3KTIA

Structure of clpp in complex with adep1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktiA00
1K39A 1WDMA 2F9YA 4L8KA 3HP0A 3T3WA 2Q34A 4MXIA 1ON9A 1ON3A 2Q2XA 3FF6A 3R6HA 4U18A 3T88A 4JYJA 3IBBA 5C90A 4KD6A 3QWDA 3R9SA 3TVWA 2CBYA 4K29A 3H0QA 4JYLA 1OD4A 3QREA 2FZSA 1UIYA 3STAA 1N6DA 3KTJA 3JU1A 4FZWC 3PEAA 3KQFA 1XO6A 1XNWA 1TYFA 2FBMA 1XNVA 4NNQA 3HLN1 2J5IA 4YLHA 1MJ3A 2F6QA 3BPPA 3PGQA 4KWBA 3H0JA 5DL1A 1EF9A 5G1RA 5G1QA 1N6EA 4ZDDA 2WTBA 4FJWD 1FC7A 1EY3A 1PIXA 4JSBA 1OD2A 2VSUE 4RYFA 3KTKA 2VSSF 2F9IA 3MFMA 3V5EA 3QK8A 2PBPA 3RRVA 3Q0GA 2VSSA 5CTCA 4I52A 3OT6A 4DI1A 1FC6A 2EJ5A 4I4ZA 1DUBA 3ZW9A 3M6NA 3GF7A 4JVTA 3TT6A 2J5GA 3K8XA 1Q51A 1NZYB 3T89A 4JCTA 2QQ3A 3P5MA 3K50A 4JWVA 2F6IA 5FIFA 4QIIA 4WCZA 3GKBA 3PZKA 5DU4A 5KDRB 4ELXA 3QKAA 3RSIA 4Q1IA 2GTRA 3Q0JA 3HE2A 2ZL0A 2VREA 1DCIA 3DORA 2VX2A 4JCRA 5E0SH 5JBWA 3V5IA 1J7XA 2J5SA 4Z0MA 5DTPA 3MYBA 4KPKA 4ASIA 1VRGA 4U0HA 3BF0A 5DZKA 3P2LA 3U9TB 4ZDCA 5KJPA 1UYRA 5DUFA 1TG6A 2J5GD 4WYOB 4G2RA 3H02A 1YG8A 3P85A 4GHNA 5FUSA 5G1SA 3QXIA 2ZL4A 1NZYA 3M6MA 3IAVA 3OC7A 3GMAA 5KDRA 2X24A 3FDUA 2ZL2A 4ELSA 3HINA 2ZQQA 5C9GA 3G64A 1PJHA 4FNBA 2VSSE 3KTGA 1XNYA 2FW2A 2A81A 4K2NA 4U19A 3PE8A 4B3IA 2W3PA 2PG8A 4FNDA 4ZU2A 4HNKA 4Q0GA 4K3WA 4IZDA 1HZDA 4U0GH 3SWXA 2VSUC 2IEXA 2J5II 3U9RB 4JJTA 4OLQA 3ZWAA 3WG5A 4U1AA 1W2XA 1SG4A 3RSTA 3LKEA 3HRXA 4OG1A 1K32A 3R0OA 4F47A 1HNUA 4MOUA 2PPYA 3ST9A 3H0SA 5E0NX 4ZDBA 4HC8A 3OMEA 3TDCA 2X58A 1X0UA 1FCFA 2DEOA 4B3JA 4FB8A 4MI2A 1RJNA 4EMPA 5INFA 4FN8A 3R9QA 3H0UA 3DJAA 5DU8A 1UYTA 2DUBA 3TV5A 5E0SA 1SZOA 3KTHA 4QFEA 4RCNA 1XX4A 4JCSA 1JXZA 4FZWA 3Q1TA 2NP9A 4FN7A 1UYSA 3NJBA 4JFCA 3BEZA 2C8TA 2ZL3A 5DU6A 2D3TA 1N6FA 4EMLA 5JBXA 5DTWA 3U9SB 3ZWCA 2UZFA 3MT6A 4RYFH 4B3HA 5INGA 4ZDEA 3I47A 3SLLA 3TT7A 4LK5A 4QIJA 4I42A 3GF3A 1YG6A 4JOTA 3T8AA 4IZCA 1UYVA 1FC9A 2HW5A 2CE3A 2F9YB 1O8UA 4GM2A 2VSUF 1EF8A 3TRRA 3GLMA 5DKPA 3TZ3A 4IZBA 2VSUA 4KNPA 1HNOA 2A7KA 3ZWBA 4WZ8B 4JCQA 5MGBA 3VIVA 3QMJA 5DUCA 4ELWA 3R9TA 2A7SA 3ISAA 3N6RB 3ZW8A 2J5IB 3IB9A 1Q52A 2BZRA 3H81A 3TVUA 3KTIA 4U0GA 1WDLA 1Y7OA 3QXZA 5INIA 4OMRA 3TLFA 3T8BA 2Q35A 3LAOA 5DZKH 2F9IB 4L6WA 1WZ8A 2ZQRA 1RJMA 4ZDFA 3NJDA 4EMMA 4NEKA 3L3SA 3QYRA 3MOYA 1WDKA 3Q7HA 5IKLB 5CTBA
