA 4JI2M 5I59A 3FE3A 3MVXA 4R2BA 4DR6M 3U6QA 5L9OA 3C58A 4P1LA 1FJ9A 4YHHM 1A8EA 3DP4A 2DWAA 5LDZA 2KDLA 5EHSA 4BDRA 1A7LA 4H5FA 3I4VA 2QFLA 3IJOB 4MBPA 1IN6A 3B74A 4PCDA 4X9TA 1AMFA 1SBPA 2OPFA 4GF8A 4Q8RA 3LQRA 1R2YA 4N6DA 4QBAA 1MY1A 1CUKA 2Q2AA 3IB2A 1LCTA 2RGOA 2CMOA 1SXJD 4M9ZA 3J81S 4PP0A 2BWBA 4A3VB 4EDPA 1G71A 3R6UA 1TH4A 5H8FA 3GRVA 1PJTA 1FBEA 1QUJA 3CFZA 1VEJA 3B6WA 3V76A 1OKSA 5A5XB 3KOSA 1WIVA 3OTOM 1R2ZA 1FBGA 3ILKA 3CRBA 1CB6A 2XA5A 4LZZA 1R7RA 4GWUA 3DZDA 4EUOA 4KODA 4YMBA 3TWLA 2OWTA 2L7IA 2WSEF 4I8CA 5LMNM 4GBWA 1BK4A 4GX4A 4ISUA 4G61A 1SXJA 1N3XA 3K6WA 2LVAA 1FTAA 2LVOC 2KLFA 1OIBA 3EIEA 1UIVA 2G93A 2XHDA 1V34A 3TQLA 3O6GA 4G2ZA 4LCBA 3GLIE 4KCDA 5DYHA 3GRUA 2UUCM 3SFZA 4L6V6 3S9LC 2CZHA 5BR8M 2MJ5B 3FUTA 3RQTA 1N77A 2DAGA 1RU3A 1IBLM 3IB0A 3UK4A 4F3PA 1L2CA 4ZS9A 2X7QA 1E94E 1Q35A 4N15A 1XXHA 2QVVA 1NNFA 2RINA 4O7MA 3VLVA 3W68A 4L16A 4I8OA 4IR8A 3E21A 1OTRA 4ZE9A 1UM8A 3M7GA 1IMDA 4GWYA 2KQZA 1XMOM 3ILTB 2HAVA 3H6WA 3ZQJA 1MXUA 2R46A 4GMQA 3SESA 4AB6A 1NUYA 3CF6E 3HN0A 4TQUQ 4NL4H 4JN6A 5DEXB 4F2OA 3GRYA 3HWSA 1MN3A 2R65A 4BDOA 1DTZA 4HTGA 3USDA 2P2AA 3FTDA 2Z23A 1LFHA 3J2PB 1OLAA 5M2VA 4M0DA 1E32A 2C99A 1SYIA 1XI6A 2UU9M 2REGA 1FTLA 1VDWA 4NQ8A 3K6VA 4TUWA 4NEDA 1IXIA 3PUVE 4PAFA 1NUXA 4NN3A 3OO6A 4I81A 2GQFA 1LCFA 2XEPA 3L28A 2I0BA 2PX1A 4M9SA 3KN3A 4N8YA 3A29A 2XSZA 3QXMA 2H5YA 2A5YB 4U1OA 4DIGA 4HE1A 2RKMA 3Q25A 5I57B 1SW4A 1IN7A 2XF3A 5ITQA 2UYFA 1B5JA 1MM7A 5I7IA 1I6AA 1XC1A 3M8UA 4GWXA 4JI1M 3A42A 1OQHA 3K6XA 4PTKA 3RN8A 3LW5F 4OHNA 1NMUA 3I5OA 5EYGA 4LJ6A 1O64A 1Q3BA 1N36M 1DBZA 4HXVA 3GBAA 3SYLA 1LBVA 2KNVA 5C1BA 3GPPA 1P1OA 2P0SA 3T6PA 2MH8A 1ORYB 2DWMA 5ITXE 3TPZA 5H8FB 3Q28A 2IA4A 4DR1M 1FRPA 2CUZA 3PD8A 2DXIA 4P0GA 2JNHA 4EQBA 2YJPA 5KDTA 1LTMA 4PGPA 4ND9A 4KYEA 3IOTA 4PQJA 3R26A 5FSWA 1UTBA 2FE8A 3M3KA 4Y28F 3UP9A 1JETA 5H8NB 3FUZA 3QWLA 4XK8F 1JQFA 2BJWA 1GTKA 1NV4A 1GVCA 4BDLA 1N34M 4IBEA 1MXWA 4WXJA 2HHMA 2X49A 3S9EA 3V83A 1MXYA 2FIXA 2ESNA 2ONSA 2EJSA 1QYRA 3RT8A 3WAEA 4G4OA 1SQYA 1FTMA 4M9XA 4F29A 5DEXA 3TE6A 3KS8A 1F4IA 5L8DA 1QAOA 5ITXA 1LAHE 3EKIA 2C96A 4GHAA 3H7MA 5H8HB 2O6AA 3E4RA 3OENA 4QRZA 3HPIA 2CV0A 3H06B 3TWMA 1LBXA 4F3SA 2B3TA 2EA0A 3THGA 1W5SA 1FQCA 2K47A 2W7YA 1B58A 3MP8A 1B5HA 3B89A 1MY3A 2O84X 1VE4A 1EZOA 5IGAA 4P56A 3K92A 3KFUG 3HU2A 3HJSA 1XB2B 2UVGA 4X64M 5IREB 3MYUA 1NHWC 2Y7WA 3F92A 2F6PA 4BDNA 3A98B 3KP1E 1SXJB 2CFOA 4IIWA 4YB6A 4QXDA 2RGHA 2ZAOA 1I69A 5H8NA 4GOTA 1FCKA 1B0HA 4R9FA 2VQFM 3PUYE 2L5VA 2W82A 4QHTA 4DDDA 3EF7A 4POXA 1NV8A 2YFQA 3M3LA 3FVGA 1FQDA 1JR3E 3RY3A 4LFCM 1SW1A 3C33A 4NGUA 1US4A 3J27B 4JI7M 1QW0A 3GLIB 3V8XB 2DWNA 4NE4A 1GV8A 1DGBA 1M5EA 3KBRA 1H43A 1J09A 1B2HA 1M5DA 5AA1A 2FOIC 5FLXS 2ANJA 1IQPA 3TKDA 5IZ3B 3E9XA 4GBVA 1IBMM 1XXHE 4IBCA 3SBJA 3IB1A 1B40A 3ODBA 3VLUA 3GP1A 3GLHB 1IMFA 2XX8A 4IO3A 4QFNA 4PFBA 1RDXA 2FNCA 4XEQA 5EXPA 2FHYA 5KQ8A 3RUMA 1YUBA 2O7UA 3D4GA 3EHUA 2QBYB 3IR1A 4NF0A 3C3EA 3CF2A 3GLIA 3S2VA 5JI2E 1GJSA 3U60A 3O66A 2RCBA 4QOSA 1TR8A 5FTLA 3G3FA 4QNRA 3FUVA 1SW5A 4Z0IA 1XMQM 3JV9A 4I40A 3M6AA 1HSLA 5KPZA 3JYRA 1SXJE 2DAMA 2AIXA 3FKEA 1IXHA 1SVXB 1B4ZA 4AG5A 2Q74A 1Q9DA 2EKKA 3T15A 3HO7A 4DV1M 1G41A 4L15A 1DO2A 1QDTA 1LV7A 1R6BX 5TU0A 1KYIA 1G59A 2HQ0A 3RGSA 4G4QA 1A5TA 2Y84A 3IFAA 3LR1A 1KWHA 3EHSA 2Y21A 3FXBA 1TF0B 3TQSA 5E26A 5EYFA 1YSYA 1PJSA 1QJMA 4DXUA 3CSBA 2OX3A 4GWSA 4IBFA 4TLMB 4FD2A 2Y5LA 3FV1A 5L8RF 2I4BA 2F6GA 1N0TA 1B7ZA 3O97A 4X62M 1H44A 1CE2A 1YXIA 2E1SA 1ZMUA 5L9MA 2RKOA 3RPLB 4DV5M 1M5CA 1DTGA 4QSDA 1Z6TA 4GHLA 4NF4B 2UVJA 1T43A 2Q8MA 3NWLA 1OAIA 4IO4A 1PEBA 5H8SA 4U4SA 3TODA 1XC8A 1WJ7A 1TH2A 5K2YA 3U5ZA 1PB8A 3GLHA 3GBBA 4KXPA 4B3SM 1NI9A 5DYIA 1URGA 2C5RA 1D3KA 1I94M 1Z7NE 3T9HB 5FTMA 4XBOA 4KQPA 4GRKA 1IXSB 1USYE 3KVWA 4LJAA 1FTKA 3FTFA 3NBIA 3IHPA 1PJIA 3AXFA 2QMXA 4IY6A 2KHHA 3KSXA 2QRYA 3G3HA 4N6KA 5ICQA 3KOXE 4NWCA 3WAFA 1MU5A 5AA2A 2ALUA 1FNNA 1EE8A 4P16A 4XTCQ 4AQYM 3U65A 4IBKA 4H45A 2LVPC 3THIA 1QKAA 1JVXA 1NV5A 4BDMA 4EQ9A 4ZEBA 2JP7A 4DV7M 1MRPA 1DGHB 4OVJA 1GR2A 2B4MA 1GKIA 3EPEA 1VQ1A 4GC9A 1MS7A 4ZEFA 4P8BA 3PUZE 2XD3A 4CGYB 1LFGA 2P3NA 3PV0E 4B3TM 4DE8A 1AIVA 3GXAA 3PMVA 3PPOA 1ZQ9A 4LF8M 4JI8M 4H1XA 3IAZA 1NUWA 2Z3XA 3N6UA 4UN2B 4KFQA 3TYHA 4Z6YA 4NXMM 4WP2A 3J80S 2CZLA 4OTEA 4R75A 3KP0E 2FBPA 3G3IA 2JY7A 3SMPA 3TZAA 4UABA 3H4JA 1FQEA 5F3WA 3K9OA 1KA0A 4QOZC 3B8BA 3Q29A 3HCQA 4LRSA 2CZIA 3FASA 5I58B 1PRBA 1P1NA 3OELA 4XKPA 2L4EA 1PDAA 2V3QA 3EHTA 4AS4A 2NQ8C 3AOGA 3R9XB 1FBPA 1JNFA 3T9XB 2CP8A 4H67A 3HU3A 5ET5A 2KNZA 3KW6A 4DUYM 4OZ9A 2PFYA 3CGWA 1GABA 1YAEA 2C98A 3BKIB 1AUAA 1NH7A 2X4AA 5F24A 1AOVA 2R0IA 3AL0C 3FZVA 4GRIA 5FHNA 1V33A 2F8DA 4RYAA 4NF6B 2Z8YM 4HEOA 1EU8A 3MSTA 1Q02A 3GLFB 1TDHA 4LG2A 1FSAA 3O6HA 2LVNC 4AI6A 4OANA 3SDFA 1FBHA 2DZOB 3K0VA 4IGRA 2CRUA 2DKLA 1ATGA 2L2DA 1QUKA 3GLBA 3GRRA 1NO1A 1MDQA 3HHWA 2F4VM 4JV5M 1NV9A 4Z8XA 5KCJA 4DR7M 1VSOA 2PCRA 1P99A 2VIIA 3FUUA 2RC7A 2UXDM 1PC3A 3RT6B 3BXWA 3PPQA 4QF9A 3OSRA 3VXCA 5TP9B 3MBPA 1GGGA 1HQCA 4F3GA 4MHFA 4R6YA 2ABHA 4L8RC 2ZNTA 1IBKM 2F5XA 2GHAA 5IZ3A 5HM4B 4MNCA 3VDFA 3L25A 1KSFX 3FUWA 4CIZA 4QHSA 3U72A 3AOEA 3QYEA 4PAKA 3W0FA 1MY0A 1D0MA 1NHGC 1UIUA 4CHTB 3K4UA 4X66M 2HZKA 3TTRA 2OCUA 1JB0F 4CISA 3L6GA 4MGIE 3FD9A 1NNKA 3AOEC 4HE2A 3H6TA 3CHGA 3HZJA 4CJ6A 1TFAA 1J7KA 2XWOA 3S4UA 4C1TA 5CMMA 4TLLB 3SAUA 4P11A 3FYCA 3IG8A 2O25A 4GFRA 2J5YA 2XXXA 3KJ7A 2OZZA 4IO6A 4LQ5A 4DR5M 3EQ1A 4O7IA 1G8PA 2V1UA 2WYKA 4KLNA 4OX9M 4NMYA 4P17A 1IMBA 4PF8A 2DI0A 4XKRA 1TWYA 1B7HA 4PFUA 1D0KA 4R74A 2PYYA 2A5TB 4Q30B 2AYSA 3E3KA 2L6OA 4HL4A 4Q5TA 1IY1A 1L1TA 2F7AA 2CV2A 2OOAA 5EQAA 3FRHA 1B7UA 3FJGA 4N6PA 4PAIA 2F5NA 4NX1A 3M0EA 4GX6A 4RF1A 1Z5CA 3BOSA 4DXBA 3MVZA 3ZH9B 5H8HA 4G6ZA 4XF5A 4FE8A 4EF1A 4EIWA 2UYEA 3L29A 2NUVA 4K0KM 1XS5A 1ZAEA 1WDNA 4OW0A 1N84A 4KYDA 4KHPM 5A5LA 4OVRA 2CE7A 4H8JA 2PT1A 4F22A 5C18A 2CWBA 1FPKA 4YKKA 4JWXA 4N91A 2O1LA 3SKPA 1A55A 1XVYA 2V93A 2XFTA 1JP4A 3MZ9A 2R44A 3HHYA 4OEVA 1IMAA 3TEPA 1LGBC 1LEVA 5DYGA 1IUDA 1ZU0A 1R5LA 1DOTA 3TL4X 3U6DA 3FXRA 4JVCA 4NF4A 5IT9S 3LQQA 2UXAA 4YU0A 2JZ1A 1SW2A 1YCJA 2DE3A 3QUJA 4IBDA 1Y4CA 3A3CA 1M5FA 3K01A 1BKAA 1L2BA 3B6QA 3FD3A 3ZKKA 1C1KA 3QK6A 3VFJA 1L2DA 4ITQA 2C9CA 1B46A 1Y9UA 4KCCA 4FW9A 2F78A 5EXXA 1LLSA 3WHKA 1A54A 3Q8GA 2APLA 3L26A 1ZBMA 1GL7A 2QS4A 2RCAA 2UXBM 1IZ1A 1NVMA 2Y20A 2CZKA 2O1MA 3UIFA 4IBIA 4ELQA 3U6LA 3TTKA 1M5BA 1MY2A 4GC5A 3T22A 3DA1A 4F1IA 5AA3A 2M60A 2H5XA 3A46A 2O5RA 2ZZXA 3GPYA 5I56B 4DCXA 1H45A 3TDJA 5ITOA 2R4EA 4YZZA 2XWVA 4FWDA 4MJOA 5TPAB 1FPBA 4PE5B 5IKBA 2N35A 4G8HA 2LHGA 3B7NA 1KFVA 3QAXA 1BTJA 5F7VA 1S3SA 3PXGA 3DELB 1XWIA 1K3WA 3TCHA 4FCTA 2QQ8A 4LGYA 1ZKBA 2DDKA 5BUUA 2BJJX 4NAPA 2UUBM 2XWIA 2QHOB 1II5A 2F97A 4XXUA 5EP3A 5B70A 4DR2M 3KC1A 3W9WA 5ELVA 1UTHB 1GJTA 1B3GA 4NTLA 2BJIA 4LFAM 3E13X 5DW8A 4DBGB 1TH3A 1NV2A 4FEBA 2YR0A 1B5IA 1ZJLA 5FHOA 3KJTA 3UGJA 1OAOC 1S7YA 2HCAA 4R73A 2QNJA 3U61B 3U60B 4YB7A 2KZUA 3I3VA 1YE9A 1N7WA 2D7HA 2FH0A 1QUIA 3VDPA 3VFDA 2Q9TA 3VLFB 1E9RA 4LP2B 3N94A 1AWBA 2VP1A 2F5PA 4O3BA 2DOJA 3G7WA 4R72A 2VD2A 4NRWA 5CRYA 3HU1A 1DMBA 1Z7ME 1NNTA 4JBZA 1DPEA 1PBPA 2V3TA 2QENA 1SYHA 4LN5A 4P9KA 2DVZA 4EF2A 3L6HA 3K1PA 3PTYA 2LBCA 2B4LA 1EYIA 1MJGM 2HXWA 3MP1A 4PD2A 5AE4A 2HPGA 1B1XA 2FNAA 3HX3A 1N75A 1LAGE 2QS1A 1SXJC 3U61A 3PNYA 2DWJA 1MPCA 3B6TA 1US5A 1SG9A 2H25A 3H4MA 2DE2A 3C4MA 5I2NA 4MNIA 4O3CA 1VFEA 1T0KA 2P1SA 1TTEA 3R8FA 3VVDA 3A3UA 3RGYA 2HWJA 3I01M 4D82A 2D21A 1YTVA 4JB7A 4NWDA 4NHBA 4DZ1A 4MLQA 3W9VA 1POTA 2DQVA 3IJXB 4OQOA 1E9SA 5BPVA 4U22A 1JEVA 4PFTA 1A99A 2QSFX 2I58A 4DR4M 2X26A 1A8FA 2JZ0A 2QPQA 2JA2A 3PD9A 1VFDA 1W5TA 5ITPA 1IIWA 1YYZA 1JVYA 2RC8A 2LXEA 2I0CA 2F5OA 3LBSA 2ZTDA 4RXLA 4NG7A 3SEUA 2VGQA 3O2AA 1R6ZA 2THIA 4N81A 5AA2B 3SATA 2LAOA 1Y1MA 3RTFB 2OQ4A 2QBYA 3QIMA 4ZEKA 4RNAA 3CG3A 2HEUA 1B3FA 2R8TA 3LC8A 4R6HA 1BIYA 5ISUA 2MKZA 3U8QA 4NF5A 1IN5A 1B3HA 4O94A 1XOCA 2XH9A 1Z5AA 1XHYA 5FTHA 4GEWA 1O7TA 4LVQA 2K0BX 5AA4A 2FS1A 3MK6A 2ZYMA 5KCJB 4GH9A 3SERA 3J7BA 1PB7A 3KN7A 1YZ0A 3CTWB 4QNMA 1FBDA 4R9GA 4W5WA 2QMWA 4GD5A 4OEUA 3HFUA 4IBBA 3MPLA 5FTJA 4G68C 1LBZA 4BLAA 1Z5BA 4ZDMA 2Y7KA 3LSLA 4MX6A 2QS3A 4KHZE 1GLNA 5I58A 1IEJA 4AKHA 1R4GA 1IN8A 4U23A 2UVIA 1LSTA 4EXLA 4GLIA 4AW4A 4GKKM 2XXTA 3KSJA 3U6CA 4JXIA 2R4JA 4ZZEA 1LFIA 2F36A 2DP8A 1D9QA 3CIJA 1Y3NA 2ZNUA 4E0XA 1B3EA 2B65A 1C7YA 2JY8A 2DWLA 4L17A 4RK2A 1L5TA 2HXRA 2VPOA 3G3GA 4GWWA 4N4UA 1PBQA 4QFOA 3KOTA 3WHLA 2X7PA 4RNSA 2AHMA 2QL3A 3VVFA 3VXBA 4B08A 1OQYA 1B32A 1DPPA 4RPNA 4PFRA 1QQWA 3T1BA 1JQJC 2NOOA 3G3KA 4DV6M 5ITUA 1N3WA 3O6IA 3D8BA 3K6UA 4DV2M 2DVCA 4E0WA 5LOMA 1FPFA 4OYVA 5JK4A 2ZTCA 4F1VA 3N6TA 1IMEA 5CBRA 1Z59A 3GPXA 3SEYA 1N7XA 1MQHA 4GITA 1POY1 2B3FA 2OOBA 4AKIA 3W15C 3BIHA 2I7PA 1R9LA 3B7QA 3DOAA 3PNVA 2Z8DA 2BJVA 1IXSA 4ESWA 3UMMA 4IO5A 1MY4A 3T0JA 1KZ8A 1FBCA 1Q1KA 1FPEA 4FCVA 1JW1A 1NL5A 2P5TA 2Y7IA 4N17A 4MB7A 1TFDA 4X65M 2CEXA 3TAJA 3TQWA 3IG5A 3TCGA 2VF7A 4RJZA 5HPQA 2YNMD 3LUYA 5DTBA 1VEKA 3GO8A 3VVEA 1QULA 5FTIA 3PPPA 3LSWA 2XXVA 3T9UA 4G8NA 4P3LA 2VF8A 3MJ5A 4LJ7A 4OA4A 3K2LA 2CEAA 1QZEA 1MPBA 1MQJA 4DV3M 3SHGB 1NUZA 1UQWA 5CI5A 3U6SA 3HHZA 1LB9A 1IQ7A 4OVSA 1QZMA 3HY5A 3PMXA 4M4GA 4G4NA 3TTMA 4PC9A 4PBHA 2DXYA 3PMWA 1NSFA 4QFLA 3GLHE 1WR1B 1P1UA 2YQZA 4YKPA 3LVVA 2LNHC 3SAWA 1QKBA 4ZPXA 2UUAM 4QFKA 2Y0QA 4P0IA 2XXHA 1MXVA 4U2RA 4MCOA 4ZECA 4DV4M 1VDDA 4LFBM 3RTWB 4G8MA 3K9PA 1I6BA 5DVIA 2L09A 4OWDA 1QDRA 2ZYKA 2ZXTA 4KR5A 4R6KA 2JY5A 2O01F 3AFHA 4IJEA 4OETA 1EH3A 1Q39A 2DHRA 1K3XA 1NY5A 1QUSA 4IBGA 3EN3A 3OEMA 1FJ6A 1OMPA 3VK7A 4P1EA 1HQYE 5ITTA 3IECA 1ZTYA 4GXSB 4MAGA 3U92A 3HHXA 3MAMA 2FIEA 1EYJA 3LUZA 4XFEA 4DV0M 2HHHM 4MFIA 3T9VA 3KXEC 3GLGE 7CATA 1RKMA 2ZZWA 4BB9A 1XNQM 2XGNA 3GLGA 1L1ZA 1VDLA 4YY3M 5ITRA 4OVPA 4NRVA 2WBBA 3RYDA 3IK6B 4QSCA 4WURA 2LTUA 4NF8B 1HSJA 2OJTA 2Z8FA 3H3GA 3R7XA 4LF6M 1K9YA 2NXOA 1HNZM 1O63A 3LCUA 1KA1A 1SI0A 3RPWA 4LONB 2XXWA 4NSRA 3DP6A 1MQIA 4X48A 3T66A 4L4UA 1DSNA 3B7ZA 4QSEA 4JVDA 3I4YA 1UTBB 2H1RA 4YMAA 4B7FA 4U21A 4I4LA 2PBWA 4H65A 1I4WA 4G68A 1B52A 2I3VA 3TUSA 2E0SA 1Y3PA 1JR3A 2YLNA 3ISPA 3GQ3A 1NJGA 5I59B 1URSA 2V25A 2J7OA 4JI0M 3FBPA 4PFIA 4AB5A 3JR5A 2DAIA 5FBPA 2E5LM 2OBGA 3ZCBB 4BBAA 3CF0A 2F5SA 2DYXA 1IMCA 1MH4A 3O9PA 4RA1A 1IXZA 2UVHA 5CM6A 3RFWA 1LBBA 4THIA 4MGHA 2DAKA 2DZLA 4R71A 4OU7A 2F3DA 3RNNA 2DSFA 5IZ1A
