3KSXA

The alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
289
structure length
289
Chain Sequence
AAEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
total genus 95
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksxA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksxA02
4NF8B 5ITPA 1D3KA 4LVQA 3TPAA 4FJPA 4R6HA 1LSTA 3C35A 5KCJB 4NF6B 3O28A 2HCAA 4KFQA 5I58B 3CI8A 4R9FA 4U4SA 5CMCA 4ELQA 2F7AA 5H8HA 3ONMA 2Y84A 3PUWE 3CFLA 1IXCA 1SYHA 4ELRA 2AYSA 3P7IA 4F1YA 1ANFA 2X7QA 3M8UA 5DVJA 3PPQA 4LQ2A 5M2VA 3LC8A 2FYIA 4LZ7A 3FXUA 2DQVA 4JWOA 3K01A 3CRBA 3N26A 5EYFA 4RXLA 2Y7WA 4WEPA 4KHZE 3C36A 4NF4A 5AA4B 3KBRA 4JXIA 1RYXA 2IEEA 4AQ4A 3MBPA 4WEDA 4BDOA 3VXBA 3LSLA 1MY3A 3TDJA 2F7CA 2V84A 1UTBA 3E13X 1TWYA 4HS7A 4I8CA 2F5XA 2O84X 1B7ZA 5CMMA 4GWOA 3ILUB 2O1LA 1M5FA 3H03A 5H8NB 2AL4A 3OOAA 3FJ7A 3UORA 1UQWA 1OLCA 2NUVA 1LAHE 4KYEA 2B65A 1QVSA 1OQGA 4I9DA 3HHFA 3MVYA 1LLSA 3O2AA 5A5XA 2XXHA 3K0VA 4AB6A 2Y7PA 1WODA 3OEMA 3TUSA 4Q5TA 4DCXA 3T9VA 5FHMA 1A8FA 1PC3A 3OD7A 3UA8A 1URSA 4YZZA 3A09A 4FATA 4M4GA 4DZ1A 4DE8A 4FORA 1IUDA 5TP9A 1MQGA 3MP1A 2QL3A 5H8QB 2XD2A 2OZZA 3B6WA 3M3LA 3KGCA 4DCYA 4X1DA 1L5TA 3CFZA 1FQAA 3QUJA 2H9BA 2QS3A 4PP0A 4IY6A 1JQFA 2UVJA 4YAHX 4U23A 5BWJA 1I69A 4NF5A 1S50A 3KJTA 1EU8A 3N6TA 3IB2A 4OEVA 1EZOA 3OENA 2GH9A 2RC7A 4M1VA 1OVBA 1XVYA 1EZPA 1B0LA 4EQ9A 4MFIA 3O9PA 3VVFA 4ELOA 4KYDA 3G7WA 3H3GA 3TZAA 4GD5A 3RT6B 1MXXA 1ELJA 3DP6A 4G68C 5CBRA 1DTGA 1QULA 1B3LA 3TTNA 2PBWA 4H0WA 3VLWA 4H67A 3OEKA 3IOTA 2DVCA 4RK2A 3CSGA 3KJ7A 2FA7A 2Z8DA 4KR5A 2I4CA 4H8JA 3IO6A 1IITA 3C32A 3H6TA 2P2AA 3E3KA 1B2HA 1Y1ZA 3Q25A 4GQOA 3IOVA 4XXUA 1DMBA 5FTIA 3OO6A 3HHGA 3CFXA 1B32A 4GOTA 2V3UA 2PYYA 1A54A 3IJXB 4F3BA 2M8CA 1Y1MA 2HEUA 2XXTA 1IXGA 2ZNTA 3B6QA 1MQDA 1NNTA 1EH3A 2O1MA 3B7DA 3H06B 1YTVA 3WAEA 4XKQA 3IX1A 2R71A 2ZYMA 3ECRA 3CSBA 5AA1A 2GHBA 1M5BA 1H45A 2DE4A 2P1SA 2Q9TA 4RA1A 5ITOA 1FTJA 1IEJA 4KCCA 4F18A 1Y4CA 1B7HA 1UIVA 4QFKA 4BLAA 1NH8A 1SI1A 2UVIA 1ZMGA 4X1BA 1P1UA 4O3AA 2D21A 1I6QA 4N13A 3BBRA 3RGYA 3IL1B 4EQBA 4N07A 3GZGA 3PUYE 2OLBA 4ZS9A 1FCKA 4MLVA 4KI0E 4HCYA 3V89B 4YMAA 1LBBA 5I56B 4L17A 1B51A 2F6GA 3ZKLA 3PD8A 2V93A 4GXSB 3PMVA 3O29A 3MPLA 1MM6A 4XKPA 4BDLA 3PMWA 5I2NA 1GGGA 3EN3A 1Z7ME 1MQIA 3VLUA 5B7DA 5F1QA 2O7UA 1PB7A 3T93B 5DEXB 1LBCA 4G8NA 2XXUA 3TODA 4FE8A 1B1XA 4DLDA 1UIUA 1LCFA 2OWSA 4HTGA 3K6VA 2HQ0A 2Q88A 3EHSA 5CI5A 1VE4A 1A99A 3CG3A 2XXYA 4TLMB 3OELA 1A55A 2B3FA 2D5WA 2NOOA 2YLNA 5KDTB 1MH3A 2UXAA 3Q28A 4U21A 3SEVA 4P11A 4Q8RA 3RPWA 4G77A 2QMXA 5CMBA 3LSXA 4NF6A 3RN8A 4Z7EA 2I0CA 4I62A 3TTKA 1A40A 2R9JA 3D4GA 3QXMA 3VVEA 5AA2A 2DWHA 2I3VA 1LCTA 2QMWA 3KG2A 3E9XA 4R75A 5B70A 4GFRA 1DOTA 2A5SA 4OFJA 3V5AA 3MQ9A 4IO7A 5JTYB 4YKIA 4EQ7A 1NH7A 2E1SA 4EUOA 4Z0IA 2Z8EA 4GRKA 1MXWA 1Y20A 3O6GA 4G68B 2I58A 4NE4A 1Q35A 1NNFA 4Q30B 1IXHA 2RCAA 3RQTA 2VD3A 3C4MA 1R1NA 2XXXA 1JW1A 3Q26A 3K1NA 1PB9A 3IAZA 2A5TB 2DXRA 1NFTA 1HSJA 1JNFA 1MPCA 3FGSA 1R9QA 5KZTA 4OENA 1XHYA 4F3SA 1YCJA 1MPBA 2W7YA 3S2VA 1H3DA 3KSXA 2DP8A 4OFLA 1WVJA 1O7TA 1MY4A 3EQ1A 1OQHA 5F7VA 1B58A 5TPAB 2REGA 1MY0A 4XTCQ 4G4PA 1IQ7A 3PPRA 4P0GA 4FIMA 2RF1A 1NNPA 3T22A 1B46A 4IY5A 3KN7A 2XX7A 2ZYKA 3K6XA 4JBZA 1PDAA 1MQJA 4DIGA 3G3GA 4QHQA 2NXOA 1M5DA 1IIWA 4FEDA 1PBQA 5FHNA 2Z8FA 2NWJA 3TTLA 3TYHA 2RINA 4EXKA 3IOUA 4NWCA 4PETA 2DE3A 3K6UA 3LR1A 3U72A 1LFGA 2I49A 2Q2AA 3O6IA 1J1NA 3G3KA 1N0TA 2OCUA 2UVGA 2DYXA 2X7PA 2D3IA 3V83A 2ABHA 1P1OA 1R6ZA 1FQFA 5DYHA 3U1OA 1B3EA 3IO4A 4ZECA 3RNNA 3W9WA 2QS4A 1XVXA 3K1PA 3M3KA 3TKDA 1SW5A 2ZXTA 3RUMA 1MRPA 3CVGA 4LZ8A 2HAUA 4MH5A 2RC9A 3MVXA 1LGBC 3FVGA 1US4A 1FQBA 5ELVA 1SW2A 3K6WA 4EF2A 2Q2CA 3QSLA 3DELB 3T9UA 2O51A 4F19A 4N6PA 3N94A 4YU0A 3HSTA 1P99A 5I57A 5FTHA 2IA4A 1P1WA 2UYFA 4GL0A 5ISUA 2RCBA 4KD5A 2F7BA 4ESXA 3UK4A 5AE4A 4ZZAA 4ZE8A 3GBAA 3PPPA 2DOJA 4F2OA 2F78A 2DE2A 4U1OA 4IO3A 4YKKA 1JW5A 5H8HB 2VOZA 2XHDA 4F3GA 4NTLA 4OZ9A 5BUUA 1DPEA 3SDFA 4LONB 4HW8A 4GVOA 1BP5A 5L9MA 1YAEA 3ZKKA 3PUZE 3HCQA 2PVUA 2UVHA 1SVXB 5HM4B 3DM0A 2H25A 5H8FA 2OK2A 1FTMA 2RC8A 4FEBA 3SKPA 5EHSA 4OQOA 4NF4B 4OVJA 4RY1A 2QS1A 3PMXA 3U92A 2XXWA 3MZ9A 3MC2A 1N3WA 1ZU0A 3PGFA 3MUQA 4TQUQ 2V25A 2ONRA 5L9SA 2Y7KA 3FUZA 3Q27A 2NVUB 2F6PA 1UTBB 5I2KA 1B5HA 1MXVA 3IR1A 1TT1A 2YJPA 4ESWA 1SD3A 1N7WA 1KWHA 3VE1B 3FVKA 2H99A 4ND9A 2QSXA 5IAIA 3I5OA 3UN6A 4LQ5A 3T9XB 3VLVA 1HSEA 5A5XB 4OESA 3RY3A 3IORA 4OYVA 1M5CA 3PUXE 3EPEA 1AIVA 3TCGA 1B3FA 2G29A 5CBSA 1AH5A 4NEDA 1B5JA 4YMBA 5TP9B 2QS2A 3C9HA 3L6GA 4PQJA 1GTKA 3BFUA 3S4UA 2O68A 1H76A 1I6AA 1MY1A 4WXJA 3DLNA 3O66A 4RPOA 3GLBA 3OXNA 3H6WA 4IO4A 1D4NA 1QUJA 1OVTA 4NF5B 2RKMA 4F1VA 1LAGE 1P1NA 4XIGQ 3VVDA 1USYE 1BKAA 1Y4TA 1R9LA 3IOWA 4RYAA 2XXIA 2XX9A 3QK6A 2XXQA 2WKYA 3RLFE 1SW4A 1USYH 3MWBA 3W9VA 1M5EA 2F36A 4QFOA 2ESNA 3FJMA 1B3GA 3ILTB 3KSJA 1Q1KA 2BJJX 4MF3A 1QUKA 4BDMA 2I4BA 3TCFA 3H6UA 2HFBA 1ZIUA 1IZ1A 1B05A 1IXIA 4F1UA 1Y3QA 2VP1A 1PEBA 1OMPA 4R9GA 2XXVA 3MZ1A 3EF7A 4G8MA 4OXVA 2DWAA 2ZYNA 1MXZA 2F34A 3VDFA 1N84A 4AB5A 5DTBA 3Q29A 4OWDA 3SEYA 2CZLA 3I3VA 1B4ZA 2GHAA 4LUBA 4IO6A 4GIZA 4NF8A 1ZKBA 3UGWA 2GRVA 3FVOA 5KCJA 2PMSA 4H5FA 3I6VA 4JDFA 3QYTA 5I58A 2ZYOA 3BKIB 3GBBA 1PB8A 4ECFA 3FJGA 3MZBA 3O97A 2X26A 2THIA 3VV5A 1MPDA 1N04A 4UA8A 4F22A 1CB6A 1D9VA 1JW4A 1DTZA 2GFEA 4DXBA 3USDA 1FW0A 3C34A 3PD9A 5I59B 1SBPA 2DWIA 1MS7A 4ZEDA 1B52A 4POWA 4LATA 1XT8A 1FQEA 4IO5A 4PFYA 1B6HA 5CMKA 4OETA 3K1MA 3PUVE 3TAJA 5AA4A 3DP4A 4GL8A 5AA2D 1MDP1 3SEWA 1MXUA 5I2NB 2OWTA 4GF8A 1URGA 3KOTA 3KZGA 1B1HA 1UTHB 2ONKE 4R72A 3RT8A 4LA9A 1FTKA 4ZEKA 4OTEA 3FASA 3QUFA 4OMBA 3ZS6A 1LB9A 3S9MC 1MXYA 4KPTA 3LSFB 3G3HA 2AL5A 4JSOA 4QSCA 5H8NA 2H4IA 5JEIA 1FTLA 4IB2A 3A3UA 4O3CA 3FXQA 1H43A 2O7IA 3K4UA 1A7LA 1FQDA 4LP2B 1MQHA 3IB0A 4R6YA 2HAVA 1US5A 4QFPA 4PFWA 4LZ5A 2G93A 4OFOA 4DXCA 4F39A 4G8HA 4ZEIA 3S9EA 1VFEA 2I0BA 5AA2B 1TFDA 4ISUA 3LSWA 4Q0CA 1B9JA 1O63A 4U2RA 2XXPA 1Z7NE 1YPNA 4RJZA 1URDA 3R26A 2DWJA 1EZ9A 5H8QA 2HXWA 1XS5A 2E0SA 1TFAA 3THIA 2PT2A 3DP8A 3JZJA 2I3WA 2VGQA 1AL3A 3KN8A 4YICA 1FTOA 1VSOA 2YPNA 2DSFA 2ZNUA 3PPNA 4EDPA 3T96B 5AA3A 1JEVA 3M3FA 2H5YA 3ODBA 3OO9A 4K3FA 4F2QA 3RTWB 4DDDA 3AXFA 3MAMA 4O3BA 5DT6A 4TLLB 2Q8JA 2FNCA 3OO7A 2O6AA 1DSNA 4KCDA 4P0IA 3D4CA 3C33A 3S9NC 3SERA 3UP9A 3H7MA 1JETA 5LOMA 1BTJA 1TXFA 4NWDA 3BFTA 4YB6A 1QW0A 1GVCA 5K2YA 1I6BA 2Z23A 2I48A 3HO7A 2AIXA 4U22A 4UACA 4R2BA 2R6GE 4G2ZA 1GR2A 4KQPA 2ZNSA 5CM6A 1JEUA 4TOZA 1B0HA 1POY1 3TFLA 5L9OA 1BLFA 3L6HA 1QKBA 3H6VA 5HPQA 3G3JA 3A3CA 3OSRA 5H8SA 5FHOA 4MLQA 3WAFA 2QJEA 4ZEBA 3IJOB 3K00A 3HN0A 1N3XA 5HBCA 4QRZA 4FECA 4H6DA 2ZMBA 1MG1A 3F11A 5CRYA 3OMBA 3EHTA 1GV8A 3LBSA 1QUIA 3E4RA 1OIBA 4R73A 2F8DA 4IGRA 4C1TA 1PBPA 2DVZA 5IKBA 3SESA 4ELPA 4PFUA 3KFMA 2ALUA 3MP6A 3R7XA 1WDNA 2Y7IA 4EXLA 5TU0A 1BIYA 2V3QA 3CG1A 1DPPA 2P0SA 4QF9A 4QFNA 3V8XB 4OEUA 4YB7A 3SEXA 1LFHA 3TCHA 4YKJA 4XKRA 4E0XA 3U93A 4HCWA 5I56A 4JSDA 2LAOA 4ZDMA 2F97A 2CMOA 1OLAA 5L8DA 1ZJLA 4GXAA 4OERA 1NMUA 3VFJA 3B6TA 4THIA 3FIRA 3HPIA 5I57B 4R6KA 4YB5A 4C1UA 3LUYA 3FVNA 2VHAA 2VD2A 1LFIA 5DEXA 2XXRA 1F9BA 3T66A 1POTA 3CIJA 4JB7A 1MM7A 3QIMA 3OSQA 5K2XA 5ICQA 1NNKA 3TQWA 1SI0A 3G3FA 1QJMA 1H44A 1JVXA 3MJNA 5KDTA 4KYSA 2ONSA 1D9YA 1FQCA 1A8EA 1N76A 5CC2A 1T0KA 3H4ZA 4X9TA 3FD3A 3VXCA 1P1QA 3EHUA 4BDNA 4ONYA 4JWXA 4XKNA 3JV9A 1LAXA 2REJA 4F31B 2UYEA 4GLIA 5H8FB 1B5IA 4RK9A 4ZZEA 1ZLQA 3FV1A 3N6UA 2DXYA 3FATA 4X48A 4DXUA 5JK4A 3TEPA 4F3PA 3C31A 3KEIA 4IO2A 3FZVA 3PPOA 4U4XA 4H1XA 4RPNA 2PX1A 2XD3A 4YKPA 5DVIA 5I84A 3ZSFA 3RTFB 3IK6B 5I59A 5JTYA 4H8IA 4E0WA 4ZE9A 4EF1A 5ICTA 3CR9A 3T9HB 5I2KB 3PV0E 1B40A 4G68A 1Y3PA 1S7YA 4ZEFA 3IB1A 3S9LC 1AOVA 1VFDA 3U8QA 2HZLA 2A5TA 2V3TA 1NKXA 5EHMA 4PE5B 1HSLA 1UTHA 2Q89A 2Z22A 1B7UA 1Y9UA 1XOCA 2OJTA 2ANJA 4FAJA 3SETA 3OO8A 3MPKA 1O64A 1LB8A 2HZKA 2O69A 3K2DA 5TPAA 3TTRA 1MH4A 2XX8A 1AMFA 1VR5A 1B4HA 1SQYA 3TTMA 1RYOA 3U94A 2Y7RA 5J1DA 4R74A 3R6UA 3SEUA 3TQLA 2H98A 1II5A 4MBPA 3MVZA 3PU5A 2DS9A 4H65A 1S9TA 2I6EA 3QAXA 4PFTA 3N5LA 4I1DA 3UIFA 1CE2A 4U1ZA 1ZTYA 4OHNA 4POXA 3MVWA 4BDRA 4QSDA 4RNSA 4C0RA 3FXRA 1ATGA 3JYRA 1SDXA 2B3BA 1RKMA 1SW1A 3GXAA 1NL5A 1LAFE 1QKAA 1N7XA 4QSEA 4JWYA 2KLFA 3K02A 4NMYA 1JVYA 3KOSA 2F35A 4IGTA 3KN3A 1SYIA 3W15C 4R2FA 3O6HA 1B3HA 1ZBMA 2QPQA 1Y3NA 3MW0A 4QFLA 3MP8A 1XC1A 2PT1A 3FV2A 1MDQA 2QRYA 2OBGA 4WKMA 4H5GA 4BDQA 3HV1A 3G3IA 3TELA 5DVFA 3TMGA 4F29A 1MY2A
chains in the Genus database with same CATH superfamily
3ZC7B 2B4LA 4NF8B 5ITPA 5IT9S 1D3KA 4LVQA 3TPAA 4OW0A 4DV4M 4FJPA 4R6HA 1LSTA 1N75A 3C35A 2P3VA 5KCJB 4DR1M 4NF6B 4O94A 5KPZA 3O28A 4LF9M 2HCAA 2HHMA 1VEJA 4KFQA 3J7BA 5I58B 3CI8A 4R9FA 3NBXX 3NBIA 3W68A 4U4SA 5CMCA 1IM2A 4ELQA 3SFZA 4JXJA 2F7AA 5H8HA 3ONMA 3W67A 2Y84A 2F5NA 2FHYA 1QAOA 3HU2A 3PUWE 3CFLA 3C58A 1VQ1A 1IXCA 3GLFA 1SYHA 4ELRA 2QQ8A 4GC5A 1J5EM 2CZKA 2KEBA 1TR8A 2AYSA 2CEXA 1IMBA 4IIWA 5ET8A 4HL4A 1FPDA 3P7IA 4F1YA 1D0LA 1ANFA 2X7QA 4AI6A 3M8UA 5DVJA 3FUXA 3PPQA 1R2YA 3PNVA 2CEAA 4LQ2A 5M2VA 3LC8A 2VQEM 2FYIA 4LZ7A 4QBAA 3FXUA 1TH3A 2DQVA 4JWOA 1NVMA 1G41A 5J16A 3K01A 5LMNM 3CRBA 1XHBA 3N26A 2DVWB 5EYFA 4RXLA 2Y7WA 4WEPA 4KHZE 4B3SM 3C36A 4NF4A 5AA4B 4D80A 3KBRA 1NI9A 4JXIA 3E79A 1RYXA 2IEEA 1TDHA 1V34A 4AQ4A 4MB7A 3Q8XA 3MBPA 4WEDA 4R7GA 2XWIA 4N15A 1HT1E 4BDOA 3IFCA 3AOGA 3VXBA 4N91A 4GKJM 3LSLA 1MY3A 3TDJA 1Y8GA 4GHLA 3GLIE 2JJKA 3HFUA 2F7CA 2V84A 5FTKA 1UTBA 3E13X 1TWYA 3GLHE 3K9PA 3I4VA 1JR3E 4LJ7A 2CEYA 4LZZA 4HS7A 2F5XA 4I8CA 2O84X 1VDWA 1B7ZA 4AG6A 5CMMA 2CWBA 5DFLA 4GWOA 3ILUB 2BWEA 1NV3A 3HWSA 2O1LA 1M5FA 3H03A 5H8NB 2QBYA 2AL4A 3OOAA 2LBCA 1IN5A 3JR4A 1TF0B 2O25A 2UUAM 3FJ7A 1NV6A 2R45A 3UORA 1TH4A 1UQWA 1OLCA 4X04A 2NUVA 4L78A 1EFUB 3LQQA 1NV8A 1LAHE 4KYEA 2B65A 3U60B 4QHTA 4PF8A 2W82A 1OQGA 1QVSA 3D1RA 3U5ZA 4I9DA 3HHFA 3MVYA 4AZFA 1LLSA 3O2AA 5A5XA 2XXHA 1NHWC 4NF0A 4NOOB 3K0VA 4AB6A 2ZZXA 2Y7PA 2GQFA 1WODA 3OEMA 3TUSA 4Q5TA 4DCXA 4HLQA 4PDGA 5FHMA 3T9VA 1A8FA 1GJSA 4PAKA 3KP0E 1PC3A 2PCRA 3OD7A 2KDLA 3UA8A 1URSA 4YZZA 3A09A 4FATA 4M4GA 4XF5A 4DZ1A 4NRWA 4JYAM 4DE8A 1R6BX 4FORA 1IUDA 1QYRA 4LJ8A 5TP9A 1RDYA 1MQGA 3MP1A 1DV0A 2QL3A 5ET6A 1NNJA 1F4IA 5H8QB 2XD2A 4PDHA 2OZZA 3B6WA 4DR6M 3M3LA 4PCDA 3U6QA 4L15A 3KGCA 4DCYA 4PAFA 4MGYE 4X1DA 1L5TA 3CFZA 3HU3A 1FQAA 3QUJA 2H9BA 2QS3A 4NHBA 4PP0A 4IY6A 3LCVB 1JQFA 2UVJA 2BWBA 5IWAM 3J81S 4YAHX 4U23A 5BWJA 1I69A 4NF5A 1S50A 3KJTA 4F29A 2C98A 1EU8A 3N6TA 3IB2A 1NV7A 4OEVA 1OQYA 1L2CA 3GLFE 2OOAA 1YYZA 3OENA 1EZOA 2R18A 2GH9A 2V6ZM 3I04M 2RC7A 1PJSA 4M1VA 3FKEA 1OVBA 5C18A 2NQ8C 1XVYA 3LQRA 1EZPA 1B0LA 1FPBA 4EQ9A 1Q3CA 3FUUA 4FWGA 3O9PA 4GWXA 4MFIA 4G4NA 3VVFA 4LF6M 4ELOA 1K9ZA 4KYDA 3G7WA 5KO3A 3H3GA 4PBQA 3TZAA 1WGLA 4GD5A 1NY5A 3FRIA 3RT6B 2APLA 3R8FA 1MXXA 1ELJA 3DP6A 4G68C 4P47A 4KO8A 3Q8GA 5IZ3B 2QVUA 5CBRA 3U6DA 1DTGA 1QULA 1B3LA 2H5XA 3LVWA 3TTNA 2PBWA 4HXVA 3IECA 4H0WA 4MCOA 3VLWA 4N6DA 1NNUC 5ITXA 4H67A 3OEKA 3IOTA 2DVCA 2JA2A 4RK2A 3CSGA 4JVDA 3KJ7A 2FA7A 2Z8DA 4KR5A 4BB9A 4P9KA 2I4CA 4H8JA 2OOBA 2L09A 3RFWA 3IO6A 1IITA 1N78A 3C32A 4MEVA 3H6TA 2Y21A 4DBGB 3AOEC 2P2AA 3GRYA 1E9SA 4IBBA 3E3KA 4G6ZA 1GL7A 2VF7A 1B2HA 1LBVA 1Y1ZA 4LF5M 3Q25A 4GQOA 1KZ8A 3IOVA 2CV1A 1DMBA 4XXUA 4D82A 2JY6B 5FTIA 3M6AA 3OO6A 2R4JA 3HHGA 4RNAA 3A42A 3CFXA 1B32A 4GKKM 4GOTA 1XC8A 4GBWA 1YSYA 3U61B 3L28A 2V3UA 3SHGB 3FTDA 4MNIA 2PYYA 1A54A 2X4AA 1FTAA 3IJXB 4LFAM 3SYLA 4F3BA 2CHGA 2M8CA 1Y1MA 2HEUA 2XXTA 1FPEA 1IXGA 2R6FA 3WHLA 2ZNTA 1L1TA 3B6QA 1MQDA 4BBAA 1EH3A 1NNTA 2O1MA 3B7DA 3H06B 1YTVA 3WAEA 1IMFA 4DI4B 4XKQA 2QSFX 1IN8A 3IX1A 2R71A 1XNRM 2C9CA 2ZYMA 1N36M 3ECRA 4B3TM 3CSBA 5AA1A 2GHBA 1M5BA 4QHSA 3JAMS 1G8PA 1FBPA 1H45A 2DE4A 2P1SA 3DFZA 2Q9TA 4RA1A 5ITOA 1FTJA 