chains in the Genus database with same CATH superfamily
1K39A 1WDMA 2F9YA 4L8KA 3HP0A 3T3WA 2Q34A 4MXIA 1ON9A 1ON3A 2Q2XA 3FF6A 3R6HA 4U18A 3T88A 4JYJA 3IBBA 5C90A 4KD6A 3QWDA 3R9SA 3TVWA 2CBYA 4K29A 3H0QA 4JYLA 1OD4A 3QREA 2FZSA 1UIYA 3STAA 1N6DA 3KTJA 3JU1A 4FZWC 3PEAA 3KQFA 1XO6A 1XNWA 1TYFA 2FBMA 1XNVA 4NNQA 3HLN1 2J5IA 4YLHA 1MJ3A 2F6QA 3BPPA 3PGQA 4KWBA 3H0JA 5DL1A 1EF9A 5G1RA 5G1QA 1N6EA 4ZDDA 2WTBA 4FJWD 1FC7A 1EY3A 1PIXA 4JSBA 1OD2A 2VSUE 4RYFA 3KTKA 2VSSF 2F9IA 3MFMA 3V5EA 3QK8A 4HDTA 2PBPA 3RRVA 3Q0GA 2VSSA 5CTCA 4I52A 3OT6A 4DI1A 1FC6A 2EJ5A 4I4ZA 1DUBA 3ZW9A 3M6NA 3GF7A 4JVTA 3TT6A 2J5GA 3K8XA 1Q51A 1NZYB 3T89A 4JCTA 2QQ3A 3P5MA 3BPTA 3K50A 4JWVA 2F6IA 5FIFA 4QIIA 4WCZA 3GKBA 3PZKA 5DU4A 5KDRB 4ELXA 3QKAA 3RSIA 4Q1IA 2GTRA 3Q0JA 3HE2A 2ZL0A 2VREA 1DCIA 3DORA 2VX2A 4JCRA 2YJGA 5E0SH 5JBWA 3V5IA 1J7XA 2J5SA 4Z0MA 4J2UA 5DTPA 3MYBA 4KPKA 4ASIA 1VRGA 4U0HA 3BF0A 5DZKA 3P2LA 3U9TB 4ZDCA 5KJPA 1UYRA 5DUFA 1TG6A 2J5GD 4WYOB 4G2RA 3H02A 1YG8A 3P85A 4GHNA 5FUSA 5G1SA 3QXIA 2ZL4A 1NZYA 3M6MA 3IAVA 3OC7A 3GMAA 5KDRA 2X24A 3FDUA 2ZL2A 4ELSA 3HINA 2ZQQA 5C9GA 3G64A 1PJHA 4FNBA 2VSSE 3KTGA 1XNYA 2FW2A 2A81A 4K2NA 4U19A 3PE8A 4B3IA 2W3PA 2PG8A 4FNDA 4ZU2A 4HNKA 4Q0GA 4K3WA 4IZDA 1HZDA 4U0GH 3SWXA 2VSUC 2IEXA 4NARA 2J5II 3U9RB 4JJTA 4OLQA 3ZWAA 3WG5A 4U1AA 1W2XA 1SG4A 3RSTA 3LKEA 3HRXA 5HUQA 4OG1A 1K32A 3R0OA 4F47A 1HNUA 4MOUA 2PPYA 3ST9A 3H0SA 5E0NX 4ZDBA 4HC8A 3OMEA 3TDCA 2X58A 1X0UA 1FCFA 2DEOA 4B3JA 4FB8A 4MI2A 1RJNA 4EMPA 5INFA 4FN8A 3R9QA 3H0UA 3DJAA 5DU8A 1UYTA 2DUBA 3TV5A 5E0SA 1SZOA 3KTHA 4QFEA 4RCNA 1XX4A 4JCSA 1JXZA 4FZWA 3Q1TA 2NP9A 4FN7A 1UYSA 3NJBA 4JFCA 3BEZA 2C8TA 2ZL3A 5DU6A 2D3TA 1N6FA 4EMLA 5JBXA 5DTWA 3U9SB 3ZWCA 2UZFA 3MT6A 4RYFH 4B3HA 5INGA 4ZDEA 3I47A 3SLLA 3TT7A 4LK5A 4QIJA 4I42A 3GF3A 1YG6A 4JOTA 3T8AA 4IZCA 1UYVA 1FC9A 2HW5A 2CE3A 2F9YB 1O8UA 4GM2A 2VSUF 1EF8A 3TRRA 3GLMA 5DKPA 3TZ3A 4IZBA 