chains in the Genus database with same CATH topology
4FWHA 1H6UA 4OVZA 1XXHB 2HKJA 3LMMA 3C36A 3CI8A 2ZMBA 4ZEIA 4LF5M 4GVOA 5DVFA 3K1JA 4JWOA 2I4CA 3QYTA 1N78A 3K8ZA 2J7NA 3L2AA 1VR5A 2EO2A 3FV2A 4OFJA 4MM3B 3ONMA 4I1DA 3SHFA 5EXTA 4I62A 4N13A 2AL4A 1K82A 4LY6A 2O68A 3HGIA 3FGSA 3B9PA 5F1QA 1I6QA 1PM5A 1OJLA 1HT1E 3KEIA 4LQ2A 3F11A 3O29A 3T1YM 2QJEA 2XLJA 1IN4A 2GHBA 3OMBA 1D2NA 3SYKA 4KD5A 4YICA 4GIPA 2R71A 4REZA 2LWXA 2XFSA 2Q88A 3RGPA 1NNUC 5A5XA 5ICTA 2XXUA 3IOUA 3DLNA 4LZ5A 5LMUM 5J1DA 3I6VA 5EQTA 2D7GA 1HNXM 3K02A 4WEPA 4GWOA 2GRVA 4PFYA 3UZUA 4FAJA 2I49A 2G8LA 2ONKE 2YPNA 4IGTA 3IX1A 4S12A 3D4CA 5I84A 4R2FA 1FQBA 2H99A 2KEBA 2XSZD 1RYOA 3KN8A 4LATA 5FTKA 3KZGA 4DR3M 2R6GE 4FEDA 1N76A 1TDZA 3D8LA 1FW0A 5EJCA 1B9JA 5E6JA 2ZYOA 4OESA 4JI5M 3KOYE 1QANA 2GFEA 1IY2A 2F34A 3PPNA 1FTOA 5H8QB 3KGCA 1LB8A 3CSGA 3UGWA 4U1ZA 2D5WA 5EHMA 1B0LA 4G77A 2KW0A 3T96B 2KRKA 4IB2A 4LRTA 4OXVA 3SC3A 3MZBA 2FFJA 1S9TA 4IO2A 1B1HA 3HHGA 2Y7RA 3FTCA 3MQ9A 1QAMA 3C31A 4JDFA 2ONRA 4JSDA 2F5QA 1MXZA 2KZSA 1EZPA 4C1UA 3TFLA 3IL1B 4OVZB 1UTHA 3SETA 3SARA 2NVUB 3MZ1A 2CHGA 2XXIA 4NOOB 2DVWB 5AA2D 4POWA 3U93A 1XNRM 4EQ7A 5CBSA 4LZJA 4O3AA 3U6MA 1MPDA 3I51A 2CHQA 5GKNA 3OO9A 2KXEA 1OQGA 2XZFA 4DXCA 5KZTA 3S9MC 3UK6A 4YKIA 5B7DA 2H4IA 3IOWA 1OVTA 3FXUA 4GL8A 4XGIA 3O28A 3U6EA 3FVOA 1FJGM 3K1NA 4L78A 1MQDA 4DUZM 1Y3QA 3MJNA 3MWBA 2QSXA 3SMSA 4LZ7A 1P1QA 2FYIA 4HS7A 3HJ8A 4LZ8A 2XXPA 4IY5A 1D9YA 2DXRA 2I3WA 4LF4M 1MM6A 4I9DA 5EP2A 3FVKA 5FHMA 3U1OA 1B51A 2CV1A 2AL5A 3FTEA 4MLVA 1Y4TA 4X1BA 2G29A 4M1VA 1D9VA 1ZMGA 2RF1A 4OENA 2HFBA 3MW0A 1MH3A 2D7EA 2F7BA 1N33M 2BNKA 1AH5A 5I57A 4LF7M 4FATA 2VD3A 1D4NA 3GZGA 1DGFA 2HCBA 3HV1A 3ZKLA 1IY0A 2F35A 5HBCA 1BLFA 4GKJM 3UJNA 4YAHX 1Q3CA 3CG1A 1IXGA 3VLWA 5JI3E 3V5AA 2ZM6M 3W0LB 1Y1ZA 3MUQA 4LF9M 3ZC7B 2PT2A 4MGKE 5IZ7D 4PFWA 4MF3A 3RE8A 3QSLA 3FIRA 4LA9A 4HLQA 4ZZAA 2Z8EA 2O69A 3OO8A 3MVYA 3PUWE 4ECFA 4D80A 2XXRA 1NJFA 4MGYE 4JI6M 2HAUA 2DWIA 4NF5B 4I5SA 2GH9A 4QFPA 5DVJA 4ELRA 1IITA 3PFIA 3MPKA 3TPAA 4HCYA 4AQ4A 3KG2A 4R7GA 1F9BA 1XVXA 5A2QS 2IEEA 4H6DA 1USYH 4IO7A 2Z4RA 2Q89A 4F3BA 1WXQA 2DWHA 5KQDA 3TMGA 4LJ4A 4KI0E 3IOVA 3ILUB 1BP5A 4NF8A 3IO4A 4JXJA 4AKGA 2C9OA 2RC9A 3OEKA 2Q2CA 1DO0A 1GL6A 4AZFA 2Z4SA 4ELOA 2QZ4A 1RYXA 4B7HA 1SI1A 3VKGA 3HJQA 4RF0A 5TPAA 2O7IA 4DCYA 5KPTA 3S9NC 2I48A 4N07A 4B3MM 1H76A 3PVSA 2XXQA 1G4AE 2V1CA 4FWGA 1JEUA 3PU5A 4H5GA 4RPOA 3VV5A 1TGUA 1YPNA 2QS2A 3BFUA 2EUCA 3HKPA 3U6PA 5CC2A 3SAVA 1WVJA 1R1NA 1FQAA 5AA4B 8CATA 2QP9X 3AV0A 3DFZA 1Y20A 4QHQA 4K3FA 2REJA 3TTNA 1X37A 3B7DA 2XX7A 5JTYA 3N5LA 2O51A 2R9JA 2VOZA 3VK8A 1QVRA 1HT2E 3U6OA 3C32A 4F1UA 3JZJA 3FYDA 3OD7A 4JI3M 4KO8A 4YB5A 4PT5A 2XD2A 2KA6B 1ZLQA 2R18A 4BLCA 2XXYA 3DP8A 2XZUA 3UN6A 3IO6A 1R9QA 4OERA 2Q8JA 2Y7PA 1MQGA 4HW8A 2Q2EB 2PVUA 5KO3A 1TT1A 3C35A 5FTNA 2VQEM 2VHAA 1JW4A 2Y0TA 1ANFA 2V84A 3IORA 4YKJA 3FVNA 1ZIUA 4H0WA 3AKZA 3AJIB 4ONYA 3JAMS 3T1HM 3EIHA 4PDGA 4B7GA 1MX0A 1XT8A 3DM0A 3OO7A 3UA8A 4UACA 4G68B 4OFOA 4GIZA 4EXKA 1NH8A 4F1YA 4D81A 3GLFA 1NFTA 3SASA 3MC2A 4TOZA 4JWYA 4ELPA 3M3FA 1B05A 2ZYNA 3OOAA 4ESXA 3FATA 1PB9A 1L8QA 3HHFA 2ZBKB 3HSTA 5I2KA 4DLDA 1OFHA 3Q26A 1AL3A 5IWAM 1OLCA 3VE1B 4F31B 3K2DA 5EP1A 3GQ4A 4IBJA 1NNPA 3N26A 4FIMA 2V6ZM 2L7HA 4B3RM 2PMSA 4GL0A 1J5EM 1MDP1 2DS9A 4LJ5A 1MG1A 2XX9A 1MXXA 3E9SA 1OFIA 3SEXA 3H6UA 1A40A 3BBRA 3KS4A 1DGHA 5JTYB 4M0WA 2DWZB 4R3DA 2OLBA 4KYSA 1T3TA 3TTLA 4HCWA 3VDUA 4NF6A 3LSXA 1JR3D 5I2KB 5L9SA 3L27A 2D3IA 3QUFA 3CFLA 2H98A 1OVBA 2ZAMA 2Z22A 3OXNA 3MP6A 4LUBA 4WEDA 3T93B 3FJ7A 3T38A 3A45A 4F19A 5JEIA 1ELJA 2DZNB 2Z7JA 1HSEA 3QAUA 1N04A 3MHVC 4H8IA 1NY6A 1WODA 4U4XA 3CR9A 5DNYA 3FJMA 4MH0E 5K2XA 4RY1A 3LSFB 1TXFA 4WW0A 1URDA 5I56A 1SD3A 1S50A 5EXSA 1PJJA 2R45A 5CMCA 4LGMA 1LAXA 4JYAM 3OSQA 3UORA 3SEWA 2R62A 1SDXA 2NWJA 2OWSA 5H37D 3ZS6A 4AG6A 3KFMA 4PDIA 2M5ZA 3TWKA 4OFLA 3H6VA 3U5ZB 1DGGA 3JR4A 2HZLA 3GQ5A 4MH5A 1LBCA 2I7NA 4F18A 1B6HA 1FTJA 4GXAA 4IJFA 2QPAA 3C9HA 5DT6A 3CVGA 4JI4M 4XKNA 3MVWA 1B4HA 1HNWM 2A5TA 3K1MA 3BFTA 3C34A 1N32M 4C0RA 3J7AS 2QCUA 5CMBA 2V3UA 5EP4A 1P1WA 3A09A 2A5SA 2G5GX 1EZ9A 4NXNM 1J1NA 3U94A 4ZE8A 4FJPA 3PGFA 4II7A 4F2QA 2M8CA 3TCFA 1GVNA 4PETA 1QVSA 5I2NB 3ZSFA 3FXQA 4KPTA 1HR0M 2FA7A 3V89B 3VKHA 3RLFE 4ZEDA 3LVWA 2LH0A 2HL7A 2UXCM 4XIGQ 2CHVA 1IXRC 1NNJA 4BDQA 1H3DA 2ZANA 4FVMA 3FUXA 4JSOA 4FORA 4Z7EA 3H03A 4UA8A 3CFXA 3P7IA 5TP9A 2H9BA 5BWJA 5CMKA 4OMBA 5IAIA 1IM2A 3GLGB 2DE4A 3PPRA 3GPUA 2KRUA 4PCZA 1JW5A 3TELA 4XKQA 5H8QA 5KPRA 2X8AA 2ZNSA 3G3JA 5ITYA 4F39A 3KOWE 2WKYA 1B3LA 1LAFE 4RK9A 4WKMA 3KOZE 4MGZE 1XHBA 2I6EA 1G3IA 4G4PA 3K00A 4FECA 2OK2A 4G4RA 2B3BA 2ERCA 1NKXA 3Q8XA 4X1DA 3ECRA 4LJ9A 1FQFA 4LJ8A 1QAQA 3PUXE 4Q0CA 2F7CA 3KDSE 4NSOB 4GQOA 1IXCA 4FCWA 5KDTB 3H4ZA 3Q27A 3SEVA 4JI2M 5I59A 3MVXA 4R2BA 4DR6M 3U6QA 5L9OA 3C58A 4YHHM 1A8EA 3DP4A 2DWAA 5EHSA 4BDRA 1A7LA 4H5FA 3I4VA 3IJOB 4MBPA 1IN6A 4X9TA 1AMFA 1SBPA 2OPFA 4GF8A 4Q8RA 3LQRA 1R2YA 1MY1A 2Q2AA 3IB2A 1LCTA 2RGOA 2CMOA 1SXJD 4M9ZA 3J81S 4PP0A 4A3VB 4EDPA 3R6UA 1TH4A 5H8FA 3GRVA 1QUJA 3CFZA 3B6WA 5A5XB 3KOSA 3OTOM 1R2ZA 3ILKA 3CRBA 1CB6A 4LZZA 1R7RA 3DZDA 4EUOA 4KODA 4YMBA 3TWLA 2OWTA 2L7IA 4I8CA 5LMNM 4ISUA 1SXJA 1N3XA 3K6WA 2KLFA 1OIBA 3EIEA 1UIVA 2G93A 2XHDA 3TQLA 3O6GA 4G2ZA 4LCBA 5DYHA 4KCDA 3GRUA 2UUCM 3SFZA 3S9LC 5BR8M 3FUTA 3RQTA 1N77A 1IBLM 3IB0A 3UK4A 4F3PA 1L2CA 4ZS9A 2X7QA 1E94E 1Q35A 1XXHA 1NNFA 2RINA 3VLVA 4L16A 4I8OA 4ZE9A 1UM8A 3M7GA 1XMOM 3ILTB 2HAVA 3H6WA 1MXUA 2R46A 4GMQA 3SESA 4AB6A 3CF6E 3HN0A 4TQUQ 4NL4H 4JN6A 5DEXB 4F2OA 3GRYA 3HWSA 2R65A 4BDOA 1DTZA 4HTGA 3USDA 2Z23A 3FTDA 2P2AA 1LFHA 3J2PB 1OLAA 5M2VA 4M0DA 1E32A 2C99A 1SYIA 2UU9M 2REGA 1FTLA 3K6VA 4TUWA 4NEDA 1IXIA 3PUVE 3OO6A 4I81A 1LCFA 2I0BA 2XEPA 3L28A 2PX1A 4M9SA 3KN3A 2XSZA 3QXMA 2H5YA 2A5YB 4U1OA 4DIGA 2RKMA 3Q25A 5I57B 1SW4A 1IN7A 2XF3A 5ITQA 2UYFA 1B5JA 1MM7A 1I6AA 1XC1A 3M8UA 4JI1M 3A42A 1OQHA 3K6XA 3RN8A 4OHNA 1NMUA 3I5OA 4LJ6A 1O64A 1Q3BA 1N36M 3GBAA 3SYLA 5C1BA 3GPPA 1P1OA 2P0SA 1ORYB 2DWMA 5ITXE 3TPZA 5H8FB 3Q28A 2IA4A 4DR1M 2CUZA 3PD8A 2DXIA 4P0GA 4EQBA 2YJPA 5KDTA 4ND9A 4KYEA 3IOTA 4PQJA 3R26A 5FSWA 1UTBA 2FE8A 3M3KA 3UP9A 1JETA 5H8NB 3FUZA 3QWLA 1JQFA 2BJWA 1GTKA 1GVCA 4BDLA 1N34M 4IBEA 1MXWA 4WXJA 2X49A 3S9EA 3V83A 1MXYA 2ESNA 2ONSA 1QYRA 3RT8A 3WAEA 4G4OA 1SQYA 1FTMA 4M9XA 4F29A 5DEXA 3TE6A 3KS8A 5L8DA 1QAOA 5ITXA 1LAHE 2C96A 4GHAA 3H7MA 5H8HB 2O6AA 3E4RA 3OENA 4QRZA 3HPIA 2CV0A 3H06B 3TWMA 4F3SA 2EA0A 3THGA 1W5SA 1FQCA 2K47A 2W7YA 1B58A 3MP8A 1B5HA 1MY3A 2O84X 1VE4A 1EZOA 3K92A 3KFUG 3HU2A 3HJSA 2UVGA 4X64M 5IREB 1NHWC 2Y7WA 2F6PA 4BDNA 3A98B 3KP1E 1SXJB 2CFOA 4IIWA 4YB6A 2RGHA 2ZAOA 1I69A 5H8NA 4GOTA 1FCKA 1B0HA 4R9FA 2VQFM 3PUYE 2W82A 4QHTA 4DDDA 3EF7A 4POXA 2YFQA 3M3LA 3FVGA 1FQDA 3RY3A 4LFCM 1SW1A 3C33A 1US4A 3J27B 4JI7M 1QW0A 3GLIB 3V8XB 2DWNA 4NE4A 1GV8A 1DGBA 1M5EA 3KBRA 1H43A 1J09A 1B2HA 1M5DA 5AA1A 2FOIC 5FLXS 2ANJA 1IQPA 3TKDA 3E9XA 1IBMM 4IBCA 3SBJA 3IB1A 1B40A 3ODBA 3VLUA 3GP1A 3GLHB 2XX8A 4QFNA 4IO3A 2FNCA 5EXPA 5KQ8A 3RUMA 1YUBA 2O7UA 3D4GA 3EHUA 2QBYB 3IR1A 3CF2A 3GLIA 3S2VA 5JI2E 3U60A 3O66A 2RCBA 4QOSA 5FTLA 3G3FA 4QNRA 3FUVA 1SW5A 4Z0IA 1XMQM 3JV9A 3M6AA 1HSLA 5KPZA 3JYRA 1SXJE 2AIXA 3FKEA 1IXHA 1SVXB 1B4ZA 4AG5A 3T15A 3HO7A 4DV1M 1G41A 4L15A 1DO2A 1LV7A 1R6BX 5TU0A 1KYIA 1G59A 2HQ0A 3RGSA 4G4QA 2Y84A 3LR1A 1KWHA 3EHSA 2Y21A 3TQSA 5E26A 5EYFA 1YSYA 1QJMA 4DXUA 3CSBA 4IBFA 4TLMB 4FD2A 3FV1A 2I4BA 2F6GA 1N0TA 1B7ZA 3O97A 4X62M 1H44A 1CE2A 2E1SA 5L9MA 2RKOA 4DV5M 1M5CA 1DTGA 4QSDA 1Z6TA 4GHLA 4NF4B 2UVJA 3NWLA 4IO4A 1PEBA 5H8SA 4U4SA 3TODA 1XC8A 1TH2A 5K2YA 3U5ZA 1PB8A 3GLHA 3GBBA 4B3SM 5DYIA 1URGA 2C5RA 1D3KA 1I94M 1Z7NE 3T9HB 5FTMA 4XBOA 4KQPA 4GRKA 1IXSB 1USYE 3KVWA 4LJAA 1FTKA 3FTFA 3NBIA 3AXFA 1PJIA 2QMXA 4IY6A 3KSXA 2QRYA 3G3HA 5ICQA 3KOXE 4NWCA 3WAFA 1MU5A 5AA2A 2ALUA 1FNNA 1EE8A 4P16A 4XTCQ 4AQYM 4IBKA 3THIA 1QKAA 1JVXA 4BDMA 4EQ9A 4ZEBA 4DV7M 1MRPA 1DGHB 4OVJA 1GR2A 1GKIA 3EPEA 4GC9A 1MS7A 4ZEFA 3PUZE 2XD3A 4CGYB 1LFGA 3PV0E 4B3TM 4DE8A 1AIVA 3GXAA 3PMVA 3PPOA 1ZQ9A 4LF8M 4JI8M 4H1XA 3IAZA 2Z3XA 3N6UA 4KFQA 3TYHA 4Z6YA 4NXMM 3J80S 2CZLA 4OTEA 4R75A 3KP0E 3G3IA 3SMPA 3TZAA 1FQEA 5F3WA 4QOZC 3Q29A 3HCQA 4LRSA 3FASA 5I58B 1P1NA 3OELA 4XKPA 1PDAA 2V3QA 3EHTA 2NQ8C 3AOGA 3R9XB 1JNFA 3T9XB 4H67A 3HU3A 3KW6A 4DUYM 4OZ9A 1YAEA 2C98A 3BKIB 1NH7A 2X4AA 1AOVA 3AL0C 3FZVA 4GRIA 5FHNA 2F8DA 4RYAA 4NF6B 1EU8A 3GLFB 1TDHA 4LG2A 3O6HA 4AI6A 3SDFA 4IGRA 2DZOB 3K0VA 1ATGA 3GLBA 1QUKA 3GRRA 1MDQA 3HHWA 2F4VM 4JV5M 4Z8XA 5KCJA 4DR7M 1VSOA 1P99A 2VIIA 3FUUA 2RC7A 2UXDM 1PC3A 3RT6B 3PPQA 4QF9A 3OSRA 3VXCA 5TP9B 3MBPA 1GGGA 1HQCA 4F3GA 4R6YA 2ABHA 4L8RC 2ZNTA 1IBKM 2F5XA 2GHAA 5HM4B 3VDFA 3L25A 1KSFX 3FUWA 4QHSA 3U72A 3AOEA 3W0FA 1MY0A 1NHGC 1UIUA 4CHTB 3K4UA 4X66M 2HZKA 3TTRA 2OCUA 4CISA 3L6GA 4MGIE 3FD9A 1NNKA 3AOEC 3H6TA 1TFAA 1J7KA 3S4UA 4C1TA 5CMMA 4TLLB 3SAUA 4P11A 3FYCA 3IG8A 4GFRA 2XXXA 3KJ7A 2OZZA 4IO6A 4LQ5A 4DR5M 3EQ1A 1G8PA 2V1UA 4KLNA 4OX9M 4NMYA 4XKRA 1TWYA 1B7HA 4PFUA 4R74A 2PYYA 2A5TB 4Q30B 2AYSA 3E3KA 2L6OA 4HL4A 4Q5TA 1IY1A 1L1TA 2F7AA 2CV2A 1B7UA 3FJGA 4N6PA 2F5NA 3M0EA 4RF1A 1Z5CA 3BOSA 4DXBA 3MVZA 3ZH9B 5H8HA 4G6ZA 4FE8A 4EF1A 4EIWA 2UYEA 3L29A 2NUVA 4K0KM 1XS5A 1ZAEA 1WDNA 4OW0A 1N84A 4KYDA 4KHPM 2CE7A 4H8JA 2PT1A 4F22A 5C18A 4YKKA 4JWXA 3SKPA 2O1LA 1A55A 1XVYA 2V93A 2XFTA 3MZ9A 3HHYA 4OEVA 3TEPA 1LGBC 5DYGA 1IUDA 1ZU0A 3TL4X 1DOTA 3FXRA 3U6DA 