3GRUA 1IEJA 5FTMA 5LTCA 4KCCA 4F18A 1Y4CA 4IBIA 1FPKA 1B7HA 1UIVA 4XK8F 2VF8A 4QFKA 1NH8A 1SI1A 3IG5A 4BLAA 2UVIA 4FCVA 1ZMGA 4X1BA 4F2LA 4NG7A 4LCBA 1P1UA 1Q9DA 4O3AA 2R65A 2D21A 1I6QA 4N13A 3BBRA 3RGYA 3IL1B 3PNYA 4EQBA 3GQ3A 4MGIE 2WEFA 2CV0A 2XSZA 4N07A 3GZGA 3PUYE 2CP8A 3QWLA 4JI3M 2OLBA 5C1BA 4W5WA 3KOZE 1FCKA 4ZS9A 1IY2A 4LF4M 1YE9A 2X49A 3HZJA 4KI0E 4MLVA 4KXPA 4HCYA 2QCUA 3V89B 3CF0A 1LBBA 4YMAA 4L17A 5I56B 1B51A 2F6GA 5EJCA 4G61A 4GWZA 1KA1A 3ZKLA 1VG5A 3A46A 3PD8A 2WBBA 1IN7A 2KQZA 2V93A 4GXSB 1HNXM 3GRVA 4I81A 3PMVA 4LG2A 2DZNB 1DBZA 3O29A 4LJ5A 3MPLA 1MM6A 3L2AA 4XKPA 3PMWA 4BDLA 5I2NA 1GGGA 2EUCA 3E46A 3EN3A 5EXTA 1Z7ME 4JVCA 1MU5A 1PJQA 1MQIA 4G4QA 2WYKA 3VLUA 5FTLA 5B7DA 5BR8M 5F1QA 2O7UA 1PB7A 4JI6M 3PTYA 3T0JA 5EXPA 1FSAA 2DHRA 2R46A 2XLJA 3T93B 5DEXB 2KNAA 1LBCA 4G8NA 4LN5A 2XXUA 4WW0A 1IXSB 3TODA 5LDZA 1T6OA 4FE8A 3NWLA 1B1XA 5FLXS 3T1BA 4DLDA 5ITXE 1UIUA 4X8RA 1LCFA 2OWSA 3TL4X 4DUZM 2LHGA 4HTGA 3K6VA 4IBKA 2FFJA 3VK7A 2HQ0A 2Q88A 1VE4A 3EHSA 1A99A 4H46A 3CG3A 5CI5A 4I3EA 2XXYA 1Z5BA 4TLMB 3OELA 3H4MA 1A55A 1DO0A 2XZUA 2B3FA 2D5WA 1HR0M 2NOOA 2YLNA 5KDTB 3L26A 1MH3A 2UXAA 3Q28A 4U21A 3SEVA 4P11A 4JI7M 3RPLB 1WXQA 1NV4A 4Q8RA 3KFUG 4MGZE 3RPWA 4G77A 2FOIC 2QMXA 5CMBA 3LSXA 4NF6A 2CHQA 3QMFA 3RN8A 3H4JA 4Z7EA 5IREB 2I0CA 4I62A 2FNAA 3TTKA 1A40A 2Z3XA 2R9JA 3B7QA 4L4UA 3D4GA 3QXMA 5KPTA 3VVEA 4A3VB 4LJ9A 3E78A 2DXIA 5AA2A 2DWHA 3SZPA 2WBDA 3FRHA 2CFOA 2I3VA 1LCTA 3FUTA 1NUYA 3I51A 1NSFA 2QMWA 3FTFA 4GX3A 3KVWA 3KG2A 3E9XA 2DHYA 5I3SA 4IJFA 1WJ7A 4R75A 2RRUA 5B70A 4GFRA 1FBDA 1SXJB 4P17A 1DOTA 2A5SA 3JR5A 4OFJA 1XXHB 3MQ9A 4IO7A 3V5AA 5KQ8A 2Z8YM 2D7GA 5JTYB 3V76A 4YKIA 4EQ7A 2LVAA 3U6MA 1NH7A 2E1SA 2I7NA 1TTEA 1NV5A 4QOSA 2CV2A 4EUOA 3AFHA 1WR1B 4Z0IA 4WP2A 4P1LA 2Z8EA 4GRKA 1MXWA 1SPIA 1Y20A 1OTRA 1NJGA 1WHCA 1FBFA 3O6GA 4G68B 2I58A 4NE4A 1Q35A 1NNFA 4Q30B 1IXHA 2RCAA 3RQTA 2JY5A 2VD3A 3C4MA 1R1NA 2XXXA 1JW1A 3Q26A 3K1NA 1PB9A 1L2BA 3IAZA 2A5TB 2DXRA 3CGWA 4CISA 1I94M 1HSJA 1NFTA 1JNFA 4X65M 3SASA 1MPCA 1DCUA 3FGSA 4AS4A 2XFTA 1R9QA 4TUWA 1ORYB 3RGPA 5KZTA 3PVSA 4OENA 1XHYA 2XGNA 4F3SA 1YCJA 2QP9X 2FE8A 1MPBA 1QGXA 3ILKA 2W7YA 3S2VA 5F24A 1H3DA 1FRPA 2QENA 3KSXA 2DP8A 4OFLA 1FNNA 1WVJA 5EXSA 1O7TA 4N6KA 3MYUA 2QZ4A 1MY4A 3EQ1A 1OQHA 5F7VA 3SAVA 1B58A 2G5GX 2MKZA 5TPAB 5F3WA 2DAKA 2REGA 1MY0A 4XTCQ 4G4PA 1IQ7A 4M9XA 3MJ5A 3PPRA 2F3DA 4P0GA 4FIMA 2RF1A 2DWMA 1NNPA 1EYJA 3T22A 1KSFX 3E21A 1B46A 1FPLA 4XFEA 4CHTB 3GPUA 4NXNM 4IY5A 3KN7A 2XX7A 2ZYKA 1SG9A 3K6XA 4JBZA 1PDAA 3DA1A 1MQJA 4DIGA 3G3GA 4QHQA 3E9SA 2NXOA 1M5DA 4L8RC 1NV9A 2J7NA 1QQWA 1IIWA 1FJGM 4FEDA 1OIPA 1PBQA 5FHNA 1OFHA 2Z8FA 2NWJA 3TTLA 3TYHA 2RINA 2UXBM 4EXKA 1VEGA 3IOUA 4NGUA 4NWCA 4PETA 2DE3A 3K6UA 3LR1A 1MX0A 4PC9A 1EE8A 3U72A 1LFGA 2I49A 4N8GA 2MROB 4DV7M 2Q2AA 3B7NA 2KNZA 3O6IA 3HJQA 1J1NA 2V4CA 2Z7JA 5EYGA 2GNOA 4OX9M 1HNWM 3G3KA 3IFAA 1N0TA 2OCUA 2QPAA 2UVGA 2FH0A 2DYXA 1IMAA 4P1EA 2X7PA 5ESYA 2D3IA 1D9QA 2UXDM 3V83A 1LBXA 1H6UA 2ABHA 4O7IA 4AG5A 3ISPA 3QAUA 1P1OA 3GLGA 1R6ZA 1FQFA 4KHPM 5DYHA 3U1OA 4FWDA 1B3EA 1EYIA 4I3YA 2M5ZA 3IO4A 3VDPA 2WYPA 4MJOA 4ZECA 2A5YB 3RNNA 3W9WA 4XGIA 3GLHB 2QS4A 1XVXA 3K1PA 3M3KA 2XA5A 3TKDA 1SW5A 4LFCM 2ZXTA 4DV6M 1NV1A 4OVZA 3RUMA 2X8AA 1MRPA 3CVGA 4LZ8A 2HAUA 4MH5A 1FJ6A 2RC9A 3MVXA 2Y0TA 4PGNA 1LGBC 3FVGA 4MNCA 3SAWA 4LF8M 1US4A 1FQBA 5ELVA 2CZHA 1SW2A 1A5TA 3K6WA 4EF2A 2Q2CA 3KP1E 3QSLA 3DELB 3T9UA 2Q2EB 2O51A 1QDTA 2XF3A 1OJLA 3K92A 1Z5CA 2D7HA 3U6PA 1FBHA 4F19A 3J2PB 4N6PA 4FVMA 3HHZA 4B3RM 3N94A 4OVQA 4YU0A 4QXDA 3HX3A 3HSTA 1P99A 5I57A 1FBCA 4II7A 5FTHA 2IA4A 1P1WA 3EIEA 2UYFA 4GL0A 2WSFF 3LVVA 5ISUA 2HHHM 1NV2A 2RCBA 4KD5A 2HXRA 5IGAA 2F7BA 4ESXA 3UK4A 3UGJA 1JQJC 5AE4A 4ZZAA 4ZE8A 4LY6A 3GBAA 3PPPA 1YLAA 2DOJA 2MJ5B 4F2OA 1QZMA 2F5PA 4KLNA 2F78A 2DE2A 2VPNA 4U1OA 1N33M 1AWBA 4IO3A 4QNRA 4YKKA 1JW5A 3B74A 4FCTA 5H8HB 3U6EA 2VOZA 2XHDA 4F3GA 4NTLA 2EJSA 2KNVA 4OZ9A 2DNAA 1IBMM 1EIJA 5BUUA 1DPEA 3SDFA 3GLFB 5ITYA 4LONB 1PGYA 1N32M 4HW8A 5EXXA 4GVOA 3SATA 4LZJA 1BP5A 1WGNA 5L9MA 3VKHA 3HHWA 4D81A 1YAEA 3ZKKA 5KQDA 1R7RA 3TWLA 2RGOA 3PUZE 4KODA 2DENA 3HCQA 2PVUA 2KA6B 2UVHA 1SVXB 5ET7A 5HM4B 4PFRA 4AKIA 3DM0A 4G4RA 2H25A 5H8FA 3K8ZA 1UFZA 4P56A 2OK2A 1FTMA 2RC8A 2XWVA 1NY6A 1LBYA 3B9PA 2K47A 4G3OA 3U6LA 1AUAA 4FEBA 5ITTA 1SXJC 4P8BA 3SKPA 5E26A 5EHSA 4OQOA 4NF4B 1QAQA 3VDUA 4OVJA 4RY1A 2QS1A 3PMXA 1QVRA 4JV5M 1INPA 3U92A 1G4AE 2XXWA 5LMUM 2CRUA 3MZ9A 1IBLM 3MC2A 3VKGA 3F92A 3KS4A 1N3WA 1ZU0A 3PGFA 3MUQA 4TQUQ 3CHGA 2F3BA 2V1UA 1Z6TA 2BJIA 2V25A 3GLGE 2ONRA 5L9SA 2Y7KA 2DAGA 3FUZA 2EKFA 3Q27A 2NVUB 4RKUF 2F6PA 2L6OA 4DV0M 1UTBB 2ZBKB 3AJIB 2LWXA 5I2KA 1B5HA 1K3XA 4WURA 5I5PA 1MXVA 4AS5A 1I4WA 3IR1A 1TT1A 2YJPA 4ESWA 4ZPXA 1K82A 4OVSA 1SD3A 1N7WA 1KWHA 1C1KA 3VE1B 3KOXE 3U6OA 3GRRA 3FVKA 2YQZA 2H99A 4B7HA 4XBOA 4ND9A 1TDZA 4UN2B 2QSXA 5IAIA 3I5OA 3UN6A 3KOWE 3M7GA 4LQ5A 4DV2M 3T9XB 4BLCA 3U5ZB 1FJ9A 2FIEA 1DO2A 1L2DA 4I8OA 4KT0F 1ZQ9A 2VQFM 3AL0C 3VLVA 1P3QQ 4DR7M 1HSEA 5A5XB 4OESA 3FTEA 3IORA 4GBVA 3RY3A 2RGHA 1RDXA 4K0KM 1M5CA 4OYVA 2HWJA 3PUXE 3KS8A 3GPXA 3EPEA 1AIVA 3TCGA 2WSCF 1B3FA 2G29A 5CBSA 1AH5A 1T3TA 4NEDA 4PF6A 1R5LA 3BBZA 1V92A 4GWSA 1B5JA 1JP4A 4PDIA 4YMBA 3LUZA 5TP9B 2QS2A 3A98B 3C9HA 3L6GA 2QHOB 2JXNA 3FYDA 2ZAMA 1FPFA 3GP1A 1R4GA 3MK6A 1FBEA 4PQJA 1GTKA 3BFUA 5EQAA 3S4UA 1NUXA 1CNQA 1IN6A 3HHXA 4LJ4A 2O68A 2MGWA 1H76A 2YFQA 1I6AA 1MY1A 4WXJA 3DLNA 2ZTCA 3O66A 4RPOA 2H1RA 3GLBA 3OXNA 1J7KA 2ERCA 3H6WA 4IO4A 2FVZA 1D4NA 1QUJA 1OVTA 4NF5B 1OAIA 2RKMA 3FTCA 4F1VA 1OFIA 1LAGE 1P1NA 5IZZA 4XIGQ 3GQ5A 2EKKA 3VVDA 1FPJA 2F5SA 1USYE 4XEQA 4M0WA 1BKAA 1Y4TA 1R9LA 2HKJA 4L6V6 3IOWA 4RYAA 2XXIA 2XX9A 3QK6A 2XXQA 2WKYA 3RLFE 1SW4A 1USYH 3MWBA 3W9VA 1M5EA 3SAUA 1DGHB 2F36A 1YXIA 2ZZWA 4QFOA 4AKHA 2ESNA 5IZ7D 3FJMA 2JP7A 1B3GA 4MIJA 3ILTB 3KSJA 1Z5AA 1Q1KA 2BJJX 1DGGA 3VK8A 2UU9M 3HHYA 2DKLA 4MF3A 1QUKA 4UABA 4BDMA 2R44A 1QDRA 2JWSA 2DDKA 4FBPA 2B3TA 3TQSA 2I4BA 3TCFA 3H6UA 2HFBA 2G8LA 3TWKA 1ZIUA 1IZ1A 1B05A 1IXIA 1CUKA 2R62A 4F1UA 5KPRA 1Y3QA 3U6CA 4MX6A 1SXJD 4AKGA 2VP1A 1PEBA 3B50A 3RYDA 1OMPA 4R9GA 2KZUA 2XXVA 4JI8M 2XSZD 4IBDA 2F4VM 3MZ1A 3EF7A 3SHFA 4B3MM 3VFDA 4G8MA 4MM3B 4I4LA 7CATA 2EO2A 4ANRA 3AOEA 3FD9A 4OXVA 2DWAA 2ZYNA 1MN3A 2LVOC 1MXZA 2F34A 3VDFA 1N84A 1KYIA 1JB0F 4AB5A 5DTBA 3Q29A 4OWDA 3SEYA 2CZLA 3I3VA 1LTMA 1B4ZA 4PCZA 2GHAA 4LUBA 3SBJA 4LFBM 4IO6A 5EP2A 4GIZA 1GABA 4NF8A 4H45A 2Y5LA 1ZKBA 3UGWA 3K2LA 2GRVA 1QANA 3FVOA 5KCJA 3GPYA 2PMSA 2QFLA 3I6VA 4H5FA 2JNHA 4JDFA 1QUTA 4FD2A 3T1YM 1GJTA 3QYTA 5I58A 1G71A 2ZYOA 3BKIB 3GBBA 1PB8A 2ZANA 4ECFA 3FJGA 3D8LA 3MZBA 3O97A 4IJEA 2OQ4A 2X26A 4M9SA 2FIXA 2WZJA 2THIA 4REZA 2J5YA 3VV5A 2F5QA 1MPDA 2KRUA 2QNJA 1N04A 4UA8A 4N4UA 4F22A 4LF7M 1CB6A 1D9VA 3J27B 4IBGA 5FTNA 4CGYB 1JW4A 1HJPA 2Y5KA 4NXMM 1DTZA 2GFEA 4DXBA 4G4OA 3USDA 1FW0A 2QVRA 3C34A 5L8RF 1D0MA 3PD9A 5I59B 2R8TA 1SBPA 2DWIA 1MS7A 4ZEDA 1B52A 1E9RA 4PAIA 2K6BA 4POWA 4LATA 2VT5A 1ZMWA 2HCBA 1XI6A 1XT8A 2LNHC 1FQEA 1OAOC 2JY8A 4F1IA 4IO5A 2E5LM 3CF6E 1AIPC 3WHKA 2CZIA 4PFYA 2DAIA 4GITA 5E6JA 1B6HA 4OETA 5CMKA 3K1MA 2UXCM 3PUVE 3TAJA 5AA4A 3DP4A 4GL8A 2L4FA 5AA2D 3VLFB 1MDP1 3SEWA 1MXUA 1J09A 1ZV1A 5I2NB 2OWTA 1GLNA 4GF8A 1URGA 3KOTA 3KZGA 1B1HA 2Q8MA 1UTHB 4R3DA 2ONKE 4R72A 4NQ8A 2LH0A 2KHHA 1XNQM 3RT8A 4LJ6A 1ZMVA 2CUZA 5EQTA 1PJIA 4LA9A 1FTKA 3MMPA 3T1HM 4ZEKA 5FBPA 2O01F 5GKNA 4OVTA 1HNZM 3DZDA 2Q74A 4OVPA 4OTEA 3FASA 1NV0A 3UZUA 3QUFA 1D0KA 4DV1M 4OMBA 4JI2M 4JI0M 3ZS6A 1LB9A 1JR3D 4GMQA 3S9MC 1MXYA 2LXEA 3I4YA 4KPTA 3LSFB 3G3HA 2AHMA 2AL5A 4JSOA 2B4MA 4QSCA 5H8NA 2H4IA 5JEIA 4JVIA 4Z8XA 1FTLA 4O8MA 4IB2A 2HL7A 3A3UA 3FYCA 4O3CA 3FXQA 1G3IA 1H43A 1YZ0A 2O7IA 3K4UA 5EP3A 1A7LA 1FQDA 4LP2B 1MQHA 3IB0A 3SC3A 3U60A 4R6YA 2J7OA 2JZ0A 2HAVA 4GWUA 3RGSA 2XWOA 1US5A 4JI4M 1E94E 4QFPA 2Z4SA 4PBHA 4PFWA 1IFYA 4GIPA 4LZ5A 2G93A 2XH9A 4OFOA 4DXCA 4F39A 3GYYA 4G8HA 4LGMA 4ZEIA 3S9EA 4PE3A 1VFEA 2JZ1A 8CATA 2DZLA 2I0BA 5AA2B 3TPZA 2QVVA 1TFDA 4ISUA 3LSWA 4Q0CA 4NL4H 1B9JA 1O63A 4U2RA 4PGPA 2JY7A 2XXPA 2CHVA 3FUWA 1Z7NE 1YPNA 4RJZA 2FBPA 1URDA 3R26A 2DWJA 1EZ9A 3SYKA 1KFVA 5H8QA 1FBGA 4Q7JA 2HXWA 1IY0A 1XS5A 2OPFA 3L25A 2E0SA 2LHCA 1TFAA 4NAPA 3THIA 1K9YA 4FWHA 3GLIB 5BPVA 2PT2A 4CIZA 5DW8A 3DP8A 4NX1A 1NO1A 4DV3M 4I40A 3JZJA 2OX3A 2I3WA 2VGQA 4MHFA 3ROJA 1AL3A 3KN8A 1RU3A 2D7EA 4YICA 1R2ZA 1WIVA 2M60A 1FTOA 1VSOA 1HQCA 3HGIA 4HE1A 1OKSA 2YPNA 1EYKA 1VDDA 2DSFA 4LJAA 4IBJA 2DWZB 1N77A 2OO9A 4CJ6A 2P3NA 2ZNUA 3HKPA 3PPNA 4EDPA 3T96B 1PM5A 5AA3A 1JEVA 3M3FA 4OA4A 2H5YA 3ODBA 3LCUA 2EA0A 3OO9A 4GC9A 4K3FA 3RTWB 3I01M 4DDDA 4F2QA 3AXFA 3MAMA 4O3BA 5DT6A 4TLLB 2Q8JA 1GL6A 2FNCA 3T15A 1YUBA 3OO7A 1ZMUA 2O6AA 2Z4RA 1DSNA 4KCDA 4X62M 4P0IA 3D4CA 3C33A 5IZ3A 4IBFA 3S9NC 3SERA 2K0BX 3UP9A 2JUJA 3H7MA 1JETA 3KC0A 1UM8A 5LOMA 3IHPA 1BTJA 1TXFA 4NWDA 4MGHA 3KC1A 3BFTA 4YB6A 1QW0A 4GWYA 1GVCA 5K2YA 1I6BA 1L8QA 3KW6A 3GPPA 2Z23A 2I48A 3HO7A 4LGYA 5A2QS 2AIXA 4U22A 4UACA 2K9DA 4R2BA 2R6GE 4G2ZA 4B7FA 1GR2A 2DI0A 4KQPA 3UK6A 3W0LB 2ZNSA 5CM6A 2XFSA 1JEUA 4TOZA 1B0HA 1POY1 3TFLA 5L9OA 1BLFA 3A29A 5DNYA 3L6HA 1QKBA 3H6VA 4GRIA 5HPQA 4AW4A 3G3JA 4OVRA 3A3CA 3TWMA 3OSRA 1N34M 2KRKA 5H8SA 4EIWA 3U61A 5FHOA 1VEKA 4GEWA 3J7AS 3B7ZA 4MLQA 3WAFA 4ITQA 2Y0QA 2QJEA 4GWWA 2F5OA 4ZEBA 2WSEF 3IJOB 1QAMA 2KXEA 3M0EA 2L5VA 3K00A 3HN0A 1N3XA 4FCWA 5HBCA 3FE3A 3ZQJA 3AKZA 4DR3M 2VIIA 4QRZA 4FECA 3UMMA 4H6DA 2ZMBA 1MG1A 3F11A 1DK4A 2I7PA 5CRYA 2XZFA 1XB2B 3OMBA 3SARA 3EHTA 1GV8A 3LBSA 1QUIA 3E4RA 4P16A 1OIBA 1V33A 3GLGB 4R73A 2F8DA 3BOSA 4IGRA 1GVNA 4C1TA 1PBPA 2DAEA 2DWNA 2DVZA 5IKBA 2XEPA 3EKIA 1FPGA 3SESA 4ELPA 4PFUA 3KFMA 2ALUA 4RF1A 1G0HA 1G59A 4NRVA 5JI3E 5ITUA 4QOZC 2ZTDA 2DWLA 3MP6A 4OVZB 3R7XA 1WDNA 2R4EA 2Y7IA 1NHGC 5FSWA 4EXLA 5TU0A 1BIYA 2V3QA 1L1ZA 5JI2E 3CG1A 1IQPA 3R9XB 1DPPA 2P0SA 4QF9A 4QFNA 3V8XB 3K9OA 4Z6YA 4PT5A 4OEUA 4YB7A 3SEXA 1IMCA 5I7IA 1LFHA 3TCHA 4YKJA 4XKRA 3KDSE 4E0XA 3U93A 4HCWA 1FPIA 2G3QA 5I56A 4JSDA 1DGHA 4IBEA 2LAOA 5ITRA 4ZDMA 4MGKE 3TE6A 3C9PA 2CMOA 2F97A 3HY5A 3KXEC 1OLAA 2VPOA 3GQ4A 1S3SA 5L8DA 1ZJLA 2QBYB 1DGFA 4GXAA 2C96A 4X66M 1PJTA 4OERA 4DR5M 3K1JA 4YHHM 1NMUA 3PXGA 3B6TA 1IXZA 3VFJA 4THIA 3FIRA 3FBPA 3HPIA 5I57B 1Z59A 4R6KA 2V1CA 2L2DA 1BK4A 4HE0A 1OIZA 1KA0A 4YB5A 4C1UA 1IXRC 3LUYA 4RF0A 3GO8A 3SMPA 3FVNA 2UUBM 2VHAA 2VD2A 1LFIA 5DEXA 2XXRA 3IG8A 1F9BA 2WX9A 3T66A 1POTA 1NJFA 1IXSA 3CIJA 4JB7A 1MM7A 3QIMA 4DUYM 3OSQA 5K2XA 5ICQA 1NNKA 3TQWA 3CF2A 1SI0A 3G3FA 1QJMA 1H44A 1JVXA 3MJNA 4LRSA 3OTOM 3THGA 4GH9A 1LBWA 3U6SA 5KDTA 4KYSA 1LBZA 2YNMD 2ONSA 1D9YA 1PJJA 1IBKM 2L7HA 1FQCA 1A8EA 1N76A 5CC2A 2Y20A 1T0KA 3PFIA 3H4ZA 4X9TA 2RKOA 3RPLA 1Q02A 3FD3A 4NSOB 3VXCA 1P1QA 3EHUA 2KZSA 4BDNA 4YY3M 4ONYA 4JWXA 4XKNA 3MHVC 3JV9A 1LAXA 3B89A 2REJA 4M9ZA 4F31B 4AQYM 2UYEA 4GLIA 4B7GA 5H8FB 1B5IA 2VDBB 3FUVA 4GX4A 2BNKA 2LVPC 4RK9A 4ZZEA 1ZLQA 4PTKA 2C5RA 3FV1A 1LV7A 3N6UA 5EP1A 2DXYA 3FATA 4X48A 4DR2M 5EQ9A 4DXUA 5JK4A 1TH2A 3TEPA 4N81A 4F3PA 3C31A 3KEIA 5ITQA 3C3DA 4IO2A 5T3JA 3UJNA 3MSTA 3FZVA 1D2NA 3PPOA 1SXJA 1LEVA 1MJGM 4U4XA 4H1XA 4RPNA 3C3EA 1XXHA 2PX1A 2XD3A 4YKPA 2BJVA 5DVIA 4LRTA 5I84A 4FW9A 2HAKA 3ZSFA 2KW0A 1BVSA 1GKIA 3RTFB 2C9OA 3IK6B 5I59A 5JTYA 4H8IA 4S12A 4E0WA 4ZE9A 4EF1A 5ICTA 2DZOB 4JI5M 3CR9A 3T9HB 3ZH9B 1RDZA 5I2KB 3PV0E 1B40A 2PFZA 4G68A 1Y3PA 3LMMA 3LW5F 1S7YA 4ZEFA 3IB1A 3S9LC 3AV0A 4MAGA 1AOVA 1X37A 1Q3BA 3J80S 3ZCBB 1VFDA 3U8QA 5FTJA 2HZLA 3LV0A 4GHAA 2A5TA 1NKXA 2V3TA 1TGUA 1C7YA 4JN6A 1G0IA 5EHMA 3B8BA 4X64M 1HSLA 4PE5B 3D8BA 1UTHA 2Q89A 2Z22A 2YR0A 4NC6A 1K3WA 1HT2E 3QYEA 1B7UA 1Y9UA 1XOCA 5DYIA 2OJTA 1W5SA 4NN3A 4JI1M 2BJWA 2ANJA 2OWZA 4MH0E 2ZM6M 1XWIA 5EP4A 4FAJA 3FXBA 3A45A 3SETA 3OO8A 3MPKA 1O64A 1LB8A 4Y28F 5DYGA 2PFYA 4O7MA 2KR0A 2HZKA 2O69A 3K2DA 3BXWA 5TPAA 3SMSA 3TTRA 4MNPA 1XMQM 4IR8A 2L7IA 1MH4A 5EQ7A 1T43A 3RE8A 2XX8A 1AMFA 1DGBA 1VR5A 1B4HA 1SQYA 2UUCM 3TTMA 1RYOA 1IY1A 3U94A 2ZZVA 4NSRA 1XMOM 2FS1A 4DR4M 2Y7RA 5A5LA 5J1DA 3KOYE 4R74A 3R6UA 2GQ1A 3SEUA 3TQLA 3BIGA 3HJ8A 3L27A 4HEOA 4MMPA 2H98A 1II5A 4MBPA 3NOHA 3MVZA 3PU5A 5ET5A 3BIHA 2DS9A 4H65A 1S9TA 2I6EA 2ZAOA 1IMEA 3QAXA 4PFIA 4N8YA 4PFTA 2N35A 3N5LA 4IBCA 3QYBA 3T38A 4I5SA 5EYHA 1NUWA 4I1DA 2C99A 2XWKA 3UIFA 1CE2A 4U1ZA 1ZTYA 4OHNA 4L16A 3HJSA 4POXA 1IN4A 4R71A 2O5RA 3KBZA 4OANA 2HPGA 1Q39A 3MVWA 4BDRA 5IM2A 4QSDA 5EQ8A 4RNSA 4C0RA 3FXRA 1QUSA 3EIHA 3GLIA 3HU1A 3T6PA 1ATGA 2P5TA 4HE2A 3JYRA 4M0DA 1IMDA 1SDXA 2LTUA 2B3BA 1RKMA 1SW1A 3GXAA 2R0IA 3GLHA 1LAFE 1JR3A 4PDDA 1QKAA 1E32A 1N7XA 4QSEA 4JWYA 3U65A 1HQYE 1VDLA 2LVQD 2L4EA 2KLFA 3K02A 4DV5M 4NMYA 1JVYA 2XXKA 4DI3D 3KOSA 4OU7A 2F35A 4PD2A 4IGTA 1SXJE 3KN3A 5IZ1A 2LVNC 1SYIA 3W15C 3L29A 4R2FA 1XXHE 3O6HA 4QNMA 1B3HA 1ZBMA 2QPQA 1PRBA 1Y3NA 3MW0A 3DOAA 4QFLA 4N17A 2DAMA 4B08A 2CE7A 4P3LA 3MP8A 1XC1A 1ZAEA 2PT1A 3FV2A 1MDQA 1GO5A 2QRYA 4PFBA 2MH8A 2OBGA 2MR9A 4WKMA 5H37D 1W5TA 4H5GA 4BDQA 3HV1A 3G3IA 1NUZA 3TELA 3CTWB 3W0FA 5DVFA 3TMGA 4GX6A 1QZEA 1NL5A 1MY2A
