3KTGA

Structure of clpp from bacillus subtilis in monoclinic crystal form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
188
Chain Sequence
b'IPTVIAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTHLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 65
structure length 188
sequence length 196
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktgA00
3RSTA 5INGA 2D3TA 3P85A 1RJMA 1J7XA 3T88A 4G2RA 2EJ5A 4EMPA 3TT7A 5DU8A 2FW2A 1HZDA 5DZKA 5KDRB 3T8BA 4JFCA 4WYOB 4ZDFA 3Q0JA 3T8AA 2F6QA 2NP9A 3DJAA 2ZL2A 1DUBA 2ZQRA 2VSSA 3KTGA 3BEZA 3PGQA 2A7SA 2J5GD 4QFEA 5DL1A 3N6RB 2GTRA 3ST9A 4FNBA 1ON3A 4U18A 4RCNA 3WG5A 4NNQA 1O8UA 4MI2A 1EF8A 4FN7A 1OD4A 5CTCA 3OT6A 2VREA 1N6FA 4ELWA 1TYFA 5FIFA 5DZKH 2HW5A 4YLHA 1XNWA 4JVTA 3QYRA 5C90A 2VSUA 1Y7OA 3T3WA 5CTBA 4JJTA 4JSBA 3QK8A 3H02A 3ISAA 5KDRA 3M6NA 5DTPA 3FDUA 4K3WA 3R9TA 4B3JA 2X58A 4Q0GA 3K8XA 1NZYA 1WDKA 1UIYA 3HINA 2UZFA 5KJPA 4OMRA 1FC9A 4JYJA 3H0SA 4GM2A 4IZCA 5JBXA 1EF9A 3MOYA 5G1QA 3L3SA 4ELXA 2A7KA 1WDMA 1FC6A 1TG6A 2ZQQA 1JXZA 4Z0MA 2J5SA 3T89A 1SG4A 5INIA 4MOUA 3P5MA 2DUBA 3PEAA 3H0QA 3H0UA 3FF6A 4L8KA 3HLN1 5DKPA 2F9IB 2J5II 4JWVA 1PIXA 1ON9A 1SZOA 4FJWD 3GF7A 4LK5A 4B3HA 1RJNA 3IBBA 1XNVA 3JU1A 3PZKA 3GF3A 1Q51A 3GKBA 3MFMA 1YG6A 4FB8A 3R9QA 1MJ3A 3QXIA 4K29A 1UYTA 1EY3A 3QKAA 3IAVA 5DUCA 2VSSE 4IZDA 3HP0A 3OC7A 4JCSA 3KTKA 1K32A 2VX2A 4HC8A 1YG8A 3DORA 3ZWCA 4JOTA 4OLQA 3Q1TA 4KWBA 3QREA 2W3PA 4EMMA 1FC7A 1K39A 2Q34A 3TLFA 3QXZA 3TDCA 2ZL0A 5G1RA 4F47A 2VSUC 4ASIA 4RYFH 2CBYA 2FBMA 3KTIA 4MXIA 5DU4A 3SLLA 3M6MA 3MYBA 2FZSA 1WZ8A 2VSUE 2X24A 3KTJA 3TRRA 3H81A 2J5GA 1N6EA 3R9SA 2F9IA 3QMJA 2PPYA 3IB9A 3Q0GA 3V5IA 5DTWA 3H0JA 1DCIA 2ZL4A 4WCZA 3TVUA 1XO6A 4OG1A 4U0HA 1UYVA 2A81A 4WZ8B 2ZL3A 2BZRA 3OMEA 1HNOA 3U9SB 5IKLB 4KPKA 3QWDA 2IEXA 4I4ZA 4JCQA 3MT6A 4FZWA 4FN8A 4KNPA 4U1AA 5JBWA 3NJDA 3V5EA 1HNUA 4I42A 2CE3A 2VSSF 4HNKA 2DEOA 4DI1A 3LAOA 3LKEA 3U9RB 3HE2A 1OD2A 1XNYA 2F9YB 4JCTA 5MGBA 3SWXA 4RYFA 4B3IA 3R0OA 4EMLA 3RSIA 4K2NA 1UYSA 5G1SA 3TV5A 3TT6A 3HRXA 5E0SH 1NZYB 3ZW9A 3P2LA 3TZ3A 2J5IB 3GLMA 4ZU2A 4JCRA 4ZDCA 2VSUF 3KQFA 