3KTIA

Structure of clpp in complex with adep1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktiA00
1N6EA 2W3PA 3KTKA 3SLLA 2CBYA 1VRGA 2D3TA 3GF3A 1YG8A 2ZL3A 3TVWA 3K50A 3PGQA 5MGBA 3WG5A 3G64A 3KTGA 1FC9A 4JCRA 3H0QA 4FN7A 3R9QA 4ELXA 2F9YB 5DZKA 4FNDA 3H0JA 2VSUF 3OMEA 2VREA 3PZKA 4OLQA 1JXZA 3GF7A 3HRXA 4FNBA 2FZSA 3H02A 3STAA 1UYRA 3NJDA 2BZRA 2A7SA 5E0SH 2GTRA 4Q1IA 1RJMA 4GM2A 4ZDEA 3KTHA 3PE8A 4I4ZA 4YLHA 1O8UA 3NJBA 1EF9A 4ZDDA 1TG6A 1TYFA 3QKAA 4B3IA 1ON9A 1SG4A 4G2RA 2DEOA 3RRVA 3T8BA 3ISAA 3MYBA 3RSTA 4OMRA 4RYFH 1FC6A 2VSUE 3T3WA 3IB9A 5INGA 4JCQA 3DORA 5JBXA 3TDCA 1UYVA 5DTPA 3M6NA 1XNVA 1MJ3A 4K3WA 4ELWA 3H81A 3BPPA 3N6RB 5G1QA 3P5MA 4MXIA 1ON3A 3P85A 4NNQA 4DI1A 2Q35A 2F9IB 4L8KA 3V5IA 4KWBA 1FC7A 3QYRA 5DUFA 2UZFA 3R0OA 1OD4A 1SZOA 3MT6A 1N6FA 2Q34A 2WTBA 3K8XA 4JYLA 5DL1A 1RJNA 3QWDA 3H0UA 3QREA 1J7XA 4U0GA 4GHNA 3JU1A 2ZL4A 1XNYA 3QK8A 4U18A 2J5GA 4KD6A 4JVTA 1WDKA 5KDRB 3TLFA 3KTJA 3ST9A 4ZDBA 3IAVA 5INFA 4ZDCA 2VSSE 3KTIA 1K32A 4JOTA 1EF8A 1X0UA 3ZW9A 3DJAA 5INIA 4FN8A 3IBBA 4ELSA 2PPYA 2PBPA 3TVUA 3TT6A 5DZKH 1Y7OA 4FJWD 5CTCA 4QFEA 2ZQRA 2DUBA 4B3JA 4JWVA 3T88A 1N6DA 2FBMA 5CTBA 1K39A 5DUCA 1FCFA 3ZW8A 2EJ5A 5C9GA 2J5IB 4U0HA 5DU4A 5KDRA 1HNUA 4ZU2A 3T8AA 4MI2A 4I42A 3U9TB 1DUBA 5DKPA 1XO6A 5IKLB 1HNOA 2X24A 2CE3A 3HE2A 5DU6A 1OD2A 4KPKA 4IZBA 1Q51A 4JYJA 1PJHA 2VX2A 3GMAA 3R6HA 3TV5A 3OT6A 3Q0GA 4WCZA 1XNWA 3R9SA 5G1RA 4OG1A 4F47A 1EY3A 4IZDA 3M6MA 5E0SA 3Q7HA 3V5EA 4ZDFA 3H0SA 2C8TA 2QQ3A 1UYSA 3RSIA 3QMJA 3GLMA 3ZWAA 4I52A 3L3SA 4QIIA 3LKEA 2X58A 4HC8A 2VSSA 1DCIA 4U1AA 4JSBA 5FIFA 5C90A 2J5IA 1WZ8A 3TT7A 3R9TA 3FDUA 3ZWCA 3BEZA 4RYFA 4FZWA 4JCTA 1YG6A 2Q2XA 2F6IA 1HZDA 4ASIA 5FUSA 4IZCA 3P2LA 3LAOA 2J5SA 1XX4A 1WDMA 4KNPA 3TRRA 2HW5A 5KJPA 3TZ3A 2A81A 2F6QA 2VSSF 3GKBA 1WDLA 1Q52A 4HNKA 1W2XA 3HINA 2VSUA 5E0NX 4B3HA 2NP9A 2VSUC 5G1SA 2J5II 3Q1TA 1NZYA 3BF0A 4JJTA 4MOUA 3T89A 3HLN1 4K29A 3QXIA 4Z0MA 4U0GH 1UIYA 3U9SB 3PEAA 5DU8A 4NEKA 2A7KA 4JFCA 1PIXA 4FZWC 4LK5A 2F9YA 3MFMA 2ZL2A 3SWXA 4JCSA 4Q0GA 4WZ8B 5JBWA 2ZL0A 3QXZA 4WYOB 2FW2A 3KQFA 4QIJA 4U19A 3U9RB 2PG8A 4L6WA 3MOYA 4K2NA 3HP0A 2J5GD 2IEXA 3Q0JA 3FF6A 3I47A 4FB8A 4EMLA 4EMPA 4EMMA 4RCNA 5DTWA 2F9IA 3OC7A 3ZWBA 1NZYB 3VIVA 1UYTA 2ZQQA