chains in the Genus database with same CATH topology
3ZC7B 4NF8B 5ITPA 5IT9S 1D3KA 4LVQA 3TPAA 4OW0A 4DV4M 4FJPA 4R6HA 1LSTA 1N75A 3C35A 5KCJB 4DR1M 4NF6B 5KPZA 3O28A 4LF9M 2HCAA 4KFQA 3J7BA 5I58B 3CI8A 4R9FA 3NBIA 4U4SA 5CMCA 1IM2A 4ELQA 3SFZA 4JXJA 2F7AA 5H8HA 3ONMA 2Y84A 2F5NA 1QAOA 3HU2A 3PUWE 3CFLA 3C58A 1IXCA 3GLFA 1SYHA 4ELRA 4GC5A 1J5EM 2KEBA 2AYSA 4IIWA 4HL4A 3P7IA 4F1YA 1ANFA 2X7QA 4AI6A 3M8UA 5DVJA 3FUXA 3PPQA 1R2YA 3PNVA 2CEAA 4LQ2A 5M2VA 3LC8A 2VQEM 2FYIA 4LZ7A 3FXUA 1TH3A 2DQVA 4JWOA 1NVMA 1G41A 3K01A 5LMNM 3CRBA 1XHBA 3N26A 2DVWB 5EYFA 4RXLA 2Y7WA 4WEPA 4KHZE 4B3SM 3C36A 4NF4A 5AA4B 4D80A 3KBRA 4JXIA 1RYXA 2IEEA 1TDHA 4AQ4A 4MB7A 3Q8XA 3MBPA 4WEDA 4R7GA 1HT1E 4BDOA 3AOGA 3VXBA 4GKJM 3LSLA 1MY3A 3TDJA 4GHLA 2F7CA 2V84A 5FTKA 1UTBA 3E13X 1TWYA 4LJ7A 3I4VA 4HS7A 4I8CA 4LZZA 2F5XA 2O84X 1B7ZA 4AG6A 5CMMA 4GWOA 3ILUB 3HWSA 2O1LA 1M5FA 3H03A 5H8NB 2QBYA 2AL4A 3OOAA 1IN5A 3JR4A 2UUAM 3FJ7A 2R45A 3UORA 1TH4A 1UQWA 1OLCA 2NUVA 4L78A 3LQQA 1LAHE 4KYEA 2B65A 3U60B 4QHTA 2W82A 1OQGA 1QVSA 3U5ZA 4I9DA 3HHFA 3MVYA 4AZFA 1LLSA 3O2AA 5A5XA 2XXHA 1NHWC 4NOOB 3K0VA 4AB6A 2Y7PA 1WODA 3OEMA 3TUSA 4Q5TA 4DCXA 4HLQA 4PDGA 5FHMA 3T9VA 1A8FA 3KP0E 1PC3A 3OD7A 3UA8A 1URSA 4YZZA 3A09A 4FATA 4M4GA 4DZ1A 4NRWA 4JYAM 4DE8A 1R6BX 4FORA 1IUDA 1QYRA 4LJ8A 5TP9A 1MQGA 3MP1A 2QL3A 1NNJA 5H8QB 2XD2A 2OZZA 3B6WA 4DR6M 3M3LA 3U6QA 4L15A 3KGCA 4DCYA 4MGYE 4X1DA 1L5TA 3CFZA 3HU3A 1FQAA 3QUJA 2H9BA 2QS3A 4PP0A 4IY6A 1JQFA 2UVJA 5IWAM 3J81S 4YAHX 4U23A 5BWJA 1I69A 4NF5A 1S50A 3KJTA 4F29A 2C98A 1EU8A 3N6TA 3IB2A 4OEVA 1L2CA 1EZOA 3OENA 2R18A 2GH9A 2V6ZM 2RC7A 4M1VA 3FKEA 1OVBA 5C18A 2NQ8C 1XVYA 3LQRA 1EZPA 1B0LA 4EQ9A 1Q3CA 3FUUA 4FWGA 3O9PA 4MFIA 3VVFA 4G4NA 4LF6M 4ELOA 4KYDA 3G7WA 5KO3A 3H3GA 3TZAA 4GD5A 1NY5A 3RT6B 3R8FA 1MXXA 1ELJA 3DP6A 4G68C 4KO8A 5CBRA 3U6DA 1DTGA 1QULA 1B3LA 3LVWA 3TTNA 2PBWA 4H0WA 3VLWA 1NNUC 5ITXA 4H67A 3OEKA 3IOTA 2DVCA 2JA2A 4RK2A 3CSGA 3KJ7A 2FA7A 2Z8DA 4KR5A 4BB9A 2I4CA 4H8JA 2L09A 3RFWA 3IO6A 1IITA 1N78A 3C32A 3H6TA 2Y21A 3AOEC 2P2AA 3GRYA 1E9SA 4IBBA 3E3KA 4G6ZA 1GL7A 1B2HA 1Y1ZA 3Q25A 4LF5M 4GQOA 3IOVA 2CV1A 1DMBA 4XXUA 4D82A 5FTIA 3M6AA 3OO6A 2R4JA 3HHGA 4RNAA 3A42A 3CFXA 1B32A 4GKKM 4GOTA 1XC8A 1YSYA 3U61B 3L28A 2V3UA 3SHGB 3FTDA 2PYYA 1A54A 2X4AA 3IJXB 4LFAM 3SYLA 4F3BA 2CHGA 2M8CA 1Y1MA 2HEUA 2XXTA 1IXGA 3WHLA 2ZNTA 1L1TA 3B6QA 1MQDA 4BBAA 1EH3A 1NNTA 2O1MA 3B7DA 3H06B 1YTVA 3WAEA 4XKQA 1IN8A 3IX1A 2R71A 1XNRM 2C9CA 2ZYMA 1N36M 3ECRA 4B3TM 3CSBA 5AA1A 2GHBA 1M5BA 4QHSA 3JAMS 1G8PA 1H45A 2DE4A 2P1SA 3DFZA 2Q9TA 4RA1A 5ITOA 3GRUA 1FTJA 1IEJA 5FTMA 4KCCA 4F18A 1Y4CA 4IBIA 1B7HA 1UIVA 4QFKA 4BLAA 1NH8A 1SI1A 3IG5A 2UVIA 4FCVA 1ZMGA 4X1BA 4LCBA 1P1UA 4O3AA 2R65A 2D21A 1I6QA 4N13A 3BBRA 3RGYA 3IL1B 3PNYA 4EQBA 3GQ3A 4MGIE 2CV0A 2XSZA 4N07A 3GZGA 3PUYE 3QWLA 4JI3M 2OLBA 5C1BA 4W5WA 3KOZE 1FCKA 4ZS9A 1IY2A 4LF4M 1YE9A 2X49A 4MLVA 4KI0E 4HCYA 2QCUA 3V89B 3CF0A 1LBBA 4YMAA 4L17A 5I56B 1B51A 2F6GA 5EJCA 3ZKLA 3A46A 3PD8A 1IN7A 2V93A 4GXSB 1HNXM 3GRVA 4I81A 3PMVA 4LG2A 2DZNB 3O29A 4LJ5A 3MPLA 1MM6A 3L2AA 4XKPA 3PMWA 4BDLA 5I2NA 1GGGA 2EUCA 3EN3A 5EXTA 1Z7ME 1MU5A 1MQIA 4G4QA 3VLUA 5B7DA 5FTLA 5BR8M 5F1QA 2O7UA 1PB7A 4JI6M 5EXPA 2DHRA 2R46A 2XLJA 3T93B 5DEXB 1LBCA 4G8NA 2XXUA 4WW0A 1IXSB 3TODA 4FE8A 3NWLA 1B1XA 5FLXS 4DLDA 5ITXE 1UIUA 1LCFA 2OWSA 3TL4X 4DUZM 4HTGA 3K6VA 4IBKA 2FFJA 3VK7A 2HQ0A 2Q88A 1VE4A 3EHSA 1A99A 5CI5A 3CG3A 2XXYA 1Z5BA 4TLMB 3OELA 3H4MA 1A55A 1DO0A 2XZUA 2B3FA 2D5WA 1HR0M 2NOOA 2YLNA 5KDTB 3L26A 1MH3A 2UXAA 3Q28A 4U21A 3SEVA 4P11A 4JI7M 1WXQA 4Q8RA 3KFUG 4MGZE 3RPWA 4G77A 2FOIC 2QMXA 5CMBA 3LSXA 4NF6A 2CHQA 3RN8A 4Z7EA 5IREB 2I0CA 4I62A 2FNAA 3TTKA 1A40A 2Z3XA 2R9JA 4L4UA 3D4GA 3QXMA 5KPTA 3VVEA 4A3VB 4LJ9A 2DXIA 5AA2A 2DWHA 2CFOA 2I3VA 1LCTA 3FUTA 2QMWA 3I51A 1NSFA 3FTFA 3KVWA 3KG2A 3E9XA 4IJFA 4R75A 5B70A 4GFRA 1SXJB 1DOTA 2A5SA 3JR5A 4OFJA 1XXHB 3MQ9A 4IO7A 3V5AA 5KQ8A 2D7GA 5JTYB 4YKIA 4EQ7A 3U6MA 1NH7A 2E1SA 2I7NA 4QOSA 2CV2A 4EUOA 3AFHA 4Z0IA 2Z8EA 4GRKA 1MXWA 1Y20A 1NJGA 3O6GA 4G68B 2I58A 4NE4A 1Q35A 1NNFA 4Q30B 1IXHA 2RCAA 3RQTA 2VD3A 3C4MA 1R1NA 2XXXA 1JW1A 3Q26A 3K1NA 1PB9A 1L2BA 3IAZA 2A5TB 2DXRA 4CISA 1I94M 1HSJA 1NFTA 1JNFA 4X65M 3SASA 1MPCA 3FGSA 2XFTA 1R9QA 4TUWA 1ORYB 3RGPA 5KZTA 3PVSA 4OENA 1XHYA 2XGNA 4F3SA 1YCJA 2QP9X 2FE8A 1MPBA 3ILKA 2W7YA 3S2VA 1H3DA 2QENA 3KSXA 2DP8A 4OFLA 1FNNA 1WVJA 5EXSA 1O7TA 2QZ4A 1MY4A 3EQ1A 1OQHA 5F7VA 3SAVA 1B58A 2G5GX 5TPAB 5F3WA 2REGA 1MY0A 4XTCQ 4G4PA 1IQ7A 4M9XA 3MJ5A 3PPRA 4P0GA 4FIMA 2RF1A 2DWMA 1NNPA 3T22A 1KSFX 1B46A 4CHTB 3GPUA 4NXNM 4IY5A 3KN7A 2XX7A 2ZYKA 3K6XA 4JBZA 1PDAA 3DA1A 1MQJA 4DIGA 3G3GA 4QHQA 3E9SA 2NXOA 1M5DA 4L8RC 2J7NA 1QQWA 1IIWA 1FJGM 4FEDA 1PBQA 5FHNA 1OFHA 2Z8FA 2NWJA 3TTLA 3TYHA 2RINA 2UXBM 4EXKA 3IOUA 4NWCA 4PETA 2DE3A 3K6UA 3LR1A 1MX0A 1EE8A 3U72A 1LFGA 2I49A 4DV7M 2Q2AA 3O6IA 3HJQA 1J1NA 2Z7JA 4OX9M 1HNWM 3G3KA 1N0TA 2OCUA 2QPAA 2UVGA 2DYXA 2X7PA 2D3IA 2UXDM 3V83A 1H6UA 2ABHA 4AG5A 3QAUA 1P1OA 3GLGA 1R6ZA 1FQFA 4KHPM 5DYHA 3U1OA 4FWDA 1B3EA 2M5ZA 3IO4A 3VDPA 4ZECA 2A5YB 3RNNA 3W9WA 4XGIA 3GLHB 2QS4A 1XVXA 3K1PA 3M3KA 3TKDA 1SW5A 4LFCM 2ZXTA 4DV6M 4OVZA 3RUMA 2X8AA 1MRPA 3CVGA 4LZ8A 2HAUA 4MH5A 2RC9A 3MVXA 2Y0TA 1LGBC 3FVGA 3SAWA 4LF8M 1US4A 1FQBA 5ELVA 1SW2A 3K6WA 4EF2A 2Q2CA 3KP1E 3QSLA 3DELB 3T9UA 2Q2EB 2O51A 2XF3A 1OJLA 3K92A 1Z5CA 2D7HA 3U6PA 4F19A 3J2PB 4N6PA 4FVMA 3HHZA 4B3RM 3N94A 4YU0A 3HSTA 1P99A 5I57A 4II7A 5FTHA 2IA4A 1P1WA 3EIEA 2UYFA 4GL0A 5ISUA 3LVVA 2HHHM 2RCBA 4KD5A 2F7BA 4ESXA 3UK4A 3UGJA 1JQJC 5AE4A 4ZZAA 4ZE8A 4LY6A 3GBAA 3PPPA 2DOJA 4F2OA 1QZMA 2F5PA 4KLNA 2F78A 2DE2A 4U1OA 1N33M 4IO3A 4YKKA 4QNRA 1JW5A 5H8HB 4FCTA 3U6EA 2VOZA 2XHDA 4F3GA 4NTLA 4OZ9A 1IBMM 5BUUA 1DPEA 3SDFA 3GLFB 5ITYA 4LONB 1N32M 4HW8A 5EXXA 4GVOA 3SATA 4LZJA 1BP5A 5L9MA 3VKHA 3HHWA 4D81A 1YAEA 3ZKKA 5KQDA 1R7RA 3TWLA 2RGOA 3PUZE 4KODA 3HCQA 2PVUA 2KA6B 2UVHA 1SVXB 5HM4B 4AKIA 3DM0A 4G4RA 2H25A 5H8FA 3K8ZA 2OK2A 1FTMA 2RC8A 1NY6A 3B9PA 2K47A 3U6LA 4FEBA 5ITTA 1SXJC 3SKPA 5E26A 5EHSA 4OQOA 4NF4B 1QAQA 3VDUA 4OVJA 4RY1A 2QS1A 3PMXA 1QVRA 4JV5M 3U92A 1G4AE 2XXWA 5LMUM 3MZ9A 1IBLM 3MC2A 3VKGA 3KS4A 1N3WA 1ZU0A 3PGFA 3MUQA 4TQUQ 2V1UA 1Z6TA 2V25A 2ONRA 5L9SA 2Y7KA 3FUZA 3Q27A 2NVUB 2F6PA 2L6OA 4DV0M 1UTBB 2ZBKB 3AJIB 2LWXA 5I2KA 1B5HA 1K3XA 4WURA 1MXVA 1I4WA 3IR1A 1TT1A 2YJPA 4ESWA 4ZPXA 1K82A 1SD3A 1N7WA 1KWHA 1C1KA 3VE1B 3KOXE 3U6OA 3GRRA 3FVKA 2YQZA 2H99A 4B7HA 4XBOA 4ND9A 1TDZA 2QSXA 5IAIA 3I5OA 3UN6A 3KOWE 3M7GA 4LQ5A 4DV2M 3T9XB 4BLCA 3U5ZB 1DO2A 1L2DA 4I8OA 1ZQ9A 2VQFM 3AL0C 3VLVA 4DR7M 1HSEA 5A5XB 4OESA 3FTEA 3IORA 3RY3A 2RGHA 4K0KM 1M5CA 4OYVA 3PUXE 3KS8A 3GPXA 3EPEA 1AIVA 3TCGA 1B3FA 2G29A 5CBSA 1AH5A 1T3TA 4NEDA 1B5JA 4PDIA 4YMBA 5TP9B 2QS2A 3A98B 3C9HA 3L6GA 3FYDA 2ZAMA 3GP1A 3MK6A 4PQJA 1GTKA 3BFUA 3S4UA 1IN6A 3HHXA 4LJ4A 2O68A 1H76A 2YFQA 1I6AA 1MY1A 4WXJA 3DLNA 3O66A 4RPOA 2H1RA 3GLBA 3OXNA 1J7KA 2ERCA 3H6WA 4IO4A 1D4NA 1QUJA 1OVTA 4NF5B 2RKMA 3FTCA 4F1VA 1OFIA 1LAGE 1P1NA 4XIGQ 3GQ5A 3VVDA 2F5SA 1USYE 4M0WA 1BKAA 1Y4TA 1R9LA 2HKJA 3IOWA 4RYAA 2XXIA 2XX9A 3QK6A 2XXQA 2WKYA 3RLFE 1SW4A 1USYH 3MWBA 3W9VA 1M5EA 3SAUA 1DGHB 2F36A 4QFOA 4AKHA 2ESNA 5IZ7D 3FJMA 1B3GA 3ILTB 3KSJA 1Z5AA 1Q1KA 2BJJX 1DGGA 3VK8A 2UU9M 3HHYA 4MF3A 1QUKA 4BDMA 3TQSA 2I4BA 3TCFA 3H6UA 2HFBA 2G8LA 3TWKA 1ZIUA 1IZ1A 1B05A 1IXIA 2R62A 4F1UA 5KPRA 1Y3QA 3U6CA 1SXJD 4AKGA 2VP1A 1PEBA 1OMPA 4R9GA 2KZUA 2XXVA 4JI8M 2XSZD 4IBDA 2F4VM 3MZ1A 3EF7A 3SHFA 4B3MM 3VFDA 4G8MA 4MM3B 4I4LA 7CATA 2EO2A 3AOEA 3FD9A 4OXVA 2DWAA 2ZYNA 1MXZA 2F34A 3VDFA 1N84A 1KYIA 4AB5A 5DTBA 3Q29A 4OWDA 3SEYA 2CZLA 3I3VA 1B4ZA 4PCZA 2GHAA 4LUBA 3SBJA 4LFBM 4IO6A 5EP2A 4GIZA 4NF8A 1ZKBA 3UGWA 3K2LA 2GRVA 1QANA 3FVOA 5KCJA 3GPYA 2PMSA 4H5FA 3I6VA 4JDFA 4FD2A 3T1YM 3QYTA 5I58A 2ZYOA 3BKIB 3GBBA 1PB8A 2ZANA 4ECFA 3FJGA 3D8LA 3MZBA 3O97A 4IJEA 2OQ4A 2X26A 4M9SA 2THIA 4REZA 3VV5A 2F5QA 1MPDA 2KRUA 1N04A 4UA8A 4F22A 4LF7M 1CB6A 1D9VA 3J27B 4IBGA 5FTNA 4CGYB 1JW4A 4NXMM 1DTZA 2GFEA 4DXBA 4G4OA 3USDA 1FW0A 3C34A 3PD9A 5I59B 1SBPA 2DWIA 1MS7A 4ZEDA 1B52A 1E9RA 4POWA 4LATA 2HCBA 1XT8A 2LNHC 1FQEA 4IO5A 2E5LM 3CF6E 3WHKA 4PFYA 4GITA 5E6JA 1B6HA 4OETA 5CMKA 3K1MA 2UXCM 3PUVE 3TAJA 5AA4A 3DP4A 4GL8A 5AA2D 3VLFB 1MDP1 3SEWA 1MXUA 1J09A 5I2NB 2OWTA 1GLNA 4GF8A 1URGA 3KOTA 3KZGA 1B1HA 1UTHB 4R3DA 2ONKE 4R72A 2LH0A 1XNQM 3RT8A 4LJ6A 2CUZA 1PJIA 5EQTA 4LA9A 1FTKA 3T1HM 4ZEKA 5GKNA 1HNZM 3DZDA 4OTEA 3FASA 3UZUA 3QUFA 4DV1M 4OMBA 4JI2M 4JI0M 3ZS6A 1LB9A 1JR3D 4GMQA 3S9MC 1MXYA 2LXEA 3I4YA 4KPTA 3LSFB 3G3HA 2AHMA 2AL5A 4JSOA 4QSCA 5H8NA 2H4IA 5JEIA 4Z8XA 1FTLA 4IB2A 2HL7A 3A3UA 3FYCA 4O3CA 3FXQA 1G3IA 1H43A 2O7IA 3K4UA 5EP3A 1A7LA 1FQDA 4LP2B 1MQHA 3IB0A 3SC3A 3U60A 4R6YA 2J7OA 2HAVA 3RGSA 1US5A 4JI4M 1E94E 4QFPA 2Z4SA 4PFWA 4GIPA 4LZ5A 2G93A 2XH9A 4OFOA 4DXCA 4F39A 4G8HA 4LGMA 4ZEIA 3S9EA 1VFEA 8CATA 2I0BA 5AA2B 3TPZA 1TFDA 4ISUA 3LSWA 4Q0CA 4NL4H 1B9JA 1O63A 4U2RA 2XXPA 2CHVA 3FUWA 1Z7NE 1YPNA 4RJZA 1URDA 3R26A 2DWJA 1EZ9A 3SYKA 1KFVA 5H8QA 2HXWA 1IY0A 1XS5A 2OPFA 3L25A 2E0SA 1TFAA 3THIA 4FWHA 3GLIB 5BPVA 2PT2A 3DP8A 4DV3M 3JZJA 2I3WA 2VGQA 1AL3A 3KN8A 2D7EA 4YICA 1R2ZA 2M60A 1FTOA 1VSOA 1HQCA 3HGIA 2YPNA 1VDDA 2DSFA 4LJAA 4IBJA 2DWZB 1N77A 2ZNUA 3HKPA 3PPNA 4EDPA 3T96B 1PM5A 5AA3A 1JEVA 3M3FA 2H5YA 3ODBA 2EA0A 3OO9A 4GC9A 4K3FA 3RTWB 4DDDA 4F2QA 3AXFA 3MAMA 4O3BA 5DT6A 4TLLB 2Q8JA 1GL6A 2FNCA 3T15A 1YUBA 3OO7A 2O6AA 2Z4RA 1DSNA 4KCDA 4X62M 4P0IA 3D4CA 3C33A 4IBFA 3S9NC 3SERA 3UP9A 3H7MA 1JETA 1UM8A 5LOMA 1BTJA 1TXFA 4NWDA 4MGHA 3BFTA 4YB6A 1QW0A 1GVCA 5K2YA 1I6BA 1L8QA 3KW6A 3GPPA 2Z23A 2I48A 3HO7A 4LGYA 5A2QS 2AIXA 4U22A 4UACA 4R2BA 2R6GE 4G2ZA 4B7FA 1GR2A 4KQPA 3UK6A 3W0LB 2ZNSA 5CM6A 2XFSA 1JEUA 4TOZA 1B0HA 1POY1 3TFLA 5L9OA 1BLFA 5DNYA 3L6HA 1QKBA 3H6VA 4GRIA 5HPQA 4AW4A 3G3JA 3A3CA 3TWMA 3OSRA 1N34M 2KRKA 5H8SA 4EIWA 3U61A 5FHOA 3J7AS 4MLQA 3WAFA 4ITQA 2Y0QA 2QJEA 4ZEBA 2F5OA 3IJOB 1QAMA 2KXEA 3M0EA 3K00A 3HN0A 1N3XA 4FCWA 5HBCA 3AKZA 4DR3M 2VIIA 4QRZA 4FECA 3UMMA 4H6DA 2ZMBA 1MG1A 3F11A 2I7PA 5CRYA 2XZFA 3OMBA 3SARA 3EHTA 1GV8A 3LBSA 1QUIA 3E4RA 4P16A 1OIBA 3GLGB 4R73A 2F8DA 3BOSA 4IGRA 1GVNA 4C1TA 1PBPA 2DWNA 2DVZA 5IKBA 2XEPA 3SESA 4ELPA 4PFUA 3KFMA 2ALUA 4RF1A 1G59A 4NRVA 5JI3E 5ITUA 4QOZC 2DWLA 3MP6A 4OVZB 3R7XA 1WDNA 2R4EA 2Y7IA 1NHGC 5FSWA 4EXLA 5TU0A 1BIYA 2V3QA 1L1ZA 