2Q35A 1W2XA 3BPPA 3PE8A 4ZDEA 1VRGA 3ZWAA 2Q2XA 4U19A 3KTHA 2F6IA 1FCFA 5E0NX 4I52A 4U0GA 3G64A 3R6HA 3I47A 3GMAA 3NJBA 4NEKA 3VIVA 1N6DA 5FUSA 1WDLA 2WTBA 3TVWA 3ZW8A 5C9GA 2PBPA 4ELSA 4QIIA 3STAA 2F9YA 3Q7HA 4ZDBA 2QQ3A 4GHNA 3BF0A 3K50A 1Q52A 4FNDA 5E0SA 3ZWBA 3U9TB 5DUFA 2PG8A 3RRVA 1XX4A 4L6WA 4Q1IA 4JYLA 4QIJA 2J5IA 4IZBA 5DU6A 1X0UA 4FZWC 1UYRA 4KD6A 4U0GH 2C8TA 4ZDDA 1PJHA 5INFA
chains in the Genus database with same CATH superfamily
3RSTA 5INGA 2D3TA 3P85A 1RJMA 1J7XA 3T88A 4G2RA 2EJ5A 4EMPA 3TT7A 5DU8A 2FW2A 1HZDA 5DZKA 5KDRB 3T8BA 4JFCA 4WYOB 4ZDFA 3Q0JA 3T8AA 2F6QA 2NP9A 3DJAA 2ZL2A 1DUBA 2ZQRA 2VSSA 3KTGA 3BEZA 3PGQA 2A7SA 2J5GD 4QFEA 5DL1A 3N6RB 2GTRA 3ST9A 4FNBA 1ON3A 4U18A 4RCNA 3WG5A 4NNQA 1O8UA 4MI2A 1EF8A 4FN7A 1OD4A 5CTCA 3OT6A 2VREA 1N6FA 4ELWA 1TYFA 5FIFA 5DZKH 2HW5A 4YLHA 1XNWA 4JVTA 3QYRA 5C90A 2VSUA 1Y7OA 3T3WA 5CTBA 4JJTA 4JSBA 3QK8A 3H02A 3ISAA 5KDRA 3M6NA 5DTPA 3FDUA 4K3WA 3R9TA 4B3JA 2X58A 4Q0GA 3K8XA 1NZYA 1WDKA 1UIYA 3HINA 2UZFA 5KJPA 4OMRA 1FC9A 4JYJA 3H0SA 4GM2A 4IZCA 5JBXA 1EF9A 3MOYA 5G1QA 3L3SA 4ELXA 2A7KA 1WDMA 1FC6A 1TG6A 2ZQQA 1JXZA 4Z0MA 2J5SA 3T89A 1SG4A 5INIA 4MOUA 3P5MA 2DUBA 3PEAA 3H0QA 3H0UA 3FF6A 4L8KA 3HLN1 5DKPA 2F9IB 2J5II 4JWVA 1PIXA 1ON9A 1SZOA 4FJWD 3GF7A 4LK5A 4B3HA 1RJNA 3IBBA 1XNVA 3JU1A 3PZKA 3GF3A 1Q51A 3GKBA 3MFMA 1YG6A 4FB8A 3R9QA 1MJ3A 3QXIA 4K29A 1UYTA 1EY3A 3QKAA 3IAVA 5DUCA 2VSSE 4IZDA 3HP0A 3OC7A 4JCSA 3KTKA 1K32A 2VX2A 4HC8A 1YG8A 3DORA 3ZWCA 4JOTA 4OLQA 3Q1TA 4KWBA 3QREA 2W3PA 4EMMA 1FC7A 1K39A 2Q34A 3TLFA 3QXZA 3TDCA 2ZL0A 5G1RA 4F47A 2VSUC 4ASIA 4RYFH 2CBYA 2FBMA 3KTIA 4MXIA 5DU4A 3SLLA 3M6MA 3MYBA 2FZSA 1WZ8A 2VSUE 2X24A 3KTJA 3TRRA 3H81A 2J5GA 1N6EA 3R9SA 2F9IA 3QMJA 2PPYA 3IB9A 3Q0GA 3V5IA 5DTWA 3H0JA 1DCIA 2ZL4A 4WCZA 3TVUA 1XO6A 4OG1A 4U0HA 1UYVA 2A81A 4WZ8B 2ZL3A 2BZRA 3OMEA 1HNOA 3U9SB 5IKLB 4KPKA 3QWDA 2IEXA 4I4ZA 4JCQA 3MT6A 2YJGA 4FZWA 4FN8A 4KNPA 4U1AA 5JBWA 3NJDA 3V5EA 1HNUA 4I42A 2CE3A 2VSSF 4HNKA 2DEOA 4DI1A 3LAOA 3LKEA 3U9RB 3HE2A 1OD2A 1XNYA 2F9YB 4JCTA 5MGBA 3SWXA 4RYFA 4B3IA 3R0OA 4EMLA 3RSIA 4K2NA 1UYSA 5G1SA 3TV5A 