2VSUA 4KNPA 1HNOA 2A7KA 3ZWBA 4WZ8B 4JCQA 5MGBA 3VIVA 3QMJA 5DUCA 4ELWA 3R9TA 2A7SA 3ISAA 3N6RB 3ZW8A 2J5IB 3IB9A 1Q52A 2BZRA 3H81A 3TVUA 3KTIA 4U0GA 1WDLA 1Y7OA 3QXZA 5INIA 4OMRA 3TLFA 3T8BA 2Q35A 3LAOA 5DZKH 2F9IB 4L6WA 1WZ8A 2ZQRA 1RJMA 4ZDFA 3NJDA 4EMMA 4NEKA 3L3SA 3QYRA 3MOYA 1WDKA 3Q7HA 5IKLB 5CTBA
chains in the Genus database with same CATH topology
1K39A 1WDMA 2F9YA 4L8KA 3HP0A 3T3WA 2Q34A 4MXIA 1ON9A 1ON3A 2Q2XA 3FF6A 3R6HA 4U18A 3T88A 4JYJA 3IBBA 5C90A 4KD6A 3QWDA 3R9SA 3TVWA 2CBYA 4K29A 3H0QA 4JYLA 1OD4A 3QREA 2FZSA 1UIYA 3STAA 1N6DA 3KTJA 3JU1A 4FZWC 3PEAA 3KQFA 1XO6A 1XNWA 1TYFA 2FBMA 1XNVA 4NNQA 3HLN1 2J5IA 4YLHA 1MJ3A 2F6QA 3BPPA 3PGQA 4KWBA 3H0JA 5DL1A 1EF9A 5G1RA 5G1QA 1N6EA 4ZDDA 2WTBA 4FJWD 1FC7A 1EY3A 1PIXA 4JSBA 1OD2A 2VSUE 4RYFA 3KTKA 2VSSF 2F9IA 3MFMA 3V5EA 3QK8A 4HDTA 2PBPA 3RRVA 3Q0GA 2VSSA 5CTCA 4I52A 3OT6A 4DI1A 1FC6A 2EJ5A 4I4ZA 1DUBA 3ZW9A 3M6NA 3GF7A 4JVTA 3TT6A 2J5GA 3K8XA 1Q51A 1NZYB 3T89A 4JCTA 2QQ3A 3P5MA 3BPTA 3K50A 4JWVA 2F6IA 5FIFA 4QIIA 4WCZA 3GKBA 3PZKA 5DU4A 5KDRB 4ELXA 3QKAA 3RSIA 4Q1IA 2GTRA 3Q0JA 3HE2A 2ZL0A 2VREA 1DCIA 3DORA 2VX2A 4JCRA 2YJGA 5E0SH 5JBWA 3V5IA 1J7XA 2J5SA 4Z0MA 4J2UA 5DTPA 3MYBA 4KPKA 4ASIA 1VRGA 4U0HA 3BF0A 5DZKA 3P2LA 3U9TB 4ZDCA 5KJPA 1UYRA 5DUFA 1TG6A 2J5GD 4WYOB 4G2RA 3H02A 1YG8A 3P85A 4GHNA 5FUSA 5G1SA 3QXIA 2ZL4A 1NZYA 3M6MA 3IAVA 3OC7A 3GMAA 5KDRA 2X24A 3FDUA 2ZL2A 4ELSA 3HINA 2ZQQA 5C9GA 3G64A 1PJHA 4FNBA 2VSSE 3KTGA 1XNYA 2FW2A 2A81A 4K2NA 4U19A 3PE8A 4B3IA 2W3PA 2PG8A 4FNDA 4ZU2A 4HNKA 4Q0GA 4K3WA 4IZDA 1HZDA 4U0GH 3SWXA 2VSUC 2IEXA 4NARA 2J5II 3U9RB 4JJTA 4OLQA 3ZWAA 3WG5A 4U1AA 1W2XA 1SG4A 3RSTA 3LKEA 3HRXA 5HUQA 4OG1A 1K32A 3R0OA 4F47A 1HNUA 4MOUA 2PPYA 3ST9A 3H0SA 5E0NX 4ZDBA 4HC8A 3OMEA 3TDCA 2X58A 1X0UA 1FCFA 2DEOA 4B3JA 4FB8A 4MI2A 1RJNA 4EMPA 5INFA 4FN8A 3R9QA 3H0UA 3DJAA 5DU8A 1UYTA 2DUBA 3TV5A 5E0SA 1SZOA 3KTHA 4QFEA 4RCNA 1XX4A 4JCSA 1JXZA 4FZWA 3Q1TA 2NP9A 4FN7A 1UYSA 3NJBA 4JFCA 3BEZA 2C8TA 2ZL3A 5DU6A 2D3TA 1N6FA 4EMLA 5JBXA 5DTWA 3U9SB 3ZWCA 2UZFA 3MT6A 4RYFH 4B3HA 5INGA 4ZDEA 3I47A 3SLLA 