5JI2E 3CG1A 1IQPA 3R9XB 1DPPA 2P0SA 4QF9A 4QFNA 3V8XB 4Z6YA 4PT5A 4OEUA 4YB7A 3SEXA 1LFHA 3TCHA 4YKJA 4XKRA 3KDSE 4E0XA 3U93A 4HCWA 5I56A 4JSDA 1DGHA 4IBEA 2LAOA 5ITRA 4ZDMA 4MGKE 3TE6A 2F97A 2CMOA 3KXEC 1OLAA 3GQ4A 1S3SA 5L8DA 1ZJLA 2QBYB 1DGFA 4GXAA 2C96A 4X66M 4OERA 4DR5M 3K1JA 4YHHM 1NMUA 3PXGA 3B6TA 1IXZA 3VFJA 4THIA 3FIRA 3HPIA 5I57B 1Z59A 4R6KA 2V1CA 4YB5A 4C1UA 1IXRC 3LUYA 4RF0A 3GO8A 3SMPA 3FVNA 2UUBM 2VHAA 2VD2A 1LFIA 5DEXA 2XXRA 3IG8A 1F9BA 3T66A 1POTA 1NJFA 3CIJA 4JB7A 1MM7A 3QIMA 4DUYM 3OSQA 5K2XA 5ICQA 1NNKA 3TQWA 3CF2A 1SI0A 3G3FA 1QJMA 1H44A 1JVXA 3MJNA 4LRSA 3OTOM 3THGA 4GH9A 3U6SA 5KDTA 4KYSA 2YNMD 2ONSA 1D9YA 1PJJA 1IBKM 2L7HA 1FQCA 1A8EA 1N76A 5CC2A 2Y20A 1T0KA 3PFIA 3H4ZA 4X9TA 2RKOA 3FD3A 4NSOB 3VXCA 1P1QA 3EHUA 2KZSA 4BDNA 4YY3M 4ONYA 4JWXA 4XKNA 3MHVC 3JV9A 1LAXA 2REJA 4M9ZA 4F31B 4AQYM 2UYEA 4GLIA 4B7GA 5H8FB 1B5IA 3FUVA 2BNKA 4RK9A 4ZZEA 1ZLQA 2C5RA 3FV1A 1LV7A 3N6UA 5EP1A 2DXYA 3FATA 4X48A 4DR2M 4DXUA 5JK4A 1TH2A 3TEPA 4F3PA 3C31A 3KEIA 5ITQA 4IO2A 3UJNA 3FZVA 1D2NA 3PPOA 1SXJA 4U4XA 4H1XA 4RPNA 1XXHA 2PX1A 2XD3A 4YKPA 2BJVA 5DVIA 4LRTA 5I84A 4FW9A 3ZSFA 2KW0A 1GKIA 3RTFB 2C9OA 3IK6B 5I59A 5JTYA 4H8IA 4S12A 4E0WA 4ZE9A 4EF1A 5ICTA 2DZOB 4JI5M 3CR9A 3T9HB 3ZH9B 5I2KB 3PV0E 1B40A 4G68A 1Y3PA 3LMMA 1S7YA 4ZEFA 3IB1A 3S9LC 3AV0A 1AOVA 1X37A 1Q3BA 3J80S 3ZCBB 1VFDA 3U8QA 5FTJA 2HZLA 4GHAA 2A5TA 1NKXA 2V3TA 1TGUA 4JN6A 5EHMA 4X64M 1HSLA 4PE5B 3D8BA 1UTHA 2Q89A 2Z22A 2YR0A 1K3WA 1HT2E 1B7UA 1Y9UA 1XOCA 5DYIA 2OJTA 1W5SA 4JI1M 2BJWA 2ANJA 4MH0E 2ZM6M 1XWIA 5EP4A 4FAJA 3A45A 3SETA 3OO8A 3MPKA 1O64A 1LB8A 5DYGA 2HZKA 2O69A 3K2DA 5TPAA 3SMSA 3TTRA 1XMQM 2L7IA 1MH4A 3RE8A 2XX8A 1AMFA 1DGBA 1VR5A 1B4HA 1SQYA 2UUCM 3TTMA 1RYOA 1IY1A 3U94A 4NSRA 1XMOM 4DR4M 2Y7RA 5J1DA 3KOYE 4R74A 3R6UA 3SEUA 3TQLA 3HJ8A 3L27A 2H98A 1II5A 4MBPA 3MVZA 3PU5A 2DS9A 4H65A 1S9TA 2I6EA 2ZAOA 3QAXA 4PFTA 3N5LA 4IBCA 3T38A 4I5SA 4I1DA 2C99A 3UIFA 1CE2A 4U1ZA 1ZTYA 4OHNA 4L16A 3HJSA 4POXA 1IN4A 2O5RA 1Q39A 3MVWA 4BDRA 4QSDA 4RNSA 4C0RA 3FXRA 3EIHA 3GLIA 3HU1A 1ATGA 2P5TA 3JYRA 4M0DA 1SDXA 2B3BA 1RKMA 1SW1A 3GXAA 3GLHA 1LAFE 1JR3A 1QKAA 1E32A 1N7XA 4QSEA 4JWYA 1HQYE 2KLFA 3K02A 4DV5M 4NMYA 1JVYA 3KOSA 4OU7A 2F35A 4PD2A 4IGTA 1SXJE 3KN3A 1SYIA 3W15C 3L29A 4R2FA 3O6HA 4QNMA 1B3HA 1ZBMA 2QPQA 1Y3NA 3MW0A 3DOAA 4QFLA 4B08A 2CE7A 3MP8A 1XC1A 1ZAEA 2PT1A 3FV2A 1MDQA 2QRYA 2OBGA 4WKMA 5H37D 1W5TA 4H5GA 4BDQA 3HV1A 3G3IA 3TELA 3CTWB 3W0FA 5DVFA 3TMGA 1NL5A 1MY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF8 B;  5ITP A;  1D3K A;  4LVQ A;  3TPA A;  4FJP A;  4R6H A;  1LST A;  3C35 A;  5KCJ B;  4NF6 B;  3O28 A;  2HCA A;  4KFQ A;  5I58 B;  3CI8 A;  4R9F A;  4U4S A;  5CMC A;  4ELQ A;  2F7A A;  5H8H A;  3ONM A;  2Y84 A;  3PUW E;  3CFL A;  1IXC A;  1SYH A;  4ELR A;  2AYS A;  3P7I A;  4F1Y A;  1ANF A;  2X7Q A;  3M8U A;  5DVJ A;  3PPQ A;  4LQ2 A;  5M2V A;  3LC8 A;  2FYI A;  4LZ7 A;  3FXU A;  2DQV A;  4JWO A;  3K01 A;  3CRB A;  3N26 A;  5EYF A;  4RXL A;  2Y7W A;  4WEP A;  4KHZ E;  3C36 A;  4NF4 A;  5AA4 B;  3KBR A;  4JXI A;  1RYX A;  2IEE A;  4AQ4 A;  3MBP A;  4WED A;  4BDO A;  3VXB A;  3LSL A;  1MY3 A;  3TDJ A;  2F7C A;  2V84 A;  1UTB A;  3E13 X;  1TWY A;  4HS7 A;  4I8C A;  2F5X A;  2O84 X;  1B7Z A;  5CMM A;  4GWO A;  3ILU B;  2O1L A;  1M5F A;  3H03 A;  5H8N B;  2AL4 A;  3OOA A;  3FJ7 A;  3UOR A;  1UQW A;  1OLC A;  2NUV A;  1LAH E;  4KYE A;  2B65 A;  1QVS A;  1OQG A;  4I9D A;  3HHF A;  3MVY A;  1LLS A;  3O2A A;  5A5X A;  2XXH A;  3K0V A;  4AB6 A;  2Y7P A;  1WOD A;  3OEM A;  3TUS A;  4Q5T A;  4DCX A;  3T9V A;  5FHM A;  1A8F A;  1PC3 A;  3OD7 A;  3UA8 A;  1URS A;  4YZZ A;  3A09 A;  4FAT A;  4M4G A;  4DZ1 A;  4DE8 A;  4FOR A;  1IUD A;  5TP9 A;  1MQG A;  3MP1 A;  2QL3 A;  5H8Q B;  2XD2 A;  2OZZ A;  3B6W A;  3M3L A;  3KGC A;  4DCY A;  4X1D A;  1L5T A;  3CFZ A;  1FQA A;  3QUJ A;  2H9B A;  2QS3 A;  4PP0 A;  4IY6 A;  1JQF A;  2UVJ A;  4YAH X;  4U23 A;  5BWJ A;  1I69 A;  4NF5 A;  1S50 A;  3KJT A;  1EU8 A;  3N6T A;  3IB2 A;  4OEV A;  1EZO A;  3OEN A;  2GH9 A;  2RC7 A;  4M1V A;  1OVB A;  1XVY A;  1EZP A;  1B0L A;  4EQ9 A;  4MFI A;  3O9P A;  3VVF A;  4ELO A;  4KYD A;  3G7W A;  3H3G A;  3TZA A;  4GD5 A;  3RT6 B;  1MXX A;  1ELJ A;  3DP6 A;  4G68 C;  5CBR A;  1DTG A;  1QUL A;  1B3L A;  3TTN A;  2PBW A;  4H0W A;  3VLW A;  4H67 A;  3OEK A;  3IOT A;  2DVC A;  4RK2 A;  3CSG A;  3KJ7 A;  2FA7 A;  2Z8D A;  4KR5 A;  2I4C A;  4H8J A;  3IO6 A;  1IIT A;  3C32 A;  3H6T A;  2P2A A;  3E3K A;  1B2H A;  1Y1Z A;  3Q25 A;  4GQO A;  3IOV A;  4XXU A;  1DMB A;  5FTI A;  3OO6 A;  3HHG A;  3CFX A;  1B32 A;  4GOT A;  2V3U A;  2PYY A;  1A54 A;  3IJX B;  4F3B A;  2M8C A;  1Y1M A;  2HEU A;  2XXT A;  1IXG A;  2ZNT A;  3B6Q A;  1MQD A;  1NNT A;  1EH3 A;  2O1M A;  3B7D A;  3H06 B;  1YTV A;  3WAE A;  4XKQ A;  3IX1 A;  2R71 A;  2ZYM A;  3ECR A;  3CSB A;  5AA1 A;  2GHB A;  1M5B A;  1H45 A;  2DE4 A;  2P1S A;  2Q9T A;  4RA1 A;  5ITO A;  1FTJ A;  1IEJ A;  4KCC A;  4F18 A;  1Y4C A;  1B7H A;  1UIV A;  4QFK A;  4BLA A;  1NH8 A;  1SI1 A;  2UVI A;  1ZMG A;  4X1B A;  1P1U A;  4O3A A;  2D21 A;  1I6Q A;  4N13 A;  3BBR A;  3RGY A;  3IL1 B;  4EQB A;  4N07 A;  3GZG A;  3PUY E;  2OLB A;  4ZS9 A;  1FCK A;  4MLV A;  4KI0 E;  4HCY A;  3V89 B;  4YMA A;  1LBB A;  5I56 B;  4L17 A;  1B51 A;  2F6G A;  3ZKL A;  3PD8 A;  2V93 A;  4GXS B;  3PMV A;  3O29 A;  3MPL A;  1MM6 A;  4XKP A;  4BDL A;  3PMW A;  5I2N A;  1GGG A;  3EN3 A;  1Z7M E;  1MQI A;  3VLU A;  5B7D A;  5F1Q A;  2O7U A;  1PB7 A;  3T93 B;  5DEX B;  1LBC A;  4G8N A;  2XXU A;  3TOD A;  4FE8 A;  1B1X A;  4DLD A;  1UIU A;  1LCF A;  2OWS A;  4HTG A;  3K6V A;  2HQ0 A;  2Q88 A;  3EHS A;  5CI5 A;  1VE4 A;  1A99 A;  3CG3 A;  2XXY A;  4TLM B;  3OEL A;  1A55 A;  2B3F A;  2D5W A;  2NOO A;  2YLN A;  5KDT B;  1MH3 A;  2UXA A;  3Q28 A;  4U21 A;  3SEV A;  4P11 A;  4Q8R A;  3RPW A;  4G77 A;  2QMX A;  5CMB A;  3LSX A;  4NF6 A;  3RN8 A;  4Z7E A;  2I0C A;  4I62 A;  3TTK A;  1A40 A;  2R9J A;  3D4G A;  3QXM A;  3VVE A;  5AA2 A;  2DWH A;  2I3V A;  1LCT A;  2QMW A;  3KG2 A;  3E9X A;  4R75 A;  5B70 A;  4GFR A;  1DOT A;  2A5S A;  4OFJ A;  3V5A A;  3MQ9 A;  4IO7 A;  5JTY B;  4YKI A;  4EQ7 A;  1NH7 A;  2E1S A;  4EUO A;  4Z0I A;  2Z8E A;  4GRK A;  1MXW A;  1Y20 A;  3O6G A;  4G68 B;  2I58 A;  4NE4 A;  1Q35 A;  1NNF A;  4Q30 B;  1IXH A;  2RCA A;  3RQT A;  2VD3 A;  3C4M A;  1R1N A;  2XXX A;  1JW1 A;  3Q26 A;  3K1N A;  1PB9 A;  3IAZ A;  2A5T B;  2DXR A;  1NFT A;  1HSJ A;  1JNF A;  1MPC A;  3FGS A;  1R9Q A;  5KZT A;  4OEN A;  1XHY A;  4F3S A;  1YCJ A;  1MPB A;  2W7Y A;  3S2V A;  1H3D A;  3KSX A;  2DP8 A;  4OFL A;  1WVJ A;  1O7T A;  1MY4 A;  3EQ1 A;  1OQH A;  5F7V A;  1B58 A;  5TPA B;  2REG A;  1MY0 A;  4XTC Q;  4G4P A;  1IQ7 A;  3PPR A;  4P0G A;  4FIM A;  2RF1 A;  1NNP A;  3T22 A;  1B46 A;  4IY5 A;  3KN7 A;  2XX7 A;  2ZYK A;  3K6X A;  4JBZ A;  1PDA A;  1MQJ A;  4DIG A;  3G3G A;  4QHQ A;  2NXO A;  1M5D A;  1IIW A;  4FED A;  1PBQ A;  5FHN A;  2Z8F A;  2NWJ A;  3TTL A;  3TYH A;  2RIN A;  4EXK A;  3IOU A;  4NWC A;  4PET A;  2DE3 A;  3K6U A;  3LR1 A;  3U72 A;  1LFG A;  2I49 A;  2Q2A A;  3O6I A;  1J1N A;  3G3K A;  1N0T A;  2OCU A;  2UVG A;  2DYX A;  2X7P A;  2D3I A;  3V83 A;  2ABH A;  1P1O A;  1R6Z A;  1FQF A;  5DYH A;  3U1O A;  1B3E A;  3IO4 A;  4ZEC A;  3RNN A;  3W9W A;  2QS4 A;  1XVX A;  3K1P A;  3M3K A;  3TKD A;  1SW5 A;  2ZXT A;  3RUM A;  1MRP A;  3CVG A;  4LZ8 A;  2HAU A;  4MH5 A;  2RC9 A;  3MVX A;  1LGB C;  3FVG A;  1US4 A;  1FQB A;  5ELV A;  1SW2 A;  3K6W A;  4EF2 A;  2Q2C A;  3QSL A;  3DEL B;  3T9U A;  2O51 A;  4F19 A;  4N6P A;  3N94 A;  4YU0 A;  3HST A;  1P99 A;  5I57 A;  5FTH A;  2IA4 A;  1P1W A;  2UYF A;  4GL0 A;  5ISU A;  2RCB A;  4KD5 A;  2F7B A;  4ESX A;  3UK4 A;  5AE4 A;  4ZZA A;  4ZE8 A;  3GBA A;  3PPP A;  2DOJ A;  4F2O A;  2F78 A;  2DE2 A;  4U1O A;  4IO3 A;  4YKK A;  1JW5 A;  5H8H B;  2VOZ A;  2XHD A;  4F3G A;  4NTL A;  4OZ9 A;  5BUU A;  1DPE A;  3SDF A;  4LON B;  4HW8 A;  4GVO A;  1BP5 A;  5L9M A;  1YAE A;  3ZKK A;  3PUZ E;  3HCQ A;  2PVU A;  2UVH A;  1SVX B;  5HM4 B;  3DM0 A;  2H25 A;  5H8F A;  2OK2 A;  1FTM A;  2RC8 A;  4FEB A;  3SKP A;  5EHS A;  4OQO A;  4NF4 B;  4OVJ A;  4RY1 A;  2QS1 A;  3PMX A;  3U92 A;  2XXW A;  3MZ9 A;  3MC2 A;  1N3W A;  1ZU0 A;  3PGF A;  3MUQ A;  4TQU Q;  2V25 A;  2ONR A;  5L9S A;  2Y7K A;  3FUZ A;  3Q27 A;  2NVU B;  2F6P A;  1UTB B;  5I2K A;  1B5H A;  1MXV A;  3IR1 A;  1TT1 A;  2YJP A;  4ESW A;  1SD3 A;  1N7W A;  1KWH A;  3VE1 B;  3FVK A;  2H99 A;  4ND9 A;  2QSX A;  5IAI A;  3I5O A;  3UN6 A;  4LQ5 A;  3T9X B;  3VLV A;  1HSE A;  5A5X B;  4OES A;  3RY3 A;  3IOR A;  4OYV A;  1M5C A;  3PUX E;  3EPE A;  1AIV A;  3TCG A;  1B3F A;  2G29 A;  5CBS A;  1AH5 A;  4NED A;  1B5J A;  4YMB A;  5TP9 B;  2QS2 A;  3C9H A;  3L6G A;  4PQJ A;  1GTK A;  3BFU A;  3S4U A;  2O68 A;  1H76 A;  1I6A A;  1MY1 A;  4WXJ A;  3DLN A;  3O66 A;  4RPO A;  3GLB A;  3OXN A;  3H6W A;  4IO4 A;  1D4N A;  1QUJ A;  1OVT A;  4NF5 B;  2RKM A;  4F1V A;  1LAG E;  1P1N A;  4XIG Q;  3VVD A;  1USY E;  1BKA A;  1Y4T A;  1R9L A;  3IOW A;  4RYA A;  2XXI A;  2XX9 A;  3QK6 A;  2XXQ A;  2WKY A;  3RLF E;  1SW4 A;  1USY H;  3MWB A;  3W9V A;  1M5E A;  2F36 A;  4QFO A;  2ESN A;  3FJM A;  1B3G A;  3ILT B;  3KSJ A;  1Q1K A;  2BJJ X;  4MF3 A;  1QUK A;  4BDM A;  2I4B A;  3TCF A;  3H6U A;  2HFB A;  1ZIU A;  1IZ1 A;  1B05 A;  1IXI A;  4F1U A;  1Y3Q A;  2VP1 A;  1PEB A;  1OMP A;  4R9G A;  2XXV A;  3MZ1 A;  3EF7 A;  4G8M A;  4OXV A;  2DWA A;  2ZYN A;  1MXZ A;  2F34 A;  3VDF A;  1N84 A;  4AB5 A;  5DTB A;  3Q29 A;  4OWD A;  3SEY A;  2CZL A;  3I3V A;  1B4Z A;  2GHA A;  4LUB A;  4IO6 A;  4GIZ A;  4NF8 A;  1ZKB A;  3UGW A;  2GRV A;  3FVO A;  5KCJ A;  2PMS A;  4H5F A;  3I6V A;  4JDF A;  3QYT A;  5I58 A;  2ZYO A;  3BKI B;  3GBB A;  1PB8 A;  4ECF A;  3FJG A;  3MZB A;  3O97 A;  2X26 A;  2THI A;  3VV5 A;  1MPD A;  1N04 A;  4UA8 A;  4F22 A;  1CB6 A;  1D9V A;  1JW4 A;  1DTZ A;  2GFE A;  4DXB A;  3USD A;  1FW0 A;  3C34 A;  3PD9 A;  5I59 B;  1SBP A;  2DWI A;  1MS7 A;  4ZED A;  1B52 A;  4POW A;  4LAT A;  1XT8 A;  1FQE A;  4IO5 A;  4PFY A;  1B6H A;  5CMK A;  4OET A;  3K1M A;  3PUV E;  3TAJ A;  5AA4 A;  3DP4 A;  4GL8 A;  5AA2 D;  1MDP 1;  3SEW A;  1MXU A;  5I2N B;  2OWT A;  4GF8 A;  1URG A;  3KOT A;  3KZG A;  1B1H A;  1UTH B;  2ONK E;  4R72 A;  3RT8 A;  4LA9 A;  1FTK A;  4ZEK A;  4OTE A;  3FAS A;  3QUF A;  4OMB A;  3ZS6 A;  1LB9 A;  3S9M C;  1MXY A;  4KPT A;  3LSF B;  3G3H A;  2AL5 A;  4JSO A;  4QSC A;  5H8N A;  2H4I A;  5JEI A;  1FTL A;  4IB2 A;  3A3U A;  4O3C A;  3FXQ A;  1H43 A;  2O7I A;  3K4U A;  1A7L A;  1FQD A;  4LP2 B;  1MQH A;  3IB0 A;  4R6Y A;  2HAV A;  1US5 A;  4QFP A;  4PFW A;  4LZ5 A;  2G93 A;  4OFO A;  4DXC A;  4F39 A;  4G8H A;  4ZEI A;  3S9E A;  1VFE A;  2I0B A;  5AA2 B;  1TFD A;  4ISU A;  3LSW A;  4Q0C A;  1B9J A;  1O63 A;  4U2R A;  2XXP A;  1Z7N E;  1YPN A;  4RJZ A;  1URD A;  3R26 A;  2DWJ A;  1EZ9 A;  5H8Q A;  2HXW A;  1XS5 A;  2E0S A;  1TFA A;  3THI A;  2PT2 A;  3DP8 A;  3JZJ A;  2I3W A;  2VGQ A;  1AL3 A;  3KN8 A;  4YIC A;  1FTO A;  1VSO A;  2YPN A;  2DSF A;  2ZNU A;  3PPN A;  4EDP A;  3T96 B;  5AA3 A;  1JEV A;  3M3F A;  2H5Y A;  3ODB A;  3OO9 A;  4K3F A;  4F2Q A;  3RTW B;  4DDD A;  3AXF A;  3MAM A;  4O3B A;  5DT6 A;  4TLL B;  2Q8J A;  2FNC A;  3OO7 A;  2O6A A;  1DSN A;  4KCD A;  4P0I A;  3D4C A;  3C33 A;  3S9N C;  3SER A;  3UP9 A;  3H7M A;  1JET A;  5LOM A;  1BTJ A;  1TXF A;  4NWD A;  3BFT A;  4YB6 A;  1QW0 A;  1GVC A;  5K2Y A;  1I6B A;  2Z23 A;  2I48 A;  3HO7 A;  2AIX A;  4U22 A;  4UAC A;  4R2B A;  2R6G