4NF4A 5IT9S 3LQQA 2UXAA 4YU0A 1SW2A 1YCJA 2DE3A 3QUJA 4IBDA 1Y4CA 3A3CA 1M5FA 3K01A 1BKAA 1L2BA 3B6QA 3FD3A 3ZKKA 1C1KA 3QK6A 3VFJA 1L2DA 4ITQA 2C9CA 1B46A 1Y9UA 4KCCA 4FW9A 2F78A 5EXXA 3WHKA 1A54A 1LLSA 3L26A 1ZBMA 1GL7A 2QS4A 2RCAA 2UXBM 1IZ1A 1NVMA 2Y20A 2O1MA 3UIFA 4IBIA 4ELQA 3U6LA 3TTKA 1M5BA 1MY2A 4GC5A 3T22A 3DA1A 5AA3A 2M60A 3A46A 2O5RA 3GPYA 5I56B 4DCXA 1H45A 3TDJA 5ITOA 2R4EA 4YZZA 4FWDA 5TPAB 4PE5B 5IKBA 4G8HA 1KFVA 3QAXA 1BTJA 5F7VA 1S3SA 3PXGA 3DELB 1XWIA 1K3WA 3TCHA 4FCTA 4LGYA 1ZKBA 5BUUA 2BJJX 2UUBM 1II5A 2F97A 4XXUA 5EP3A 5B70A 4DR2M 3W9WA 5ELVA 1UTHB 1B3GA 4NTLA 4LFAM 3E13X 1TH3A 4FEBA 2YR0A 1B5IA 1ZJLA 5FHOA 3KJTA 3UGJA 1S7YA 2HCAA 4R73A 3U61B 3U60B 4YB7A 2KZUA 3I3VA 1YE9A 1N7WA 2D7HA 1QUIA 3VDPA 3VFDA 2Q9TA 3VLFB 1E9RA 4LP2B 3N94A 2VP1A 2F5PA 4O3BA 2DOJA 3G7WA 4R72A 2VD2A 4NRWA 5CRYA 3HU1A 1DMBA 1Z7ME 1NNTA 4JBZA 1DPEA 2V3TA 1PBPA 2QENA 1SYHA 2DVZA 4EF2A 3L6HA 3K1PA 2HXWA 3MP1A 4PD2A 5AE4A 1B1XA 2FNAA 1N75A 1LAGE 2QS1A 1SXJC 3U61A 3PNYA 2DWJA 1MPCA 3B6TA 1US5A 2H25A 3H4MA 2DE2A 3C4MA 5I2NA 4O3CA 1VFEA 1T0KA 2P1SA 3R8FA 3VVDA 3A3UA 3RGYA 4D82A 2D21A 1YTVA 4JB7A 4NWDA 4DZ1A 4MLQA 3W9VA 1POTA 2DQVA 3IJXB 4OQOA 1E9SA 5BPVA 4U22A 1JEVA 4PFTA 1A99A 2I58A 4DR4M 2X26A 1A8FA 2QPQA 2JA2A 3PD9A 1VFDA 1W5TA 5ITPA 1IIWA 1JVYA 2RC8A 2LXEA 2I0CA 2F5OA 3LBSA 4RXLA 3SEUA 2VGQA 3O2AA 1R6ZA 2THIA 5AA2B 3SATA 2LAOA 1Y1MA 3RTFB 2OQ4A 2QBYA 3QIMA 4ZEKA 4RNAA 3CG3A 2HEUA 1B3FA 3LC8A 4R6HA 1BIYA 5ISUA 3U8QA 4NF5A 1IN5A 1B3HA 1XOCA 2XH9A 1Z5AA 1XHYA 5FTHA 1O7TA 4LVQA 5AA4A 2ZYMA 3MK6A 5KCJB 4GH9A 3SERA 3J7BA 1PB7A 3KN7A 4QNMA 3CTWB 4R9GA 4W5WA 2QMWA 4GD5A 4OEUA 4IBBA 3MPLA 5FTJA 4G68C 4BLAA 1Z5BA 4ZDMA 2Y7KA 3LSLA 2QS3A 4KHZE 1GLNA 5I58A 1IEJA 4AKHA 1IN8A 4U23A 2UVIA 1LSTA 4EXLA 4GLIA 4AW4A 4GKKM 2XXTA 3KSJA 3U6CA 4JXIA 2R4JA 4ZZEA 1LFIA 2F36A 2DP8A 3CIJA 1Y3NA 2ZNUA 4E0XA 1B3EA 2B65A 2DWLA 4L17A 4RK2A 1L5TA 3G3GA 1PBQA 4QFOA 3KOTA 3WHLA 2X7PA 4RNSA 2AHMA 2QL3A 3VVFA 3VXBA 4B08A 1B32A 1DPPA 4RPNA 1QQWA 1JQJC 2NOOA 3G3KA 4DV6M 5ITUA 1N3WA 3O6IA 3D8BA 3K6UA 4DV2M 2DVCA 4E0WA 5LOMA 4OYVA 5JK4A 4F1VA 3N6TA 5CBRA 1Z59A 3GPXA 3SEYA 1N7XA 1MQHA 4GITA 1POY1 2B3FA 4AKIA 3W15C 2I7PA 1R9LA 3DOAA 3PNVA 2Z8DA 2BJVA 4ESWA 3UMMA 4IO5A 1MY4A 1Q1KA 4FCVA 1JW1A 1NL5A 2P5TA 2Y7IA 4MB7A 1TFDA 4X65M 3TAJA 3TQWA 3IG5A 3TCGA 4RJZA 5HPQA 2YNMD 3LUYA 5DTBA 3GO8A 3VVEA 1QULA 5FTIA 3PPPA 3LSWA 2XXVA 3T9UA 4G8NA 3MJ5A 4LJ7A 3K2LA 2CEAA 1MPBA 1MQJA 4DV3M 3SHGB 1UQWA 5CI5A 3U6SA 3HHZA 1LB9A 1IQ7A 1QZMA 3PMXA 4M4GA 4G4NA 3TTMA 2DXYA 3PMWA 1NSFA 4QFLA 1P1UA 2YQZA 4YKPA 3LVVA 2LNHC 3SAWA 1QKBA 4ZPXA 2UUAM 4QFKA 2Y0QA 4P0IA 2XXHA 1MXVA 4U2RA 4ZECA 4DV4M 1VDDA 4LFBM 3RTWB 4G8MA 1I6BA 5DVIA 2L09A 4OWDA 2ZYKA 2ZXTA 4KR5A 4R6KA 3AFHA 4IJEA 4OETA 1EH3A 1Q39A 2DHRA 1K3XA 1NY5A 4IBGA 3EN3A 3OEMA 1OMPA 3VK7A 1HQYE 5ITTA 1ZTYA 4GXSB 3U92A 3HHXA 3MAMA 4DV0M 2HHHM 4MFIA 3T9VA 3KXEC 7CATA 1RKMA 4BB9A 1XNQM 2XGNA 3GLGA 1L1ZA 4YY3M 5ITRA 4NRVA 3IK6B 4QSCA 4WURA 4NF8B 1HSJA 2OJTA 2Z8FA 3H3GA 3R7XA 4LF6M 2NXOA 1HNZM 1O63A 1SI0A 3RPWA 4LONB 2XXWA 4NSRA 3DP6A 1MQIA 4X48A 3T66A 4L4UA 1DSNA 4QSEA 3I4YA 1UTBB 2H1RA 4YMAA 4B7FA 4U21A 4I4LA 2PBWA 4H65A 1I4WA 4G68A 1B52A 2I3VA 3TUSA 2E0SA 1Y3PA 1JR3A 2YLNA 3GQ3A 1NJGA 5I59B 1URSA 2V25A 2J7OA 4JI0M 4AB5A 3JR5A 2E5LM 2OBGA 3ZCBB 4BBAA 3CF0A 2F5SA 2DYXA 1MH4A 3O9PA 4RA1A 1IXZA 2UVHA 5CM6A 3RFWA 1LBBA 4THIA 4MGHA 4OU7A 3RNNA 2DSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDP 1;  3E4R A;  3OEN A;  4QRZ A;  3HPI A;  2DS9 A;  3H06 B;  4YZZ A;  5TPA B;  4F3S A;  1MG1 A;  2XX9 A;  3C36 A;  1MXX A;  3CI8 A;  4PE5 B;  2ZMB A;  1FQC A;  2W7Y A;  4ZEI A;  5IKB A;  3SEX A;  1B58 A;  4GVO A;  3H6U A;  1A40 A;  3MP8 A;  1B5H A;  5DVF A;  3BBR A;  4G8H A;  3QAX A;  5JTY B;  1BTJ A;  1MY3 A;  2O84 X;  4JWO A;  1VE4 A;  2I4C A;  3DEL B;  2OLB A;  3QYT A;  4KYS A;  4U1Z A;  3TCH A;  3TTL A;  1EZO A;  4HCW A;  1VR5 A;  1ZKB A;  4NF6 A;  3FV2 A;  5BUU A;  2BJJ X;  3LSX A;  4OFJ A;  5I2K B;  5L9S A;  3ONM A;  4I1D A;  2D3I A;  2UVG A;  3QUF A;  3CFL A;  2H98 A;  4I62 A;  4N13 A;  2AL4 A;  1II5 A;  1OVB A;  2F97 A;  4XXU A;  5I59 A;  2O68 A;  5B70 A;  3FGS A;  2Y7W A;  2F6P A;  4BDN A;  5F1Q A;  1I6Q A;  3TDJ A;  2Z22 A;  3OXN A;  3MP6 A;  3W9W A;  3KEI A;  4LQ2 A;  3F11 A;  4YB6 A;  5ELV A;  1UTH B;  1B3G A;  1I69 A;  4LUB A;  5H8N A;  3O29 A;  4GOT A;  1FCK A;  4NTL A;  1B0H A;  4R9F A;  3PUY E;  2QJE A;  3E13 X;  4WED A;  3T93 B;  4DDD A;  3FJ7 A;  4EXK A;  3EF7 A;  4POX A;  2GHB A;  4FEB A;  3OMB A;  3M3L A;  4F19 A;  1B5I A;  4KD5 A;  4YIC A;  1ZJL A;  5JEI A;  1ELJ A;  5FHO A;  2R71 A;  3KJT A;  3FVG A;  1FQD A;  1N04 A;  1HSE A;  1S7Y A;  1SW1 A;  2HCA A;  3C33 A;  3RY3 A;  4H8I A;  1US4 A;  4R73 A;  1WOD A;  2Q88 A;  4U4X A;  3CR9 A;  1QW0 A;  4YB7 A;  3FJM A;  3V8X B;  5A5X A;  5K2X A;  5ICT A;  3I3V A;  4RY1 A;  2XXU A;  1N7W A;  3IOU A;  4NE4 A;  3LSF B;  1TXF A;  1GV8 A;  1QUI A;  3DLN A;  4LZ5 A;  4LP2 B;  2Q9T A;  3KBR A;  1M5E A;  1H43 A;  1URD A;  5I56 A;  5J1D A;  1SD3 A;  3N94 A;  2VP1 A;  1S50 A;  3I6V A;  1B2H A;  1M5D A;  4O3B A;  5CMC A;  2DOJ A;  3G7W A;  3K02 A;  2VD2 A;  4R72 A;  1LAX A;  4WEP A;  5CRY A;  4GWO A;  2GRV A;  1DMB A;  1Z7M E;  3OSQ A;  2ANJ A;  4PFY A;  3TKD A;  3UOR A;  3SEW A;  1NNT A;  4FAJ A;  3E9X A;  4JBZ A;  2I49 A;  1DPE A;  1PBP A;  2ONK E;  1SDX A;  2V3T A;  2YPN A;  1SYH A;  2DVZ A;  3IB1 A;  1B40 A;  4IGT A;  2OWS A;  3L6H A;  2NWJ A;  3K1P A;  3IX1 A;  3KFM A;  3ODB A;  3VLU A;  3ZS6 A;  3D4C A;  2XX8 A;  4QFN A;  4IO3 A;  5I84 A;  2FNC A;  4R2F A;  4OFL A;  1FQB A;  3RUM A;  2HXW A;  2O7U A;  3D4G A;  2H99 A;  3MP1 A;  3EHU A;  3H6V A;  5AE4 A;  1B1X A;  3IR1 A;  1LAG E;  2QS1 A;  1RYO A;  2HZL A;  3KN8 A;  4LAT A;  4MH5 A;  1LBC A;  3KZG A;  3S2V A;  5I59 B;  2DWJ A;  1MPC A;  3B6T A;  1US5 A;  2R6G E;  4FED A;  1N76 A;  4F18 A;  1B6H A;  1FTJ A;  4GXA A;  3O66 A;  1FW0 A;  2RCB A;  3C9H A;  3G3F A;  3CVG A;  5DT6 A;  1B9J A;  2H25 A;  4XKN A;  3MVW A;  2DE2 A;  3C4M A;  1B4H A;  1SW5 A;  5I2N A;  2A5T A;  4O3C A;  4Z0I A;  2ZYO A;  4OES A;  3JV9 A;  1VFE A;  1HSL A;  3JYR A;  2P1S A;  1T0K A;  2AIX A;  1IXH A;  1SVX B;  1B4Z A;  3VVD A;  3A3U A;  3RGY A;  3HO7 A;  3K1M A;  3BFT A;  2D21 A;  2GFE A;  1YTV A;  2F34 A;  4JB7 A;  4NWD A;  3PPN A;  1FTO A;  3C34 A;  5H8Q B;  5TU0 A;  4MLQ A;  3W9V A;  1POT A;  2DQV A;  3KGC A;  3IJX B;  4OQO A;  4C0R A;  4U22 A;  2HQ0 A;  2V3U A;  1LB8 A;  3CSG A;  5CMB A;  1JEV A;  1P1W A;  4PFT A;  2Y84 A;  3LR1 A;  3A09 A;  1A99 A;  1KWH A;  2A5S A;  1B0L A;  1EZ9 A;  2D5W A;  2I58 A;  3EHS A;  4G77 A;  5EHM A;  5EYF A;  1J1N A;  3T96 B;  2X26 A;  1QJM A;  3U94 A;  4BDO A;  4ZE8 A;  4IB2 A;  1A8F A;  4FJP A;  4OXV A;  4DXU A;  3CSB A;  3PGF A;  2QPQ A;  3MZB A;  4F2Q A;  2M8C A;  3TCF A;  3PD9 A;  4TLM B;  1S9T A;  1VFD A;  3FV1 A;  5ITP A;  2I4B A;  1IIW A;  4IO2 A;  2F6G A;  4PET A;  1QVS A;  1N0T A;  1B7Z A;  3O97 A;  1B1H A;  1H44 A;  1CE2 A;  1JVY A;  2E1S A;  2RC8 A;  2Y7R A;  2I0C A;  3FXQ A;  3HHG A;  4KPT A;  3LBS A;  3ZSF A;  2FA7 A;  3MQ9 A;  3C31 A;  4JDF A;  4RXL A;  2ONR A;  4JSD A;  3V89 B;  3SEU A;  1MXZ A;  2VGQ A;  1M5C A;  1DTG A;  1EZP A;  4QSD A;  3O2A A;  1R6Z A;  4NF4 B;  4C1U A;  2UVJ A;  2THI A;  3RLF E;  3TFL A;  3IL1 B;  4ZED A;  1UTH A;  4IO4 A;  5AA2 B;  5AA1 A;  1PEB A;  4XIG Q;  5H8S A;  4U4S A;  3SET A;  2LAO A;  1Y1M A;  3TOD A;  3RTF B;  4BDQ A;  5K2Y A;  2NVU B;  1H3D A;  1PB8 A;  3MZ1 A;  3QIM A;  4ZEK A;  2XXI A;  3CG3 A;  2HEU A;  1B3F A;  3GBB A;  5AA2 D;  4POW A;  3U93 A;  1URG A;  3LC8 A;  1D3K A;  4FOR A;  4JSO A;  4EQ7 A;  4R6H A;  4Z7E A;  5CBS A;  1BIY A;  4O3A A;  5ISU A;  3H03 A;  3U8Q A;  1Z7N E;  4UA8 A;  3CFX A;  3P7I A;  4NF5 A;  4PQJ A;  5TP9 A;  3T9H B;  1MPD A;  2H9B A;  1B3H A;  5BWJ A;  1XOC A;  5CMK A;  1XHY A;  3OO9 A;  4OMB A;  1OQG A;  4KQP A;  5FTH A;  5IAI A;  4DXC A;  4GRK A;  5KZT A;  1O7T A;  1USY E;  2DE4 A;  3PPR A;  4LVQ A;  3S9M C;  1FTK A;  5AA4 A;  2ZYM A;  4YKI A;  5KCJ B;  5B7D A;  3AXF A;  2QMX A;  4IY6 A;  1JW5 A;  2H4I A;  3IOW A;  3TEL A;  1OVT A;  3FXU A;  4XKQ A;  3KSX A;  2QRY A;  3G3H A;  4GL8 A;  3SER A;  1PB7 A;  3KN7 A;  5H8Q A;  5ICQ A;  4NWC A;  3WAF A;  2ZNS A;  5AA2 A;  3G3J A;  2ALU A;  3O28 A;  4R9G A;  4XTC Q;  2QMW A;  3FVO A;  2WKY A;  4F39 A;  4GD5 A;  3K1N A;  1B3L A;  1LAF E;  4OEU A;  4RK9 A;  4WKM A;  3MPL A;  1MQD A;  5EHS A;  3THI A;  1QKA A;  1JVX A;  4G68 C;  4BDM A;  4EQ9 A;  1Y3Q A;  4ZEB A;  3MJN A;  3MWB A;  4BLA A;  1MRP A;  2QSX A;  1GR2 A;  2Y7K A;  4OVJ A;  4ZDM A;  4YMA A;  3LSL A;  2I6E A;  2QS3 A;  3EPE A;  4KHZ E;  1MS7 A;  4G4P A;  4LZ7 A;  1P1Q A;  2FYI A;  3K00 A;  2XD3 A;  3PUZ E;  1LFG A;  1IEJ A;  4FEC A;  4HS7 A;  4ZEF A;  2OK2 A;  5I58 A;  4LZ8 A;  2XXP A;  3PV0 E;  1D9Y A;  4IY5 A;  2DXR A;  2UVI A;  2I3W A;  1LST A;  4U23 A;  4DE8 A;  3GXA A;  3PMV A;  3PPO A;  4DZ1 A;  2B3B A;  4GLI A;  1NKX A;  4EXL A;  1AIV A;  4H1X A;  1MM6 A;  4I9D A;  2XXT A;  3FVK A;  3KSJ A;  3IAZ A;  4JXI A;  3N6U A;  4KFQ A;  5FHM A;  4X1D A;  1B51 A;  4ZZE A;  3TYH A;  3U1O A;  1LFI A;  3ECR A;  5ITO A;  2F36 A;  2DP8 A;  1FQF A;  3CIJ A;  2AL5 A;  2CZL A;  4OTE A;  4MLV A;  1Y4T A;  5I2N B;  4R75 A;  4X1B A;  1Y3N A;  3PUX E;  4Q0C A;  2ZNU A;  2G29 A;  3G3I A;  2F7C A;  4E0X A;  1B3E A;  2B65 A;  4M1V A;  1D9V A;  1ZMG A;  4GQO A;  2RF1 A;  4L17 A;  4RK2 A;  1L5T A;  3TZA A;  1IXC A;  3G3G A;  4OEN A;  1FQE A;  2HFB A;  3MW0 A;  5KDT B;  1MH3 A;  1PBQ A;  2F7B A;  4QFO A;  3KOT A;  3H4Z A;  3Q27 A;  3SEV A;  1AH5 A;  2X7P A;  4RNS A;  3Q29 A;  4QSC A;  4FAT A;  5I57 A;  2VD3 A;  2QL3 A;  3HCQ A;  3VVF A;  3MVX A;  3VXB A;  4R2B A;  1D4N A;  1B32 A;  1DPP A;  3GZG A;  5L9O A;  