chains in the Genus database with same CATH superfamily
1N6EA 2W3PA 3KTKA 3SLLA 2CBYA 1VRGA 2D3TA 3GF3A 1YG8A 2ZL3A 3TVWA 3K50A 3PGQA 5MGBA 2YJGA 3WG5A 3G64A 3KTGA 1FC9A 4JCRA 3H0QA 4FN7A 3R9QA 4ELXA 2F9YB 5DZKA 4FNDA 3H0JA 2VSUF 3OMEA 2VREA 3PZKA 4OLQA 1JXZA 3GF7A 3HRXA 4FNBA 2FZSA 3H02A 3STAA 1UYRA 3NJDA 2BZRA 2A7SA 5E0SH 2GTRA 4Q1IA 1RJMA 4GM2A 4ZDEA 3KTHA 3PE8A 4I4ZA 4YLHA 1O8UA 3NJBA 1EF9A 4ZDDA 1TG6A 1TYFA 3QKAA 4B3IA 1ON9A 1SG4A 4G2RA 2DEOA 3RRVA 3T8BA 3ISAA 3MYBA 3RSTA 4OMRA 4RYFH 1FC6A 2VSUE 3T3WA 3IB9A 5INGA 4JCQA 3DORA 5JBXA 3TDCA 1UYVA 5DTPA 3M6NA 1XNVA 1MJ3A 4K3WA 4ELWA 3H81A 3BPPA 3N6RB 5G1QA 3P5MA 4MXIA 1ON3A 3P85A 4NNQA 4DI1A 2Q35A 2F9IB 4L8KA 3V5IA 4KWBA 1FC7A 3QYRA 5DUFA 2UZFA 3R0OA 1OD4A 1SZOA 3MT6A 1N6FA 2Q34A 2WTBA 3K8XA 4JYLA 5DL1A 1RJNA 3QWDA 3H0UA 3QREA 1J7XA 4U0GA 4GHNA 3JU1A 2ZL4A 1XNYA 3QK8A 4U18A 2J5GA 4KD6A 4JVTA 1WDKA 5KDRB 3TLFA 3KTJA 3ST9A 4ZDBA 3IAVA 5INFA 4ZDCA 2VSSE 3KTIA 1K32A 4JOTA 1EF8A 1X0UA 3ZW9A 3DJAA 5INIA 4FN8A 4NARA 3IBBA 4ELSA 2PPYA 2PBPA 3TVUA 3TT6A 5DZKH 4J2UA 1Y7OA 4FJWD 5CTCA 4QFEA 2ZQRA 2DUBA 4B3JA 5HUQA 4JWVA 3T88A 1N6DA 2FBMA 5CTBA 1K39A 5DUCA 1FCFA 3ZW8A 2EJ5A 5C9GA 2J5IB 4U0HA 5DU4A 5KDRA 1HNUA 4ZU2A 3T8AA 4MI2A 4I42A 3U9TB 1DUBA 5DKPA 1XO6A 5IKLB 1HNOA 2X24A 2CE3A 3HE2A 5DU6A 1OD2A 4KPKA 4IZBA 1Q51A 4JYJA 1PJHA 2VX2A 3GMAA 3R6HA 3TV5A 3OT6A 3Q0GA 4WCZA 1XNWA 3R9SA 5G1RA 4OG1A 4F47A 1EY3A 4IZDA 3M6MA 5E0SA 3Q7HA 3V5EA 4ZDFA 3H0SA 2C8TA 2QQ3A 1UYSA 3RSIA 3QMJA 4HDTA 3GLMA 3ZWAA 4I52A 3L3SA 4QIIA 3LKEA 2X58A 4HC8A 2VSSA 1DCIA 4U1AA 4JSBA 5FIFA 5C90A 2J5IA 1WZ8A 3TT7A 3R9TA 3FDUA 3ZWCA 3BEZA 4RYFA 4FZWA 4JCTA 1YG6A 2Q2XA 2F6IA 1HZDA 4ASIA 5FUSA 4IZCA 3P2LA 3LAOA 2J5SA 1XX4A 1WDMA 4KNPA 3TRRA 2HW5A 5KJPA 3TZ3A 2A81A 2F6QA 2VSSF 3GKBA 1WDLA 1Q52A 4HNKA 1W2XA 3HINA 2VSUA 5E0NX 4B3HA 2NP9A 2VSUC 5G1SA 2J5II 3Q1TA 1NZYA 3BF0A 4JJTA 4MOUA 3T89A 3HLN1 4K29A 3QXIA 4Z0MA 