3TT7A 4LK5A 4QIJA 4I42A 3GF3A 1YG6A 4JOTA 3T8AA 4IZCA 1UYVA 1FC9A 2HW5A 2CE3A 2F9YB 1O8UA 4GM2A 2VSUF 1EF8A 3TRRA 3GLMA 5DKPA 3TZ3A 4IZBA 2VSUA 4KNPA 1HNOA 2A7KA 3ZWBA 4WZ8B 4JCQA 5MGBA 3VIVA 3QMJA 5DUCA 4ELWA 3R9TA 2A7SA 3ISAA 3N6RB 3ZW8A 2J5IB 3IB9A 1Q52A 2BZRA 3H81A 3TVUA 3KTIA 4U0GA 1WDLA 1Y7OA 3QXZA 5INIA 4OMRA 3TLFA 3T8BA 2Q35A 3LAOA 5DZKH 2F9IB 4L6WA 1WZ8A 2ZQRA 1RJMA 4ZDFA 3NJDA 4EMMA 4NEKA 3L3SA 3QYRA 3MOYA 1WDKA 3Q7HA 5IKLB 5CTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K39 A;  1WDM A;  2F9Y A;  4L8K A;  3HP0 A;  3T3W A;  2Q34 A;  4MXI A;  1ON9 A;  1ON3 A;  2Q2X A;  3FF6 A;  3R6H A;  4U18 A;  3T88 A;  4JYJ A;  3IBB A;  5C90 A;  4KD6 A;  3QWD A;  3R9S A;  3TVW A;  2CBY A;  4K29 A;  3H0Q A;  4JYL A;  1OD4 A;  3QRE A;  2FZS A;  1UIY A;  3STA A;  1N6D A;  3KTJ A;  3JU1 A;  4FZW C;  3PEA A;  3KQF A;  1XO6 A;  1XNW A;  1TYF A;  2FBM A;  1XNV A;  4NNQ A;  3HLN 1;  2J5I A;  4YLH A;  1MJ3 A;  2F6Q A;  3BPP A;  3PGQ A;  4KWB A;  3H0J A;  5DL1 A;  1EF9 A;  5G1R A;  5G1Q A;  1N6E A;  4ZDD A;  2WTB A;  4FJW D;  1FC7 A;  1EY3 A;  1PIX A;  4JSB A;  1OD2 A;  2VSU E;  4RYF A;  3KTK A;  2VSS F;  2F9I A;  3MFM A;  3V5E A;  3QK8 A;  2PBP A;  3RRV A;  3Q0G A;  2VSS A;  5CTC A;  4I52 A;  3OT6 A;  4DI1 A;  1FC6 A;  2EJ5 A;  4I4Z A;  1DUB A;  3ZW9 A;  3M6N A;  3GF7 A;  4JVT A;  3TT6 A;  2J5G A;  3K8X A;  1Q51 A;  1NZY B;  3T89 A;  4JCT A;  2QQ3 A;  3P5M A;  3K50 A;  4JWV A;  2F6I A;  5FIF A;  4QII A;  4WCZ A;  3GKB A;  3PZK A;  5DU4 A;  5KDR B;  4ELX A;  3QKA A;  3RSI A;  4Q1I A;  2GTR A;  3Q0J A;  3HE2 A;  2ZL0 A;  2VRE A;  1DCI A;  3DOR A;  2VX2 A;  4JCR A;  5E0S H;  5JBW A;  3V5I A;  1J7X A;  2J5S A;  4Z0M A;  5DTP A;  3MYB A;  4KPK A;  4ASI A;  1VRG A;  4U0H A;  3BF0 A;  5DZK A;  3P2L A;  3U9T B;  4ZDC A;  5KJP A;  1UYR A;  5DUF A;  1TG6 A;  2J5G D;  4WYO B;  4G2R A;  3H02 A;  1YG8 A;  3P85 A;  4GHN A;  5FUS A;  5G1S A;  3QXI A;  2ZL4 A;  1NZY A;  3M6M A;  3IAV A;  3OC7 A;  3GMA A;  5KDR A;  2X24 A;  3FDU A;  2ZL2 A;  4ELS A;  3HIN A;  2ZQQ A;  5C9G A;  3G64 A;  1PJH