4RPN A;  3FAS A;  3HV1 A;  5I58 B;  1A8E A;  2NOO A;  3DP4 A;  3G3K A;  2DWA A;  3ZKL A;  2F35 A;  1P1N A;  1BLF A;  3OEL A;  4XKP A;  1N3W A;  3O6I A;  1PDA A;  2V3Q A;  3CG1 A;  3EHT A;  4YAH X;  1IXG A;  1A7L A;  3K6U A;  3VLW A;  4BDR A;  4H5F A;  5LOM A;  2DVC A;  3IJO B;  4MBP A;  4E0W A;  1JNF A;  3T9X B;  4X9T A;  1AMF A;  3V5A A;  4H67 A;  4OYV A;  1SBP A;  4Q8R A;  4GF8 A;  5JK4 A;  4F1V A;  3N6T A;  5CBR A;  1MY1 A;  4OZ9 A;  2Q2A A;  3IB2 A;  3SEY A;  1LCT A;  1N7X A;  1Y1Z A;  3MUQ A;  2CMO A;  1MQH A;  1YAE A;  4PP0 A;  4EDP A;  2PT2 A;  1POY 1;  2B3F A;  3R6U A;  4PFW A;  3W15 C;  3BKI B;  1R9L A;  4MF3 A;  5H8F A;  1NH7 A;  3QSL A;  3FIR A;  1QUJ A;  3CFZ A;  4LA9 A;  2Z8D A;  4ZZA A;  1AOV A;  2Z8E A;  2O69 A;  3OO8 A;  3S9E A;  4ESW A;  3B6W A;  3MVY A;  3PUW E;  3FZV A;  5FHN A;  4ECF A;  5A5X B;  4IO5 A;  3KOS A;  1MY4 A;  2F8D A;  4RYA A;  4NF6 B;  1Q1K A;  2XXR A;  2DWI A;  1EU8 A;  1JW1 A;  2HAU A;  3CRB A;  1NL5 A;  4NF5 B;  1CB6 A;  2GH9 A;  2Y7I A;  4QFP A;  5DVJ A;  1TFD A;  4ELR A;  1IIT A;  3O6H A;  3MPK A;  3TPA A;  4EUO A;  3SDF A;  3TAJ A;  4HCY A;  4IGR A;  3K0V A;  3TQW A;  4AQ4 A;  4YMB A;  2OWT A;  3KG2 A;  1ATG A;  4I8C A;  3GLB A;  1QUK A;  1F9B A;  3TCG A;  1XVX A;  4RJZ A;  5HPQ A;  1MDQ A;  3LUY A;  2IEE A;  5DTB A;  4H6D A;  1USY H;  4IO7 A;  4ISU A;  5F7V A;  2Q89 A;  5L9M A;  4F3B A;  5KCJ A;  1N3X A;  1VSO A;  2DWH A;  3K6W A;  3VVE A;  1QUL A;  3TMG A;  4KI0 E;  1P99 A;  2KLF A;  3IOV A;  3ILU B;  1BP5 A;  1OIB A;  2RC7 A;  3LSW A;  2XXV A;  1UIV A;  3PPP A;  2G93 A;  4NF8 A;  2XHD A;  3IO4 A;  4G8N A;  3T9U A;  1PC3 A;  3RT6 B;  3TQL A;  3PPQ A;  4QF9 A;  3OSR A;  3VXC A;  5TP9 B;  3MBP A;  1GGG A;  3O6G A;  4G2Z A;  5DYH A;  4KCD A;  1MPB A;  4F3G A;  1MQJ A;  2RC9 A;  4R6Y A;  2ABH A;  2ZNT A;  1UQW A;  3OEK A;  5CI5 A;  2Q2C A;  3S9L C;  2F5X A;  1LB9 A;  2GHA A;  5HM4 B;  3RQT A;  3VDF A;  4ELO A;  1RYX A;  3IB0 A;  3U72 A;  3UK4 A;  1IQ7 A;  4F3P A;  4ZS9 A;  3PMX A;  1MY0 A;  2X7Q A;  4M4G A;  1Q35 A;  3TTM A;  1SI1 A;  1UIU A;  5TPA A;  3K4U A;  1NNF A;  2HZK A;  2OCU A;  2RIN A;  3TTR A;  3VLV A;  2DXY A;  3L6G A;  3PMW A;  2O7I A;  4DCY A;  3S9N C;  1NNK A;  4ZE9 A;  4QFL A;  3H6T A;  2I48 A;  4N07 A;  1P1U A;  3ILT B;  1H76 A;  2HAV A;  1TFA A;  3H6W A;  1MXU A;  3S4U A;  3SES A;  4YKP A;  2XXQ A;  4AB6 A;  3PU5 A;  4H5G A;  4C1T A;  1JEU A;  5CMM A;  1QKB A;  4RPO A;  3VV5 A;  4TLL B;  4P11 A;  3HN0 A;  4TQU Q;  5DEX B;  4F2O A;  4QFK A;  4GFR A;  1YPN A;  2QS2 A;  4P0I A;  2XXX A;  2XXH A;  3BFU A;  1DTZ A;  3KJ7 A;  2OZZ A;  4IO6 A;  1MXV A;  4LQ5 A;  4U2R A;  4ZEC A;  3EQ1 A;  4HTG A;  3USD A;  2P2A A;  2Z23 A;  1WVJ A;  5CC2 A;  1LFH A;  3RTW B;  1OLA A;  1R1N A;  4G8M A;  1FQA A;  1I6B A;  5M2V A;  4NMY A;  5AA4 B;  5DVI A;  4OWD A;  2ZYK A;  1SYI A;  2ZXT A;  4KR5 A;  4R6K A;  1Y20 A;  4XKR A;  1TWY A;  4QHQ A;  1B7H A;  2REG A;  4K3F A;  2REJ A;  4PFU A;  4OET A;  4R74 A;  1FTL A;  1EH3 A;  3UGW A;  2PYY A;  3TTN A;  3B7D A;  3K6V A;  2A5T B;  4NED A;  2XX7 A;  1IXI A;  4Q30 B;  3PUV E;  2AYS A;  5JTY A;  3E3K A;  3N5L A;  2O51 A;  2R9J A;  3OO6 A;  4Q5T A;  3EN3 A;  3OEM A;  2VOZ A;  1LCF A;  2F7A A;  1OMP A;  2I0B A;  2PX1 A;  3KN3 A;  3C32 A;  4F1U A;  3JZJ A;  3QXM A;  1B7U A;  3FJG A;  2H5Y A;  4N6P A;  1ZTY A;  4U1O A;  3OD7 A;  4GXS B;  4DIG A;  4EF2 A;  3U92 A;  2RKM A;  3MAM A;  3Q25 A;  5I57 B;  1SW4 A;  2UYF A;  1B5J A;  1MM7 A;  4MFI A;  4YB5 A;  3T9V A;  4DXB A;  1I6A A;  1RKM A;  3MVZ A;  1XC1 A;  3M8U A;  4UAC A;  2XD2 A;  5H8H A;  1ZLQ A;  4FE8 A;  4EF1 A;  1OQH A;  3K6X A;  2UYE A;  2XXY A;  2NUV A;  3DP8 A;  3RN8 A;  1XS5 A;  3UN6 A;  3IO6 A;  1WDN A;  4OHN A;  1N84 A;  1NMU A;  1R9Q A;  3IK6 B;  4KYD A;  3I5O A;  4OER A;  4H8J A;  2PT1 A;  2Y7P A;  2Q8J A;  1O64 A;  4F22 A;  4YKK A;  3GBA A;  4JWX A;  3SKP A;  2O1L A;  1MQG A;  4NF8 B;  1A55 A;  1HSJ A;  2OJT A;  2Z8F A;  3H3G A;  1XVY A;  3R7X A;  2V93 A;  2NXO A;  4HW8 A;  2PVU A;  1O63 A;  1P1O A;  1TT1 A;  3C35 A;  2P0S A;  5HBC A;  3MZ9 A;  2VHA A;  5H8F B;  1JW4 A;  1ANF A;  3Q28 A;  4OEV A;  1SI0 A;  2IA4 A;  3TEP A;  3RPW A;  2V84 A;  3IOR A;  4YKJ A;  1LGB C;  3FVN A;  4LON B;  1ZU0 A;  1IUD A;  2XXW A;  1ZIU A;  3DP6 A;  1DOT A;  1MQI A;  3FXR A;  3PD8 A;  4H0W A;  4P0G A;  4ONY A;  4NF4 A;  1DSN A;  4X48 A;  3T66 A;  2YJP A;  4EQB A;  5KDT A;  4QSE A;  2UXA A;  1UTB B;  4ND9 A;  4YU0 A;  4KYE A;  1SW2 A;  1XT8 A;  1YCJ A;  2DE3 A;  3DM0 A;  3IOT A;  3OO7 A;  3QUJ A;  3R26 A;  4G68 B;  4GIZ A;  4OFO A;  1UTB A;  1NH8 A;  1Y4C A;  4U21 A;  3A3C A;  3M3K A;  2PBW A;  1M5F A;  3K01 A;  1BKA A;  4H65 A;  3UP9 A;  4G68 A;  4F1Y A;  1B52 A;  2I3V A;  1JET A;  3B6Q A;  3FD3 A;  5H8N B;  3ZKK A;  3QK6 A;  1NFT A;  3FUZ A;  3TUS A;  2E0S A;  3MC2 A;  4TOZ A;  3VFJ A;  1JQF A;  1GTK A;  1GVC A;  4BDL A;  1Y3P A;  1Y9U A;  1B46 A;  4JWY A;  4KCC A;  4ELP A;  1MXW A;  2YLN A;  2F78 A;  3M3F A;  4WXJ A;  1A54 A;  1B05 A;  1LLS A;  2ZYN A;  1ZBM A;  3OOA A;  1URS A;  2QS4 A;  2V25 A;  3FAT A;  5FTI A;  1MXY A;  1PB9 A;  4ESX A;  3V83 A;  4AB5 A;  3UA8 A;  2RCA A;  2ESN A;  3HHF A;  1IZ1 A;  3HST A;  2O1M A;  2ONS A;  5I2K A;  2OBG A;  4DLD A;  3UIF A;  3RT8 A;  3WAE A;  4ELQ A;  1SQY A;  3Q26 A;  1FTM A;  4F29 A;  1AL3 A;  3TTK A;  1M5B A;  5DEX A;  1OLC A;  2DYX A;  1MY2 A;  1MH4 A;  3VE1 B;  3K2D A;  4F31 B;  3O9P A;  4RA1 A;  3T22 A;  5L8D A;  2UVH A;  5AA3 A;  1LAH E;  5CM6 A;  1LBB A;  4THI A;  1NNP A;  3N26 A;  4FIM A;  5I56 B;  4DCX A;  3RNN A;  2DSF A;  3H7M A;  1H45 A;  5H8H B;  2PMS A;  4GL0 A;  2O6A A; 
#chains in the Genus database with same CATH topology
 1DCU A;  4FWH A;  1H6U A;  4OVZ A;  1XXH B;  2HKJ A;  3LMM A;  3C36 A;  3CI8 A;  4MNP A;  2ZMB A;  4ZEI A;  4LF5 M;  4GVO A;  5I5P A;  5DVF A;  4MMP A;  3K1J A;  4JWO A;  2I4C A;  3QYT A;  1N78 A;  3K8Z A;  2J7N A;  3L2A A;  1VR5 A;  2EO2 A;  3FV2 A;  4OFJ A;  4MM3 B;  2WSC F;  3ONM A;  3SHF A;  4I1D A;  5EXT A;  4I62 A;  4N13 A;  2AL4 A;  1K82 A;  4LY6 A;  2O68 A;  2MR9 A;  3HGI A;  3FGS A;  3B9P A;  4I3E A;  5F1Q A;  1I6Q A;  1PM5 A;  1OJL A;  1HT1 E;  3KEI A;  4LQ2 A;  3F11 A;  1G0I A;  3O29 A;  3T1Y M;  2QJE A;  2XLJ A;  1IN4 A;  3W67 A;  2GHB A;  3OMB A;  4MEV A;  1D2N A;  3SYK A;  4KD5 A;  4YIC A;  4GIP A;  2R71 A;  1SPI A;  2L4F A;  4REZ A;  2LWX A;  2XFS A;  2Q88 A;  3RGP A;  1NNU C;  5A5X A;  4X8R A;  5ICT A;  2XXU A;  2WZJ A;  3IOU A;  1BVS A;  3DLN A;  4LZ5 A;  5LMU M;  5J1D A;  3I6V A;  4GWZ A;  5EQT A;  2D7G A;  1HNX M;  2VPN A;  3K02 A;  1PGY A;  4WEP A;  4GWO A;  2GRV A;  4PFY A;  3UZU A;  4FAJ A;  4PGN A;  1GO5 A;  2I49 A;  2G8L A;  2ONK E;  2YPN A;  4IGT A;  4KT0 F;  3IX1 A;  4S12 A;  2KR0 A;  3D4C A;  3NBX X;  5I84 A;  5LTC A;  4R2F A;  2OWZ A;  1EFU B;  1FQB A;  2H99 A;  2XWK A;  1VEG A;  2KEB A;  2XSZ D;  1QGX A;  1OIP A;  1RYO A;  3KN8 A;  4LAT A;  1WGN A;  5FTK A;  3KZG A;  2KNA A;  4DR3 M;  2R6G E;  4FED A;  1N76 A;  1TDZ A;  3D8L A;  1FW0 A;  2EKF A;  1VG5 A;  5EJC A;  1B9J A;  5E6J A;  2ZYO A;  4OES A;  4JI5 M;  3KOY E;  3MMP A;  1QAN A;  2GFE A;  1IY2 A;  2F34 A;  3PPN A;  1FTO A;  5H8Q B;  3KGC A;  5EQ9 A;  1LB8 A;  3CSG A;  3UGW A;  4PE3 A;  4U1Z A;  2D5W A;  5EHM A;  1B0L A;  4G77 A;  2KW0 A;  1G0H A;  4PF6 A;  3T96 B;  2RRU A;  1INP A;  2KRK A;  4IB2 A;  4LRT A;  4OXV A;  3SC3 A;  3MZB A;  2FFJ A;  1S9T A;  2Y5K A;  4IO2 A;  1B1H A;  3HHG A;  2Y7R A;  3FTC A;  3KBZ A;  1NV0 A;  1QAM A;  3C31 A;  3MQ9 A;  4JDF A;  2ONR A;  4JSD A;  5ESY A;  2F5Q A;  1MXZ A;  2KZS A;  4O8M A;  1EZP A;  4C1U A;  3TFL A;  3IL1 B;  4OVZ B;  1UTH A;  1P3Q Q;  3NOH A;  3SET A;  5J16 A;  3SAR A;  2NVU B;  3MZ1 A;  2CHG A;  1RDZ A;  2XXI A;  4NOO B;  2DVW B;  5AA2 D;  4PDD A;  4POW A;  3U93 A;  1XNR M;  4EQ7 A;  5CBS A;  4LZJ A;  4O3A A;  3QYB A;  3U6M A;  1MPD A;  3I51 A;  2CHQ A;  1D0L A;  5GKN A;  3OO9 A;  2KXE A;  1OQG A;  2XZF A;  4DXC A;  5KZT A;  3S9M C;  3UK6 A;  4YKI A;  5B7D A;  1FPD A;  2H4I A;  3IOW A;  1OVT A;  3FXU A;  4GL8 A;  4PBQ A;  2OO9 A;  1V92 A;  4XGI A;  2DAE A;  3O28 A;  3U6E A;  3FVO A;  1FJG M;  3K1N A;  4L78 A;  2ZZV A;  1DV0 A;  1MQD A;  3B50 A;  4DUZ M;  1FBF A;  1Y3Q A;  3MJN A;  3MWB A;  1WHC A;  2QSX A;  3SMS A;  4LZ7 A;  1P1Q A;  2FYI A;  4HS7 A;  1LBY A;  3HJ8 A;  4LZ8 A;  3I04 M;  2WYP A;  2XXP A;  1D9Y A;  4IY5 A;  2DXR A;  2I3W A;  4LF4 M;  1MM6 A;  4I9D A;  5EP2 A;  3FVK A;  5FHM A;  3U1O A;  1B51 A;  2CV1 A;  1OIZ A;  2AL5 A;  3FTE A;  4MLV A;  1Y4T A;  4X1B A;  2G29 A;  4M1V A;  1YLA A;  1D9V A;  1ZMG A;  2RF1 A;  2VT5 A;  4OVQ A;  4OEN A;  2HFB A;  3MW0 A;  1MH3 A;  2D7E A;  2F7B A;  1NV7 A;  1N33 M;  2BNK A;  1AH5 A;  5I57 A;  4LF7 M;  4FAT A;  2VD3 A;  4JVI A;  2LHC A;  1D4N A;  3GZG A;  1DGF A;  2HCB A;  3HV1 A;  3ZKL A;  1IY0 A;  4G3O A;  2F35 A;  1BLF A;  5HBC A;  4GKJ M;  3UJN A;  4F2L A;  4YAH X;  1Q3C A;  3CG1 A;  1IXG A;  1ZMW A;  3VLW A;  5JI3 E;  3V5A A;  2ZM6 M;  1UFZ A;  3W0L B;  1DK4 A;  4H46 A;  1Y1Z A;  3MUQ A;  4LF9 M;  1IFY A;  3ZC7 B;  3D1R A;  2PT2 A;  4MGK E;  5IZ7 D;  4PFW A;  4DI3 D;  4MF3 A;  3RE8 A;  1PJQ A;  1FPG A;  3QSL A;  3FIR A;  4LA9 A;  4HLQ A;  4ZZA A;  2Z8E A;  2O69 A;  3OO8 A;  3MVY A;  3PUW E;  4ECF A;  4D80 A;  2XXR A;  1NJF A;  4MGY E;  4JI6 M;  2DWI A;  2HAU A;  4NF5 B;  4AS5 A;  4I5S A;  2GNO A;  2GH9 A;  4QFP A;  5DVJ A;  4ELR A;  4Q7J A;  3PFI A;  1IIT A;  3MPK A;  3TPA A;  2K9D A;  4HCY A;  4AQ4 A;  3ROJ A;  5IZZ A;  5ET8 A;  3KG2 A;  1FPJ A;  4R7G A;  1F9B A;  1XVX A;  5A2Q S;  2IEE A;  4H6D A;  1USY H;  4IO7 A;  4X04 A;  2Z4R A;  2Q89 A;  4F3B A;  1WXQ A;  2DWH A;  1AIP C;  3E78 A;  5KQD A;  3BIG A;  4LJ4 A;  4KI0 E;  3IOV A;  3TMG A;  3ILU B;  1BP5 A;  4NF8 