4U0GH 1UIYA 3U9SB 3PEAA 5DU8A 4NEKA 2A7KA 4JFCA 1PIXA 4FZWC 4LK5A 2F9YA 3MFMA 2ZL2A 3SWXA 4JCSA 4Q0GA 4WZ8B 5JBWA 2ZL0A 3QXZA 4WYOB 2FW2A 3KQFA 4QIJA 4U19A 3U9RB 2PG8A 4L6WA 3MOYA 4K2NA 3HP0A 2J5GD 2IEXA 3Q0JA 3FF6A 3I47A 4FB8A 4EMLA 4EMPA 4EMMA 4RCNA 5DTWA 3BPTA 2F9IA 3OC7A 3ZWBA 1NZYB 3VIVA 1UYTA 2ZQQA
chains in the Genus database with same CATH topology
1N6EA 2W3PA 3KTKA 3SLLA 2CBYA 1VRGA 2D3TA 3GF3A 1YG8A 2ZL3A 3TVWA 3K50A 3PGQA 5MGBA 2YJGA 3WG5A 3G64A 3KTGA 1FC9A 4JCRA 3H0QA 4FN7A 3R9QA 4ELXA 2F9YB 5DZKA 4FNDA 3H0JA 2VSUF 3OMEA 2VREA 3PZKA 4OLQA 1JXZA 3GF7A 3HRXA 4FNBA 2FZSA 3H02A 3STAA 1UYRA 3NJDA 2BZRA 2A7SA 5E0SH 2GTRA 4Q1IA 1RJMA 4GM2A 4ZDEA 3KTHA 3PE8A 4I4ZA 4YLHA 1O8UA 3NJBA 1EF9A 4ZDDA 1TG6A 1TYFA 3QKAA 4B3IA 1ON9A 1SG4A 4G2RA 2DEOA 3RRVA 3T8BA 3ISAA 3MYBA 3RSTA 4OMRA 4RYFH 1FC6A 2VSUE 3T3WA 3IB9A 5INGA 4JCQA 3DORA 5JBXA 3TDCA 1UYVA 5DTPA 3M6NA 1XNVA 1MJ3A 4K3WA 4ELWA 3H81A 3BPPA 3N6RB 5G1QA 3P5MA 4MXIA 1ON3A 3P85A 4NNQA 4DI1A 2Q35A 2F9IB 4L8KA 3V5IA 4KWBA 1FC7A 3QYRA 5DUFA 2UZFA 3R0OA 1OD4A 1SZOA 3MT6A 1N6FA 2Q34A 2WTBA 3K8XA 4JYLA 5DL1A 1RJNA 3QWDA 3H0UA 3QREA 1J7XA 4U0GA 4GHNA 3JU1A 2ZL4A 1XNYA 3QK8A 4U18A 2J5GA 4KD6A 4JVTA 1WDKA 5KDRB 3TLFA 3KTJA 3ST9A 4ZDBA 3IAVA 5INFA 4ZDCA 2VSSE 3KTIA 1K32A 4JOTA 1EF8A 1X0UA 3ZW9A 3DJAA 5INIA 4FN8A 4NARA 3IBBA 4ELSA 2PPYA 2PBPA 3TVUA 3TT6A 5DZKH 4J2UA 1Y7OA 4FJWD 5CTCA 4QFEA 2ZQRA 2DUBA 4B3JA 5HUQA 4JWVA 3T88A 1N6DA 2FBMA 5CTBA 1K39A 5DUCA 1FCFA 3ZW8A 2EJ5A 5C9GA 2J5IB 4U0HA 5DU4A 5KDRA 1HNUA 4ZU2A 3T8AA 4MI2A 4I42A 3U9TB 1DUBA 5DKPA 1XO6A 5IKLB 1HNOA 2X24A 2CE3A 3HE2A 5DU6A 1OD2A 4KPKA 4IZBA 1Q51A 4JYJA 1PJHA 2VX2A 3GMAA 3R6HA 3TV5A 3OT6A 3Q0GA 4WCZA 1XNWA 3R9SA 5G1RA 4OG1A 4F47A 1EY3A 4IZDA 3M6MA 5E0SA 3Q7HA 3V5EA 4ZDFA 3H0SA 2C8TA 2QQ3A 1UYSA 3RSIA 3QMJA 4HDTA 3GLMA 3ZWAA 4I52A 3L3SA 4QIIA 3LKEA 2X58A 4HC8A 2VSSA 1DCIA 4U1AA 4JSBA 5FIFA 5C90A 2J5IA 1WZ8A 3TT7A 3R9TA 3FDUA 3ZWCA 3BEZA 4RYFA 4FZWA 4JCTA 1YG6A 2Q2XA 2F6IA 1HZDA 4ASIA 5FUSA 4IZCA 3P2LA 3LAOA 2J5SA 1XX4A 1WDMA 4KNPA 3TRRA 2HW5A 5KJPA 3TZ3A 2A81A 2F6QA 2VSSF 