A;  4FNB A;  2VSS E;  3KTG A;  1XNY A;  2FW2 A;  2A81 A;  4K2N A;  4U19 A;  3PE8 A;  4B3I A;  2W3P A;  2PG8 A;  4FND A;  4ZU2 A;  4HNK A;  4Q0G A;  4K3W A;  4IZD A;  1HZD A;  4U0G H;  3SWX A;  2VSU C;  2IEX A;  2J5I I;  3U9R B;  4JJT A;  4OLQ A;  3ZWA A;  3WG5 A;  4U1A A;  1W2X A;  1SG4 A;  3RST A;  3LKE A;  3HRX A;  4OG1 A;  1K32 A;  3R0O A;  4F47 A;  1HNU A;  4MOU A;  2PPY A;  3ST9 A;  3H0S A;  5E0N X;  4ZDB A;  4HC8 A;  3OME A;  3TDC A;  2X58 A;  1X0U A;  1FCF A;  2DEO A;  4B3J A;  4FB8 A;  4MI2 A;  1RJN A;  4EMP A;  5INF A;  4FN8 A;  3R9Q A;  3H0U A;  3DJA A;  5DU8 A;  1UYT A;  2DUB A;  3TV5 A;  5E0S A;  1SZO A;  3KTH A;  4QFE A;  4RCN A;  1XX4 A;  4JCS A;  1JXZ A;  4FZW A;  3Q1T A;  2NP9 A;  4FN7 A;  1UYS A;  3NJB A;  4JFC A;  3BEZ A;  2C8T A;  2ZL3 A;  5DU6 A;  2D3T A;  1N6F A;  4EML A;  5JBX A;  5DTW A;  3U9S B;  3ZWC A;  2UZF A;  3MT6 A;  4RYF H;  4B3H A;  5ING A;  4ZDE A;  3I47 A;  3SLL A;  3TT7 A;  4LK5 A;  4QIJ A;  4I42 A;  3GF3 A;  1YG6 A;  4JOT A;  3T8A A;  4IZC A;  1UYV A;  1FC9 A;  2HW5 A;  2CE3 A;  2F9Y B;  1O8U A;  4GM2 A;  2VSU F;  1EF8 A;  3TRR A;  3GLM A;  5DKP A;  3TZ3 A;  4IZB A;  2VSU A;  4KNP A;  1HNO A;  2A7K A;  3ZWB A;  4WZ8 B;  4JCQ A;  5MGB A;  3VIV A;  3QMJ A;  5DUC A;  4ELW A;  3R9T A;  2A7S A;  3ISA A;  3N6R B;  3ZW8 A;  2J5I B;  3IB9 A;  1Q52 A;  2BZR A;  3H81 A;  3TVU A;  3KTI A;  4U0G A;  1WDL A;  1Y7O A;  3QXZ A;  5INI A;  4OMR A;  3TLF A;  3T8B A;  2Q35 A;  3LAO A;  5DZK H;  2F9I B;  4L6W A;  1WZ8 A;  2ZQR A;  1RJM A;  4ZDF A;  3NJD A;  4EMM A;  4NEK A;  3L3S A;  3QYR A;  3MOY A;  1WDK A;  3Q7H A;  5IKL B;  5CTB A; 
#chains in the Genus database with same CATH topology
 1K39 A;  1WDM A;  2F9Y A;  4L8K A;  3HP0 A;  3T3W A;  2Q34 A;  4MXI A;  1ON9 A;  1ON3 A;  2Q2X A;  3FF6 A;  3R6H A;  4U18 A;  3T88 A;  4JYJ A;  3IBB A;  5C90 A;  4KD6 A;  3QWD A;  3R9S A;  3TVW A;  2CBY A;  4K29 A;  3H0Q A;  4JYL A;  1OD4 A;  3QRE A;  2FZS A;  1UIY A;  3STA A;  1N6D A;  3KTJ A;  3JU1 A;  4FZW C;  3PEA A;  3KQF A;  1XO6 A;  1XNW A;  1TYF A;  2FBM A;  1XNV