A;  3IO4 A;  4JXJ A;  3C3D A;  4AKG A;  2C9O A;  2RC9 A;  3OEK A;  2Q2C A;  5EQ7 A;  2DEN A;  1DO0 A;  1GL6 A;  4AZF A;  2Z4S A;  4ELO A;  3BBZ A;  2QZ4 A;  1RYX A;  4B7H A;  1SI1 A;  3VKG A;  2VDB B;  3HJQ A;  4RF0 A;  5TPA A;  2LVQ D;  2O7I A;  4DCY A;  5KPT A;  3S9N C;  3FRI A;  2I48 A;  4N07 A;  4B3M M;  1H76 A;  3PVS A;  2XXQ A;  1G4A E;  2V1C A;  4FWG A;  1JEU A;  3PU5 A;  4H5G A;  4RPO A;  3VV5 A;  1LBW A;  1TGU A;  2WBD A;  1YPN A;  2QS2 A;  3BFU A;  2EUC A;  3GLF E;  3HKP A;  3SZP A;  3U6P A;  5CC2 A;  3SAV A;  1WVJ A;  1R1N A;  1FQA A;  5AA4 B;  8CAT A;  2QP9 X;  3AV0 A;  3DFZ A;  1Y20 A;  4QHQ A;  4K3F A;  2REJ A;  3TTN A;  1X37 A;  3B7D A;  2QVR A;  2XX7 A;  5JTY A;  3N5L A;  5IM2 A;  2O51 A;  2R9J A;  2VOZ A;  3VK8 A;  1QVR A;  1HT2 E;  3U6O A;  3C32 A;  4F1U A;  3JZJ A;  3FYD A;  1QUT A;  3OD7 A;  4JI3 M;  5ET7 A;  4KO8 A;  4YB5 A;  4MIJ A;  4PT5 A;  2XD2 A;  2KA6 B;  5EYH A;  1ZLQ A;  2R18 A;  4BLC A;  2XXY A;  3DP8 A;  2XZU A;  3UN6 A;  3IO6 A;  1R9Q A;  4OER A;  2Q8J A;  2Y7P A;  1NV1 A;  1MQG A;  4HW8 A;  2Q2E B;  2PVU A;  5KO3 A;  1TT1 A;  3C35 A;  5FTN A;  3GYY A;  2VQE M;  2VHA A;  1JW4 A;  2Y0T A;  1ANF A;  3KC0 A;  1WGL A;  2V84 A;  3IOR A;  4YKJ A;  3FVN A;  1ZIU A;  4H0W A;  3AKZ A;  3AJI B;  4ONY A;  3JAM S;  3T1H M;  3EIH A;  4PDG A;  4B7G A;  1MX0 A;  1XT8 A;  3DM0 A;  3OO7 A;  3RPL A;  3UA8 A;  4UAC A;  4G68 B;  4OFO A;  4GIZ A;  4EXK A;  1NH8 A;  4F1Y A;  4D81 A;  3GLF A;  1NFT A;  2CEY A;  3SAS A;  3MC2 A;  4TOZ A;  4JWY A;  4ELP A;  3M3F A;  1B05 A;  2MGW A;  2ZYN A;  3OOA A;  4ESX A;  3FAT A;  1PB9 A;  1L8Q A;  1EYK A;  2DHY A;  3E79 A;  2ZBK B;  3HHF A;  3HST A;  3LV0 A;  5I2K A;  4DLD A;  1OFH A;  1NV3 A;  1RDY A;  3Q26 A;  1AL3 A;  1ZV1 A;  5IWA M;  1OLC A;  3VE1 B;  4F31 B;  3K2D A;  5EP1 A;  3GQ4 A;  4IBJ A;  1EIJ A;  1NNP A;  2PFZ A;  3N26 A;  4FIM A;  2V6Z M;  2L7H A;  4B3R M;  2PMS A;  2HAK A;  4GL0 A;  1J5E M;  1MDP 1;  2WX9 A;  2DS9 A;  4LJ5 A;  1MG1 A;  2XX9 A;  5T3J A;  1MXX A;  3E9S A;  1OFI A;  2JWS A;  2XXK A;  2BWE A;  3SEX A;  3H6U A;  1A40 A;  3BBR A;  3KS4 A;  1DGH A;  5JTY B;  2JXN A;  4M0W A;  1FPI A;  2DWZ B;  4R3D A;  2OLB A;  4KYS A;  1T3T A;  3TTL A;  4HCW A;  2JJK A;  3VDU A;  4NF6 A;  3LSX A;  1JR3 D;  5I2K B;  5L9S A;  3L27 A;  2D3I A;  3QUF A;  3CFL A;  2H98 A;  1OVB A;  2ZAM A;  1K9Z A;  4DI4 B;  1NV6 A;  1T6O A;  2Z22 A;  3OXN A;  3MP6 A;  4P47 A;  4LUB A;  4WED A;  3T93 B;  3FJ7 A;  3T38 A;  3A45 A;  4F19 A;  5JEI A;  1ELJ A;  2DZN B;  4N8G A;  2Z7J A;  1HSE A;  3QAU A;  1N04 A;  3MHV C;  4H8I A;  1NY6 A;  1WOD A;  2WEF A;  4U4X A;  3CR9 A;  5DNY A;  3FJM A;  4MH0 E;  5K2X A;  4RY1 A;  3LSF B;  1TXF A;  4WW0 A;  1URD A;  5I56 A;  1SD3 A;  4PDH A;  1S50 A;  5EXS A;  1PJJ A;  2R45 A;  5CMC A;  2DNA A;  4LGM A;  1LAX A;  4JYA M;  3OSQ A;  3UOR A;  3SEW A;  2R62 A;  1SDX A;  2MRO B;  2NWJ A;  2OWS A;  5H37 D;  3ZS6 A;  4AG6 A;  3KFM A;  5ET6 A;  4PDI A;  5DFL A;  2M5Z A;  3TWK A;  4OFL A;  2QVU A;  3H6V A;  3U5Z B;  1DGG A;  3JR4 A;  2HZL A;  3GQ5 A;  4MH5 A;  1LBC A;  2I7N A;  3C9P A;  4F18 A;  1B6H A;  1FTJ A;  4GXA A;  4IJF A;  2QPA A;  3C9H A;  5DT6 A;  3CVG A;  4JI4 M;  4XKN A;  3MVW A;  1B4H A;  1HNW M;  2A5T A;  5EQ8 A;  4HE0 A;  2R6F A;  3K1M A;  3BFT A;  1CNQ A;  4ANR A;  3C34 A;  1N32 M;  4C0R A;  3J7A S;  2QCU A;  5CMB A;  2V3U A;  5EP4 A;  1P1W A;  3A09 A;  2A5S A;  1EZ9 A;  2G5G X;  4NXN M;  1J1N A;  3U94 A;  4ZE8 A;  4FJP A;  2V4C A;  3PGF A;  4II7 A;  4F2Q A;  2M8C A;  3TCF A;  1GVN A;  1ZMV A;  4PET A;  1QVS A;  5I2N B;  3ZSF A;  3IFC A;  4GX3 A;  3FXQ A;  4KPT A;  1HR0 M;  2FA7 A;  2JUJ A;  3V89 B;  2F3B A;  3VKH A;  3RLF E;  4ZED A;  3LVW A;  2LH0 A;  2HL7 A;  2UXC M;  3E46 A;  2GQ1 A;  4XIG Q;  2CHV A;  1IXR C;  1NNJ A;  4RKU F;  4BDQ A;  1H3D A;  4OVT A;  1HJP A;  2ZAN A;  4FVM A;  3FUX A;  4JSO A;  4FOR A;  4Z7E A;  3H03 A;  4UA8 A;  3CFX A;  3P7I A;  5TP9 A;  2H9B A;  5BWJ A;  5CMK A;  4OMB A;  5IAI A;  3LCV B;  1IM2 A;  3GLG B;  2DE4 A;  3PPR A;  2P3V A;  3GPU A;  2KRU A;  4PCZ A;  1JW5 A;  3TEL A;  4XKQ A;  3QMF A;  5H8Q A;  5KPR A;  2X8A A;  2WSF F;  2ZNS A;  3G3J A;  5ITY A;  4F39 A;  3KOW E;  2WKY A;  1B3L A;  1LAF E;  4RK9 A;  4WKM A;  3KOZ E;  4FBP A;  4MGZ E;  1XHB A;  2JY6 B;  4NC6 A;  2I6E A;  1G3I A;  4G4P A;  3K00 A;  4FEC A;  2OK2 A;  2G3Q A;  4G4R A;  2B3B A;  2ERC A;  1NKX A;  2FVZ A;  3Q8X A;  4X1D A;  3ECR A;  2K6B A;  4LJ9 A;  1FQF A;  5I3S A;  4LJ8 A;  1QAQ A;  3PUX E;  4Q0C A;  2F7C A;  3KDS E;  4NSO B;  4GQO A;  4I3Y A;  1Y8G A;  1IXC A;  4FCW A;  1FPL A;  5KDT B;  3H4Z A;  3Q27 A;  3SEV A;  4JI2 M;  5I59 A;  3FE3 A;  3MVX A;  4R2B A;  4DR6 M;  3U6Q A;  5L9O A;  3C58 A;  4P1L A;  1FJ9 A;  4YHH M;  1A8E A;  3DP4 A;  2DWA A;  5LDZ A;  2KDL A;  5EHS A;  4BDR A;  1A7L A;  4H5F A;  3I4V A;  2QFL A;  3IJO B;  4MBP A;  1IN6 A;  3B74 A;  4PCD A;  4X9T A;  1AMF A;  1SBP A;  2OPF A;  4GF8 A;  4Q8R A;  3LQR A;  1R2Y A;  4N6D A;  4QBA A;  1MY1 A;  1CUK A;  2Q2A A;  3IB2 A;  1LCT A;  2RGO A;  2CMO A;  1SXJ D;  4M9Z A;  3J81 S;  4PP0 A;  2BWB A;  4A3V B;  4EDP A;  1G71 A;  3R6U A;  1TH4 A;  5H8F A;  3GRV A;  1PJT A;  1FBE A;  1QUJ A;  3CFZ A;  1VEJ A;  3B6W A;  3V76 A;  1OKS A;  5A5X B;  3KOS A;  1WIV A;  3OTO M;  1R2Z A;  1FBG A;  3ILK A;  3CRB A;  1CB6 A;  2XA5 A;  4LZZ A;  1R7R A;  4GWU A;  3DZD A;  4EUO A;  4KOD A;  4YMB A;  3TWL A;  2OWT A;  2L7I A;  2WSE F;  4I8C A;  5LMN M;  4GBW A;  1BK4 A;  4GX4 A;  4ISU A;  4G61 A;  1SXJ A;  1N3X A;  3K6W A;  2LVA A;  1FTA A;  2LVO C;  2KLF A;  1OIB A;  3EIE A;  1UIV A;  2G93 A;  2XHD A;  1V34 A;  3TQL A;  3O6G A;  4G2Z A;  4LCB A;  3GLI E;  4KCD A;  5DYH A;  3GRU A;  2UUC M;  3SFZ A;  4L6V 6;  3S9L C;  2CZH A;  5BR8 M;  2MJ5 B;  3FUT A;  3RQT A;  1N77 A;  2DAG A;  1RU3 A;  1IBL M;  3IB0 A;  3UK4 A;  4F3P A;  1L2C A;  4ZS9 A;  2X7Q A;  1E94 E;  1Q35 A;  4N15 A;  1XXH A;  2QVV A;  1NNF A;  2RIN A;  4O7M A;  3VLV A;  3W68 A;  4L16 A;  4I8O A;  4IR8 A;  3E21 A;  1OTR A;  4ZE9 A;  1UM8 A;  3M7G A;  1IMD A;  4GWY A;  2KQZ A;  1XMO M;  3ILT B;  2HAV A;  3H6W A;  3ZQJ A;  1MXU A;  2R46 A;  4GMQ A;  3SES A;  4AB6 A;  1NUY A;  3CF6 E;  3HN0 A;  4TQU Q;  4NL4 H;  4JN6 A;  5DEX B;  4F2O A;  3GRY A;  3HWS A;  1MN3 A;  2R65 A;  4BDO A;  1DTZ A;  4HTG A;  3USD A;  2P2A A;  3FTD A;  2Z23 A;  1LFH A;  3J2P B;  1OLA A;  5M2V A;  4M0D A;  1E32 A;  2C99 A;  1SYI A;  1XI6 A;  2UU9 M;  2REG A;  1FTL A;  1VDW A;  4NQ8 A;  3K6V A;  4TUW A;  4NED A;  1IXI A;  3PUV E;  4PAF A;  1NUX A;  4NN3 A;  3OO6 A;  4I81 A;  2GQF A;  1LCF A;  2XEP A;  3L28 A;  2I0B A;  2PX1 A;  4M9S A;  3KN3 A;  4N8Y A;  3A29 A;  2XSZ A;  3QXM A;  2H5Y A;  2A5Y B;  4U1O A;  4DIG A;  4HE1 A;  2RKM A;  3Q25 A;  5I57 B;  1SW4 A;  1IN7 A;  2XF3 A;  5ITQ A;  2UYF A;  1B5J A;  1MM7 A;  5I7I A;  1I6A A;  1XC1 A;  3M8U A;  4GWX A;  4JI1 M;  3A42 A;  1OQH A;  3K6X A;  4PTK A;  3RN8 A;  3LW5 F;  4OHN A;  1NMU A;  3I5O A;  5EYG A;  4LJ6 A;  1O64 A;  1Q3B A;  1N36 M;  1DBZ A;  4HXV A;  3GBA A;  3SYL A;  1LBV A;  2KNV A;  5C1B A;  3GPP A;  1P1O A;  2P0S A;  3T6P A;  2MH8 A;  1ORY B;  2DWM A;  5ITX E;  3TPZ A;  5H8F B;  3Q28 A;  2IA4 A;  4DR1 M;  1FRP A;  2CUZ A;  3PD8 A;  2DXI A;  4P0G A;  2JNH A;  4EQB A;  2YJP A;  5KDT A;  1LTM A;  4PGP A;  4ND9 A;  4KYE A;  3IOT A;  4PQJ A;  3R26 A;  5FSW A;  1UTB A;  2FE8 A;  3M3K A;  4Y28 F;  3UP9 A;  1JET A;  5H8N B;  3FUZ A;  3QWL A;  4XK8 F;  1JQF A;  2BJW A;  1GTK A;  1NV4 A;  1GVC A;  4BDL A;  1N34 M;  4IBE A;  1MXW A;  4WXJ A;  2HHM A;  2X49 A;  3S9E A;  3V83 A;  1MXY A;  2FIX A;  2ESN A;  2ONS A;  2EJS A;  1QYR A;  3RT8 A;  3WAE A;  4G4O A;  1SQY A;  1FTM A;  4M9X A;  4F29 A;  5DEX A;  3TE6 A;  3KS8 A;  1F4I A;  5L8D A;  1QAO A;  5ITX A;  1LAH E;  3EKI A;  2C96 A;  4GHA A;  3H7M A;  5H8H B;  2O6A A;  3E4R A;  3OEN A;  4QRZ A;  3HPI A;  2CV0 A;  3H06 B;  3TWM A;  1LBX A;  4F3S A;  2B3T A;  2EA0 A;  3THG A;  1W5S A;  1FQC A;  2K47 A;  2W7Y A;  1B58 A;  3MP8 A;  1B5H A;  3B89 A;  1MY3 A;  2O84 X;  1VE4 A;  1EZO A;  5IGA A;  4P56 A;  3K92 A;  3KFU G;  3HU2 A;  3HJS A;  1XB2 B;  2UVG A;  4X64 M;  5IRE B;  3MYU A;  1NHW C;  2Y7W A;  3F92 A;  2F6P A;  4BDN A;  3A98 B;  3KP1 E;  1SXJ B;  2CFO A;  4IIW A;  4YB6 A;  4QXD A;  2RGH A;  2ZAO A;  1I69 A;  5H8N A;  4GOT A;  1FCK A;  1B0H A;  4R9F A;  2VQF M;  3PUY E;  2L5V A;  2W82 A;  4QHT A;  4DDD A;  3EF7 A;  4POX A;  1NV8 A;  2YFQ A;  3M3L A;  3FVG A;  1FQD A;  1JR3 E;  3RY3 A;  4LFC M;  1SW1 A;  3C33 A;  4NGU A;  1US4 A;  3J27 B;  4JI7 M;  1QW0 A;  3GLI B;  3V8X B;  2DWN A;  4NE4 A;  1GV8 A;  1DGB A;  1M5E A;  3KBR A;  1H43 A;  1J09 A;  1B2H A;  1M5D A;  5AA1 A;  2FOI C;  5FLX S;  2ANJ A;  1IQP A;  3TKD A;  5IZ3 B;  3E9X A;  4GBV A;  1IBM M;  1XXH E;  4IBC A;  3SBJ A;  3IB1 A;  1B40 A;  3ODB A;  3VLU A;  3GP1 A;  3GLH B;  1IMF A;  2XX8 A;  4IO3 A;  4QFN A;  4PFB A;  1RDX A;  2FNC A;  4XEQ A;  5EXP A;  2FHY A;  5KQ8 A;  3RUM A;  1YUB A;  2O7U A;  3D4G A;  3EHU A;  2QBY B;  3IR1 A;  4NF0 A;  3C3E A;  3CF2 A;  3GLI A;  3S2V A;  5JI2 E;  1GJS A;  3U60 A;  3O66 A;  2RCB A;  4QOS A;  1TR8 A;  5FTL A;  3G3F A;  4QNR A;  3FUV A;  1SW5 A;  4Z0I A;  1XMQ M;  3JV9 A;  4I40 A;  3M6A A;  1HSL A;  5KPZ A;  3JYR A;  1SXJ E;  2DAM A;  2AIX A;  3FKE A;  1IXH A;  1SVX B;  1B4Z A;  4AG5 A;  2Q74 A;  1Q9D A;  2EKK A;  3T15 A;  3HO7 A;  4DV1 M;  1G41 A;  4L15 A;  1DO2 A;  1QDT A;  1LV7 A;  1R6B X;  5TU0 A;  1KYI A;  1G59 A;  2HQ0 A;  3RGS A;  4G4Q A;  1A5T A;  2Y84 A;  3IFA A;  3LR1 A;  1KWH A;  3EHS A;  2Y21 A;  3FXB A;  1TF0 B;  3TQS A;  5E26 A;  5EYF A;  1YSY A;  1PJS A;  1QJM A;  4DXU A;  3CSB A;  2OX3 A;  4GWS A;  4IBF A;  4TLM B;  4FD2 A;  2Y5L A;  3FV1 A;  5L8R F;  2I4B A;  2F6G A;  1N0T A;  1B7Z A;  