3TT6A 3HRXA 5E0SH 1NZYB 3ZW9A 3P2LA 4HDTA 3TZ3A 2J5IB 3GLMA 4ZU2A 4JCRA 4J2UA 4ZDCA 2VSUF 3KQFA 2Q35A 1W2XA 3BPPA 3PE8A 4ZDEA 1VRGA 3ZWAA 2Q2XA 4U19A 3KTHA 2F6IA 1FCFA 5E0NX 4I52A 4U0GA 3G64A 3R6HA 3I47A 3GMAA 3NJBA 4NEKA 3VIVA 1N6DA 5FUSA 1WDLA 5HUQA 2WTBA 3TVWA 3ZW8A 5C9GA 2PBPA 4ELSA 4QIIA 3STAA 2F9YA 3Q7HA 4ZDBA 2QQ3A 4GHNA 3BF0A 3K50A 1Q52A 4FNDA 5E0SA 3ZWBA 3U9TB 5DUFA 2PG8A 3RRVA 1XX4A 4L6WA 4Q1IA 4JYLA 4QIJA 3BPTA 2J5IA 4IZBA 5DU6A 1X0UA 4FZWC 1UYRA 4KD6A 4U0GH 2C8TA 4ZDDA 1PJHA 4NARA 5INFA
chains in the Genus database with same CATH topology
3RSTA 5INGA 2D3TA 3P85A 1RJMA 1J7XA 3T88A 4G2RA 2EJ5A 4EMPA 3TT7A 5DU8A 2FW2A 1HZDA 5DZKA 5KDRB 3T8BA 4JFCA 4WYOB 4ZDFA 3Q0JA 3T8AA 2F6QA 2NP9A 3DJAA 2ZL2A 1DUBA 2ZQRA 2VSSA 3KTGA 3BEZA 3PGQA 2A7SA 2J5GD 4QFEA 5DL1A 3N6RB 2GTRA 3ST9A 4FNBA 1ON3A 4U18A 4RCNA 3WG5A 4NNQA 1O8UA 4MI2A 1EF8A 4FN7A 1OD4A 5CTCA 3OT6A 2VREA 1N6FA 4ELWA 1TYFA 5FIFA 5DZKH 2HW5A 4YLHA 1XNWA 4JVTA 3QYRA 5C90A 2VSUA 1Y7OA 3T3WA 5CTBA 4JJTA 4JSBA 3QK8A 3H02A 3ISAA 5KDRA 3M6NA 5DTPA 3FDUA 4K3WA 3R9TA 4B3JA 2X58A 4Q0GA 3K8XA 1NZYA 1WDKA 1UIYA 3HINA 2UZFA 5KJPA 4OMRA 1FC9A 4JYJA 3H0SA 4GM2A 4IZCA 5JBXA 1EF9A 3MOYA 5G1QA 3L3SA 4ELXA 2A7KA 1WDMA 1FC6A 1TG6A 2ZQQA 1JXZA 4Z0MA 2J5SA 3T89A 1SG4A 5INIA 4MOUA 3P5MA 2DUBA 3PEAA 3H0QA 3H0UA 3FF6A 4L8KA 3HLN1 5DKPA 2F9IB 2J5II 4JWVA 1PIXA 1ON9A 1SZOA 4FJWD 3GF7A 4LK5A 4B3HA 1RJNA 3IBBA 1XNVA 3JU1A 3PZKA 3GF3A 1Q51A 3GKBA 3MFMA 1YG6A 4FB8A 3R9QA 1MJ3A 3QXIA 4K29A 1UYTA 1EY3A 3QKAA 3IAVA 5DUCA 2VSSE 4IZDA 3HP0A 3OC7A 4JCSA 3KTKA 1K32A 2VX2A 4HC8A 1YG8A 3DORA 3ZWCA 4JOTA 4OLQA 3Q1TA 4KWBA 3QREA 2W3PA 4EMMA 1FC7A 1K39A 2Q34A 3TLFA 3QXZA 3TDCA 2ZL0A 5G1RA 4F47A 2VSUC 4ASIA 4RYFH 2CBYA 2FBMA 3KTIA 4MXIA 5DU4A 3SLLA 3M6MA 3MYBA 2FZSA 1WZ8A 2VSUE 2X24A 3KTJA 3TRRA 3H81A 2J5GA 1N6EA 3R9SA 2F9IA 3QMJA 2PPYA 3IB9A 3Q0GA 3V5IA 5DTWA 3H0JA 1DCIA 2ZL4A 4WCZA 3TVUA 1XO6A 4OG1A 4U0HA 1UYVA 2A81A 4WZ8B 2ZL3A 2BZRA 3OMEA 1HNOA 3U9SB 5IKLB 4KPKA 3QWDA 2IEXA 4I4ZA 4JCQA 3MT6A 2YJGA 4FZWA 4FN8A 4KNPA 4U1AA 5JBWA 3NJDA 3V5EA 1HNUA 4I42A 2CE3A 2VSSF 4HNKA 2DEOA 4DI1A 3LAOA 