A;  4NNQ A;  3HLN 1;  2J5I A;  4YLH A;  1MJ3 A;  2F6Q A;  3BPP A;  3PGQ A;  4KWB A;  3H0J A;  5DL1 A;  1EF9 A;  5G1R A;  5G1Q A;  1N6E A;  4ZDD A;  2WTB A;  4FJW D;  1FC7 A;  1EY3 A;  1PIX A;  4JSB A;  1OD2 A;  2VSU E;  4RYF A;  3KTK A;  2VSS F;  2F9I A;  3MFM A;  3V5E A;  3QK8 A;  4HDT A;  2PBP A;  3RRV A;  3Q0G A;  2VSS A;  5CTC A;  4I52 A;  3OT6 A;  4DI1 A;  1FC6 A;  2EJ5 A;  4I4Z A;  1DUB A;  3ZW9 A;  3M6N A;  3GF7 A;  4JVT A;  3TT6 A;  2J5G A;  3K8X A;  1Q51 A;  1NZY B;  3T89 A;  4JCT A;  2QQ3 A;  3P5M A;  3BPT A;  3K50 A;  4JWV A;  2F6I A;  5FIF A;  4QII A;  4WCZ A;  3GKB A;  3PZK A;  5DU4 A;  5KDR B;  4ELX A;  3QKA A;  3RSI A;  4Q1I A;  2GTR A;  3Q0J A;  3HE2 A;  2ZL0 A;  2VRE A;  1DCI A;  3DOR A;  2VX2 A;  4JCR A;  2YJG A;  5E0S H;  5JBW A;  3V5I A;  1J7X A;  2J5S A;  4Z0M A;  4J2U A;  5DTP A;  3MYB A;  4KPK A;  4ASI A;  1VRG A;  4U0H A;  3BF0 A;  5DZK A;  3P2L A;  3U9T B;  4ZDC A;  5KJP A;  1UYR A;  5DUF A;  1TG6 A;  2J5G D;  4WYO B;  4G2R A;  3H02 A;  1YG8 A;  3P85 A;  4GHN A;  5FUS A;  5G1S A;  3QXI A;  2ZL4 A;  1NZY A;  3M6M A;  3IAV A;  3OC7 A;  3GMA A;  5KDR A;  2X24 A;  3FDU A;  2ZL2 A;  4ELS A;  3HIN A;  2ZQQ A;  5C9G A;  3G64 A;  1PJH A;  4FNB A;  2VSS E;  3KTG A;  1XNY A;  2FW2 A;  2A81 A;  4K2N A;  4U19 A;  3PE8 A;  4B3I A;  2W3P A;  2PG8 A;  4FND A;  4ZU2 A;  4HNK A;  4Q0G A;  4K3W A;  4IZD A;  1HZD A;  4U0G H;  3SWX A;  2VSU C;  2IEX A;  4NAR A;  2J5I I;  3U9R B;  4JJT A;  4OLQ A;  3ZWA A;  3WG5 A;  4U1A A;  1W2X A;  1SG4 A;  3RST A;  3LKE A;  3HRX A;  5HUQ A;  4OG1 A;  1K32 A;  3R0O A;  4F47 A;  1HNU A;  4MOU A;  2PPY A;  3ST9 A;  3H0S A;  5E0N X;  4ZDB A;  4HC8 A;  3OME A;  3TDC A;  2X58 A;  1X0U A;  1FCF A;  2DEO A;  4B3J A;  4FB8 A;  4MI2 A;  1RJN A;  4EMP A;  5INF A;  4FN8 A;  3R9Q A;  3H0U A;  3DJA A;  5DU8 A;  1UYT A;  2DUB A;  3TV5 A;  5E0S A;  1SZO A;  3KTH A;  4QFE A;  4RCN A;  1XX4 A;  4JCS A;  1JXZ A;  4FZW A;  3Q1T A;  2NP9 A;  4FN7 A;  1UYS A;  3NJB A;  4JFC A;  3BEZ A;  2C8T A;  2ZL3 A;  5DU6 A;  2D3T A;  1N6F A;  4EML A;  5JBX A;  