3O97 A;  4X62 M;  1H44 A;  1CE2 A;  1YXI A;  2E1S A;  1ZMU A;  5L9M A;  2RKO A;  3RPL B;  4DV5 M;  1M5C A;  1DTG A;  4QSD A;  1Z6T A;  4GHL A;  4NF4 B;  2UVJ A;  1T43 A;  2Q8M A;  3NWL A;  1OAI A;  4IO4 A;  1PEB A;  5H8S A;  4U4S A;  3TOD A;  1XC8 A;  1WJ7 A;  1TH2 A;  5K2Y A;  3U5Z A;  1PB8 A;  3GLH A;  3GBB A;  4KXP A;  4B3S M;  1NI9 A;  5DYI A;  1URG A;  2C5R A;  1D3K A;  1I94 M;  1Z7N E;  3T9H B;  5FTM A;  4XBO A;  4KQP A;  4GRK A;  1IXS B;  1USY E;  3KVW A;  4LJA A;  1FTK A;  3FTF A;  3NBI A;  3IHP A;  1PJI A;  3AXF A;  2QMX A;  4IY6 A;  2KHH A;  3KSX A;  2QRY A;  3G3H A;  4N6K A;  5ICQ A;  3KOX E;  4NWC A;  3WAF A;  1MU5 A;  5AA2 A;  2ALU A;  1FNN A;  1EE8 A;  4P16 A;  4XTC Q;  4AQY M;  3U65 A;  4IBK A;  4H45 A;  2LVP C;  3THI A;  1QKA A;  1JVX A;  1NV5 A;  4BDM A;  4EQ9 A;  4ZEB A;  2JP7 A;  4DV7 M;  1MRP A;  1DGH B;  4OVJ A;  1GR2 A;  2B4M A;  1GKI A;  3EPE A;  1VQ1 A;  4GC9 A;  1MS7 A;  4ZEF A;  4P8B A;  3PUZ E;  2XD3 A;  4CGY B;  1LFG A;  2P3N A;  3PV0 E;  4B3T M;  4DE8 A;  1AIV A;  3GXA A;  3PMV A;  3PPO A;  1ZQ9 A;  4LF8 M;  4JI8 M;  4H1X A;  3IAZ A;  1NUW A;  2Z3X A;  3N6U A;  4UN2 B;  4KFQ A;  3TYH A;  4Z6Y A;  4NXM M;  4WP2 A;  3J80 S;  2CZL A;  4OTE A;  4R75 A;  3KP0 E;  2FBP A;  3G3I A;  2JY7 A;  3SMP A;  3TZA A;  4UAB A;  3H4J A;  1FQE A;  5F3W A;  3K9O A;  1KA0 A;  4QOZ C;  3B8B A;  3Q29 A;  3HCQ A;  4LRS A;  2CZI A;  3FAS A;  5I58 B;  1PRB A;  1P1N A;  3OEL A;  4XKP A;  2L4E A;  1PDA A;  2V3Q A;  3EHT A;  4AS4 A;  2NQ8 C;  3AOG A;  3R9X B;  1FBP A;  1JNF A;  3T9X B;  2CP8 A;  4H67 A;  3HU3 A;  5ET5 A;  2KNZ A;  3KW6 A;  4DUY M;  4OZ9 A;  2PFY A;  3CGW A;  1GAB A;  1YAE A;  2C98 A;  3BKI B;  1AUA A;  1NH7 A;  2X4A A;  5F24 A;  1AOV A;  2R0I A;  3AL0 C;  3FZV A;  4GRI A;  5FHN A;  1V33 A;  2F8D A;  4RYA A;  4NF6 B;  2Z8Y M;  4HEO A;  1EU8 A;  3MST A;  1Q02 A;  3GLF B;  1TDH A;  4LG2 A;  1FSA A;  3O6H A;  2LVN C;  4AI6 A;  4OAN A;  3SDF A;  1FBH A;  2DZO B;  3K0V A;  4IGR A;  2CRU A;  2DKL A;  1ATG A;  2L2D A;  1QUK A;  3GLB A;  3GRR A;  1NO1 A;  1MDQ A;  3HHW A;  2F4V M;  4JV5 M;  1NV9 A;  4Z8X A;  5KCJ A;  4DR7 M;  1VSO A;  2PCR A;  1P99 A;  2VII A;  3FUU A;  2RC7 A;  2UXD M;  1PC3 A;  3RT6 B;  3BXW A;  3PPQ A;  4QF9 A;  3OSR A;  3VXC A;  5TP9 B;  3MBP A;  1GGG A;  1HQC A;  4F3G A;  4MHF A;  4R6Y A;  2ABH A;  4L8R C;  2ZNT A;  1IBK M;  2F5X A;  2GHA A;  5IZ3 A;  5HM4 B;  4MNC A;  3VDF A;  3L25 A;  1KSF X;  3FUW A;  4CIZ A;  4QHS A;  3U72 A;  3AOE A;  3QYE A;  4PAK A;  3W0F A;  1MY0 A;  1D0M A;  1NHG C;  1UIU A;  4CHT B;  3K4U A;  4X66 M;  2HZK A;  3TTR A;  2OCU A;  1JB0 F;  4CIS A;  3L6G A;  4MGI E;  3FD9 A;  1NNK A;  3AOE C;  4HE2 A;  3H6T A;  3CHG A;  3HZJ A;  4CJ6 A;  1TFA A;  1J7K A;  2XWO A;  3S4U A;  4C1T A;  5CMM A;  4TLL B;  3SAU A;  4P11 A;  3FYC A;  3IG8 A;  2O25 A;  4GFR A;  2J5Y A;  2XXX A;  3KJ7 A;  2OZZ A;  4IO6 A;  4LQ5 A;  4DR5 M;  3EQ1 A;  4O7I A;  1G8P A;  2V1U A;  2WYK A;  4KLN A;  4OX9 M;  4NMY A;  4P17 A;  1IMB A;  4PF8 A;  2DI0 A;  4XKR A;  1TWY A;  1B7H A;  4PFU A;  1D0K A;  4R74 A;  2PYY A;  2A5T B;  4Q30 B;  2AYS A;  3E3K A;  2L6O A;  4HL4 A;  4Q5T A;  1IY1 A;  1L1T A;  2F7A A;  2CV2 A;  2OOA A;  5EQA A;  3FRH A;  1B7U A;  3FJG A;  4N6P A;  4PAI A;  2F5N A;  4NX1 A;  3M0E A;  4GX6 A;  4RF1 A;  1Z5C A;  3BOS A;  4DXB A;  3MVZ A;  3ZH9 B;  5H8H A;  4G6Z A;  4XF5 A;  4FE8 A;  4EF1 A;  4EIW A;  2UYE A;  3L29 A;  2NUV A;  4K0K M;  1XS5 A;  1ZAE A;  1WDN A;  4OW0 A;  1N84 A;  4KYD A;  4KHP M;  5A5L A;  4OVR A;  2CE7 A;  4H8J A;  2PT1 A;  4F22 A;  5C18 A;  2CWB A;  1FPK A;  4YKK A;  4JWX A;  4N91 A;  2O1L A;  3SKP A;  1A55 A;  1XVY A;  2V93 A;  2XFT A;  1JP4 A;  3MZ9 A;  2R44 A;  3HHY A;  4OEV A;  1IMA A;  3TEP A;  1LGB C;  1LEV A;  5DYG A;  1IUD A;  1ZU0 A;  1R5L A;  1DOT A;  3TL4 X;  3U6D A;  3FXR A;  4JVC A;  4NF4 A;  5IT9 S;  3LQQ A;  2UXA A;  4YU0 A;  2JZ1 A;  1SW2 A;  1YCJ A;  2DE3 A;  3QUJ A;  4IBD A;  1Y4C A;  3A3C A;  1M5F A;  3K01 A;  1BKA A;  1L2B A;  3B6Q A;  3FD3 A;  3ZKK A;  1C1K A;  3QK6 A;  3VFJ A;  1L2D A;  4ITQ A;  2C9C A;  1B46 A;  1Y9U A;  4KCC A;  4FW9 A;  2F78 A;  5EXX A;  1LLS A;  3WHK A;  1A54 A;  3Q8G A;  2APL A;  3L26 A;  1ZBM A;  1GL7 A;  2QS4 A;  2RCA A;  2UXB M;  1IZ1 A;  1NVM A;  2Y20 A;  2CZK A;  2O1M A;  3UIF A;  4IBI A;  4ELQ A;  3U6L A;  3TTK A;  1M5B A;  1MY2 A;  4GC5 A;  3T22 A;  3DA1 A;  4F1I A;  5AA3 A;  2M60 A;  2H5X A;  3A46 A;  2O5R A;  2ZZX A;  3GPY A;  5I56 B;  4DCX A;  1H45 A;  3TDJ A;  5ITO A;  2R4E A;  4YZZ A;  2XWV A;  4FWD A;  4MJO A;  5TPA B;  1FPB A;  4PE5 B;  5IKB A;  2N35 A;  4G8H A;  2LHG A;  3B7N A;  1KFV A;  3QAX A;  1BTJ A;  5F7V A;  1S3S A;  3PXG A;  3DEL B;  1XWI A;  1K3W A;  3TCH A;  4FCT A;  2QQ8 A;  4LGY A;  1ZKB A;  2DDK A;  5BUU A;  2BJJ X;  4NAP A;  2UUB M;  2XWI A;  2QHO B;  1II5 A;  2F97 A;  4XXU A;  5EP3 A;  5B70 A;  4DR2 M;  3KC1 A;  3W9W A;  5ELV A;  1UTH B;  1GJT A;  1B3G A;  4NTL A;  2BJI A;  4LFA M;  3E13 X;  5DW8 A;  4DBG B;  1TH3 A;  1NV2 A;  4FEB A;  2YR0 A;  1B5I A;  1ZJL A;  5FHO A;  3KJT A;  3UGJ A;  1OAO C;  1S7Y A;  2HCA A;  4R73 A;  2QNJ A;  3U61 B;  3U60 B;  4YB7 A;  2KZU A;  3I3V A;  1YE9 A;  1N7W A;  2D7H A;  2FH0 A;  1QUI A;  3VDP A;  3VFD A;  2Q9T A;  3VLF B;  1E9R A;  4LP2 B;  3N94 A;  1AWB A;  2VP1 A;  2F5P A;  4O3B A;  2DOJ A;  3G7W A;  4R72 A;  2VD2 A;  4NRW A;  5CRY A;  3HU1 A;  1DMB A;  1Z7M E;  1NNT A;  4JBZ A;  1DPE A;  1PBP A;  2V3T A;  2QEN A;  1SYH A;  4LN5 A;  4P9K A;  2DVZ A;  4EF2 A;  3L6H A;  3K1P A;  3PTY A;  2LBC A;  2B4L A;  1EYI A;  1MJG M;  2HXW A;  3MP1 A;  4PD2 A;  5AE4 A;  2HPG A;  1B1X A;  2FNA A;  3HX3 A;  1N75 A;  1LAG E;  2QS1 A;  1SXJ C;  3U61 A;  3PNY A;  2DWJ A;  1MPC A;  3B6T A;  1US5 A;  1SG9 A;  2H25 A;  3H4M A;  2DE2 A;  3C4M A;  5I2N A;  4MNI A;  4O3C A;  1VFE A;  1T0K A;  2P1S A;  1TTE A;  3R8F A;  3VVD A;  3A3U A;  3RGY A;  2HWJ A;  3I01 M;  4D82 A;  2D21 A;  1YTV A;  4JB7 A;  4NWD A;  4NHB A;  4DZ1 A;  4MLQ A;  3W9V A;  1POT A;  2DQV A;  3IJX B;  4OQO A;  1E9S A;  5BPV A;  4U22 A;  1JEV A;  4PFT A;  1A99 A;  2QSF X;  2I58 A;  4DR4 M;  2X26 A;  1A8F A;  2JZ0 A;  2QPQ A;  2JA2 A;  3PD9 A;  1VFD A;  1W5T A;  5ITP A;  1IIW A;  1YYZ A;  1JVY A;  2RC8 A;  2LXE A;  2I0C A;  2F5O A;  3LBS A;  2ZTD A;  4RXL A;  4NG7 A;  3SEU A;  2VGQ A;  3O2A A;  1R6Z A;  2THI A;  4N81 A;  5AA2 B;  3SAT A;  2LAO A;  1Y1M A;  3RTF B;  2OQ4 A;  2QBY A;  3QIM A;  4ZEK A;  4RNA A;  3CG3 A;  2HEU A;  1B3F A;  2R8T A;  3LC8 A;  4R6H A;  1BIY A;  5ISU A;  2MKZ A;  3U8Q A;  4NF5 A;  1IN5 A;  1B3H A;  4O94 A;  1XOC A;  2XH9 A;  1Z5A A;  1XHY A;  5FTH A;  4GEW A;  1O7T A;  4LVQ A;  2K0B X;  5AA4 A;  2FS1 A;  3MK6 A;  2ZYM A;  5KCJ B;  4GH9 A;  3SER A;  3J7B A;  1PB7 A;  3KN7 A;  1YZ0 A;  3CTW B;  4QNM A;  1FBD A;  4R9G A;  4W5W A;  2QMW A;  4GD5 A;  4OEU A;  3HFU A;  4IBB A;  3MPL A;  5FTJ A;  4G68 C;  1LBZ A;  4BLA A;  1Z5B A;  4ZDM A;  2Y7K A;  3LSL A;  4MX6 A;  2QS3 A;  4KHZ E;  1GLN A;  5I58 A;  1IEJ A;  4AKH A;  1R4G A;  1IN8 A;  4U23 A;  2UVI A;  1LST A;  4EXL A;  4GLI A;  4AW4 A;  4GKK M;  2XXT A;  3KSJ A;  3U6C A;  4JXI A;  2R4J A;  4ZZE A;  1LFI A;  2F36 A;  2DP8 A;  1D9Q A;  3CIJ A;  1Y3N A;  2ZNU A;  4E0X A;  1B3E A;  2B65 A;  1C7Y A;  2JY8 A;  2DWL A;  4L17 A;  4RK2 A;  1L5T A;  2HXR A;  2VPO A;  3G3G A;  4GWW A;  4N4U A;  1PBQ A;  4QFO A;  3KOT A;  3WHL A;  2X7P A;  4RNS A;  2AHM A;  2QL3 A;  3VVF A;  3VXB A;  4B08 A;  1OQY A;  1B32 A;  1DPP A;  4RPN A;  4PFR A;  1QQW A;  3T1B A;  1JQJ C;  2NOO A;  3G3K A;  4DV6 M;  5ITU A;  1N3W A;  3O6I A;  3D8B A;  3K6U A;  4DV2 M;  2DVC A;  4E0W A;  5LOM A;  1FPF A;  4OYV A;  5JK4 A;  2ZTC A;  4F1V A;  3N6T A;  1IME A;  5CBR A;  1Z59 A;  3GPX A;  3SEY A;  1N7X A;  1MQH A;  4GIT A;  1POY 1;  2B3F A;  2OOB A;  4AKI A;  3W15 C;  3BIH A;  2I7P A;  1R9L A;  3B7Q A;  3DOA A;  3PNV A;  2Z8D A;  2BJV A;  1IXS A;  4ESW A;  3UMM A;  4IO5 A;  1MY4 A;  3T0J A;  1KZ8 A;  1FBC A;  1Q1K A;  1FPE A;  4FCV A;  1JW1 A;  1NL5 A;  2P5T A;  2Y7I A;  4N17 A;  4MB7 A;  1TFD A;  4X65 M;  2CEX A;  3TAJ A;  3TQW A;  3IG5 A;  3TCG A;  2VF7 A;  4RJZ A;  5HPQ A;  2YNM D;  3LUY A;  5DTB A;  1VEK A;  3GO8 A;  3VVE A;  1QUL A;  5FTI A;  3PPP A;  3LSW A;  2XXV A;  3T9U A;  4G8N A;  4P3L A;  2VF8 A;  3MJ5 A;  4LJ7 A;  4OA4 A;  3K2L A;  2CEA A;  1QZE A;  1MPB A;  1MQJ A;  4DV3 M;  3SHG B;  1NUZ A;  1UQW A;  5CI5 A;  3U6S A;  3HHZ A;  1LB9 A;  1IQ7 A;  4OVS A;  1QZM A;  3HY5 A;  3PMX A;  4M4G A;  4G4N A;  3TTM A;  4PC9 A;  4PBH A;  2DXY A;  3PMW A;  1NSF A;  4QFL A;  3GLH E;  1WR1 B;  1P1U A;  2YQZ A;  4YKP A;  3LVV A;  2LNH C;  3SAW A;  1QKB A;  4ZPX A;  2UUA M;  4QFK A;  2Y0Q A;  4P0I A;  2XXH A;  1MXV A;  4U2R A;  4MCO A;  4ZEC A;  4DV4 M;  1VDD A;  4LFB M;  3RTW B;  4G8M A;  3K9P A;  1I6B A;  5DVI A;  2L09 A;  4OWD A;  1QDR A;  2ZYK A;  2ZXT A;  4KR5 A;  4R6K A;  2JY5 A;  2O01 F;  3AFH A;  4IJE A;  4OET A;  1EH3 A;  1Q39 A;  2DHR A;  1K3X A;  1NY5 A;  1QUS A;  4IBG A;  3EN3 A;  3OEM A;  1FJ6 A;  1OMP A;  3VK7 A;  4P1E A;  1HQY E;  5ITT A;  3IEC A;  1ZTY A;  4GXS B;  4MAG A;  3U92 A;  3HHX A;  3MAM A;  2FIE A;  1EYJ A;  3LUZ A;  4XFE A;  4DV0 M;  2HHH M;  4MFI A;  3T9V A;  3KXE C;  3GLG E;  7CAT A;  1RKM A;  2ZZW A;  4BB9 A;  1XNQ M;  2XGN A;  3GLG A;  1L1Z A;  1VDL A;  4YY3 M;  5ITR A;  4OVP A;  4NRV A;  2WBB A;  3RYD A;  3IK6 B;  4QSC A;  4WUR A;  2LTU A;  4NF8 B;  1HSJ A;  2OJT A;  2Z8F A;  3H3G A;  3R7X A;  4LF6 M;  1K9Y A;  2NXO A;  1HNZ M;  1O63 A;  3LCU A;  1KA1 A;  1SI0 A;  3RPW A;  4LON B;  2XXW A;  4NSR A;  3DP6 A;  1MQI A;  4X48 A;  3T66 A;  4L4U A;  1DSN A;  3B7Z A;  4QSE A;  4JVD A;  3I4Y A;  1UTB B;  2H1R A;  4YMA A;  4B7F A;  4U21 A;  4I4L A;  2PBW A;  4H65 A;  1I4W A;  4G68 A;  1B52 A;  2I3V A;  3TUS A;  2E0S A;  1Y3P A;  1JR3 A;  2YLN A;  3ISP A;  3GQ3 A;  1NJG A;  5I59 B;  1URS A;  2V25 A;  2J7O A;  4JI0 M;  3FBP A;  4PFI A;  4AB5 A;  3JR5 A;  2DAI A;  5FBP A;  2E5L M;  2OBG A;  3ZCB B;  4BBA A;  3CF0 A;  2F5S A;  2DYX A;  1IMC A;  1MH4 A;  3O9P A;  4RA1 A;  1IXZ A;  2UVH A;  5CM6 A;  3RFW A;  1LBB A;  4THI A;  4MGH A;  2DAK A;  2DZL A;  4R71 A;  4OU7 A;  2F3D A;  3RNN A;  2DSF A;  5IZ1 A; 