3LKEA 3U9RB 3HE2A 1OD2A 1XNYA 2F9YB 4JCTA 5MGBA 3SWXA 4RYFA 4B3IA 3R0OA 4EMLA 3RSIA 4K2NA 1UYSA 5G1SA 3TV5A 3TT6A 3HRXA 5E0SH 1NZYB 3ZW9A 3P2LA 4HDTA 3TZ3A 2J5IB 3GLMA 4ZU2A 4JCRA 4J2UA 4ZDCA 2VSUF 3KQFA 2Q35A 1W2XA 3BPPA 3PE8A 4ZDEA 1VRGA 3ZWAA 2Q2XA 4U19A 3KTHA 2F6IA 1FCFA 5E0NX 4I52A 4U0GA 3G64A 3R6HA 3I47A 3GMAA 3NJBA 4NEKA 3VIVA 1N6DA 5FUSA 1WDLA 5HUQA 2WTBA 3TVWA 3ZW8A 5C9GA 2PBPA 4ELSA 4QIIA 3STAA 2F9YA 3Q7HA 4ZDBA 2QQ3A 4GHNA 3BF0A 3K50A 1Q52A 4FNDA 5E0SA 3ZWBA 3U9TB 5DUFA 2PG8A 3RRVA 1XX4A 4L6WA 4Q1IA 4JYLA 4QIJA 3BPTA 2J5IA 4IZBA 5DU6A 1X0UA 4FZWC 1UYRA 4KD6A 4U0GH 2C8TA 4ZDDA 1PJHA 4NARA 5INFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RST A;  5ING A;  2D3T A;  3P85 A;  1RJM A;  1J7X A;  3T88 A;  4G2R A;  2EJ5 A;  4EMP A;  3TT7 A;  5DU8 A;  2FW2 A;  1HZD A;  5DZK A;  5KDR B;  3T8B A;  4JFC A;  4WYO B;  4ZDF A;  3Q0J A;  3T8A A;  2F6Q A;  2NP9 A;  3DJA A;  2ZL2 A;  1DUB A;  2ZQR A;  2VSS A;  3KTG A;  3BEZ A;  3PGQ A;  2A7S A;  2J5G D;  4QFE A;  5DL1 A;  3N6R B;  2GTR A;  3ST9 A;  4FNB A;  1ON3 A;  4U18 A;  4RCN A;  3WG5 A;  4NNQ A;  1O8U A;  4MI2 A;  1EF8 A;  4FN7 A;  1OD4 A;  5CTC A;  3OT6 A;  2VRE A;  1N6F A;  4ELW A;  1TYF A;  5FIF A;  5DZK H;  2HW5 A;  4YLH A;  1XNW A;  4JVT A;  3QYR A;  5C90 A;  2VSU A;  1Y7O A;  3T3W A;  5CTB A;  4JJT A;  4JSB A;  3QK8 A;  3H02 A;  3ISA A;  5KDR A;  3M6N A;  5DTP A;  3FDU A;  4K3W A;  3R9T A;  4B3J A;  2X58 A;  4Q0G A;  3K8X A;  1NZY A;  1WDK A;  1UIY A;  3HIN A;  2UZF A;  5KJP A;  4OMR A;  1FC9 A;  4JYJ A;  3H0S A;  4GM2 A;  4IZC A;  5JBX A;  1EF9 A;  3MOY A;  5G1Q A;  3L3S A;  4ELX A;  2A7K A;  1WDM A;  1FC6 A;  1TG6 A;  2ZQQ A;  1JXZ A;  4Z0M A;  2J5S A;  3T89 A;  1SG4 A;  5INI A;  4MOU A;  3P5M A;  2DUB A;  3PEA A;  3H0Q A;  3H0U A;  3FF6 A;  4L8K A;  3HLN 1;  5DKP A;  2F9I B;  2J5I I;  4JWV A;  1PIX A;  1ON9 A;  1SZO A;  4FJW D;  3GF7 A;  4LK5 A;  4B3H A;  1RJN A;  3IBB A;  1XNV A;  3JU1 A;  3PZK A;  3GF3 A;  1Q51 A;  3GKB A;  3MFM A;  1YG6 A;  4FB8 A;  3R9Q A;  1MJ3 A;  3QXI A;  4K29 A;  1UYT A;  1EY3 A;  3QKA A;  3IAV A;  5DUC A;  2VSS E;  