E;  4G2Z A;  1GR2 A;  4KQP A;  2ZNS A;  5CM6 A;  1JEU A;  4TOZ A;  1B0H A;  1POY 1;  3TFL A;  5L9O A;  1BLF A;  3L6H A;  1QKB A;  3H6V A;  5HPQ A;  3G3J A;  3A3C A;  3OSR A;  5H8S A;  5FHO A;  4MLQ A;  3WAF A;  2QJE A;  4ZEB A;  3IJO B;  3K00 A;  3HN0 A;  1N3X A;  5HBC A;  4QRZ A;  4FEC A;  4H6D A;  2ZMB A;  1MG1 A;  3F11 A;  5CRY A;  3OMB A;  3EHT A;  1GV8 A;  3LBS A;  1QUI A;  3E4R A;  1OIB A;  4R73 A;  2F8D A;  4IGR A;  4C1T A;  1PBP A;  2DVZ A;  5IKB A;  3SES A;  4ELP A;  4PFU A;  3KFM A;  2ALU A;  3MP6 A;  3R7X A;  1WDN A;  2Y7I A;  4EXL A;  5TU0 A;  1BIY A;  2V3Q A;  3CG1 A;  1DPP A;  2P0S A;  4QF9 A;  4QFN A;  3V8X B;  4OEU A;  4YB7 A;  3SEX A;  1LFH A;  3TCH A;  4YKJ A;  4XKR A;  4E0X A;  3U93 A;  4HCW A;  5I56 A;  4JSD A;  2LAO A;  4ZDM A;  2F97 A;  2CMO A;  1OLA A;  5L8D A;  1ZJL A;  4GXA A;  4OER A;  1NMU A;  3VFJ A;  3B6T A;  4THI A;  3FIR A;  3HPI A;  5I57 B;  4R6K A;  4YB5 A;  4C1U A;  3LUY A;  3FVN A;  2VHA A;  2VD2 A;  1LFI A;  5DEX A;  2XXR A;  1F9B A;  3T66 A;  1POT A;  3CIJ A;  4JB7 A;  1MM7 A;  3QIM A;  3OSQ A;  5K2X A;  5ICQ A;  1NNK A;  3TQW A;  1SI0 A;  3G3F A;  1QJM A;  1H44 A;  1JVX A;  3MJN A;  5KDT A;  4KYS A;  2ONS A;  1D9Y A;  1FQC A;  1A8E A;  1N76 A;  5CC2 A;  1T0K A;  3H4Z A;  4X9T A;  3FD3 A;  3VXC A;  1P1Q A;  3EHU A;  4BDN A;  4ONY A;  4JWX A;  4XKN A;  3JV9 A;  1LAX A;  2REJ A;  4F31 B;  2UYE A;  4GLI A;  5H8F B;  1B5I A;  4RK9 A;  4ZZE A;  1ZLQ A;  3FV1 A;  3N6U A;  2DXY A;  3FAT A;  4X48 A;  4DXU A;  5JK4 A;  3TEP A;  4F3P A;  3C31 A;  3KEI A;  4IO2 A;  3FZV A;  3PPO A;  4U4X A;  4H1X A;  4RPN A;  2PX1 A;  2XD3 A;  4YKP A;  5DVI A;  5I84 A;  3ZSF A;  3RTF B;  3IK6 B;  5I59 A;  5JTY A;  4H8I A;  4E0W A;  4ZE9 A;  4EF1 A;  5ICT A;  3CR9 A;  3T9H B;  5I2K B;  3PV0 E;  1B40 A;  4G68 A;  1Y3P A;  1S7Y A;  4ZEF A;  3IB1 A;  3S9L C;  1AOV A;  1VFD A;  3U8Q A;  2HZL A;  2A5T A;  2V3T A;  1NKX A;  5EHM A;  4PE5 B;  1HSL A;  1UTH A;  2Q89 A;  2Z22 A;  1B7U A;  1Y9U A;  1XOC A;  2OJT A;  2ANJ A;  4FAJ A;  3SET A;  3OO8 A;  3MPK A;  1O64 A;  1LB8 A;  2HZK A;  2O69 A;  3K2D A;  5TPA A;  3TTR A;  1MH4 A;  2XX8 A;  1AMF A;  1VR5 A;  1B4H A;  1SQY A;  3TTM A;  1RYO A;  3U94 A;  2Y7R A;  5J1D A;  4R74 A;  3R6U A;  3SEU A;  3TQL A;  2H98 A;  1II5 A;  4MBP A;  3MVZ A;  3PU5 A;  2DS9 A;  4H65 A;  1S9T A;  2I6E A;  3QAX A;  4PFT A;  3N5L A;  4I1D A;  3UIF A;  1CE2 A;  4U1Z A;  1ZTY A;  4OHN A;  4POX A;  3MVW A;  4BDR A;  4QSD A;  4RNS A;  4C0R A;  3FXR A;  1ATG A;  3JYR A;  1SDX A;  2B3B A;  1RKM A;  1SW1 A;  3GXA A;  1NL5 A;  1LAF E;  1QKA A;  1N7X A;  4QSE A;  4JWY A;  2KLF A;  3K02 A;  4NMY A;  1JVY A;  3KOS A;  2F35 A;  4IGT A;  3KN3 A;  1SYI A;  3W15 C;  4R2F A;  3O6H A;  1B3H A;  1ZBM A;  2QPQ A;  1Y3N A;  3MW0 A;  4QFL A;  3MP8 A;  1XC1 A;  2PT1 A;  3FV2 A;  1MDQ A;  2QRY A;  2OBG A;  4WKM A;  4H5G A;  4BDQ A;  3HV1 A;  3G3I A;  3TEL A;  5DVF A;  3TMG A;  4F29 A;  1MY2 A; 
#chains in the Genus database with same CATH topology
 3ZC7 B;  2B4L A;  4NF8 B;  5ITP A;  5IT9 S;  1D3K A;  4LVQ A;  3TPA A;  4OW0 A;  4DV4 M;  4FJP A;  4R6H A;  1LST A;  1N75 A;  3C35 A;  2P3V A;  5KCJ B;  4DR1 M;  4NF6 B;  4O94 A;  5KPZ A;  3O28 A;  4LF9 M;  2HCA A;  2HHM A;  1VEJ A;  4KFQ A;  3J7B A;  5I58 B;  3CI8 A;  4R9F A;  3NBX X;  3NBI A;  3W68 A;  4U4S A;  5CMC A;  1IM2 A;  4ELQ A;  3SFZ A;  4JXJ A;  2F7A A;  5H8H A;  3ONM A;  3W67 A;  2Y84 A;  2F5N A;  2FHY A;  1QAO A;  3HU2 A;  3PUW E;  3CFL A;  3C58 A;  1VQ1 A;  1IXC A;  3GLF A;  1SYH A;  4ELR A;  2QQ8 A;  4GC5 A;  1J5E M;  2CZK A;  2KEB A;  1TR8 A;  2AYS A;  2CEX A;  1IMB A;  4IIW A;  5ET8 A;  4HL4 A;  1FPD A;  3P7I A;  4F1Y A;  1D0L A;  1ANF A;  2X7Q A;  4AI6 A;  3M8U A;  5DVJ A;  3FUX A;  3PPQ A;  1R2Y A;  3PNV A;  2CEA A;  4LQ2 A;  5M2V A;  3LC8 A;  2VQE M;  2FYI A;  4LZ7 A;  4QBA A;  3FXU A;  1TH3 A;  2DQV A;  4JWO A;  1NVM A;  1G41 A;  5J16 A;  3K01 A;  5LMN M;  3CRB A;  1XHB A;  3N26 A;  2DVW B;  5EYF A;  4RXL A;  2Y7W A;  4WEP A;  4KHZ E;  4B3S M;  3C36 A;  4NF4 A;  5AA4 B;  4D80 A;  3KBR A;  1NI9 A;  4JXI A;  3E79 A;  1RYX A;  2IEE A;  1TDH A;  1V34 A;  4AQ4 A;  4MB7 A;  3Q8X A;  3MBP A;  4WED A;  4R7G A;  2XWI A;  4N15 A;  1HT1 E;  4BDO A;  3IFC A;  3AOG A;  3VXB A;  4N91 A;  4GKJ M;  3LSL A;  1MY3 A;  3TDJ A;  1Y8G A;  4GHL A;  3GLI E;  2JJK A;  3HFU A;  2F7C A;  2V84 A;  5FTK A;  1UTB A;  3E13 X;  1TWY A;  3GLH E;  3K9P A;  3I4V A;  1JR3 E;  4LJ7 A;  2CEY A;  4LZZ A;  4HS7 A;  2F5X A;  4I8C A;  2O84 X;  1VDW A;  1B7Z A;  4AG6 A;  5CMM A;  2CWB A;  5DFL A;  4GWO A;  3ILU B;  2BWE A;  1NV3 A;  3HWS A;  2O1L A;  1M5F A;  3H03 A;  5H8N B;  2QBY A;  2AL4 A;  3OOA A;  2LBC A;  1IN5 A;  3JR4 A;  1TF0 B;  2O25 A;  2UUA M;  3FJ7 A;  1NV6 A;  2R45 A;  3UOR A;  1TH4 A;  1UQW A;  1OLC A;  4X04 A;  2NUV A;  4L78 A;  1EFU B;  3LQQ A;  1NV8 A;  1LAH E;  4KYE A;  2B65 A;  3U60 B;  4QHT A;  4PF8 A;  2W82 A;  1OQG A;  1QVS A;  3D1R A;  3U5Z A;  4I9D A;  3HHF A;  3MVY A;  4AZF A;  1LLS A;  3O2A A;  5A5X A;  2XXH A;  1NHW C;  4NF0 A;  4NOO B;  3K0V A;  4AB6 A;  2ZZX A;  2Y7P A;  2GQF A;  1WOD A;  3OEM A;  3TUS A;  4Q5T A;  4DCX A;  4HLQ A;  4PDG A;  5FHM A;  3T9V A;  1A8F A;  1GJS A;  4PAK A;  3KP0 E;  1PC3 A;  2PCR A;  3OD7 A;  2KDL A;  3UA8 A;  1URS A;  4YZZ A;  3A09 A;  4FAT A;  4M4G A;  4XF5 A;  4DZ1 A;  4NRW A;  4JYA M;  4DE8 A;  1R6B X;  4FOR A;  1IUD A;  1QYR A;  4LJ8 A;  5TP9 A;  1RDY A;  1MQG A;  3MP1 A;  1DV0 A;  2QL3 A;  5ET6 A;  1NNJ A;  1F4I A;  5H8Q B;  2XD2 A;  4PDH A;  2OZZ A;  3B6W A;  4DR6 M;  3M3L A;  4PCD A;  3U6Q A;  4L15 A;  3KGC A;  4DCY A;  4PAF A;  4MGY E;  4X1D A;  1L5T A;  3CFZ A;  3HU3 A;  1FQA A;  3QUJ A;  2H9B A;  2QS3 A;  4NHB A;  4PP0 A;  4IY6 A;  3LCV B;  1JQF A;  2UVJ A;  2BWB A;  5IWA M;  3J81 S;  4YAH X;  4U23 A;  5BWJ A;  1I69 A;  4NF5 A;  1S50 A;  3KJT A;  4F29 A;  2C98 A;  1EU8 A;  3N6T A;  3IB2 A;  1NV7 A;  4OEV A;  1OQY A;  1L2C A;  3GLF E;  2OOA A;  1YYZ A;  3OEN A;  1EZO A;  2R18 A;  2GH9 A;  2V6Z M;  3I04 M;  2RC7 A;  1PJS A;  4M1V A;  3FKE A;  1OVB A;  5C18 A;  2NQ8 C;  1XVY A;  3LQR A;  1EZP A;  1B0L A;  1FPB A;  4EQ9 A;  1Q3C A;  3FUU A;  4FWG A;  3O9P A;  4GWX A;  4MFI A;  4G4N A;  3VVF A;  4LF6 M;  4ELO A;  1K9Z A;  4KYD A;  3G7W A;  5KO3 A;  3H3G A;  4PBQ A;  3TZA A;  1WGL A;  4GD5 A;  1NY5 A;  3FRI A;  3RT6 B;  2APL A;  3R8F A;  1MXX A;  1ELJ A;  3DP6 A;  4G68 C;  4P47 A;  4KO8 A;  3Q8G A;  5IZ3 B;  2QVU A;  5CBR A;  3U6D A;  1DTG A;  1QUL A;  1B3L A;  2H5X A;  3LVW A;  3TTN A;  2PBW A;  4HXV A;  3IEC A;  4H0W A;  4MCO A;  3VLW A;  4N6D A;  1NNU C;  5ITX A;  4H67 A;  3OEK A;  3IOT A;  2DVC A;  2JA2 A;  4RK2 A;  3CSG A;  4JVD A;  3KJ7 A;  2FA7 A;  2Z8D A;  4KR5 A;  4BB9 A;  4P9K A;  2I4C A;  4H8J A;  2OOB A;  2L09 A;  3RFW A;  3IO6 A;  1IIT A;  1N78 A;  3C32 A;  4MEV A;  3H6T A;  2Y21 A;  4DBG B;  3AOE C;  2P2A A;  3GRY A;  1E9S A;  4IBB A;  3E3K A;  4G6Z A;  1GL7 A;  2VF7 A;  1B2H A;  1LBV A;  1Y1Z A;  4LF5 M;  3Q25 A;  4GQO A;  1KZ8 A;  3IOV A;  2CV1 A;  1DMB A;  4XXU A;  4D82 A;  2JY6 B;  5FTI A;  3M6A A;  3OO6 A;  2R4J A;  3HHG A;  4RNA A;  3A42 A;  3CFX A;  1B32 A;  4GKK M;  4GOT A;  1XC8 A;  4GBW A;  1YSY A;  3U61 B;  3L28 A;  2V3U A;  3SHG B;  3FTD A;  4MNI A;  2PYY A;  1A54 A;  2X4A A;  1FTA A;  3IJX B;  4LFA M;  3SYL A;  4F3B A;  2CHG A;  2M8C A;  1Y1M A;  2HEU A;  2XXT A;  1FPE A;  1IXG A;  2R6F A;  3WHL A;  2ZNT A;  1L1T A;  3B6Q A;  1MQD A;  4BBA A;  1EH3 A;  1NNT A;  2O1M A;  3B7D A;  3H06 B;  1YTV A;  3WAE A;  1IMF A;  4DI4 B;  4XKQ A;  2QSF X;  1IN8 A;  3IX1 A;  2R71 A;  1XNR M;  2C9C A;  2ZYM A;  1N36 M;  3ECR A;  4B3T M;  3CSB A;  5AA1 A;  2GHB A;  1M5B A;  4QHS A;  3JAM S;  1G8P A;  1FBP A;  1H45 A;  2DE4 A;  2P1S A;  3DFZ A;  2Q9T A;  4RA1 A;  5ITO A;  1FTJ A;  3GRU A;  1IEJ A;  5FTM A;  5LTC A;  4KCC A;  4F18 A;  1Y4C A;  4IBI A;  1FPK A;  1B7H A;  1UIV A;  4XK8 F;  2VF8 A;  4QFK A;  1NH8 A;  1SI1 A;  3IG5 A;  4BLA A;  2UVI A;  4FCV A;  1ZMG A;  4X1B A;  4F2L A;  4NG7 A;  4LCB A;  1P1U A;  1Q9D A;  4O3A A;  2R65 A;  2D21 A;  1I6Q A;  4N13 A;  3BBR A;  3RGY A;  3IL1 B;  3PNY A;  4EQB A;  3GQ3 A;  4MGI E;  2WEF A;  2CV0 A;  2XSZ A;  4N07 A;  3GZG A;  3PUY E;  2CP8 A;  3QWL A;  4JI3 M;  2OLB A;  5C1B A;  4W5W A;  3KOZ E;  1FCK A;  4ZS9 A;  1IY2 A;  4LF4 M;  1YE9 A;  2X49 A;  3HZJ A;  4KI0 E;  4MLV A;  4KXP A;  4HCY A;  2QCU A;  3V89 B;  3CF0 A;  1LBB A;  4YMA A;  4L17 A;  5I56 B;  1B51 A;  2F6G A;  5EJC A;  4G61 A;  4GWZ A;  1KA1 A;  3ZKL A;  1VG5 A;  3A46 A;  3PD8 A;  2WBB A;  1IN7 A;  2KQZ A;  2V93 A;  4GXS B;  1HNX M;  3GRV A;  4I81 A;  3PMV A;  4LG2 A;  2DZN B;  1DBZ A;  3O29 A;  4LJ5 A;  3MPL A;  1MM6 A;  3L2A A;  4XKP A;  3PMW A;  4BDL A;  5I2N A;  1GGG A;  2EUC A;  3E46 A;  3EN3 A;  5EXT A;  1Z7M E;  4JVC A;  1MU5 A;  1PJQ A;  1MQI A;  4G4Q A;  2WYK A;  3VLU A;  5FTL A;  5B7D A;  5BR8 M;  5F1Q A;  2O7U A;  1PB7 A;  4JI6 M;  3PTY A;  3T0J A;  5EXP A;  1FSA A;  2DHR A;  2R46 A;  2XLJ A;  3T93 B;  5DEX B;  2KNA A;  1LBC A;  4G8N A;  4LN5 A;  2XXU A;  4WW0 A;  1IXS B;  3TOD A;  5LDZ A;  1T6O A;  4FE8 A;  3NWL A;  1B1X A;  5FLX S;  3T1B A;  4DLD A;  5ITX E;  1UIU A;  4X8R A;  1LCF A;  2OWS A;  3TL4 X;  4DUZ M;  2LHG A;  4HTG A;  3K6V A;  4IBK A;  2FFJ A;  3VK7 A;  2HQ0 A;  2Q88 A;  1VE4 A;  3EHS A;  1A99 A;  4H46 A;  3CG3 A;  5CI5 A;  4I3E A;  2XXY A;  1Z5B A;  4TLM B;  3OEL A;  3H4M A;  1A55 A;  1DO0 A;  2XZU A;  2B3F A;  2D5W A;  1HR0 M;  2NOO A;  2YLN A;  5KDT B;  3L26 A;  1MH3 A;  2UXA A;  3Q28 A;  4U21 A;  3SEV A;  4P11 A;  4JI7 M;  3RPL B;  1WXQ A;  1NV4 A;  4Q8R A;  3KFU G;  4MGZ E;  3RPW A;  4G77 A;  2FOI C;  2QMX A;  5CMB A;  3LSX A;  4NF6 A;  2CHQ A;  3QMF A;  3RN8 A;  3H4J A;  4Z7E A;  5IRE B;  2I0C A;  4I62 A;  2FNA A;  3TTK A;  1A40 A;  2Z3X A;  2R9J A;  3B7Q A;  4L4U A;  3D4G A;  3QXM A;  5KPT A;  3VVE A;  4A3V B;  4LJ9 A;  3E78 A;  2DXI A;  5AA2 A;  2DWH A;  3SZP A;  2WBD A;  3FRH A;  2CFO A;  2I3V A;  1LCT A;  3FUT A;  1NUY A;  3I51 A;  1NSF A;  2QMW A;  3FTF A;  4GX3 A;  3KVW A;  3KG2 A;  3E9X A;  2DHY A;  5I3S A;  4IJF A;  1WJ7 A;  4R75 A;  2RRU A;  5B70 A;  4GFR A;  1FBD A;  1SXJ B;  4P17 A;  1DOT A;  2A5S A;  3JR5 A;  4OFJ A;  1XXH B;  3MQ9 A;  4IO7 A;  3V5A A;  5KQ8 A;  2Z8Y M;  2D7G A;  5JTY B;  3V76 A;  4YKI A;  4EQ7 A;  2LVA A;  3U6M A;  1NH7 A;  2E1S A;  2I7N A;  1TTE A;  1NV5 A;  4QOS A;  2CV2 A;  4EUO A;  3AFH A;  1WR1 B;  4Z0I A;  4WP2 A;  4P1L A;  2Z8E A;  4GRK A;  1MXW A;  1SPI A;  1Y20 A;  1OTR A;  1NJG A;  1WHC A;  1FBF A;  3O6G A;  4G68 B;  2I58 A;  4NE4 A;  1Q35 A;  1NNF A;  4Q30 B;  1IXH A;  2RCA A;  3RQT A;  2JY5 A;  2VD3 A;  3C4M A;  1R1N A;  2XXX A;  1JW1 A;  3Q26 A;  3K1N A;  1PB9 A;  1L2B A;  3IAZ A;  2A5T B;  2DXR A;  3CGW A;  4CIS A;  1I94 M;  1HSJ A;  1NFT A;  1JNF A;  4X65 M;  3SAS A;  1MPC A;  1DCU A;  3FGS A;  4AS4 A;  2XFT A;  1R9Q A;  4TUW A;  1ORY B;  3RGP A;  5KZT A;  3PVS A;  4OEN A;  1XHY A;  2XGN A;  4F3S A;  1YCJ A;  2QP9 X;  2FE8 A;  1MPB A;  1QGX A;  3ILK A;  2W7Y A;  3S2V A;  5F24 A;  1H3D A;  1FRP A;  2QEN A;  3KSX A;  2DP8 A;  4OFL A;  1FNN A;  1WVJ A;  5EXS A;  1O7T A;  4N6K A;  3MYU A;  2QZ4 A;  1MY4 A;  3EQ1 A;  1OQH A;  5F7V A;  3SAV A;  1B58 A;  2G5G X;  2MKZ A;  5TPA B;  5F3W A;  2DAK A;  2REG A;  1MY0 A;  4XTC Q;  4G4P A;  1IQ7 A;  4M9X A;  3MJ5 A;  3PPR A;  2F3D A;  4P0G A;  4FIM A;  2RF1 A;  2DWM A;  1NNP A;  1EYJ A;  3T22 A;  1KSF X;  3E21 A;  1B46 A;  1FPL A;  4XFE A;  4CHT B;  3GPU A;  4NXN M;  4IY5 A;  3KN7 A;  2XX7 A;  2ZYK