3GKBA 1WDLA 1Q52A 4HNKA 1W2XA 3HINA 2VSUA 5E0NX 4B3HA 2NP9A 2VSUC 5G1SA 2J5II 3Q1TA 1NZYA 3BF0A 4JJTA 4MOUA 3T89A 3HLN1 4K29A 3QXIA 4Z0MA 4U0GH 1UIYA 3U9SB 3PEAA 5DU8A 4NEKA 2A7KA 4JFCA 1PIXA 4FZWC 4LK5A 2F9YA 3MFMA 2ZL2A 3SWXA 4JCSA 4Q0GA 4WZ8B 5JBWA 2ZL0A 3QXZA 4WYOB 2FW2A 3KQFA 4QIJA 4U19A 3U9RB 2PG8A 4L6WA 3MOYA 4K2NA 3HP0A 2J5GD 2IEXA 3Q0JA 3FF6A 3I47A 4FB8A 4EMLA 4EMPA 4EMMA 4RCNA 5DTWA 3BPTA 2F9IA 3OC7A 3ZWBA 1NZYB 3VIVA 1UYTA 2ZQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6E A;  2W3P A;  3KTK A;  3SLL A;  2CBY A;  1VRG A;  2D3T A;  3GF3 A;  1YG8 A;  2ZL3 A;  3TVW A;  3K50 A;  3PGQ A;  5MGB A;  3WG5 A;  3G64 A;  3KTG A;  1FC9 A;  4JCR A;  3H0Q A;  4FN7 A;  3R9Q A;  4ELX A;  2F9Y B;  5DZK A;  4FND A;  3H0J A;  2VSU F;  3OME A;  2VRE A;  3PZK A;  4OLQ A;  1JXZ A;  3GF7 A;  3HRX A;  4FNB A;  2FZS A;  3H02 A;  3STA A;  1UYR A;  3NJD A;  2BZR A;  2A7S A;  5E0S H;  2GTR A;  4Q1I A;  1RJM A;  4GM2 A;  4ZDE A;  3KTH A;  3PE8 A;  4I4Z A;  4YLH A;  1O8U A;  3NJB A;  1EF9 A;  4ZDD A;  1TG6 A;  1TYF A;  3QKA A;  4B3I A;  1ON9 A;  1SG4 A;  4G2R A;  2DEO A;  3RRV A;  3T8B A;  3ISA A;  3MYB A;  3RST A;  4OMR A;  4RYF H;  1FC6 A;  2VSU E;  3T3W A;  3IB9 A;  5ING A;  4JCQ A;  3DOR A;  5JBX A;  3TDC A;  1UYV A;  5DTP A;  3M6N A;  1XNV A;  1MJ3 A;  4K3W A;  4ELW A;  3H81 A;  3BPP A;  3N6R B;  5G1Q A;  3P5M A;  4MXI A;  1ON3 A;  3P85 A;  4NNQ A;  4DI1 A;  2Q35 A;  2F9I B;  4L8K A;  3V5I A;  4KWB A;  1FC7 A;  3QYR A;  5DUF A;  2UZF A;  3R0O A;  1OD4 A;  1SZO A;  3MT6 A;  1N6F A;  2Q34 A;  2WTB A;  3K8X A;  4JYL A;  5DL1 A;  1RJN A;  3QWD A;  3H0U A;  3QRE A;  1J7X A;  4U0G A;  4GHN A;  3JU1 A;  2ZL4 A;  1XNY A;  3QK8 A;  4U18 A;  2J5G A;  4KD6 A;  4JVT A;  1WDK A;  5KDR B;  3TLF A;  3KTJ A;  3ST9 A;  4ZDB A;  3IAV A;  5INF A;  4ZDC A;  2VSS E;  3KTI A;  1K32 A;  4JOT A;  1EF8 A;  1X0U A;  3ZW9 A;  3DJA A;  5INI A;  4FN8 A;  3IBB A;  4ELS A;  2PPY A;  2PBP A;  3TVU A;  3TT6 A;  5DZK H;  1Y7O A;  4FJW D;  5CTC A;  4QFE A;  2ZQR A;  2DUB A;  4B3J A;  4JWV A;  3T88 A;  1N6D