5DTW A;  3U9S B;  3ZWC A;  2UZF A;  3MT6 A;  4RYF H;  4B3H A;  5ING A;  4ZDE A;  3I47 A;  3SLL A;  3TT7 A;  4LK5 A;  4QIJ A;  4I42 A;  3GF3 A;  1YG6 A;  4JOT A;  3T8A A;  4IZC A;  1UYV A;  1FC9 A;  2HW5 A;  2CE3 A;  2F9Y B;  1O8U A;  4GM2 A;  2VSU F;  1EF8 A;  3TRR A;  3GLM A;  5DKP A;  3TZ3 A;  4IZB A;  2VSU A;  4KNP A;  1HNO A;  2A7K A;  3ZWB A;  4WZ8 B;  4JCQ A;  5MGB A;  3VIV A;  3QMJ A;  5DUC A;  4ELW A;  3R9T A;  2A7S A;  3ISA A;  3N6R B;  3ZW8 A;  2J5I B;  3IB9 A;  1Q52 A;  2BZR A;  3H81 A;  3TVU A;  3KTI A;  4U0G A;  1WDL A;  1Y7O A;  3QXZ A;  5INI A;  4OMR A;  3TLF A;  3T8B A;  2Q35 A;  3LAO A;  5DZK H;  2F9I B;  4L6W A;  1WZ8 A;  2ZQR A;  1RJM A;  4ZDF A;  3NJD A;  4EMM A;  4NEK A;  3L3S A;  3QYR A;  3MOY A;  1WDK A;  3Q7H A;  5IKL B;  5CTB A; 
#chains in the Genus database with same CATH homology
 1K39 A;  1WDM A;  2F9Y A;  4L8K A;  3HP0 A;  3T3W A;  2Q34 A;  4MXI A;  1ON9 A;  1ON3 A;  2Q2X A;  3FF6 A;  3R6H A;  4U18 A;  3T88 A;  4JYJ A;  3IBB A;  5C90 A;  4KD6 A;  3QWD A;  3R9S A;  3TVW A;  2CBY A;  4K29 A;  3H0Q A;  4JYL A;  1OD4 A;  3QRE A;  2FZS A;  1UIY A;  3STA A;  1N6D A;  3KTJ A;  3JU1 A;  4FZW C;  3PEA A;  3KQF A;  1XO6 A;  1XNW A;  1TYF A;  2FBM A;  1XNV A;  4NNQ A;  3HLN 1;  2J5I A;  4YLH A;  1MJ3 A;  2F6Q A;  3BPP A;  3PGQ A;  4KWB A;  3H0J A;  5DL1 A;  1EF9 A;  5G1R A;  5G1Q A;  1N6E A;  4ZDD A;  2WTB A;  4FJW D;  1FC7 A;  1EY3 A;  1PIX A;  4JSB A;  1OD2 A;  2VSU E;  4RYF A;  3KTK A;  2VSS F;  2F9I A;  3MFM A;  3V5E A;  3QK8 A;  4HDT A;  2PBP A;  3RRV A;  3Q0G A;  2VSS A;  5CTC A;  4I52 A;  3OT6 A;  4DI1 A;  1FC6 A;  2EJ5 A;  4I4Z A;  1DUB A;  3ZW9 A;  3M6N A;  3GF7 A;  4JVT A;  3TT6 A;  2J5G A;  3K8X A;  1Q51 A;  1NZY B;  3T89 A;  4JCT A;  2QQ3 A;  3P5M A;  3BPT A;  3K50 A;  4JWV A;  2F6I A;  5FIF A;  4QII A;  4WCZ A;  3GKB A;  3PZK A;  5DU4 A;  5KDR B;  4ELX A;  3QKA A;  3RSI A;  4Q1I A;  2GTR A;  3Q0J A;  3HE2 A;  2ZL0 A;  2VRE A;  1DCI A;  3DOR A;  2VX2 A;  4JCR A;  2YJG A;  5E0S H;  5JBW A;  3V5I A;  1J7X A;  2J5S A;  4Z0M A;  4J2U A;  5DTP A;  