A;  1SG9 A;  3K6X A;  4JBZ A;  1PDA A;  3DA1 A;  1MQJ A;  4DIG A;  3G3G A;  4QHQ A;  3E9S A;  2NXO A;  1M5D A;  4L8R C;  1NV9 A;  2J7N A;  1QQW A;  1IIW A;  1FJG M;  4FED A;  1OIP A;  1PBQ A;  5FHN A;  1OFH A;  2Z8F A;  2NWJ A;  3TTL A;  3TYH A;  2RIN A;  2UXB M;  4EXK A;  1VEG A;  3IOU A;  4NGU A;  4NWC A;  4PET A;  2DE3 A;  3K6U A;  3LR1 A;  1MX0 A;  4PC9 A;  1EE8 A;  3U72 A;  1LFG A;  2I49 A;  4N8G A;  2MRO B;  4DV7 M;  2Q2A A;  3B7N A;  2KNZ A;  3O6I A;  3HJQ A;  1J1N A;  2V4C A;  2Z7J A;  5EYG A;  2GNO A;  4OX9 M;  1HNW M;  3G3K A;  3IFA A;  1N0T A;  2OCU A;  2QPA A;  2UVG A;  2FH0 A;  2DYX A;  1IMA A;  4P1E A;  2X7P A;  5ESY A;  2D3I A;  1D9Q A;  2UXD M;  3V83 A;  1LBX A;  1H6U A;  2ABH A;  4O7I A;  4AG5 A;  3ISP A;  3QAU A;  1P1O A;  3GLG A;  1R6Z A;  1FQF A;  4KHP M;  5DYH A;  3U1O A;  4FWD A;  1B3E A;  1EYI A;  4I3Y A;  2M5Z A;  3IO4 A;  3VDP A;  2WYP A;  4MJO A;  4ZEC A;  2A5Y B;  3RNN A;  3W9W A;  4XGI A;  3GLH B;  2QS4 A;  1XVX A;  3K1P A;  3M3K A;  2XA5 A;  3TKD A;  1SW5 A;  4LFC M;  2ZXT A;  4DV6 M;  1NV1 A;  4OVZ A;  3RUM A;  2X8A A;  1MRP A;  3CVG A;  4LZ8 A;  2HAU A;  4MH5 A;  1FJ6 A;  2RC9 A;  3MVX A;  2Y0T A;  4PGN A;  1LGB C;  3FVG A;  4MNC A;  3SAW A;  4LF8 M;  1US4 A;  1FQB A;  5ELV A;  2CZH A;  1SW2 A;  1A5T A;  3K6W A;  4EF2 A;  2Q2C A;  3KP1 E;  3QSL A;  3DEL B;  3T9U A;  2Q2E B;  2O51 A;  1QDT A;  2XF3 A;  1OJL A;  3K92 A;  1Z5C A;  2D7H A;  3U6P A;  1FBH A;  4F19 A;  3J2P B;  4N6P A;  4FVM A;  3HHZ A;  4B3R M;  3N94 A;  4OVQ A;  4YU0 A;  4QXD A;  3HX3 A;  3HST A;  1P99 A;  5I57 A;  1FBC A;  4II7 A;  5FTH A;  2IA4 A;  1P1W A;  3EIE A;  2UYF A;  4GL0 A;  2WSF F;  3LVV A;  5ISU A;  2HHH M;  1NV2 A;  2RCB A;  4KD5 A;  2HXR A;  5IGA A;  2F7B A;  4ESX A;  3UK4 A;  3UGJ A;  1JQJ C;  5AE4 A;  4ZZA A;  4ZE8 A;  4LY6 A;  3GBA A;  3PPP A;  1YLA A;  2DOJ A;  2MJ5 B;  4F2O A;  1QZM A;  2F5P A;  4KLN A;  2F78 A;  2DE2 A;  2VPN A;  4U1O A;  1N33 M;  1AWB A;  4IO3 A;  4QNR A;  4YKK A;  1JW5 A;  3B74 A;  4FCT A;  5H8H B;  3U6E A;  2VOZ A;  2XHD A;  4F3G A;  4NTL A;  2EJS A;  2KNV A;  4OZ9 A;  2DNA A;  1IBM M;  1EIJ A;  5BUU A;  1DPE A;  3SDF A;  3GLF B;  5ITY A;  4LON B;  1PGY A;  1N32 M;  4HW8 A;  5EXX A;  4GVO A;  3SAT A;  4LZJ A;  1BP5 A;  1WGN A;  5L9M A;  3VKH A;  3HHW A;  4D81 A;  1YAE A;  3ZKK A;  5KQD A;  1R7R A;  3TWL A;  2RGO A;  3PUZ E;  4KOD A;  2DEN A;  3HCQ A;  2PVU A;  2KA6 B;  2UVH A;  1SVX B;  5ET7 A;  5HM4 B;  4PFR A;  4AKI A;  3DM0 A;  4G4R A;  2H25 A;  5H8F A;  3K8Z A;  1UFZ A;  4P56 A;  2OK2 A;  1FTM A;  2RC8 A;  2XWV A;  1NY6 A;  1LBY A;  3B9P A;  2K47 A;  4G3O A;  3U6L A;  1AUA A;  4FEB A;  5ITT A;  1SXJ C;  4P8B A;  3SKP A;  5E26 A;  5EHS A;  4OQO A;  4NF4 B;  1QAQ A;  3VDU A;  4OVJ A;  4RY1 A;  2QS1 A;  3PMX A;  1QVR A;  4JV5 M;  1INP A;  3U92 A;  1G4A E;  2XXW A;  5LMU M;  2CRU A;  3MZ9 A;  1IBL M;  3MC2 A;  3VKG A;  3F92 A;  3KS4 A;  1N3W A;  1ZU0 A;  3PGF A;  3MUQ A;  4TQU Q;  3CHG A;  2F3B A;  2V1U A;  1Z6T A;  2BJI A;  2V25 A;  3GLG E;  2ONR A;  5L9S A;  2Y7K A;  2DAG A;  3FUZ A;  2EKF A;  3Q27 A;  2NVU B;  4RKU F;  2F6P A;  2L6O A;  4DV0 M;  1UTB B;  2ZBK B;  3AJI B;  2LWX A;  5I2K A;  1B5H A;  1K3X A;  4WUR A;  5I5P A;  1MXV A;  4AS5 A;  1I4W A;  3IR1 A;  1TT1 A;  2YJP A;  4ESW A;  4ZPX A;  1K82 A;  4OVS A;  1SD3 A;  1N7W A;  1KWH A;  1C1K A;  3VE1 B;  3KOX E;  3U6O A;  3GRR A;  3FVK A;  2YQZ A;  2H99 A;  4B7H A;  4XBO A;  4ND9 A;  1TDZ A;  4UN2 B;  2QSX A;  5IAI A;  3I5O A;  3UN6 A;  3KOW E;  3M7G A;  4LQ5 A;  4DV2 M;  3T9X B;  4BLC A;  3U5Z B;  1FJ9 A;  2FIE A;  1DO2 A;  1L2D A;  4I8O A;  4KT0 F;  1ZQ9 A;  2VQF M;  3AL0 C;  3VLV A;  1P3Q Q;  4DR7 M;  1HSE A;  5A5X B;  4OES A;  3FTE A;  3IOR A;  4GBV A;  3RY3 A;  2RGH A;  1RDX A;  4K0K M;  1M5C A;  4OYV A;  2HWJ A;  3PUX E;  3KS8 A;  3GPX A;  3EPE A;  1AIV A;  3TCG A;  2WSC F;  1B3F A;  2G29 A;  5CBS A;  1AH5 A;  1T3T A;  4NED A;  4PF6 A;  1R5L A;  3BBZ A;  1V92 A;  4GWS A;  1B5J A;  1JP4 A;  4PDI A;  4YMB A;  3LUZ A;  5TP9 B;  2QS2 A;  3A98 B;  3C9H A;  3L6G A;  2QHO B;  2JXN A;  3FYD A;  2ZAM A;  1FPF A;  3GP1 A;  1R4G A;  3MK6 A;  1FBE A;  4PQJ A;  1GTK A;  3BFU A;  5EQA A;  3S4U A;  1NUX A;  1CNQ A;  1IN6 A;  3HHX A;  4LJ4 A;  2O68 A;  2MGW A;  1H76 A;  2YFQ A;  1I6A A;  1MY1 A;  4WXJ A;  3DLN A;  2ZTC A;  3O66 A;  4RPO A;  2H1R A;  3GLB A;  3OXN A;  1J7K A;  2ERC A;  3H6W A;  4IO4 A;  2FVZ A;  1D4N A;  1QUJ A;  1OVT A;  4NF5 B;  1OAI A;  2RKM A;  3FTC A;  4F1V A;  1OFI A;  1LAG E;  1P1N A;  5IZZ A;  4XIG Q;  3GQ5 A;  2EKK A;  3VVD A;  1FPJ A;  2F5S A;  1USY E;  4XEQ A;  4M0W A;  1BKA A;  1Y4T A;  1R9L A;  2HKJ A;  4L6V 6;  3IOW A;  4RYA A;  2XXI A;  2XX9 A;  3QK6 A;  2XXQ A;  2WKY A;  3RLF E;  1SW4 A;  1USY H;  3MWB A;  3W9V A;  1M5E A;  3SAU A;  1DGH B;  2F36 A;  1YXI A;  2ZZW A;  4QFO A;  4AKH A;  2ESN A;  5IZ7 D;  3FJM A;  2JP7 A;  1B3G A;  4MIJ A;  3ILT B;  3KSJ A;  1Z5A A;  1Q1K A;  2BJJ X;  1DGG A;  3VK8 A;  2UU9 M;  3HHY A;  2DKL A;  4MF3 A;  1QUK A;  4UAB A;  4BDM A;  2R44 A;  1QDR A;  2JWS A;  2DDK A;  4FBP A;  2B3T A;  3TQS A;  2I4B A;  3TCF A;  3H6U A;  2HFB A;  2G8L A;  3TWK A;  1ZIU A;  1IZ1 A;  1B05 A;  1IXI A;  1CUK A;  2R62 A;  4F1U A;  5KPR A;  1Y3Q A;  3U6C A;  4MX6 A;  1SXJ D;  4AKG A;  2VP1 A;  1PEB A;  3B50 A;  3RYD A;  1OMP A;  4R9G A;  2KZU A;  2XXV A;  4JI8 M;  2XSZ D;  4IBD A;  2F4V M;  3MZ1 A;  3EF7 A;  3SHF A;  4B3M M;  3VFD A;  4G8M A;  4MM3 B;  4I4L A;  7CAT A;  2EO2 A;  4ANR A;  3AOE A;  3FD9 A;  4OXV A;  2DWA A;  2ZYN A;  1MN3 A;  2LVO C;  1MXZ A;  2F34 A;  3VDF A;  1N84 A;  1KYI A;  1JB0 F;  4AB5 A;  5DTB A;  3Q29 A;  4OWD A;  3SEY A;  2CZL A;  3I3V A;  1LTM A;  1B4Z A;  4PCZ A;  2GHA A;  4LUB A;  3SBJ A;  4LFB M;  4IO6 A;  5EP2 A;  4GIZ A;  1GAB A;  4NF8 A;  4H45 A;  2Y5L A;  1ZKB A;  3UGW A;  3K2L A;  2GRV A;  1QAN A;  3FVO A;  5KCJ A;  3GPY A;  2PMS A;  2QFL A;  3I6V A;  4H5F A;  2JNH A;  4JDF A;  1QUT A;  4FD2 A;  3T1Y M;  1GJT A;  3QYT A;  5I58 A;  1G71 A;  2ZYO A;  3BKI B;  3GBB A;  1PB8 A;  2ZAN A;  4ECF A;  3FJG A;  3D8L A;  3MZB A;  3O97 A;  4IJE A;  2OQ4 A;  2X26 A;  4M9S A;  2FIX A;  2WZJ A;  2THI A;  4REZ A;  2J5Y A;  3VV5 A;  2F5Q A;  1MPD A;  2KRU A;  2QNJ A;  1N04 A;  4UA8 A;  4N4U A;  4F22 A;  4LF7 M;  1CB6 A;  1D9V A;  3J27 B;  4IBG A;  5FTN A;  4CGY B;  1JW4 A;  1HJP A;  2Y5K A;  4NXM M;  1DTZ A;  2GFE A;  4DXB A;  4G4O A;  3USD A;  1FW0 A;  2QVR A;  3C34 A;  5L8R F;  1D0M A;  3PD9 A;  5I59 B;  2R8T A;  1SBP A;  2DWI A;  1MS7 A;  4ZED A;  1B52 A;  1E9R A;  4PAI A;  2K6B A;  4POW A;  4LAT A;  2VT5 A;  1ZMW A;  2HCB A;  1XI6 A;  1XT8 A;  2LNH C;  1FQE A;  1OAO C;  2JY8 A;  4F1I A;  4IO5 A;  2E5L M;  3CF6 E;  1AIP C;  3WHK A;  2CZI A;  4PFY A;  2DAI A;  4GIT A;  5E6J A;  1B6H A;  4OET A;  5CMK A;  3K1M A;  2UXC M;  3PUV E;  3TAJ A;  5AA4 A;  3DP4 A;  4GL8 A;  2L4F A;  5AA2 D;  3VLF B;  1MDP 1;  3SEW A;  1MXU A;  1J09 A;  1ZV1 A;  5I2N B;  2OWT A;  1GLN A;  4GF8 A;  1URG A;  3KOT A;  3KZG A;  1B1H A;  2Q8M A;  1UTH B;  4R3D A;  2ONK E;  4R72 A;  4NQ8 A;  2LH0 A;  2KHH A;  1XNQ M;  3RT8 A;  4LJ6 A;  1ZMV A;  2CUZ A;  5EQT A;  1PJI A;  4LA9 A;  1FTK A;  3MMP A;  3T1H M;  4ZEK A;  5FBP A;  2O01 F;  5GKN A;  4OVT A;  1HNZ M;  3DZD A;  2Q74 A;  4OVP A;  4OTE A;  3FAS A;  1NV0 A;  3UZU A;  3QUF A;  1D0K A;  4DV1 M;  4OMB A;  4JI2 M;  4JI0 M;  3ZS6 A;  1LB9 A;  1JR3 D;  4GMQ A;  3S9M C;  1MXY A;  2LXE A;  3I4Y A;  4KPT A;  3LSF B;  3G3H A;  2AHM A;  2AL5 A;  4JSO A;  2B4M A;  4QSC A;  5H8N A;  2H4I A;  5JEI A;  4JVI A;  4Z8X A;  1FTL A;  4O8M A;  4IB2 A;  2HL7 A;  3A3U A;  3FYC A;  4O3C A;  3FXQ A;  1G3I A;  1H43 A;  1YZ0 A;  2O7I A;  3K4U A;  5EP3 A;  1A7L A;  1FQD A;  4LP2 B;  1MQH A;  3IB0 A;  3SC3 A;  3U60 A;  4R6Y A;  2J7O A;  2JZ0 A;  2HAV A;  4GWU A;  3RGS A;  2XWO A;  1US5 A;  4JI4 M;  1E94 E;  4QFP A;  2Z4S A;  4PBH A;  4PFW A;  1IFY A;  4GIP A;  4LZ5 A;  2G93 A;  2XH9 A;  4OFO A;  4DXC A;  4F39 A;  3GYY A;  4G8H A;  4LGM A;  4ZEI A;  3S9E A;  4PE3 A;  1VFE A;  2JZ1 A;  8CAT A;  2DZL A;  2I0B A;  5AA2 B;  3TPZ A;  2QVV A;  1TFD A;  4ISU A;  3LSW A;  4Q0C A;  4NL4 H;  1B9J A;  1O63 A;  4U2R A;  4PGP A;  2JY7 A;  2XXP A;  2CHV A;  3FUW A;  1Z7N E;  1YPN A;  4RJZ A;  2FBP A;  1URD A;  3R26 A;  2DWJ A;  1EZ9 A;  3SYK A;  1KFV A;  5H8Q A;  1FBG A;  4Q7J A;  2HXW A;  1IY0 A;  1XS5 A;  2OPF A;  3L25 A;  2E0S A;  2LHC A;  1TFA A;  4NAP A;  3THI A;  1K9Y A;  4FWH A;  3GLI B;  5BPV A;  2PT2 A;  4CIZ A;  5DW8 A;  3DP8 A;  4NX1 A;  1NO1 A;  4DV3 M;  4I40 A;  3JZJ A;  2OX3 A;  2I3W A;  2VGQ A;  4MHF A;  3ROJ A;  1AL3 A;  3KN8 A;  1RU3 A;  2D7E A;  4YIC A;  1R2Z A;  1WIV A;  2M60 A;  1FTO A;  1VSO A;  1HQC A;  3HGI A;  4HE1 A;  1OKS A;  2YPN A;  1EYK A;  1VDD A;  2DSF A;  4LJA A;  4IBJ A;  2DWZ B;  1N77 A;  2OO9 A;  4CJ6 A;  2P3N A;  2ZNU A;  3HKP A;  3PPN A;  4EDP A;  3T96 B;  1PM5 A;  5AA3 A;  1JEV A;  3M3F A;  4OA4 A;  2H5Y A;  3ODB A;  3LCU A;  2EA0 A;  3OO9 A;  4GC9 A;  4K3F A;  3RTW B;  3I01 M;  4DDD A;  4F2Q A;  3AXF A;  3MAM A;  4O3B A;  5DT6 A;  4TLL B;  2Q8J A;  1GL6 A;  2FNC A;  3T15 A;  1YUB A;  3OO7 A;  1ZMU A;  2O6A A;  2Z4R A;  1DSN A;  4KCD A;  4X62 M;  4P0I A;  3D4C A;  3C33 A;  5IZ3 A;  4IBF A;  3S9N C;  3SER A;  2K0B X;  3UP9 A;  2JUJ A;  3H7M A;  1JET A;  3KC0 A;  1UM8 A;  5LOM A;  3IHP A;  1BTJ A;  1TXF A;  4NWD A;  4MGH A;  3KC1 A;  3BFT A;  4YB6 A;  1QW0 A;  4GWY A;  1GVC A;  5K2Y A;  1I6B A;  1L8Q A;  3KW6 A;  3GPP A;  2Z23 A;  2I48 A;  3HO7 A;  4LGY A;  5A2Q S;  2AIX A;  4U22 A;  4UAC A;  2K9D A;  4R2B A;  2R6G E;  4G2Z A;  4B7F A;  1GR2 A;  2DI0 A;  4KQP A;  3UK6 A;  3W0L B;  2ZNS A;  5CM6 A;  2XFS A;  1JEU A;  4TOZ A;  1B0H A;  1POY 1;  3TFL A;  5L9O A;  1BLF A;  3A29 A;  5DNY A;  3L6H A;  1QKB A;  3H6V A;  4GRI A;  5HPQ A;  4AW4 A;  3G3J A;  4OVR A;  3A3C A;  3TWM A;  3OSR A;  1N34 M;  2KRK A;  5H8S A;  4EIW A;  3U61 A;  5FHO A;  1VEK A;  4GEW A;  3J7A S;  3B7Z A;  4MLQ A;  3WAF A;  4ITQ A;  2Y0Q A;  2QJE A;  4GWW A;  2F5O A;  4ZEB A;  2WSE F;  3IJO B;  1QAM A;  2KXE A;  3M0E A;  2L5V A;  3K00 A;  3HN0 A;  1N3X A;  4FCW A;  5HBC A;  3FE3 A;  3ZQJ A;  3AKZ A;  4DR3 M;  2VII A;  4QRZ A;  4FEC A;  3UMM A;  4H6D A;  2ZMB A;  1MG1 A;  3F11 A;  1DK4 A;  2I7P A;  5CRY A;  2XZF A;  1XB2 B;  3OMB A;  3SAR A;  3EHT A;  1GV8 A;  3LBS A;  1QUI A;  3E4R A;  4P16 A;  1OIB A;  1V33 A;  3GLG B;  4R73 A;  2F8D A;  3BOS A;  4IGR A;  1GVN A;  4C1T A;  1PBP A;  2DAE A;  2DWN A;  2DVZ A;  5IKB A;  2XEP A;  3EKI A;  1FPG A;  3SES A;  4ELP A;  4PFU A;  3KFM A;  2ALU A;  4RF1 A;  1G0H A;  1G59 A;  4NRV A;  5JI3 E;  5ITU A;  4QOZ C;  2ZTD A;  2DWL A;  3MP6 A;  4OVZ B;  3R7X A;  1WDN A;  2R4E A;  2Y7I A;  1NHG C;  5FSW A;  4EXL A;  5TU0 A;  1BIY A;  2V3Q A;  1L1Z A;  5JI2 E;  3CG1 A;  1IQP A;  3R9X B;  1DPP A;  2P0S A;  4QF9 A;  4QFN A;  3V8X B;  3K9O A;  4Z6Y A;  4PT5 A;  4OEU A;  4YB7 A;  3SEX A;  1IMC A;  5I7I A;  1LFH A;  3TCH A;  4YKJ A;  4XKR A;  3KDS E;  4E0X A;  3U93 A;  4HCW A;  1FPI A;  2G3Q A;  5I56 A;  4JSD A;  1DGH A;  4IBE A;  2LAO A;  5ITR A;  4ZDM A;  4MGK E;  3TE6 A;  3C9P A;  2CMO A;  2F97 A;  3HY5 A;  3KXE C;  1OLA A;  2VPO A;  3GQ4 A;  1S3S A;  5L8D A;  1ZJL A;  2QBY B;  1DGF A;  4GXA A;  2C96 A;  4X66 M;  1PJT A;  4OER A;  4DR5 M;  3K1J A;  4YHH M;  1NMU A;  3PXG A;  3B6T A;  1IXZ A;  3VFJ A;  4THI A;  3FIR A;  3FBP A;  3HPI A;  5I57 B;  1Z59 A;  4R6K A;  2V1C A;  2L2D A;  1BK4 A;  4HE0 A;  1OIZ A;  1KA0 A;  4YB5 A;  4C1U A;  1IXR C;  3LUY A;  4RF0 A;  3GO8 