4IZD A;  3HP0 A;  3OC7 A;  4JCS A;  3KTK A;  1K32 A;  2VX2 A;  4HC8 A;  1YG8 A;  3DOR A;  3ZWC A;  4JOT A;  4OLQ A;  3Q1T A;  4KWB A;  3QRE A;  2W3P A;  4EMM A;  1FC7 A;  1K39 A;  2Q34 A;  3TLF A;  3QXZ A;  3TDC A;  2ZL0 A;  5G1R A;  4F47 A;  2VSU C;  4ASI A;  4RYF H;  2CBY A;  2FBM A;  3KTI A;  4MXI A;  5DU4 A;  3SLL A;  3M6M A;  3MYB A;  2FZS A;  1WZ8 A;  2VSU E;  2X24 A;  3KTJ A;  3TRR A;  3H81 A;  2J5G A;  1N6E A;  3R9S A;  2F9I A;  3QMJ A;  2PPY A;  3IB9 A;  3Q0G A;  3V5I A;  5DTW A;  3H0J A;  1DCI A;  2ZL4 A;  4WCZ A;  3TVU A;  1XO6 A;  4OG1 A;  4U0H A;  1UYV A;  2A81 A;  4WZ8 B;  2ZL3 A;  2BZR A;  3OME A;  1HNO A;  3U9S B;  5IKL B;  4KPK A;  3QWD A;  2IEX A;  4I4Z A;  4JCQ A;  3MT6 A;  4FZW A;  4FN8 A;  4KNP A;  4U1A A;  5JBW A;  3NJD A;  3V5E A;  1HNU A;  4I42 A;  2CE3 A;  2VSS F;  4HNK A;  2DEO A;  4DI1 A;  3LAO A;  3LKE A;  3U9R B;  3HE2 A;  1OD2 A;  1XNY A;  2F9Y B;  4JCT A;  5MGB A;  3SWX A;  4RYF A;  4B3I A;  3R0O A;  4EML A;  3RSI A;  4K2N A;  1UYS A;  5G1S A;  3TV5 A;  3TT6 A;  3HRX A;  5E0S H;  1NZY B;  3ZW9 A;  3P2L A;  3TZ3 A;  2J5I B;  3GLM A;  4ZU2 A;  4JCR A;  4ZDC A;  2VSU F;  3KQF A;  2Q35 A;  1W2X A;  3BPP A;  3PE8 A;  4ZDE A;  1VRG A;  3ZWA A;  2Q2X A;  4U19 A;  3KTH A;  2F6I A;  1FCF A;  5E0N X;  4I52 A;  4U0G A;  3G64 A;  3R6H A;  3I47 A;  3GMA A;  3NJB A;  4NEK A;  3VIV A;  1N6D A;  5FUS A;  1WDL A;  2WTB A;  3TVW A;  3ZW8 A;  5C9G A;  2PBP A;  4ELS A;  4QII A;  3STA A;  2F9Y A;  3Q7H A;  4ZDB A;  2QQ3 A;  4GHN A;  3BF0 A;  3K50 A;  1Q52 A;  4FND A;  5E0S A;  3ZWB A;  3U9T B;  5DUF A;  2PG8 A;  3RRV A;  1XX4 A;  4L6W A;  4Q1I A;  4JYL A;  4QIJ A;  2J5I A;  4IZB A;  5DU6 A;  1X0U A;  4FZW C;  1UYR A;  4KD6 A;  4U0G H;  2C8T A;  4ZDD A;  1PJH A;  5INF A; 
#chains in the Genus database with same CATH topology