#chains in the Genus database with same CATH homology
 4FWH A;  1H6U A;  4OVZ A;  1XXH B;  2HKJ A;  3LMM A;  3C36 A;  3CI8 A;  2ZMB A;  4ZEI A;  4LF5 M;  4GVO A;  5DVF A;  3K1J A;  4JWO A;  2I4C A;  3QYT A;  1N78 A;  3K8Z A;  2J7N A;  3L2A A;  1VR5 A;  2EO2 A;  3FV2 A;  4OFJ A;  4MM3 B;  3ONM A;  4I1D A;  3SHF A;  5EXT A;  4I62 A;  4N13 A;  2AL4 A;  1K82 A;  4LY6 A;  2O68 A;  3HGI A;  3FGS A;  3B9P A;  5F1Q A;  1I6Q A;  1PM5 A;  1OJL A;  1HT1 E;  3KEI A;  4LQ2 A;  3F11 A;  3O29 A;  3T1Y M;  2QJE A;  2XLJ A;  1IN4 A;  2GHB A;  3OMB A;  1D2N A;  3SYK A;  4KD5 A;  4YIC A;  4GIP A;  2R71 A;  4REZ A;  2LWX A;  2XFS A;  2Q88 A;  3RGP A;  1NNU C;  5A5X A;  5ICT A;  2XXU A;  3IOU A;  3DLN A;  4LZ5 A;  5LMU M;  5J1D A;  3I6V A;  5EQT A;  2D7G A;  1HNX M;  3K02 A;  4WEP A;  4GWO A;  2GRV A;  4PFY A;  3UZU A;  4FAJ A;  2I49 A;  2G8L A;  2ONK E;  2YPN A;  4IGT A;  3IX1 A;  4S12 A;  3D4C A;  5I84 A;  4R2F A;  1FQB A;  2H99 A;  2KEB A;  2XSZ D;  1RYO A;  3KN8 A;  4LAT A;  5FTK A;  3KZG A;  4DR3 M;  2R6G E;  4FED A;  1N76 A;  1TDZ A;  3D8L A;  1FW0 A;  5EJC A;  1B9J A;  5E6J A;  2ZYO A;  4OES A;  4JI5 M;  3KOY E;  1QAN A;  2GFE A;  1IY2 A;  2F34 A;  3PPN A;  1FTO A;  5H8Q B;  3KGC A;  1LB8 A;  3CSG A;  3UGW A;  4U1Z A;  2D5W A;  5EHM A;  1B0L A;  4G77 A;  2KW0 A;  3T96 B;  2KRK A;  4IB2 A;  4LRT A;  4OXV A;  3SC3 A;  3MZB A;  2FFJ A;  1S9T A;  4IO2 A;  1B1H A;  3HHG A;  2Y7R A;  3FTC A;  3MQ9 A;  1QAM A;  3C31 A;  4JDF A;  2ONR A;  4JSD A;  2F5Q A;  1MXZ A;  2KZS A;  1EZP A;  4C1U A;  3TFL A;  3IL1 B;  4OVZ B;  1UTH A;  3SET A;  3SAR A;  2NVU B;  3MZ1 A;  2CHG A;  2XXI A;  4NOO B;  2DVW B;  5AA2 D;  4POW A;  3U93 A;  1XNR M;  4EQ7 A;  5CBS A;  4LZJ A;  4O3A A;  3U6M A;  1MPD A;  3I51 A;  2CHQ A;  5GKN A;  3OO9 A;  2KXE A;  1OQG A;  2XZF A;  4DXC A;  5KZT A;  3S9M C;  3UK6 A;  4YKI A;  5B7D A;  2H4I A;  3IOW A;  1OVT A;  3FXU A;  4GL8 A;  4XGI A;  3O28 A;  3U6E A;  3FVO A;  1FJG M;  3K1N A;  4L78 A;  1MQD A;  4DUZ M;  1Y3Q A;  3MJN A;  3MWB A;  2QSX A;  3SMS A;  4LZ7 A;  1P1Q A;  2FYI A;  4HS7 A;  3HJ8 A;  4LZ8 A;  2XXP A;  4IY5 A;  1D9Y A;  2DXR A;  2I3W A;  4LF4 M;  1MM6 A;  4I9D A;  5EP2 A;  3FVK A;  5FHM A;  3U1O A;  1B51 A;  2CV1 A;  2AL5 A;  3FTE A;  4MLV A;  1Y4T A;  4X1B A;  2G29 A;  4M1V A;  1D9V A;  1ZMG A;  2RF1 A;  4OEN A;  2HFB A;  3MW0 A;  1MH3 A;  2D7E A;  2F7B A;  1N33 M;  2BNK A;  1AH5 A;  5I57 A;  4LF7 M;  4FAT A;  2VD3 A;  1D4N A;  3GZG A;  1DGF A;  2HCB A;  3HV1 A;  3ZKL A;  1IY0 A;  2F35 A;  5HBC A;  1BLF A;  4GKJ M;  3UJN A;  4YAH X;  1Q3C A;  3CG1 A;  1IXG A;  3VLW A;  5JI3 E;  3V5A A;  2ZM6 M;  3W0L B;  1Y1Z A;  3MUQ A;  4LF9 M;  3ZC7 B;  2PT2 A;  4MGK E;  5IZ7 D;  4PFW A;  4MF3 A;  3RE8 A;  3QSL A;  3FIR A;  4LA9 A;  4HLQ A;  4ZZA A;  2Z8E A;  2O69 A;  3OO8 A;  3MVY A;  3PUW E;  4ECF A;  4D80 A;  2XXR A;  1NJF A;  4MGY E;  4JI6 M;  2HAU A;  2DWI A;  4NF5 B;  4I5S A;  2GH9 A;  4QFP A;  5DVJ A;  4ELR A;  1IIT A;  3PFI A;  3MPK A;  3TPA A;  4HCY A;  4AQ4 A;  3KG2 A;  4R7G A;  1F9B A;  1XVX A;  5A2Q S;  2IEE A;  4H6D A;  1USY H;  4IO7 A;  2Z4R A;  2Q89 A;  4F3B A;  1WXQ A;  2DWH A;  5KQD A;  3TMG A;  4LJ4 A;  4KI0 E;  3IOV A;  3ILU B;  1BP5 A;  4NF8 A;  3IO4 A;  4JXJ A;  4AKG A;  2C9O A;  2RC9 A;  3OEK A;  2Q2C A;  1DO0 A;  1GL6 A;  4AZF A;  2Z4S A;  4ELO A;  2QZ4 A;  1RYX A;  4B7H A;  1SI1 A;  3VKG A;  3HJQ A;  4RF0 A;  5TPA A;  2O7I A;  4DCY A;  5KPT A;  3S9N C;  2I48 A;  4N07 A;  4B3M M;  1H76 A;  3PVS A;  2XXQ A;  1G4A E;  2V1C A;  4FWG A;  1JEU A;  3PU5 A;  4H5G A;  4RPO A;  3VV5 A;  1TGU A;  1YPN A;  2QS2 A;  3BFU A;  2EUC A;  3HKP A;  3U6P A;  5CC2 A;  3SAV A;  1WVJ A;  1R1N A;  1FQA A;  5AA4 B;  8CAT A;  2QP9 X;  3AV0 A;  3DFZ A;  1Y20 A;  4QHQ A;  4K3F A;  2REJ A;  3TTN A;  1X37 A;  3B7D A;  2XX7 A;  5JTY A;  3N5L A;  2O51 A;  2R9J A;  2VOZ A;  3VK8 A;  1QVR A;  1HT2 E;  3U6O A;  3C32 A;  4F1U A;  3JZJ A;  3FYD A;  3OD7 A;  4JI3 M;  4KO8 A;  4YB5 A;  4PT5 A;  2XD2 A;  2KA6 B;  1ZLQ A;  2R18 A;  4BLC A;  2XXY A;  3DP8 A;  2XZU A;  3UN6 A;  3IO6 A;  1R9Q A;  4OER A;  2Q8J A;  2Y7P A;  1MQG A;  4HW8 A;  2Q2E B;  2PVU A;  5KO3 A;  1TT1 A;  3C35 A;  5FTN A;  2VQE M;  2VHA A;  1JW4 A;  2Y0T A;  1ANF A;  2V84 A;  3IOR A;  4YKJ A;  3FVN A;  1ZIU A;  4H0W A;  3AKZ A;  3AJI B;  4ONY A;  3JAM S;  3T1H M;  3EIH A;  4PDG A;  4B7G A;  1MX0 A;  1XT8 A;  3DM0 A;  3OO7 A;  3UA8 A;  4UAC A;  4G68 B;  4OFO A;  4GIZ A;  4EXK A;  1NH8 A;  4F1Y A;  4D81 A;  3GLF A;  1NFT A;  3SAS A;  3MC2 A;  4TOZ A;  4JWY A;  4ELP A;  3M3F A;  1B05 A;  2ZYN A;  3OOA A;  4ESX A;  3FAT A;  1PB9 A;  1L8Q A;  3HHF A;  2ZBK B;  3HST A;  5I2K A;  4DLD A;  1OFH A;  3Q26 A;  1AL3 A;  5IWA M;  1OLC A;  3VE1 B;  4F31 B;  3K2D A;  5EP1 A;  3GQ4 A;  4IBJ A;  1NNP A;  3N26 A;  4FIM A;  2V6Z M;  2L7H A;  4B3R M;  2PMS A;  4GL0 A;  1J5E M;  1MDP 1;  2DS9 A;  4LJ5 A;  1MG1 A;  2XX9 A;  1MXX A;  3E9S A;  1OFI A;  3SEX A;  3H6U A;  1A40 A;  3BBR A;  3KS4 A;  1DGH A;  5JTY B;  4M0W A;  2DWZ B;  4R3D A;  2OLB A;  4KYS A;  1T3T A;  3TTL A;  4HCW A;  3VDU A;  4NF6 A;  3LSX A;  1JR3 D;  5I2K B;  5L9S A;  3L27 A;  2D3I A;  3QUF A;  3CFL A;  2H98 A;  1OVB A;  2ZAM A;  2Z22 A;  3OXN A;  3MP6 A;  4LUB A;  4WED A;  3T93 B;  3FJ7 A;  3T38 A;  3A45 A;  4F19 A;  5JEI A;  1ELJ A;  2DZN B;  2Z7J A;  1HSE A;  3QAU A;  1N04 A;  3MHV C;  4H8I A;  1NY6 A;  1WOD A;  4U4X A;  3CR9 A;  5DNY A;  3FJM A;  4MH0 E;  5K2X A;  4RY1 A;  3LSF B;  1TXF A;  4WW0 A;  1URD A;  5I56 A;  1SD3 A;  1S50 A;  5EXS A;  1PJJ A;  2R45 A;  5CMC A;  4LGM A;  1LAX A;  4JYA M;  3OSQ A;  3UOR A;  3SEW A;  2R62 A;  1SDX A;  2NWJ A;  2OWS A;  5H37 D;  3ZS6 A;  4AG6 A;  3KFM A;  4PDI A;  2M5Z A;  3TWK A;  4OFL A;  3H6V A;  3U5Z B;  1DGG A;  3JR4 A;  2HZL A;  3GQ5 A;  4MH5 A;  1LBC A;  2I7N A;  4F18 A;  1B6H A;  1FTJ A;  4GXA A;  4IJF A;  2QPA A;  3C9H A;  5DT6 A;  3CVG A;  4JI4 M;  4XKN A;  3MVW A;  1B4H A;  1HNW M;  2A5T A;  3K1M A;  3BFT A;  3C34 A;  1N32 M;  4C0R A;  3J7A S;  2QCU A;  5CMB A;  2V3U A;  5EP4 A;  1P1W A;  3A09 A;  2A5S A;  2G5G X;  1EZ9 A;  4NXN M;  1J1N A;  3U94 A;  4ZE8 A;  4FJP A;  3PGF A;  4II7 A;  4F2Q A;  2M8C A;  3TCF A;  1GVN A;  4PET A;  1QVS A;  5I2N B;  3ZSF A;  3FXQ A;  4KPT A;  1HR0 M;  2FA7 A;  3V89 B;  3VKH A;  3RLF E;  4ZED A;  3LVW A;  2LH0 A;  2HL7 A;  2UXC M;  4XIG Q;  2CHV A;  1IXR C;  1NNJ A;  4BDQ A;  1H3D A;  2ZAN A;  4FVM A;  3FUX A;  4JSO A;  4FOR A;  4Z7E A;  3H03 A;  4UA8 A;  3CFX A;  3P7I A;  5TP9 A;  2H9B A;  5BWJ A;  5CMK A;  4OMB A;  5IAI A;  1IM2 A;  3GLG B;  2DE4 A;  3PPR A;  3GPU A;  2KRU A;  4PCZ A;  1JW5 A;  3TEL A;  4XKQ A;  5H8Q A;  5KPR A;  2X8A A;  2ZNS A;  3G3J A;  5ITY A;  4F39 A;  3KOW E;  2WKY A;  1B3L A;  1LAF E;  4RK9 A;  4WKM A;  3KOZ E;  4MGZ E;  1XHB A;  2I6E A;  1G3I A;  4G4P A;  3K00 A;  4FEC A;  2OK2 A;  4G4R A;  2B3B A;  2ERC A;  1NKX A;  3Q8X A;  4X1D A;  3ECR A;  4LJ9 A;  1FQF A;  4LJ8 A;  1QAQ A;  3PUX E;  4Q0C A;  2F7C A;  3KDS E;  4NSO B;  4GQO A;  1IXC A;  4FCW A;  5KDT B;  3H4Z A;  3Q27 A;  3SEV A;  4JI2 M;  5I59 A;  3MVX A;  4R2B A;  4DR6 M;  3U6Q A;  5L9O A;  3C58 A;  4YHH M;  1A8E A;  3DP4 A;  2DWA A;  5EHS A;  4BDR A;  1A7L A;  4H5F A;  3I4V A;  3IJO B;  4MBP A;  1IN6 A;  4X9T A;  1AMF A;  1SBP A;  2OPF A;  4GF8 A;  4Q8R A;  3LQR A;  1R2Y A;  1MY1 A;  2Q2A A;  3IB2 A;  1LCT A;  2RGO A;  2CMO A;  1SXJ D;  4M9Z A;  3J81 S;  4PP0 A;  4A3V B;  4EDP A;  3R6U A;  1TH4 A;  5H8F A;  3GRV A;  1QUJ A;  3CFZ A;  3B6W A;  5A5X B;  3KOS A;  3OTO M;  1R2Z A;  3ILK A;  3CRB A;  1CB6 A;  4LZZ A;  1R7R A;  3DZD A;  4EUO A;  4KOD A;  4YMB A;  3TWL A;  2OWT A;  2L7I A;  4I8C A;  5LMN M;  4ISU A;  1SXJ A;  1N3X A;  3K6W A;  2KLF A;  1OIB A;  3EIE A;  1UIV A;  2G93 A;  2XHD A;  3TQL A;  3O6G A;  4G2Z A;  4LCB A;  5DYH A;  4KCD A;  3GRU A;  2UUC M;  3SFZ A;  3S9L C;  5BR8 M;  3FUT A;  3RQT A;  1N77 A;  1IBL M;  3IB0 A;  3UK4 A;  4F3P A;  1L2C A;  4ZS9 A;  2X7Q A;  1E94 E;  1Q35 A;  1XXH A;  1NNF A;  2RIN A;  3VLV A;  4L16 A;  4I8O A;  4ZE9 A;  1UM8 A;  3M7G A;  1XMO M;  3ILT B;  2HAV A;  3H6W A;  1MXU A;  2R46 A;  4GMQ A;  3SES A;  4AB6 A;  3CF6 E;  3HN0 A;  4TQU Q;  4NL4 H;  4JN6 A;  5DEX B;  4F2O A;  3GRY A;  3HWS A;  2R65 A;  4BDO A;  1DTZ A;  4HTG A;  3USD A;  2Z23 A;  3FTD A;  2P2A A;  1LFH A;  3J2P B;  1OLA A;  5M2V A;  4M0D A;  1E32 A;  2C99 A;  1SYI A;  2UU9 M;  2REG A;  1FTL A;  3K6V A;  4TUW A;  4NED A;  1IXI A;  3PUV E;  3OO6 A;  4I81 A;  1LCF A;  2I0B A;  2XEP A;  3L28 A;  2PX1 A;  4M9S A;  3KN3 A;  2XSZ A;  3QXM A;  2H5Y A;  2A5Y B;  4U1O A;  4DIG A;  2RKM A;  3Q25 A;  5I57 B;  1SW4 A;  1IN7 A;  2XF3 A;  5ITQ A;  2UYF A;  1B5J A;  1MM7 A;  1I6A A;  1XC1 A;  3M8U A;  4JI1 M;  3A42 A;  1OQH A;  3K6X A;  3RN8 A;  4OHN A;  1NMU A;  3I5O A;  4LJ6 A;  1O64 A;  1Q3B A;  1N36 M;  3GBA A;  3SYL A;  5C1B A;  3GPP A;  1P1O A;  2P0S A;  1ORY B;  2DWM A;  5ITX E;  3TPZ A;  5H8F B;  3Q28 A;  2IA4 A;  4DR1 M;  2CUZ A;  3PD8 A;  2DXI A;  4P0G A;  4EQB A;  2YJP A;  5KDT A;  4ND9 A;  4KYE A;  3IOT A;  4PQJ A;  3R26 A;  5FSW A;  1UTB A;  2FE8 A;  3M3K A;  3UP9 A;  1JET A;  5H8N B;  3FUZ A;  3QWL A;  1JQF A;  2BJW A;  1GTK A;  1GVC A;  4BDL A;  1N34 M;  4IBE A;  1MXW A;  4WXJ A;  2X49 A;  3S9E A;  3V83 A;  1MXY A;  2ESN A;  2ONS A;  1QYR A;  3RT8 A;  3WAE A;  4G4O A;  