A;  2FBM A;  5CTB A;  1K39 A;  5DUC A;  1FCF A;  3ZW8 A;  2EJ5 A;  5C9G A;  2J5I B;  4U0H A;  5DU4 A;  5KDR A;  1HNU A;  4ZU2 A;  3T8A A;  4MI2 A;  4I42 A;  3U9T B;  1DUB A;  5DKP A;  1XO6 A;  5IKL B;  1HNO A;  2X24 A;  2CE3 A;  3HE2 A;  5DU6 A;  1OD2 A;  4KPK A;  4IZB A;  1Q51 A;  4JYJ A;  1PJH A;  2VX2 A;  3GMA A;  3R6H A;  3TV5 A;  3OT6 A;  3Q0G A;  4WCZ A;  1XNW A;  3R9S A;  5G1R A;  4OG1 A;  4F47 A;  1EY3 A;  4IZD A;  3M6M A;  5E0S A;  3Q7H A;  3V5E A;  4ZDF A;  3H0S A;  2C8T A;  2QQ3 A;  1UYS A;  3RSI A;  3QMJ A;  3GLM A;  3ZWA A;  4I52 A;  3L3S A;  4QII A;  3LKE A;  2X58 A;  4HC8 A;  2VSS A;  1DCI A;  4U1A A;  4JSB A;  5FIF A;  5C90 A;  2J5I A;  1WZ8 A;  3TT7 A;  3R9T A;  3FDU A;  3ZWC A;  3BEZ A;  4RYF A;  4FZW A;  4JCT A;  1YG6 A;  2Q2X A;  2F6I A;  1HZD A;  4ASI A;  5FUS A;  4IZC A;  3P2L A;  3LAO A;  2J5S A;  1XX4 A;  1WDM A;  4KNP A;  3TRR A;  2HW5 A;  5KJP A;  3TZ3 A;  2A81 A;  2F6Q A;  2VSS F;  3GKB A;  1WDL A;  1Q52 A;  4HNK A;  1W2X A;  3HIN A;  2VSU A;  5E0N X;  4B3H A;  2NP9 A;  2VSU C;  5G1S A;  2J5I I;  3Q1T A;  1NZY A;  3BF0 A;  4JJT A;  4MOU A;  3T89 A;  3HLN 1;  4K29 A;  3QXI A;  4Z0M A;  4U0G H;  1UIY A;  3U9S B;  3PEA A;  5DU8 A;  4NEK A;  2A7K A;  4JFC A;  1PIX A;  4FZW C;  4LK5 A;  2F9Y A;  3MFM A;  2ZL2 A;  3SWX A;  4JCS A;  4Q0G A;  4WZ8 B;  5JBW A;  2ZL0 A;  3QXZ A;  4WYO B;  2FW2 A;  3KQF A;  4QIJ A;  4U19 A;  3U9R B;  2PG8 A;  4L6W A;  3MOY A;  4K2N A;  3HP0 A;  2J5G D;  2IEX A;  3Q0J A;  3FF6 A;  3I47 A;  4FB8 A;  4EML A;  4EMP A;  4EMM A;  4RCN A;  5DTW A;  2F9I A;  3OC7 A;  3ZWB A;  1NZY B;  3VIV A;  1UYT A;  2ZQQ A; 
#chains in the Genus database with same CATH topology
 1N6E A;  2W3P A;  3KTK A;  3SLL A;  2CBY A;  1VRG A;  2D3T A;  3GF3 A;  1YG8 A;  2ZL3 A;  3TVW A;  3K50 A;  3PGQ A;  5MGB A;  2YJG A;  3WG5 A;  3G64 A;  3KTG A;  1FC9 A;  4JCR A;  3H0Q A;  4FN7 A;  3R9Q A;  4ELX A;  2F9Y B;  5DZK A;  4FND A;  3H0J A;  2VSU F;  3OME A;  2VRE A;  3PZK A;  4OLQ A;  1JXZ A;  3GF7 A;  3HRX A;  4FNB A;  2FZS A;  3H02 A;  3STA A;  1UYR A;  3NJD