 3RST A;  5ING A;  2D3T A;  3P85 A;  1RJM A;  1J7X A;  3T88 A;  4G2R A;  2EJ5 A;  4EMP A;  3TT7 A;  5DU8 A;  2FW2 A;  1HZD A;  5DZK A;  5KDR B;  3T8B A;  4JFC A;  4WYO B;  4ZDF A;  3Q0J A;  3T8A A;  2F6Q A;  2NP9 A;  3DJA A;  2ZL2 A;  1DUB A;  2ZQR A;  2VSS A;  3KTG A;  3BEZ A;  3PGQ A;  2A7S A;  2J5G D;  4QFE A;  5DL1 A;  3N6R B;  2GTR A;  3ST9 A;  4FNB A;  1ON3 A;  4U18 A;  4RCN A;  3WG5 A;  4NNQ A;  1O8U A;  4MI2 A;  1EF8 A;  4FN7 A;  1OD4 A;  5CTC A;  3OT6 A;  2VRE A;  1N6F A;  4ELW A;  1TYF A;  5FIF A;  5DZK H;  2HW5 A;  4YLH A;  1XNW A;  4JVT A;  3QYR A;  5C90 A;  2VSU A;  1Y7O A;  3T3W A;  5CTB A;  4JJT A;  4JSB A;  3QK8 A;  3H02 A;  3ISA A;  5KDR A;  3M6N A;  5DTP A;  3FDU A;  4K3W A;  3R9T A;  4B3J A;  2X58 A;  4Q0G A;  3K8X A;  1NZY A;  1WDK A;  1UIY A;  3HIN A;  2UZF A;  5KJP A;  4OMR A;  1FC9 A;  4JYJ A;  3H0S A;  4GM2 A;  4IZC A;  5JBX A;  1EF9 A;  3MOY A;  5G1Q A;  3L3S A;  4ELX A;  2A7K A;  1WDM A;  1FC6 A;  1TG6 A;  2ZQQ A;  1JXZ A;  4Z0M A;  2J5S A;  3T89 A;  1SG4 A;  5INI A;  4MOU A;  3P5M A;  2DUB A;  3PEA A;  3H0Q A;  3H0U A;  3FF6 A;  4L8K A;  3HLN 1;  5DKP A;  2F9I B;  2J5I I;  4JWV A;  1PIX A;  1ON9 A;  1SZO A;  4FJW D;  3GF7 A;  4LK5 A;  4B3H A;  1RJN A;  3IBB A;  1XNV A;  3JU1 A;  3PZK A;  3GF3 A;  1Q51 A;  3GKB A;  3MFM A;  1YG6 A;  4FB8 A;  3R9Q A;  1MJ3 A;  3QXI A;  4K29 A;  1UYT A;  1EY3 A;  3QKA A;  3IAV A;  5DUC A;  2VSS E;  4IZD A;  3HP0 A;  3OC7 A;  4JCS A;  3KTK A;  1K32 A;  2VX2 A;  4HC8 A;  1YG8 A;  3DOR A;  3ZWC A;  4JOT A;  4OLQ A;  3Q1T A;  4KWB A;  3QRE A;  2W3P A;  4EMM A;  1FC7 A;  1K39 A;  2Q34 A;  3TLF A;  3QXZ A;  3TDC A;  2ZL0 A;  5G1R A;  4F47 A;  2VSU C;  4ASI A;  4RYF H;  2CBY A;  2FBM A;  3KTI A;  4MXI A;  5DU4 A;  3SLL A;  3M6M A;  3MYB A;  2FZS A;  1WZ8 A;  2VSU E;  2X24 A;  3KTJ A;  3TRR A;  3H81 A;  2J5G A;  1N6E A;  3R9S A;  2F9I A;  3QMJ A;  2PPY A;  3IB9 A;  3Q0G A;  3V5I A;  5DTW A;  3H0J A;  1DCI A;  2ZL4 A;  4WCZ A;  3TVU A;  1XO6 A;  4OG1 A;  4U0H A;  1UYV A;  2A81 A;  4WZ8 B;  2ZL3 A;  2BZR A;  3OME A;  1HNO A;  3U9S B;  5IKL B;  4KPK A;  3QWD A;  2IEX A;  4I4Z A;  4JCQ A;  3MT6 A;  2YJG A;  4FZW A;  4FN8 A;  4KNP A;  4U1A A;  5JBW A;  3NJD A;  3V5E A;  1HNU A;  4I42 A;  2CE3 A;  2VSS F;  4HNK A;  2DEO A;  4DI1 A;  3LAO A;  3LKE A;  3U9R B;  3HE2 A;  1OD2 A;  1XNY A;  2F9Y B;  4JCT A;  5MGB A;  3SWX A;  4RYF A;  