1SQY A;  1FTM A;  4M9X A;  4F29 A;  5DEX A;  3TE6 A;  3KS8 A;  5L8D A;  1QAO A;  5ITX A;  1LAH E;  2C96 A;  4GHA A;  3H7M A;  5H8H B;  2O6A A;  3E4R A;  3OEN A;  4QRZ A;  3HPI A;  2CV0 A;  3H06 B;  3TWM A;  4F3S A;  2EA0 A;  3THG A;  1W5S A;  1FQC A;  2K47 A;  2W7Y A;  1B58 A;  3MP8 A;  1B5H A;  1MY3 A;  2O84 X;  1VE4 A;  1EZO A;  3K92 A;  3KFU G;  3HU2 A;  3HJS A;  2UVG A;  4X64 M;  5IRE B;  1NHW C;  2Y7W A;  2F6P A;  4BDN A;  3A98 B;  3KP1 E;  1SXJ B;  2CFO A;  4IIW A;  4YB6 A;  2RGH A;  2ZAO A;  1I69 A;  5H8N A;  4GOT A;  1FCK A;  1B0H A;  4R9F A;  2VQF M;  3PUY E;  2W82 A;  4QHT A;  4DDD A;  3EF7 A;  4POX A;  2YFQ A;  3M3L A;  3FVG A;  1FQD A;  3RY3 A;  4LFC M;  1SW1 A;  3C33 A;  1US4 A;  3J27 B;  4JI7 M;  1QW0 A;  3GLI B;  3V8X B;  2DWN A;  4NE4 A;  1GV8 A;  1DGB A;  1M5E A;  3KBR A;  1H43 A;  1J09 A;  1B2H A;  1M5D A;  5AA1 A;  2FOI C;  5FLX S;  2ANJ A;  1IQP A;  3TKD A;  3E9X A;  1IBM M;  4IBC A;  3SBJ A;  3IB1 A;  1B40 A;  3ODB A;  3VLU A;  3GP1 A;  3GLH B;  2XX8 A;  4QFN A;  4IO3 A;  2FNC A;  5EXP A;  5KQ8 A;  3RUM A;  1YUB A;  2O7U A;  3D4G A;  3EHU A;  2QBY B;  3IR1 A;  3CF2 A;  3GLI A;  3S2V A;  5JI2 E;  3U60 A;  3O66 A;  2RCB A;  4QOS A;  5FTL A;  3G3F A;  4QNR A;  3FUV A;  1SW5 A;  4Z0I A;  1XMQ M;  3JV9 A;  3M6A A;  1HSL A;  5KPZ A;  3JYR A;  1SXJ E;  2AIX A;  3FKE A;  1IXH A;  1SVX B;  1B4Z A;  4AG5 A;  3T15 A;  3HO7 A;  4DV1 M;  1G41 A;  4L15 A;  1DO2 A;  1LV7 A;  1R6B X;  5TU0 A;  1KYI A;  1G59 A;  2HQ0 A;  3RGS A;  4G4Q A;  2Y84 A;  3LR1 A;  1KWH A;  3EHS A;  2Y21 A;  3TQS A;  5E26 A;  5EYF A;  1YSY A;  1QJM A;  4DXU A;  3CSB A;  4IBF A;  4TLM B;  4FD2 A;  3FV1 A;  2I4B A;  2F6G A;  1N0T A;  1B7Z A;  3O97 A;  4X62 M;  1H44 A;  1CE2 A;  2E1S A;  5L9M A;  2RKO A;  4DV5 M;  1M5C A;  1DTG A;  4QSD A;  1Z6T A;  4GHL A;  4NF4 B;  2UVJ A;  3NWL A;  4IO4 A;  1PEB A;  5H8S A;  4U4S A;  3TOD A;  1XC8 A;  1TH2 A;  5K2Y A;  3U5Z A;  1PB8 A;  3GLH A;  3GBB A;  4B3S M;  5DYI A;  1URG A;  2C5R A;  1D3K A;  1I94 M;  1Z7N E;  3T9H B;  5FTM A;  4XBO A;  4KQP A;  4GRK A;  1IXS B;  1USY E;  3KVW A;  4LJA A;  1FTK A;  3FTF A;  3NBI A;  3AXF A;  1PJI A;  2QMX A;  4IY6 A;  3KSX A;  2QRY A;  3G3H A;  5ICQ A;  3KOX E;  4NWC A;  3WAF A;  1MU5 A;  5AA2 A;  2ALU A;  1FNN A;  1EE8 A;  4P16 A;  4XTC Q;  4AQY M;  4IBK A;  3THI A;  1QKA A;  1JVX A;  4BDM A;  4EQ9 A;  4ZEB A;  4DV7 M;  1MRP A;  1DGH B;  4OVJ A;  1GR2 A;  1GKI A;  3EPE A;  4GC9 A;  1MS7 A;  4ZEF A;  3PUZ E;  2XD3 A;  4CGY B;  1LFG A;  3PV0 E;  4B3T M;  4DE8 A;  1AIV A;  3GXA A;  3PMV A;  3PPO A;  1ZQ9 A;  4LF8 M;  4JI8 M;  4H1X A;  3IAZ A;  2Z3X A;  3N6U A;  4KFQ A;  3TYH A;  4Z6Y A;  4NXM M;  3J80 S;  2CZL A;  4OTE A;  4R75 A;  3KP0 E;  3G3I A;  3SMP A;  3TZA A;  1FQE A;  5F3W A;  4QOZ C;  3Q29 A;  3HCQ A;  4LRS A;  3FAS A;  5I58 B;  1P1N A;  3OEL A;  4XKP A;  1PDA A;  2V3Q A;  3EHT A;  2NQ8 C;  3AOG A;  3R9X B;  1JNF A;  3T9X B;  4H67 A;  3HU3 A;  3KW6 A;  4DUY M;  4OZ9 A;  1YAE A;  2C98 A;  3BKI B;  1NH7 A;  2X4A A;  1AOV A;  3AL0 C;  3FZV A;  4GRI A;  5FHN A;  2F8D A;  4RYA A;  4NF6 B;  1EU8 A;  3GLF B;  1TDH A;  4LG2 A;  3O6H A;  4AI6 A;  3SDF A;  4IGR A;  2DZO B;  3K0V A;  1ATG A;  3GLB A;  1QUK A;  3GRR A;  1MDQ A;  3HHW A;  2F4V M;  4JV5 M;  4Z8X A;  5KCJ A;  4DR7 M;  1VSO A;  1P99 A;  2VII A;  3FUU A;  2RC7 A;  2UXD M;  1PC3 A;  3RT6 B;  3PPQ A;  4QF9 A;  3OSR A;  3VXC A;  5TP9 B;  3MBP A;  1GGG A;  1HQC A;  4F3G A;  4R6Y A;  2ABH A;  4L8R C;  2ZNT A;  1IBK M;  2F5X A;  2GHA A;  5HM4 B;  3VDF A;  3L25 A;  1KSF X;  3FUW A;  4QHS A;  3U72 A;  3AOE A;  3W0F A;  1MY0 A;  1NHG C;  1UIU A;  4CHT B;  3K4U A;  4X66 M;  2HZK A;  3TTR A;  2OCU A;  4CIS A;  3L6G A;  4MGI E;  3FD9 A;  1NNK A;  3AOE C;  3H6T A;  1TFA A;  1J7K A;  3S4U A;  4C1T A;  5CMM A;  4TLL B;  3SAU A;  4P11 A;  3FYC A;  3IG8 A;  4GFR A;  2XXX A;  3KJ7 A;  2OZZ A;  4IO6 A;  4LQ5 A;  4DR5 M;  3EQ1 A;  1G8P A;  2V1U A;  4KLN A;  4OX9 M;  4NMY A;  4XKR A;  1TWY A;  1B7H A;  4PFU A;  4R74 A;  2PYY A;  2A5T B;  4Q30 B;  2AYS A;  3E3K A;  2L6O A;  4HL4 A;  4Q5T A;  1IY1 A;  1L1T A;  2F7A A;  2CV2 A;  1B7U A;  3FJG A;  4N6P A;  2F5N A;  3M0E A;  4RF1 A;  1Z5C A;  3BOS A;  4DXB A;  3MVZ A;  3ZH9 B;  5H8H A;  4G6Z A;  4FE8 A;  4EF1 A;  4EIW A;  2UYE A;  3L29 A;  2NUV A;  4K0K M;  1XS5 A;  1ZAE A;  1WDN A;  4OW0 A;  1N84 A;  4KYD A;  4KHP M;  2CE7 A;  4H8J A;  2PT1 A;  4F22 A;  5C18 A;  4YKK A;  4JWX A;  3SKP A;  2O1L A;  1A55 A;  1XVY A;  2V93 A;  2XFT A;  3MZ9 A;  3HHY A;  4OEV A;  3TEP A;  1LGB C;  5DYG A;  1IUD A;  1ZU0 A;  3TL4 X;  1DOT A;  3FXR A;  3U6D A;  4NF4 A;  5IT9 S;  3LQQ A;  2UXA A;  4YU0 A;  1SW2 A;  1YCJ A;  2DE3 A;  3QUJ A;  4IBD A;  1Y4C A;  3A3C A;  1M5F A;  3K01 A;  1BKA A;  1L2B A;  3B6Q A;  3FD3 A;  3ZKK A;  1C1K A;  3QK6 A;  3VFJ A;  1L2D A;  4ITQ A;  2C9C A;  1B46 A;  1Y9U A;  4KCC A;  4FW9 A;  2F78 A;  5EXX A;  3WHK A;  1A54 A;  1LLS A;  3L26 A;  1ZBM A;  1GL7 A;  2QS4 A;  2RCA A;  2UXB M;  1IZ1 A;  1NVM A;  2Y20 A;  2O1M A;  3UIF A;  4IBI A;  4ELQ A;  3U6L A;  3TTK A;  1M5B A;  1MY2 A;  4GC5 A;  3T22 A;  3DA1 A;  5AA3 A;  2M60 A;  3A46 A;  2O5R A;  3GPY A;  5I56 B;  4DCX A;  1H45 A;  3TDJ A;  5ITO A;  2R4E A;  4YZZ A;  4FWD A;  5TPA B;  4PE5 B;  5IKB A;  4G8H A;  1KFV A;  3QAX A;  1BTJ A;  5F7V A;  1S3S A;  3PXG A;  3DEL B;  1XWI A;  1K3W A;  3TCH A;  4FCT A;  4LGY A;  1ZKB A;  5BUU A;  2BJJ X;  2UUB M;  1II5 A;  2F97 A;  4XXU A;  5EP3 A;  5B70 A;  4DR2 M;  3W9W A;  5ELV A;  1UTH B;  1B3G A;  4NTL A;  4LFA M;  3E13 X;  1TH3 A;  4FEB A;  2YR0 A;  1B5I A;  1ZJL A;  5FHO A;  3KJT A;  3UGJ A;  1S7Y A;  2HCA A;  4R73 A;  3U61 B;  3U60 B;  4YB7 A;  2KZU A;  3I3V A;  1YE9 A;  1N7W A;  2D7H A;  1QUI A;  3VDP A;  3VFD A;  2Q9T A;  3VLF B;  1E9R A;  4LP2 B;  3N94 A;  2VP1 A;  2F5P A;  4O3B A;  2DOJ A;  3G7W A;  4R72 A;  2VD2 A;  4NRW A;  5CRY A;  3HU1 A;  1DMB A;  1Z7M E;  1NNT A;  4JBZ A;  1DPE A;  2V3T A;  1PBP A;  2QEN A;  1SYH A;  2DVZ A;  4EF2 A;  3L6H A;  3K1P A;  2HXW A;  3MP1 A;  4PD2 A;  5AE4 A;  1B1X A;  2FNA A;  1N75 A;  1LAG E;  2QS1 A;  1SXJ C;  3U61 A;  3PNY A;  2DWJ A;  1MPC A;  3B6T A;  1US5 A;  2H25 A;  3H4M A;  2DE2 A;  3C4M A;  5I2N A;  4O3C A;  1VFE A;  1T0K A;  2P1S A;  3R8F A;  3VVD A;  3A3U A;  3RGY A;  4D82 A;  2D21 A;  1YTV A;  4JB7 A;  4NWD A;  4DZ1 A;  4MLQ A;  3W9V A;  1POT A;  2DQV A;  3IJX B;  4OQO A;  1E9S A;  5BPV A;  4U22 A;  1JEV A;  4PFT A;  1A99 A;  2I58 A;  4DR4 M;  2X26 A;  1A8F A;  2QPQ A;  2JA2 A;  3PD9 A;  1VFD A;  1W5T A;  5ITP A;  1IIW A;  1JVY A;  2RC8 A;  2LXE A;  2I0C A;  2F5O A;  3LBS A;  4RXL A;  3SEU A;  2VGQ A;  3O2A A;  1R6Z A;  2THI A;  5AA2 B;  3SAT A;  2LAO A;  1Y1M A;  3RTF B;  2OQ4 A;  2QBY A;  3QIM A;  4ZEK A;  4RNA A;  3CG3 A;  2HEU A;  1B3F A;  3LC8 A;  4R6H A;  1BIY A;  5ISU A;  3U8Q A;  4NF5 A;  1IN5 A;  1B3H A;  1XOC A;  2XH9 A;  1Z5A A;  1XHY A;  5FTH A;  1O7T A;  4LVQ A;  5AA4 A;  2ZYM A;  3MK6 A;  5KCJ B;  4GH9 A;  3SER A;  3J7B A;  1PB7 A;  3KN7 A;  4QNM A;  3CTW B;  4R9G A;  4W5W A;  2QMW A;  4GD5 A;  4OEU A;  4IBB A;  3MPL A;  5FTJ A;  4G68 C;  4BLA A;  1Z5B A;  4ZDM A;  2Y7K A;  3LSL A;  2QS3 A;  4KHZ E;  1GLN A;  5I58 A;  1IEJ A;  4AKH A;  1IN8 A;  4U23 A;  2UVI A;  1LST A;  4EXL A;  4GLI A;  4AW4 A;  4GKK M;  2XXT A;  3KSJ A;  3U6C A;  4JXI A;  2R4J A;  4ZZE A;  1LFI A;  2F36 A;  2DP8 A;  3CIJ A;  1Y3N A;  2ZNU A;  4E0X A;  1B3E A;  2B65 A;  2DWL A;  4L17 A;  4RK2 A;  1L5T A;  3G3G A;  1PBQ A;  4QFO A;  3KOT A;  3WHL A;  2X7P A;  4RNS A;  2AHM A;  2QL3 A;  3VVF A;  3VXB A;  4B08 A;  1B32 A;  1DPP A;  4RPN A;  1QQW A;  1JQJ C;  2NOO A;  3G3K A;  4DV6 M;  5ITU A;  1N3W A;  3O6I A;  3D8B A;  3K6U A;  4DV2 M;  2DVC A;  4E0W A;  5LOM A;  4OYV A;  5JK4 A;  4F1V A;  3N6T A;  5CBR A;  1Z59 A;  3GPX A;  3SEY A;  1N7X A;  1MQH A;  4GIT A;  1POY 1;  2B3F A;  4AKI A;  3W15 C;  2I7P A;  1R9L A;  3DOA A;  3PNV A;  2Z8D A;  2BJV A;  4ESW A;  3UMM A;  4IO5 A;  1MY4 A;  1Q1K A;  4FCV A;  1JW1 A;  1NL5 A;  2P5T A;  2Y7I A;  4MB7 A;  1TFD A;  4X65 M;  3TAJ A;  3TQW A;  3IG5 A;  3TCG A;  4RJZ A;  5HPQ A;  2YNM D;  3LUY A;  5DTB A;  3GO8 A;  3VVE A;  1QUL A;  5FTI A;  3PPP A;  3LSW A;  2XXV A;  3T9U A;  4G8N A;  3MJ5 A;  4LJ7 A;  3K2L A;  2CEA A;  1MPB A;  1MQJ A;  4DV3 M;  3SHG B;  1UQW A;  5CI5 A;  3U6S A;  3HHZ A;  1LB9 A;  1IQ7 A;  1QZM A;  3PMX A;  4M4G A;  4G4N A;  3TTM A;  2DXY A;  3PMW A;  1NSF A;  4QFL A;  1P1U A;  2YQZ A;  4YKP A;  3LVV A;  2LNH C;  3SAW A;  1QKB A;  4ZPX A;  2UUA M;  4QFK A;  2Y0Q A;  4P0I A;  2XXH A;  1MXV A;  4U2R A;  4ZEC A;  4DV4 M;  1VDD A;  4LFB M;  3RTW B;  4G8M A;  1I6B A;  5DVI A;  2L09 A;  4OWD A;  2ZYK A;  2ZXT A;  4KR5 A;  4R6K A;  3AFH A;  4IJE A;  4OET A;  1EH3 A;  1Q39 A;  2DHR A;  1K3X A;  1NY5 A;  4IBG A;  3EN3 A;  3OEM A;  1OMP A;  3VK7 A;  1HQY E;  5ITT A;  1ZTY A;  4GXS B;  3U92 A;  3HHX A;  3MAM A;  4DV0 M;  2HHH M;  4MFI A;  3T9V A;  3KXE C;  7CAT A;  1RKM A;  4BB9 A;  1XNQ M;  2XGN A;  3GLG A;  1L1Z A;  4YY3 M;  5ITR A;  4NRV A;  3IK6 B;  4QSC A;  4WUR A;  4NF8 B;  1HSJ A;  2OJT A;  2Z8F A;  3H3G A;  3R7X A;  4LF6 M;  2NXO A;  1HNZ M;  1O63 A;  1SI0 A;  3RPW A;  4LON B;  2XXW A;  4NSR A;  3DP6 A;  1MQI A;  4X48 A;  3T66 A;  4L4U A;  1DSN A;  4QSE A;  3I4Y A;  1UTB B;  2H1R A;  4YMA A;  4B7F A;  4U21 A;  4I4L A;  2PBW A;  4H65 A;  1I4W A;  4G68 A;  1B52 A;  2I3V A;  3TUS A;  2E0S A;  1Y3P A;  1JR3 A;  2YLN A;  3GQ3 A;  1NJG A;  5I59 B;  1URS A;  2V25 A;  2J7O A;  4JI0 M;  4AB5 A;  3JR5 A;  2E5L M;  2OBG A;  3ZCB B;  4BBA A;  3CF0 A;  2F5S A;  2DYX A;  1MH4 A;  3O9P A;  4RA1 A;  1IXZ A;  2UVH A;  5CM6 A;  3RFW A;  1LBB A;  4THI A;  4MGH A;  4OU7 A;  3RNN A;  2DSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...