A;  2BZR A;  2A7S A;  5E0S H;  2GTR A;  4Q1I A;  1RJM A;  4GM2 A;  4ZDE A;  3KTH A;  3PE8 A;  4I4Z A;  4YLH A;  1O8U A;  3NJB A;  1EF9 A;  4ZDD A;  1TG6 A;  1TYF A;  3QKA A;  4B3I A;  1ON9 A;  1SG4 A;  4G2R A;  2DEO A;  3RRV A;  3T8B A;  3ISA A;  3MYB A;  3RST A;  4OMR A;  4RYF H;  1FC6 A;  2VSU E;  3T3W A;  3IB9 A;  5ING A;  4JCQ A;  3DOR A;  5JBX A;  3TDC A;  1UYV A;  5DTP A;  3M6N A;  1XNV A;  1MJ3 A;  4K3W A;  4ELW A;  3H81 A;  3BPP A;  3N6R B;  5G1Q A;  3P5M A;  4MXI A;  1ON3 A;  3P85 A;  4NNQ A;  4DI1 A;  2Q35 A;  2F9I B;  4L8K A;  3V5I A;  4KWB A;  1FC7 A;  3QYR A;  5DUF A;  2UZF A;  3R0O A;  1OD4 A;  1SZO A;  3MT6 A;  1N6F A;  2Q34 A;  2WTB A;  3K8X A;  4JYL A;  5DL1 A;  1RJN A;  3QWD A;  3H0U A;  3QRE A;  1J7X A;  4U0G A;  4GHN A;  3JU1 A;  2ZL4 A;  1XNY A;  3QK8 A;  4U18 A;  2J5G A;  4KD6 A;  4JVT A;  1WDK A;  5KDR B;  3TLF A;  3KTJ A;  3ST9 A;  4ZDB A;  3IAV A;  5INF A;  4ZDC A;  2VSS E;  3KTI A;  1K32 A;  4JOT A;  1EF8 A;  1X0U A;  3ZW9 A;  3DJA A;  5INI A;  4FN8 A;  4NAR A;  3IBB A;  4ELS A;  2PPY A;  2PBP A;  3TVU A;  3TT6 A;  5DZK H;  4J2U A;  1Y7O A;  4FJW D;  5CTC A;  4QFE A;  2ZQR A;  2DUB A;  4B3J A;  5HUQ A;  4JWV A;  3T88 A;  1N6D A;  2FBM A;  5CTB A;  1K39 A;  5DUC A;  1FCF A;  3ZW8 A;  2EJ5 A;  5C9G A;  2J5I B;  4U0H A;  5DU4 A;  5KDR A;  1HNU A;  4ZU2 A;  3T8A A;  4MI2 A;  4I42 A;  3U9T B;  1DUB A;  5DKP A;  1XO6 A;  5IKL B;  1HNO A;  2X24 A;  2CE3 A;  3HE2 A;  5DU6 A;  1OD2 A;  4KPK A;  4IZB A;  1Q51 A;  4JYJ A;  1PJH A;  2VX2 A;  3GMA A;  3R6H A;  3TV5 A;  3OT6 A;  3Q0G A;  4WCZ A;  1XNW A;  3R9S A;  5G1R A;  4OG1 A;  4F47 A;  1EY3 A;  4IZD A;  3M6M A;  5E0S A;  3Q7H A;  3V5E A;  4ZDF A;  3H0S A;  2C8T A;  2QQ3 A;  1UYS A;  3RSI A;  3QMJ A;  4HDT A;  3GLM A;  3ZWA A;  4I52 A;  3L3S A;  4QII A;  3LKE A;  2X58 A;  4HC8 A;  2VSS A;  1DCI A;  4U1A A;  4JSB A;  5FIF A;  5C90 A;  2J5I A;  1WZ8 A;  3TT7 A;  3R9T A;  3FDU A;  3ZWC A;  3BEZ A;  4RYF A;  4FZW A;  4JCT A;  1YG6 A;  2Q2X A;  2F6I A;  1HZD A;  4ASI A;  5FUS A;  4IZC A;  3P2L A;  3LAO A;  