4B3I A;  3R0O A;  4EML A;  3RSI A;  4K2N A;  1UYS A;  5G1S A;  3TV5 A;  3TT6 A;  3HRX A;  5E0S H;  1NZY B;  3ZW9 A;  3P2L A;  4HDT A;  3TZ3 A;  2J5I B;  3GLM A;  4ZU2 A;  4JCR A;  4J2U A;  4ZDC A;  2VSU F;  3KQF A;  2Q35 A;  1W2X A;  3BPP A;  3PE8 A;  4ZDE A;  1VRG A;  3ZWA A;  2Q2X A;  4U19 A;  3KTH A;  2F6I A;  1FCF A;  5E0N X;  4I52 A;  4U0G A;  3G64 A;  3R6H A;  3I47 A;  3GMA A;  3NJB A;  4NEK A;  3VIV A;  1N6D A;  5FUS A;  1WDL A;  5HUQ A;  2WTB A;  3TVW A;  3ZW8 A;  5C9G A;  2PBP A;  4ELS A;  4QII A;  3STA A;  2F9Y A;  3Q7H A;  4ZDB A;  2QQ3 A;  4GHN A;  3BF0 A;  3K50 A;  1Q52 A;  4FND A;  5E0S A;  3ZWB A;  3U9T B;  5DUF A;  2PG8 A;  3RRV A;  1XX4 A;  4L6W A;  4Q1I A;  4JYL A;  4QIJ A;  3BPT A;  2J5I A;  4IZB A;  5DU6 A;  1X0U A;  4FZW C;  1UYR A;  4KD6 A;  4U0G H;  2C8T A;  4ZDD A;  1PJH A;  4NAR A;  5INF A; 
#chains in the Genus database with same CATH homology
 3RST A;  5ING A;  2D3T A;  3P85 A;  1RJM A;  1J7X A;  3T88 A;  4G2R A;  2EJ5 A;  4EMP A;  3TT7 A;  5DU8 A;  2FW2 A;  1HZD A;  5DZK A;  5KDR B;  3T8B A;  4JFC A;  4WYO B;  4ZDF A;  3Q0J A;  3T8A A;  2F6Q A;  2NP9 A;  3DJA A;  2ZL2 A;  1DUB A;  2ZQR A;  2VSS A;  3KTG A;  3BEZ A;  3PGQ A;  2A7S A;  2J5G D;  4QFE A;  5DL1 A;  3N6R B;  2GTR A;  3ST9 A;  4FNB A;  1ON3 A;  4U18 A;  4RCN A;  3WG5 A;  4NNQ A;  1O8U A;  4MI2 A;  1EF8 A;  4FN7 A;  1OD4 A;  5CTC A;  3OT6 A;  2VRE A;  1N6F A;  4ELW A;  1TYF A;  5FIF A;  5DZK H;  2HW5 A;  4YLH A;  1XNW A;  4JVT A;  3QYR A;  5C90 A;  2VSU A;  1Y7O A;  3T3W A;  5CTB A;  4JJT A;  4JSB A;  3QK8 A;  3H02 A;  3ISA A;  5KDR A;  3M6N A;  5DTP A;  3FDU A;  4K3W A;  3R9T A;  4B3J A;  2X58 A;  4Q0G A;  3K8X A;  1NZY A;  1WDK A;  1UIY A;  3HIN A;  2UZF A;  5KJP A;  4OMR A;  1FC9 A;  4JYJ A;  3H0S A;  4GM2 A;  4IZC A;  5JBX A;  1EF9 A;  3MOY A;  5G1Q A;  3L3S A;  4ELX A;  2A7K A;  1WDM A;  1FC6 A;  1TG6 A;  2ZQQ A;  1JXZ A;  4Z0M A;  2J5S A;  3T89 A;  1SG4 A;  5INI A;  4MOU A;  3P5M A;  2DUB A;  3PEA A;  3H0Q A;  3H0U A;  3FF6 A;  4L8K A;  3HLN 1;  5DKP A;  2F9I B;  2J5I I;  4JWV A;  1PIX A;  1ON9 A;  1SZO A;  