A;  3SMP A;  3FVN A;  2UUB M;  2VHA A;  2VD2 A;  1LFI A;  5DEX A;  2XXR A;  3IG8 A;  1F9B A;  2WX9 A;  3T66 A;  1POT A;  1NJF A;  1IXS A;  3CIJ A;  4JB7 A;  1MM7 A;  3QIM A;  4DUY M;  3OSQ A;  5K2X A;  5ICQ A;  1NNK A;  3TQW A;  3CF2 A;  1SI0 A;  3G3F A;  1QJM A;  1H44 A;  1JVX A;  3MJN A;  4LRS A;  3OTO M;  3THG A;  4GH9 A;  1LBW A;  3U6S A;  5KDT A;  4KYS A;  1LBZ A;  2YNM D;  2ONS A;  1D9Y A;  1PJJ A;  1IBK M;  2L7H A;  1FQC A;  1A8E A;  1N76 A;  5CC2 A;  2Y20 A;  1T0K A;  3PFI A;  3H4Z A;  4X9T A;  2RKO A;  3RPL A;  1Q02 A;  3FD3 A;  4NSO B;  3VXC A;  1P1Q A;  3EHU A;  2KZS A;  4BDN A;  4YY3 M;  4ONY A;  4JWX A;  4XKN A;  3MHV C;  3JV9 A;  1LAX A;  3B89 A;  2REJ A;  4M9Z A;  4F31 B;  4AQY M;  2UYE A;  4GLI A;  4B7G A;  5H8F B;  1B5I A;  2VDB B;  3FUV A;  4GX4 A;  2BNK A;  2LVP C;  4RK9 A;  4ZZE A;  1ZLQ A;  4PTK A;  2C5R A;  3FV1 A;  1LV7 A;  3N6U A;  5EP1 A;  2DXY A;  3FAT A;  4X48 A;  4DR2 M;  5EQ9 A;  4DXU A;  5JK4 A;  1TH2 A;  3TEP A;  4N81 A;  4F3P A;  3C31 A;  3KEI A;  5ITQ A;  3C3D A;  4IO2 A;  5T3J A;  3UJN A;  3MST A;  3FZV A;  1D2N A;  3PPO A;  1SXJ A;  1LEV A;  1MJG M;  4U4X A;  4H1X A;  4RPN A;  3C3E A;  1XXH A;  2PX1 A;  2XD3 A;  4YKP A;  2BJV A;  5DVI A;  4LRT A;  5I84 A;  4FW9 A;  2HAK A;  3ZSF A;  2KW0 A;  1BVS A;  1GKI A;  3RTF B;  2C9O A;  3IK6 B;  5I59 A;  5JTY A;  4H8I A;  4S12 A;  4E0W A;  4ZE9 A;  4EF1 A;  5ICT A;  2DZO B;  4JI5 M;  3CR9 A;  3T9H B;  3ZH9 B;  1RDZ A;  5I2K B;  3PV0 E;  1B40 A;  2PFZ A;  4G68 A;  1Y3P A;  3LMM A;  3LW5 F;  1S7Y A;  4ZEF A;  3IB1 A;  3S9L C;  3AV0 A;  4MAG A;  1AOV A;  1X37 A;  1Q3B A;  3J80 S;  3ZCB B;  1VFD A;  3U8Q A;  5FTJ A;  2HZL A;  3LV0 A;  4GHA A;  2A5T A;  1NKX A;  2V3T A;  1TGU A;  1C7Y A;  4JN6 A;  1G0I A;  5EHM A;  3B8B A;  4X64 M;  1HSL A;  4PE5 B;  3D8B A;  1UTH A;  2Q89 A;  2Z22 A;  2YR0 A;  4NC6 A;  1K3W A;  1HT2 E;  3QYE A;  1B7U A;  1Y9U A;  1XOC A;  5DYI A;  2OJT A;  1W5S A;  4NN3 A;  4JI1 M;  2BJW A;  2ANJ A;  2OWZ A;  4MH0 E;  2ZM6 M;  1XWI A;  5EP4 A;  4FAJ A;  3FXB A;  3A45 A;  3SET A;  3OO8 A;  3MPK A;  1O64 A;  1LB8 A;  4Y28 F;  5DYG A;  2PFY A;  4O7M A;  2KR0 A;  2HZK A;  2O69 A;  3K2D A;  3BXW A;  5TPA A;  3SMS A;  3TTR A;  4MNP A;  1XMQ M;  4IR8 A;  2L7I A;  1MH4 A;  5EQ7 A;  1T43 A;  3RE8 A;  2XX8 A;  1AMF A;  1DGB A;  1VR5 A;  1B4H A;  1SQY A;  2UUC M;  3TTM A;  1RYO A;  1IY1 A;  3U94 A;  2ZZV A;  4NSR A;  1XMO M;  2FS1 A;  4DR4 M;  2Y7R A;  5A5L A;  5J1D A;  3KOY E;  4R74 A;  3R6U A;  2GQ1 A;  3SEU A;  3TQL A;  3BIG A;  3HJ8 A;  3L27 A;  4HEO A;  4MMP A;  2H98 A;  1II5 A;  4MBP A;  3NOH A;  3MVZ A;  3PU5 A;  5ET5 A;  3BIH A;  2DS9 A;  4H65 A;  1S9T A;  2I6E A;  2ZAO A;  1IME A;  3QAX A;  4PFI A;  4N8Y A;  4PFT A;  2N35 A;  3N5L A;  4IBC A;  3QYB A;  3T38 A;  4I5S A;  5EYH A;  1NUW A;  4I1D A;  2C99 A;  2XWK A;  3UIF A;  1CE2 A;  4U1Z A;  1ZTY A;  4OHN A;  4L16 A;  3HJS A;  4POX A;  1IN4 A;  4R71 A;  2O5R A;  3KBZ A;  4OAN A;  2HPG A;  1Q39 A;  3MVW A;  4BDR A;  5IM2 A;  4QSD A;  5EQ8 A;  4RNS A;  4C0R A;  3FXR A;  1QUS A;  3EIH A;  3GLI A;  3HU1 A;  3T6P A;  1ATG A;  2P5T A;  4HE2 A;  3JYR A;  4M0D A;  1IMD A;  1SDX A;  2LTU A;  2B3B A;  1RKM A;  1SW1 A;  3GXA A;  2R0I A;  3GLH A;  1LAF E;  1JR3 A;  4PDD A;  1QKA A;  1E32 A;  1N7X A;  4QSE A;  4JWY A;  3U65 A;  1HQY E;  1VDL A;  2LVQ D;  2L4E A;  2KLF A;  3K02 A;  4DV5 M;  4NMY A;  1JVY A;  2XXK A;  4DI3 D;  3KOS A;  4OU7 A;  2F35 A;  4PD2 A;  4IGT A;  1SXJ E;  3KN3 A;  5IZ1 A;  2LVN C;  1SYI A;  3W15 C;  3L29 A;  4R2F A;  1XXH E;  3O6H A;  4QNM A;  1B3H A;  1ZBM A;  2QPQ A;  1PRB A;  1Y3N A;  3MW0 A;  3DOA A;  4QFL A;  4N17 A;  2DAM A;  4B08 A;  2CE7 A;  4P3L A;  3MP8 A;  1XC1 A;  1ZAE A;  2PT1 A;  3FV2 A;  1MDQ A;  1GO5 A;  2QRY A;  4PFB A;  2MH8 A;  2OBG A;  2MR9 A;  4WKM A;  5H37 D;  1W5T A;  4H5G A;  4BDQ A;  3HV1 A;  3G3I A;  1NUZ A;  3TEL A;  3CTW B;  3W0F A;  5DVF A;  3TMG A;  4GX6 A;  1QZE A;  1NL5 A;  1MY2 A; 
#chains in the Genus database with same CATH homology
 3ZC7 B;  4NF8 B;  5ITP A;  5IT9 S;  1D3K A;  4LVQ A;  3TPA A;  4OW0 A;  4DV4 M;  4FJP A;  4R6H A;  1LST A;  1N75 A;  3C35 A;  5KCJ B;  4DR1 M;  4NF6 B;  5KPZ A;  3O28 A;  4LF9 M;  2HCA A;  4KFQ A;  3J7B A;  5I58 B;  3CI8 A;  4R9F A;  3NBI A;  4U4S A;  5CMC A;  1IM2 A;  4ELQ A;  3SFZ A;  4JXJ A;  2F7A A;  5H8H A;  3ONM A;  2Y84 A;  2F5N A;  1QAO A;  3HU2 A;  3PUW E;  3CFL A;  3C58 A;  1IXC A;  3GLF A;  1SYH A;  4ELR A;  4GC5 A;  1J5E M;  2KEB A;  2AYS A;  4IIW A;  4HL4 A;  3P7I A;  4F1Y A;  1ANF A;  2X7Q A;  4AI6 A;  3M8U A;  5DVJ A;  3FUX A;  3PPQ A;  1R2Y A;  3PNV A;  2CEA A;  4LQ2 A;  5M2V A;  3LC8 A;  2VQE M;  2FYI A;  4LZ7 A;  3FXU A;  1TH3 A;  2DQV A;  4JWO A;  1NVM A;  1G41 A;  3K01 A;  5LMN M;  3CRB A;  1XHB A;  3N26 A;  2DVW B;  5EYF A;  4RXL A;  2Y7W A;  4WEP A;  4KHZ E;  4B3S M;  3C36 A;  4NF4 A;  5AA4 B;  4D80 A;  3KBR A;  4JXI A;  1RYX A;  2IEE A;  1TDH A;  4AQ4 A;  4MB7 A;  3Q8X A;  3MBP A;  4WED A;  4R7G A;  1HT1 E;  4BDO A;  3AOG A;  3VXB A;  4GKJ M;  3LSL A;  1MY3 A;  3TDJ A;  4GHL A;  2F7C A;  2V84 A;  5FTK A;  1UTB A;  3E13 X;  1TWY A;  4LJ7 A;  3I4V A;  4HS7 A;  4I8C A;  4LZZ A;  2F5X A;  2O84 X;  1B7Z A;  4AG6 A;  5CMM A;  4GWO A;  3ILU B;  3HWS A;  2O1L A;  1M5F A;  3H03 A;  5H8N B;  2QBY A;  2AL4 A;  3OOA A;  1IN5 A;  3JR4 A;  2UUA M;  3FJ7 A;  2R45 A;  3UOR A;  1TH4 A;  1UQW A;  1OLC A;  2NUV A;  4L78 A;  3LQQ A;  1LAH E;  4KYE A;  2B65 A;  3U60 B;  4QHT A;  2W82 A;  1OQG A;  1QVS A;  3U5Z A;  4I9D A;  3HHF A;  3MVY A;  4AZF A;  1LLS A;  3O2A A;  5A5X A;  2XXH A;  1NHW C;  4NOO B;  3K0V A;  4AB6 A;  2Y7P A;  1WOD A;  3OEM A;  3TUS A;  4Q5T A;  4DCX A;  4HLQ A;  4PDG A;  5FHM A;  3T9V A;  1A8F A;  3KP0 E;  1PC3 A;  3OD7 A;  3UA8 A;  1URS A;  4YZZ A;  3A09 A;  4FAT A;  4M4G A;  4DZ1 A;  4NRW A;  4JYA M;  4DE8 A;  1R6B X;  4FOR A;  1IUD A;  1QYR A;  4LJ8 A;  5TP9 A;  1MQG A;  3MP1 A;  2QL3 A;  1NNJ A;  5H8Q B;  2XD2 A;  2OZZ A;  3B6W A;  4DR6 M;  3M3L A;  3U6Q A;  4L15 A;  3KGC A;  4DCY A;  4MGY E;  4X1D A;  1L5T A;  3CFZ A;  3HU3 A;  1FQA A;  3QUJ A;  2H9B A;  2QS3 A;  4PP0 A;  4IY6 A;  1JQF A;  2UVJ A;  5IWA M;  3J81 S;  4YAH X;  4U23 A;  5BWJ A;  1I69 A;  4NF5 A;  1S50 A;  3KJT A;  4F29 A;  2C98 A;  1EU8 A;  3N6T A;  3IB2 A;  4OEV A;  1L2C A;  1EZO A;  3OEN A;  2R18 A;  2GH9 A;  2V6Z M;  2RC7 A;  4M1V A;  3FKE A;  1OVB A;  5C18 A;  2NQ8 C;  1XVY A;  3LQR A;  1EZP A;  1B0L A;  4EQ9 A;  1Q3C A;  3FUU A;  4FWG A;  3O9P A;  4MFI A;  3VVF A;  4G4N A;  4LF6 M;  4ELO A;  4KYD A;  3G7W A;  5KO3 A;  3H3G A;  3TZA A;  4GD5 A;  1NY5 A;  3RT6 B;  3R8F A;  1MXX A;  1ELJ A;  3DP6 A;  4G68 C;  4KO8 A;  5CBR A;  3U6D A;  1DTG A;  1QUL A;  1B3L A;  3LVW A;  3TTN A;  2PBW A;  4H0W A;  3VLW A;  1NNU C;  5ITX A;  4H67 A;  3OEK A;  3IOT A;  2DVC A;  2JA2 A;  4RK2 A;  3CSG A;  3KJ7 A;  2FA7 A;  2Z8D A;  4KR5 A;  4BB9 A;  2I4C A;  4H8J A;  2L09 A;  3RFW A;  3IO6 A;  1IIT A;  1N78 A;  3C32 A;  3H6T A;  2Y21 A;  3AOE C;  2P2A A;  3GRY A;  1E9S A;  4IBB A;  3E3K A;  4G6Z A;  1GL7 A;  1B2H A;  1Y1Z A;  3Q25 A;  4LF5 M;  4GQO A;  3IOV A;  2CV1 A;  1DMB A;  4XXU A;  4D82 A;  5FTI A;  3M6A A;  3OO6 A;  2R4J A;  3HHG A;  4RNA A;  3A42 A;  3CFX A;  1B32 A;  4GKK M;  4GOT A;  1XC8 A;  1YSY A;  3U61 B;  3L28 A;  2V3U A;  3SHG B;  3FTD A;  2PYY A;  1A54 A;  2X4A A;  3IJX B;  4LFA M;  3SYL A;  4F3B A;  2CHG A;  2M8C A;  1Y1M A;  2HEU A;  2XXT A;  1IXG A;  3WHL A;  2ZNT A;  1L1T A;  3B6Q A;  1MQD A;  4BBA A;  1EH3 A;  1NNT A;  2O1M A;  3B7D A;  3H06 B;  1YTV A;  3WAE A;  4XKQ A;  1IN8 A;  3IX1 A;  2R71 A;  1XNR M;  2C9C A;  2ZYM A;  1N36 M;  3ECR A;  4B3T M;  3CSB A;  5AA1 A;  2GHB A;  1M5B A;  4QHS A;  3JAM S;  1G8P A;  1H45 A;  2DE4 A;  2P1S A;  3DFZ A;  2Q9T A;  4RA1 A;  5ITO A;  3GRU A;  1FTJ A;  1IEJ A;  5FTM A;  4KCC A;  4F18 A;  1Y4C A;  4IBI A;  1B7H A;  1UIV A;  4QFK A;  4BLA A;  1NH8 A;  1SI1 A;  3IG5 A;  2UVI A;  4FCV A;  1ZMG A;  4X1B A;  4LCB A;  1P1U A;  4O3A A;  2R65 A;  2D21 A;  1I6Q A;  4N13 A;  3BBR A;  3RGY A;  3IL1 B;  3PNY A;  4EQB A;  3GQ3 A;  4MGI E;  2CV0 A;  2XSZ A;  4N07 A;  3GZG A;  3PUY E;  3QWL A;  4JI3 M;  2OLB A;  5C1B A;  4W5W A;  3KOZ E;  1FCK A;  4ZS9 A;  1IY2 A;  4LF4 M;  1YE9 A;  2X49 A;  4MLV A;  4KI0 E;  4HCY A;  2QCU A;  3V89 B;  3CF0 A;  1LBB A;  4YMA A;  4L17 A;  5I56 B;  1B51 A;  2F6G A;  5EJC A;  3ZKL A;  3A46 A;  3PD8 A;  1IN7 A;  2V93 A;  4GXS B;  1HNX M;  3GRV A;  4I81 A;  3PMV A;  4LG2 A;  2DZN B;  3O29 A;  4LJ5 A;  3MPL A;  1MM6 A;  3L2A A;  4XKP A;  3PMW A;  4BDL A;  5I2N A;  1GGG A;  2EUC A;  3EN3 A;  5EXT A;  1Z7M E;  1MU5 A;  1MQI A;  4G4Q A;  3VLU A;  5B7D A;  5FTL A;  5BR8 M;  5F1Q A;  2O7U A;  1PB7 A;  4JI6 M;  5EXP A;  2DHR A;  2R46 A;  2XLJ A;  3T93 B;  5DEX B;  1LBC A;  4G8N A;  2XXU A;  4WW0 A;  1IXS B;  3TOD A;  4FE8 A;  3NWL A;  1B1X A;  5FLX S;  4DLD A;  5ITX E;  1UIU A;  1LCF A;  2OWS A;  3TL4 X;  4DUZ M;  4HTG A;  3K6V A;  4IBK A;  2FFJ A;  3VK7 A;  2HQ0 A;  2Q88 A;  1VE4 A;  3EHS A;  1A99 A;  5CI5 A;  3CG3 A;  2XXY A;  1Z5B A;  4TLM B;  3OEL A;  3H4M A;  1A55 A;  1DO0 A;  2XZU A;  2B3F A;  2D5W A;  1HR0 M;  2NOO A;  2YLN A;  5KDT B;  3L26 A;  1MH3 A;  2UXA A;  3Q28 A;  4U21 A;  3SEV A;  4P11 A;  4JI7 M;  1WXQ A;  4Q8R A;  3KFU G;  4MGZ E;  3RPW A;  4G77 A;  2FOI C;  2QMX A;  5CMB A;  3LSX A;  4NF6 A;  2CHQ A;  3RN8 A;  4Z7E A;  5IRE B;  2I0C A;  4I62 A;  2FNA A;  3TTK A;  1A40 A;  2Z3X A;  2R9J A;  4L4U A;  3D4G A;  3QXM A;  5KPT A;  3VVE A;  4A3V B;  4LJ9 A;  2DXI A;  5AA2 A;  2DWH A;  2CFO A;  2I3V A;  1LCT A;  3FUT A;  2QMW A;  3I51 A;  1NSF A;  3FTF A;  3KVW A;  3KG2 A;  3E9X A;  4IJF A;  4R75 A;  5B70 A;  4GFR A;  1SXJ B;  1DOT A;  2A5S A;  3JR5 A;  4OFJ A;  1XXH B;  3MQ9 A;  4IO7 A;  3V5A A;  5KQ8 A;  2D7G A;  5JTY B;  4YKI A;  4EQ7 A;  3U6M A;  1NH7 A;  2E1S A;  2I7N A;  4QOS A;  2CV2 A;  4EUO A;  3AFH A;  4Z0I A;  2Z8E A;  4GRK A;  1MXW A;  1Y20 A;  1NJG A;  3O6G A;  4G68 B;  2I58 A;  4NE4 A;  1Q35 A;  1NNF A;  4Q30 B;  1IXH A;  2RCA A;  3RQT A;  2VD3 A;  3C4M A;  1R1N A;  2XXX A;  1JW1 A;  3Q26 A;  3K1N A;  1PB9 A;  1L2B A;  3IAZ A;  2A5T B;  2DXR A;  4CIS A;  1I94 M;  1HSJ A;  1NFT A;  1JNF A;  4X65 M;  3SAS A;  1MPC A;  3FGS A;  2XFT A;  1R9Q A;  4TUW A;  1ORY B;  3RGP A;  5KZT A;  3PVS A;  4OEN A;  1XHY A;  2XGN A;  4F3S A;  1YCJ A;  2QP9 X;  2FE8 A;  1MPB A;  3ILK A;  2W7Y A;  3S2V A;  1H3D A;  2QEN A;  3KSX A;  2DP8 A;  4OFL A;  1FNN A;  1WVJ A;  5EXS A;  1O7T A;  2QZ4 A;  1MY4 A;  3EQ1 A;  1OQH A;  5F7V A;  3SAV A;  1B58 A;  2G5G X;  5TPA B;  5F3W A;  2REG A;  1MY0 A;  4XTC Q;  4G4P A;  1IQ7 A;  4M9X A;  3MJ5 A;  3PPR A;  4P0G A;  4FIM A;  2RF1 A;  2DWM A;  1NNP A;  3T22 A;  1KSF X;  1B46 A;  4CHT B;  3GPU A;  4NXN M;  4IY5 A;  3KN7 A;  2XX7 A;  2ZYK A;  3K6X A;  4JBZ A;  1PDA A;  3DA1 A;  1MQJ A;  4DIG A;  3G3G A;  4QHQ A;  3E9S A;  2NXO A;  1M5D A;  4L8R C;  2J7N A;  1QQW A;  1IIW A;  1FJG M;  4FED A;  1PBQ A;  5FHN A;  1OFH A;  2Z8F A;  2NWJ A;  3TTL A;  3TYH A;  2RIN A;  2UXB M;  4EXK A;  3IOU A;  4NWC A;  4PET A;  2DE3 A;  3K6U A;  3LR1 A;  1MX0 A;  1EE8 A;  3U72 A;  1LFG A;  2I49 A;  4DV7 M;  2Q2A A;  3O6I A;  3HJQ A;  1J1N A;  2Z7J A;  4OX9 M;  1HNW M;  3G3K A;  1N0T A;  2OCU A;  2QPA A;  2UVG A;  2DYX A;  2X7P A;  2D3I A;  2UXD M;  3V83 A;  1H6U A;  2ABH A;  4AG5 A;  3QAU A;  1P1O A;  3GLG A;  1R6Z A;  1FQF A;  4KHP M;  5DYH A;  3U1O A;  4FWD A;  1B3E A;  2M5Z A;  3IO4 A;  3VDP A;  4ZEC A;  2A5Y B;  3RNN A;  3W9W A;  4XGI A;  3GLH