2J5S A;  1XX4 A;  1WDM A;  4KNP A;  3TRR A;  2HW5 A;  5KJP A;  3TZ3 A;  2A81 A;  2F6Q A;  2VSS F;  3GKB A;  1WDL A;  1Q52 A;  4HNK A;  1W2X A;  3HIN A;  2VSU A;  5E0N X;  4B3H A;  2NP9 A;  2VSU C;  5G1S A;  2J5I I;  3Q1T A;  1NZY A;  3BF0 A;  4JJT A;  4MOU A;  3T89 A;  3HLN 1;  4K29 A;  3QXI A;  4Z0M A;  4U0G H;  1UIY A;  3U9S B;  3PEA A;  5DU8 A;  4NEK A;  2A7K A;  4JFC A;  1PIX A;  4FZW C;  4LK5 A;  2F9Y A;  3MFM A;  2ZL2 A;  3SWX A;  4JCS A;  4Q0G A;  4WZ8 B;  5JBW A;  2ZL0 A;  3QXZ A;  4WYO B;  2FW2 A;  3KQF A;  4QIJ A;  4U19 A;  3U9R B;  2PG8 A;  4L6W A;  3MOY A;  4K2N A;  3HP0 A;  2J5G D;  2IEX A;  3Q0J A;  3FF6 A;  3I47 A;  4FB8 A;  4EML A;  4EMP A;  4EMM A;  4RCN A;  5DTW A;  3BPT A;  2F9I A;  3OC7 A;  3ZWB A;  1NZY B;  3VIV A;  1UYT A;  2ZQQ A; 
#chains in the Genus database with same CATH homology
 1N6E A;  2W3P A;  3KTK A;  3SLL A;  2CBY A;  1VRG A;  2D3T A;  3GF3 A;  1YG8 A;  2ZL3 A;  3TVW A;  3K50 A;  3PGQ A;  5MGB A;  2YJG A;  3WG5 A;  3G64 A;  3KTG A;  1FC9 A;  4JCR A;  3H0Q A;  4FN7 A;  3R9Q A;  4ELX A;  2F9Y B;  5DZK A;  4FND A;  3H0J A;  2VSU F;  3OME A;  2VRE A;  3PZK A;  4OLQ A;  1JXZ A;  3GF7 A;  3HRX A;  4FNB A;  2FZS A;  3H02 A;  3STA A;  1UYR A;  3NJD A;  2BZR A;  2A7S A;  5E0S H;  2GTR A;  4Q1I A;  1RJM A;  4GM2 A;  4ZDE A;  3KTH A;  3PE8 A;  4I4Z A;  4YLH A;  1O8U A;  3NJB A;  1EF9 A;  4ZDD A;  1TG6 A;  1TYF A;  3QKA A;  4B3I A;  1ON9 A;  1SG4 A;  4G2R A;  2DEO A;  3RRV A;  3T8B A;  3ISA A;  3MYB A;  3RST A;  4OMR A;  4RYF H;  1FC6 A;  2VSU E;  3T3W A;  3IB9 A;  5ING A;  4JCQ A;  3DOR A;  5JBX A;  3TDC A;  1UYV A;  5DTP A;  3M6N A;  1XNV A;  1MJ3 A;  4K3W A;  4ELW A;  3H81 A;  3BPP A;  3N6R B;  5G1Q A;  3P5M A;  4MXI A;  1ON3 A;  3P85 A;  4NNQ A;  4DI1 A;  2Q35 A;  2F9I B;  4L8K A;  3V5I A;  4KWB A;  1FC7 A;  3QYR A;  5DUF A;  2UZF A;  3R0O A;  1OD4 A;  1SZO A;  3MT6 A;  1N6F A;  2Q34 A;  2WTB A;  3K8X A;  4JYL A;  5DL1 A;  1RJN A;  3QWD A;  3H0U A;  3QRE A;  1J7X A;  4U0G A;  4GHN A;  3JU1 A;  2ZL4 A;  1XNY A;  3QK8 A;  4U18 A;  2J5G A;  4KD6 A;  