3MYB A;  4KPK A;  4ASI A;  1VRG A;  4U0H A;  3BF0 A;  5DZK A;  3P2L A;  3U9T B;  4ZDC A;  5KJP A;  1UYR A;  5DUF A;  1TG6 A;  2J5G D;  4WYO B;  4G2R A;  3H02 A;  1YG8 A;  3P85 A;  4GHN A;  5FUS A;  5G1S A;  3QXI A;  2ZL4 A;  1NZY A;  3M6M A;  3IAV A;  3OC7 A;  3GMA A;  5KDR A;  2X24 A;  3FDU A;  2ZL2 A;  4ELS A;  3HIN A;  2ZQQ A;  5C9G A;  3G64 A;  1PJH A;  4FNB A;  2VSS E;  3KTG A;  1XNY A;  2FW2 A;  2A81 A;  4K2N A;  4U19 A;  3PE8 A;  4B3I A;  2W3P A;  2PG8 A;  4FND A;  4ZU2 A;  4HNK A;  4Q0G A;  4K3W A;  4IZD A;  1HZD A;  4U0G H;  3SWX A;  2VSU C;  2IEX A;  4NAR A;  2J5I I;  3U9R B;  4JJT A;  4OLQ A;  3ZWA A;  3WG5 A;  4U1A A;  1W2X A;  1SG4 A;  3RST A;  3LKE A;  3HRX A;  5HUQ A;  4OG1 A;  1K32 A;  3R0O A;  4F47 A;  1HNU A;  4MOU A;  2PPY A;  3ST9 A;  3H0S A;  5E0N X;  4ZDB A;  4HC8 A;  3OME A;  3TDC A;  2X58 A;  1X0U A;  1FCF A;  2DEO A;  4B3J A;  4FB8 A;  4MI2 A;  1RJN A;  4EMP A;  5INF A;  4FN8 A;  3R9Q A;  3H0U A;  3DJA A;  5DU8 A;  1UYT A;  2DUB A;  3TV5 A;  5E0S A;  1SZO A;  3KTH A;  4QFE A;  4RCN A;  1XX4 A;  4JCS A;  1JXZ A;  4FZW A;  3Q1T A;  2NP9 A;  4FN7 A;  1UYS A;  3NJB A;  4JFC A;  3BEZ A;  2C8T A;  2ZL3 A;  5DU6 A;  2D3T A;  1N6F A;  4EML A;  5JBX A;  5DTW A;  3U9S B;  3ZWC A;  2UZF A;  3MT6 A;  4RYF H;  4B3H A;  5ING A;  4ZDE A;  3I47 A;  3SLL A;  3TT7 A;  4LK5 A;  4QIJ A;  4I42 A;  3GF3 A;  1YG6 A;  4JOT A;  3T8A A;  4IZC A;  1UYV A;  1FC9 A;  2HW5 A;  2CE3 A;  2F9Y B;  1O8U A;  4GM2 A;  2VSU F;  1EF8 A;  3TRR A;  3GLM A;  5DKP A;  3TZ3 A;  4IZB A;  2VSU A;  4KNP A;  1HNO A;  2A7K A;  3ZWB A;  4WZ8 B;  4JCQ A;  5MGB A;  3VIV A;  3QMJ A;  5DUC A;  4ELW A;  3R9T A;  2A7S A;  3ISA A;  3N6R B;  3ZW8 A;  2J5I B;  3IB9 A;  1Q52 A;  2BZR A;  3H81 A;  3TVU A;  3KTI A;  4U0G A;  1WDL A;  1Y7O A;  3QXZ A;  5INI A;  4OMR A;  3TLF A;  3T8B A;  2Q35 A;  3LAO A;  5DZK H;  2F9I B;  4L6W A;  1WZ8 A;  2ZQR A;  1RJM A;  4ZDF A;  3NJD A;  4EMM A;  4NEK A;  3L3S A;  3QYR A;  3MOY A;  1WDK A;  3Q7H A;  5IKL B;  5CTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...