B;  2QS4 A;  1XVX A;  3K1P A;  3M3K A;  3TKD A;  1SW5 A;  4LFC M;  2ZXT A;  4DV6 M;  4OVZ A;  3RUM A;  2X8A A;  1MRP A;  3CVG A;  4LZ8 A;  2HAU A;  4MH5 A;  2RC9 A;  3MVX A;  2Y0T A;  1LGB C;  3FVG A;  3SAW A;  4LF8 M;  1US4 A;  1FQB A;  5ELV A;  1SW2 A;  3K6W A;  4EF2 A;  2Q2C A;  3KP1 E;  3QSL A;  3DEL B;  3T9U A;  2Q2E B;  2O51 A;  2XF3 A;  1OJL A;  3K92 A;  1Z5C A;  2D7H A;  3U6P A;  4F19 A;  3J2P B;  4N6P A;  4FVM A;  3HHZ A;  4B3R M;  3N94 A;  4YU0 A;  3HST A;  1P99 A;  5I57 A;  4II7 A;  5FTH A;  2IA4 A;  1P1W A;  3EIE A;  2UYF A;  4GL0 A;  5ISU A;  3LVV A;  2HHH M;  2RCB A;  4KD5 A;  2F7B A;  4ESX A;  3UK4 A;  3UGJ A;  1JQJ C;  5AE4 A;  4ZZA A;  4ZE8 A;  4LY6 A;  3GBA A;  3PPP A;  2DOJ A;  4F2O A;  1QZM A;  2F5P A;  4KLN A;  2F78 A;  2DE2 A;  4U1O A;  1N33 M;  4IO3 A;  4YKK A;  4QNR A;  1JW5 A;  5H8H B;  4FCT A;  3U6E A;  2VOZ A;  2XHD A;  4F3G A;  4NTL A;  4OZ9 A;  1IBM M;  5BUU A;  1DPE A;  3SDF A;  3GLF B;  5ITY A;  4LON B;  1N32 M;  4HW8 A;  5EXX A;  4GVO A;  3SAT A;  4LZJ A;  1BP5 A;  5L9M A;  3VKH A;  3HHW A;  4D81 A;  1YAE A;  3ZKK A;  5KQD A;  1R7R A;  3TWL A;  2RGO A;  3PUZ E;  4KOD A;  3HCQ A;  2PVU A;  2KA6 B;  2UVH A;  1SVX B;  5HM4 B;  4AKI A;  3DM0 A;  4G4R A;  2H25 A;  5H8F A;  3K8Z A;  2OK2 A;  1FTM A;  2RC8 A;  1NY6 A;  3B9P A;  2K47 A;  3U6L A;  4FEB A;  5ITT A;  1SXJ C;  3SKP A;  5E26 A;  5EHS A;  4OQO A;  4NF4 B;  1QAQ A;  3VDU A;  4OVJ A;  4RY1 A;  2QS1 A;  3PMX A;  1QVR A;  4JV5 M;  3U92 A;  1G4A E;  2XXW A;  5LMU M;  3MZ9 A;  1IBL M;  3MC2 A;  3VKG A;  3KS4 A;  1N3W A;  1ZU0 A;  3PGF A;  3MUQ A;  4TQU Q;  2V1U A;  1Z6T A;  2V25 A;  2ONR A;  5L9S A;  2Y7K A;  3FUZ A;  3Q27 A;  2NVU B;  2F6P A;  2L6O A;  4DV0 M;  1UTB B;  2ZBK B;  3AJI B;  2LWX A;  5I2K A;  1B5H A;  1K3X A;  4WUR A;  1MXV A;  1I4W A;  3IR1 A;  1TT1 A;  2YJP A;  4ESW A;  4ZPX A;  1K82 A;  1SD3 A;  1N7W A;  1KWH A;  1C1K A;  3VE1 B;  3KOX E;  3U6O A;  3GRR A;  3FVK A;  2YQZ A;  2H99 A;  4B7H A;  4XBO A;  4ND9 A;  1TDZ A;  2QSX A;  5IAI A;  3I5O A;  3UN6 A;  3KOW E;  3M7G A;  4LQ5 A;  4DV2 M;  3T9X B;  4BLC A;  3U5Z B;  1DO2 A;  1L2D A;  4I8O A;  1ZQ9 A;  2VQF M;  3AL0 C;  3VLV A;  4DR7 M;  1HSE A;  5A5X B;  4OES A;  3FTE A;  3IOR A;  3RY3 A;  2RGH A;  4K0K M;  1M5C A;  4OYV A;  3PUX E;  3KS8 A;  3GPX A;  3EPE A;  1AIV A;  3TCG A;  1B3F A;  2G29 A;  5CBS A;  1AH5 A;  1T3T A;  4NED A;  1B5J A;  4PDI A;  4YMB A;  5TP9 B;  2QS2 A;  3A98 B;  3C9H A;  3L6G A;  3FYD A;  2ZAM A;  3GP1 A;  3MK6 A;  4PQJ A;  1GTK A;  3BFU A;  3S4U A;  1IN6 A;  3HHX A;  4LJ4 A;  2O68 A;  1H76 A;  2YFQ A;  1I6A A;  1MY1 A;  4WXJ A;  3DLN A;  3O66 A;  4RPO A;  2H1R A;  3GLB A;  3OXN A;  1J7K A;  2ERC A;  3H6W A;  4IO4 A;  1D4N A;  1QUJ A;  1OVT A;  4NF5 B;  2RKM A;  3FTC A;  4F1V A;  1OFI A;  1LAG E;  1P1N A;  4XIG Q;  3GQ5 A;  3VVD A;  2F5S A;  1USY E;  4M0W A;  1BKA A;  1Y4T A;  1R9L A;  2HKJ A;  3IOW A;  4RYA A;  2XXI A;  2XX9 A;  3QK6 A;  2XXQ A;  2WKY A;  3RLF E;  1SW4 A;  1USY H;  3MWB A;  3W9V A;  1M5E A;  3SAU A;  1DGH B;  2F36 A;  4QFO A;  4AKH A;  2ESN A;  5IZ7 D;  3FJM A;  1B3G A;  3ILT B;  3KSJ A;  1Z5A A;  1Q1K A;  2BJJ X;  1DGG A;  3VK8 A;  2UU9 M;  3HHY A;  4MF3 A;  1QUK A;  4BDM A;  3TQS A;  2I4B A;  3TCF A;  3H6U A;  2HFB A;  2G8L A;  3TWK A;  1ZIU A;  1IZ1 A;  1B05 A;  1IXI A;  2R62 A;  4F1U A;  5KPR A;  1Y3Q A;  3U6C A;  1SXJ D;  4AKG A;  2VP1 A;  1PEB A;  1OMP A;  4R9G A;  2KZU A;  2XXV A;  4JI8 M;  2XSZ D;  4IBD A;  2F4V M;  3MZ1 A;  3EF7 A;  3SHF A;  4B3M M;  3VFD A;  4G8M A;  4MM3 B;  4I4L A;  7CAT A;  2EO2 A;  3AOE A;  3FD9 A;  4OXV A;  2DWA A;  2ZYN A;  1MXZ A;  2F34 A;  3VDF A;  1N84 A;  1KYI A;  4AB5 A;  5DTB A;  3Q29 A;  4OWD A;  3SEY A;  2CZL A;  3I3V A;  1B4Z A;  4PCZ A;  2GHA A;  4LUB A;  3SBJ A;  4LFB M;  4IO6 A;  5EP2 A;  4GIZ A;  4NF8 A;  1ZKB A;  3UGW A;  3K2L A;  2GRV A;  1QAN A;  3FVO A;  5KCJ A;  3GPY A;  2PMS A;  4H5F A;  3I6V A;  4JDF A;  4FD2 A;  3T1Y M;  3QYT A;  5I58 A;  2ZYO A;  3BKI B;  3GBB A;  1PB8 A;  2ZAN A;  4ECF A;  3FJG A;  3D8L A;  3MZB A;  3O97 A;  4IJE A;  2OQ4 A;  2X26 A;  4M9S A;  2THI A;  4REZ A;  3VV5 A;  2F5Q A;  1MPD A;  2KRU A;  1N04 A;  4UA8 A;  4F22 A;  4LF7 M;  1CB6 A;  1D9V A;  3J27 B;  4IBG A;  5FTN A;  4CGY B;  1JW4 A;  4NXM M;  1DTZ A;  2GFE A;  4DXB A;  4G4O A;  3USD A;  1FW0 A;  3C34 A;  3PD9 A;  5I59 B;  1SBP A;  2DWI A;  1MS7 A;  4ZED A;  1B52 A;  1E9R A;  4POW A;  4LAT A;  2HCB A;  1XT8 A;  2LNH C;  1FQE A;  4IO5 A;  2E5L M;  3CF6 E;  3WHK A;  4PFY A;  4GIT A;  5E6J A;  1B6H A;  4OET A;  5CMK A;  3K1M A;  2UXC M;  3PUV E;  3TAJ A;  5AA4 A;  3DP4 A;  4GL8 A;  5AA2 D;  3VLF B;  1MDP 1;  3SEW A;  1MXU A;  1J09 A;  5I2N B;  2OWT A;  1GLN A;  4GF8 A;  1URG A;  3KOT A;  3KZG A;  1B1H A;  1UTH B;  4R3D A;  2ONK E;  4R72 A;  2LH0 A;  1XNQ M;  3RT8 A;  4LJ6 A;  2CUZ A;  1PJI A;  5EQT A;  4LA9 A;  1FTK A;  3T1H M;  4ZEK A;  5GKN A;  1HNZ M;  3DZD A;  4OTE A;  3FAS A;  3UZU A;  3QUF A;  4DV1 M;  4OMB A;  4JI2 M;  4JI0 M;  3ZS6 A;  1LB9 A;  1JR3 D;  4GMQ A;  3S9M C;  1MXY A;  2LXE A;  3I4Y A;  4KPT A;  3LSF B;  3G3H A;  2AHM A;  2AL5 A;  4JSO A;  4QSC A;  5H8N A;  2H4I A;  5JEI A;  4Z8X A;  1FTL A;  4IB2 A;  2HL7 A;  3A3U A;  3FYC A;  4O3C A;  3FXQ A;  1G3I A;  1H43 A;  2O7I A;  3K4U A;  5EP3 A;  1A7L A;  1FQD A;  4LP2 B;  1MQH A;  3IB0 A;  3SC3 A;  3U60 A;  4R6Y A;  2J7O A;  2HAV A;  3RGS A;  1US5 A;  4JI4 M;  1E94 E;  4QFP A;  2Z4S A;  4PFW A;  4GIP A;  4LZ5 A;  2G93 A;  2XH9 A;  4OFO A;  4DXC A;  4F39 A;  4G8H A;  4LGM A;  4ZEI A;  3S9E A;  1VFE A;  8CAT A;  2I0B A;  5AA2 B;  3TPZ A;  1TFD A;  4ISU A;  3LSW A;  4Q0C A;  4NL4 H;  1B9J A;  1O63 A;  4U2R A;  2XXP A;  2CHV A;  3FUW A;  1Z7N E;  1YPN A;  4RJZ A;  1URD A;  3R26 A;  2DWJ A;  1EZ9 A;  3SYK A;  1KFV A;  5H8Q A;  2HXW A;  1IY0 A;  1XS5 A;  2OPF A;  3L25 A;  2E0S A;  1TFA A;  3THI A;  4FWH A;  3GLI B;  5BPV A;  2PT2 A;  3DP8 A;  4DV3 M;  3JZJ A;  2I3W A;  2VGQ A;  1AL3 A;  3KN8 A;  2D7E A;  4YIC A;  1R2Z A;  2M60 A;  1FTO A;  1VSO A;  1HQC A;  3HGI A;  2YPN A;  1VDD A;  2DSF A;  4LJA A;  4IBJ A;  2DWZ B;  1N77 A;  2ZNU A;  3HKP A;  3PPN A;  4EDP A;  3T96 B;  1PM5 A;  5AA3 A;  1JEV A;  3M3F A;  2H5Y A;  3ODB A;  2EA0 A;  3OO9 A;  4GC9 A;  4K3F A;  3RTW B;  4DDD A;  4F2Q A;  3AXF A;  3MAM A;  4O3B A;  5DT6 A;  4TLL B;  2Q8J A;  1GL6 A;  2FNC A;  3T15 A;  1YUB A;  3OO7 A;  2O6A A;  2Z4R A;  1DSN A;  4KCD A;  4X62 M;  4P0I A;  3D4C A;  3C33 A;  4IBF A;  3S9N C;  3SER A;  3UP9 A;  3H7M A;  1JET A;  1UM8 A;  5LOM A;  1BTJ A;  1TXF A;  4NWD A;  4MGH A;  3BFT A;  4YB6 A;  1QW0 A;  1GVC A;  5K2Y A;  1I6B A;  1L8Q A;  3KW6 A;  3GPP A;  2Z23 A;  2I48 A;  3HO7 A;  4LGY A;  5A2Q S;  2AIX A;  4U22 A;  4UAC A;  4R2B A;  2R6G E;  4G2Z A;  4B7F A;  1GR2 A;  4KQP A;  3UK6 A;  3W0L B;  2ZNS A;  5CM6 A;  2XFS A;  1JEU A;  4TOZ A;  1B0H A;  1POY 1;  3TFL A;  5L9O A;  1BLF A;  5DNY A;  3L6H A;  1QKB A;  3H6V A;  4GRI A;  5HPQ A;  4AW4 A;  3G3J A;  3A3C A;  3TWM A;  3OSR A;  1N34 M;  2KRK A;  5H8S A;  4EIW A;  3U61 A;  5FHO A;  3J7A S;  4MLQ A;  3WAF A;  4ITQ A;  2Y0Q A;  2QJE A;  4ZEB A;  2F5O A;  3IJO B;  1QAM A;  2KXE A;  3M0E A;  3K00 A;  3HN0 A;  1N3X A;  4FCW A;  5HBC A;  3AKZ A;  4DR3 M;  2VII A;  4QRZ A;  4FEC A;  3UMM A;  4H6D A;  2ZMB A;  1MG1 A;  3F11 A;  2I7P A;  5CRY A;  2XZF A;  3OMB A;  3SAR A;  3EHT A;  1GV8 A;  3LBS A;  1QUI A;  3E4R A;  4P16 A;  1OIB A;  3GLG B;  4R73 A;  2F8D A;  3BOS A;  4IGR A;  1GVN A;  4C1T A;  1PBP A;  2DWN A;  2DVZ A;  5IKB A;  2XEP A;  3SES A;  4ELP A;  4PFU A;  3KFM A;  2ALU A;  4RF1 A;  1G59 A;  4NRV A;  5JI3 E;  5ITU A;  4QOZ C;  2DWL A;  3MP6 A;  4OVZ B;  3R7X A;  1WDN A;  2R4E A;  2Y7I A;  1NHG C;  5FSW A;  4EXL A;  5TU0 A;  1BIY A;  2V3Q A;  1L1Z A;  5JI2 E;  3CG1 A;  1IQP A;  3R9X B;  1DPP A;  2P0S A;  4QF9 A;  4QFN A;  3V8X B;  4Z6Y A;  4PT5 A;  4OEU A;  4YB7 A;  3SEX A;  1LFH A;  3TCH A;  4YKJ A;  4XKR A;  3KDS E;  4E0X A;  3U93 A;  4HCW A;  5I56 A;  4JSD A;  1DGH A;  4IBE A;  2LAO A;  5ITR A;  4ZDM A;  4MGK E;  3TE6 A;  2F97 A;  2CMO A;  3KXE C;  1OLA A;  3GQ4 A;  1S3S A;  5L8D A;  1ZJL A;  2QBY B;  1DGF A;  4GXA A;  2C96 A;  4X66 M;  4OER A;  4DR5 M;  3K1J A;  4YHH M;  1NMU A;  3PXG A;  3B6T A;  1IXZ A;  3VFJ A;  4THI A;  3FIR A;  3HPI A;  5I57 B;  1Z59 A;  4R6K A;  2V1C A;  4YB5 A;  4C1U A;  1IXR C;  3LUY A;  4RF0 A;  3GO8 A;  3SMP A;  3FVN A;  2UUB M;  2VHA A;  2VD2 A;  1LFI A;  5DEX A;  2XXR A;  3IG8 A;  1F9B A;  3T66 A;  1POT A;  1NJF A;  3CIJ A;  4JB7 A;  1MM7 A;  3QIM A;  4DUY M;  3OSQ A;  5K2X A;  5ICQ A;  1NNK A;  3TQW A;  3CF2 A;  1SI0 A;  3G3F A;  1QJM A;  1H44 A;  1JVX A;  3MJN A;  4LRS A;  3OTO M;  3THG A;  4GH9 A;  3U6S A;  5KDT A;  4KYS A;  2YNM D;  2ONS A;  1D9Y A;  1PJJ A;  1IBK M;  2L7H A;  1FQC A;  1A8E A;  1N76 A;  5CC2 A;  2Y20 A;  1T0K A;  3PFI A;  3H4Z A;  4X9T A;  2RKO A;  3FD3 A;  4NSO B;  3VXC A;  1P1Q A;  3EHU A;  2KZS A;  4BDN A;  4YY3 M;  4ONY A;  4JWX A;  4XKN A;  3MHV C;  3JV9 A;  1LAX A;  2REJ A;  4M9Z A;  4F31 B;  4AQY M;  2UYE A;  4GLI A;  4B7G A;  5H8F B;  1B5I A;  3FUV A;  2BNK A;  4RK9 A;  4ZZE A;  1ZLQ A;  2C5R A;  3FV1 A;  1LV7 A;  3N6U A;  5EP1 A;  2DXY A;  3FAT A;  4X48 A;  4DR2 M;  4DXU A;  5JK4 A;  1TH2 A;  3TEP A;  4F3P A;  3C31 A;  3KEI A;  5ITQ A;  4IO2 A;  3UJN A;  3FZV A;  1D2N A;  3PPO A;  1SXJ A;  4U4X A;  4H1X A;  4RPN A;  1XXH A;  2PX1 A;  2XD3 A;  4YKP A;  2BJV A;  5DVI A;  4LRT A;  5I84 A;  4FW9 A;  3ZSF A;  2KW0 A;  1GKI A;  3RTF B;  2C9O A;  3IK6 B;  5I59 A;  5JTY A;  4H8I A;  4S12 A;  4E0W A;  4ZE9 A;  4EF1 A;  5ICT A;  2DZO B;  4JI5 M;  3CR9 A;  3T9H B;  3ZH9 B;  5I2K B;  3PV0 E;  1B40 A;  4G68 A;  1Y3P A;  3LMM A;  1S7Y A;  4ZEF A;  3IB1 A;  3S9L C;  3AV0 A;  1AOV A;  1X37 A;  1Q3B A;  3J80 S;  3ZCB B;  1VFD A;  3U8Q A;  5FTJ A;  2HZL A;  4GHA A;  2A5T A;  1NKX A;  2V3T A;  1TGU A;  4JN6 A;  5EHM A;  4X64 M;  1HSL A;  4PE5 B;  3D8B A;  1UTH A;  2Q89 A;  2Z22 A;  2YR0 A;  1K3W A;  1HT2 E;  1B7U A;  1Y9U A;  1XOC A;  5DYI A;  2OJT A;  1W5S A;  4JI1 M;  2BJW A;  2ANJ A;  4MH0 E;  2ZM6 M;  1XWI A;  5EP4 A;  4FAJ A;  3A45 A;  3SET A;  3OO8 A;  3MPK A;  1O64 A;  1LB8 A;  5DYG A;  2HZK A;  2O69 A;  3K2D A;  5TPA A;  3SMS A;  3TTR A;  1XMQ M;  2L7I A;  1MH4 A;  3RE8 A;  2XX8 A;  1AMF A;  1DGB A;  1VR5 A;  1B4H A;  1SQY A;  2UUC M;  3TTM A;  1RYO A;  1IY1 A;  3U94 A;  4NSR A;  1XMO M;  4DR4 M;  2Y7R A;  5J1D A;  3KOY E;  4R74 A;  3R6U A;  3SEU A;  3TQL A;  3HJ8 A;  3L27 A;  2H98 A;  1II5 A;  4MBP A;  3MVZ A;  3PU5 A;  2DS9 A;  4H65 A;  1S9T A;  2I6E A;  2ZAO A;  3QAX A;  4PFT A;  3N5L A;  4IBC A;  3T38 A;  4I5S A;  4I1D A;  2C99 A;  3UIF A;  1CE2 A;  4U1Z A;  1ZTY A;  4OHN A;  4L16 A;  3HJS A;  4POX A;  1IN4 A;  2O5R A;  1Q39 A;  3MVW A;  4BDR A;  4QSD A;  4RNS A;  4C0R A;  3FXR A;  3EIH A;  3GLI A;  3HU1 A;  1ATG A;  2P5T A;  3JYR A;  4M0D A;  1SDX A;  2B3B A;  1RKM A;  1SW1 A;  3GXA A;  3GLH A;  1LAF E;  1JR3 A;  1QKA A;  1E32 A;  1N7X A;  4QSE A;  4JWY A;  1HQY E;  2KLF A;  3K02 A;  4DV5 M;  4NMY A;  1JVY A;  3KOS A;  4OU7 A;  2F35 A;  4PD2 A;  4IGT A;  1SXJ E;  3KN3 A;  1SYI A;  3W15 C;  3L29 A;  4R2F A;  3O6H A;  4QNM A;  1B3H A;  1ZBM A;  2QPQ A;  1Y3N A;  3MW0 A;  3DOA A;  4QFL A;  4B08 A;  2CE7 A;  3MP8 A;  1XC1 A;  1ZAE A;  2PT1 A;  3FV2 A;  1MDQ A;  2QRY A;  2OBG A;  4WKM A;  5H37 D;  1W5T A;  4H5G A;  4BDQ A;  3HV1 A;  3G3I A;  3TEL A;  3CTW B;  3W0F A;  5DVF A;  3TMG A;  1NL5 A;  1MY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...