4JVT A;  1WDK A;  5KDR B;  3TLF A;  3KTJ A;  3ST9 A;  4ZDB A;  3IAV A;  5INF A;  4ZDC A;  2VSS E;  3KTI A;  1K32 A;  4JOT A;  1EF8 A;  1X0U A;  3ZW9 A;  3DJA A;  5INI A;  4FN8 A;  4NAR A;  3IBB A;  4ELS A;  2PPY A;  2PBP A;  3TVU A;  3TT6 A;  5DZK H;  4J2U A;  1Y7O A;  4FJW D;  5CTC A;  4QFE A;  2ZQR A;  2DUB A;  4B3J A;  5HUQ A;  4JWV A;  3T88 A;  1N6D A;  2FBM A;  5CTB A;  1K39 A;  5DUC A;  1FCF A;  3ZW8 A;  2EJ5 A;  5C9G A;  2J5I B;  4U0H A;  5DU4 A;  5KDR A;  1HNU A;  4ZU2 A;  3T8A A;  4MI2 A;  4I42 A;  3U9T B;  1DUB A;  5DKP A;  1XO6 A;  5IKL B;  1HNO A;  2X24 A;  2CE3 A;  3HE2 A;  5DU6 A;  1OD2 A;  4KPK A;  4IZB A;  1Q51 A;  4JYJ A;  1PJH A;  2VX2 A;  3GMA A;  3R6H A;  3TV5 A;  3OT6 A;  3Q0G A;  4WCZ A;  1XNW A;  3R9S A;  5G1R A;  4OG1 A;  4F47 A;  1EY3 A;  4IZD A;  3M6M A;  5E0S A;  3Q7H A;  3V5E A;  4ZDF A;  3H0S A;  2C8T A;  2QQ3 A;  1UYS A;  3RSI A;  3QMJ A;  4HDT A;  3GLM A;  3ZWA A;  4I52 A;  3L3S A;  4QII A;  3LKE A;  2X58 A;  4HC8 A;  2VSS A;  1DCI A;  4U1A A;  4JSB A;  5FIF A;  5C90 A;  2J5I A;  1WZ8 A;  3TT7 A;  3R9T A;  3FDU A;  3ZWC A;  3BEZ A;  4RYF A;  4FZW A;  4JCT A;  1YG6 A;  2Q2X A;  2F6I A;  1HZD A;  4ASI A;  5FUS A;  4IZC A;  3P2L A;  3LAO A;  2J5S A;  1XX4 A;  1WDM A;  4KNP A;  3TRR A;  2HW5 A;  5KJP A;  3TZ3 A;  2A81 A;  2F6Q A;  2VSS F;  3GKB A;  1WDL A;  1Q52 A;  4HNK A;  1W2X A;  3HIN A;  2VSU A;  5E0N X;  4B3H A;  2NP9 A;  2VSU C;  5G1S A;  2J5I I;  3Q1T A;  1NZY A;  3BF0 A;  4JJT A;  4MOU A;  3T89 A;  3HLN 1;  4K29 A;  3QXI A;  4Z0M A;  4U0G H;  1UIY A;  3U9S B;  3PEA A;  5DU8 A;  4NEK A;  2A7K A;  4JFC A;  1PIX A;  4FZW C;  4LK5 A;  2F9Y A;  3MFM A;  2ZL2 A;  3SWX A;  4JCS A;  4Q0G A;  4WZ8 B;  5JBW A;  2ZL0 A;  3QXZ A;  4WYO B;  2FW2 A;  3KQF A;  4QIJ A;  4U19 A;  3U9R B;  2PG8 A;  4L6W A;  3MOY A;  4K2N A;  3HP0 A;  2J5G D;  2IEX A;  3Q0J A;  3FF6 A;  3I47 A;  4FB8 A;  4EML A;  4EMP A;  4EMM A;  4RCN A;  5DTW A;  3BPT A;  2F9I A;  3OC7 A;  3ZWB A;  1NZY B;  3VIV A;  1UYT A;  2ZQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...