4FJW D;  3GF7 A;  4LK5 A;  4B3H A;  1RJN A;  3IBB A;  1XNV A;  3JU1 A;  3PZK A;  3GF3 A;  1Q51 A;  3GKB A;  3MFM A;  1YG6 A;  4FB8 A;  3R9Q A;  1MJ3 A;  3QXI A;  4K29 A;  1UYT A;  1EY3 A;  3QKA A;  3IAV A;  5DUC A;  2VSS E;  4IZD A;  3HP0 A;  3OC7 A;  4JCS A;  3KTK A;  1K32 A;  2VX2 A;  4HC8 A;  1YG8 A;  3DOR A;  3ZWC A;  4JOT A;  4OLQ A;  3Q1T A;  4KWB A;  3QRE A;  2W3P A;  4EMM A;  1FC7 A;  1K39 A;  2Q34 A;  3TLF A;  3QXZ A;  3TDC A;  2ZL0 A;  5G1R A;  4F47 A;  2VSU C;  4ASI A;  4RYF H;  2CBY A;  2FBM A;  3KTI A;  4MXI A;  5DU4 A;  3SLL A;  3M6M A;  3MYB A;  2FZS A;  1WZ8 A;  2VSU E;  2X24 A;  3KTJ A;  3TRR A;  3H81 A;  2J5G A;  1N6E A;  3R9S A;  2F9I A;  3QMJ A;  2PPY A;  3IB9 A;  3Q0G A;  3V5I A;  5DTW A;  3H0J A;  1DCI A;  2ZL4 A;  4WCZ A;  3TVU A;  1XO6 A;  4OG1 A;  4U0H A;  1UYV A;  2A81 A;  4WZ8 B;  2ZL3 A;  2BZR A;  3OME A;  1HNO A;  3U9S B;  5IKL B;  4KPK A;  3QWD A;  2IEX A;  4I4Z A;  4JCQ A;  3MT6 A;  2YJG A;  4FZW A;  4FN8 A;  4KNP A;  4U1A A;  5JBW A;  3NJD A;  3V5E A;  1HNU A;  4I42 A;  2CE3 A;  2VSS F;  4HNK A;  2DEO A;  4DI1 A;  3LAO A;  3LKE A;  3U9R B;  3HE2 A;  1OD2 A;  1XNY A;  2F9Y B;  4JCT A;  5MGB A;  3SWX A;  4RYF A;  4B3I A;  3R0O A;  4EML A;  3RSI A;  4K2N A;  1UYS A;  5G1S A;  3TV5 A;  3TT6 A;  3HRX A;  5E0S H;  1NZY B;  3ZW9 A;  3P2L A;  4HDT A;  3TZ3 A;  2J5I B;  3GLM A;  4ZU2 A;  4JCR A;  4J2U A;  4ZDC A;  2VSU F;  3KQF A;  2Q35 A;  1W2X A;  3BPP A;  3PE8 A;  4ZDE A;  1VRG A;  3ZWA A;  2Q2X A;  4U19 A;  3KTH A;  2F6I A;  1FCF A;  5E0N X;  4I52 A;  4U0G A;  3G64 A;  3R6H A;  3I47 A;  3GMA A;  3NJB A;  4NEK A;  3VIV A;  1N6D A;  5FUS A;  1WDL A;  5HUQ A;  2WTB A;  3TVW A;  3ZW8 A;  5C9G A;  2PBP A;  4ELS A;  4QII A;  3STA A;  2F9Y A;  3Q7H A;  4ZDB A;  2QQ3 A;  4GHN A;  3BF0 A;  3K50 A;  1Q52 A;  4FND A;  5E0S A;  3ZWB A;  3U9T B;  5DUF A;  2PG8 A;  3RRV A;  1XX4 A;  4L6W A;  4Q1I A;  4JYL A;  4QIJ A;  3BPT A;  2J5I A;  4IZB A;  5DU6 A;  1X0U A;  4FZW C;  1UYR A;  4KD6 A;  4U0G H;  2C8T A;  4ZDD A;  1PJH A;  4NAR A;  5INF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...