3KTIA

Structure of clpp in complex with adep1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
b'DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktiA00
5C9GA 4QIIA 4I52A 2BZRA 2ZQQA 5DTPA 1OD2A 3V5IA 2VSSF 3K50A 4IZCA 3G64A 1N6EA 3P2LA 4MXIA 5G1SA 4JCTA 3Q7HA 4GHNA 1UYVA 1MJ3A 5MGBA 2VSUE 5DL1A 2VSSA 2J5IB 3PZKA 3U9TB 4NNQA 3TZ3A 4MOUA 3TRRA 3OMEA 5INGA 2Q34A 4FZWA 1DCIA 2A7KA 2UZFA 4FN7A 4ZDBA 4JWVA 4K2NA 4U18A 4Z0MA 1N6FA 2F6IA 3T8BA 1FC6A 1HNUA 3TLFA 3ISAA 4F47A 1SG4A 1HZDA 5JBWA 1EY3A 2QQ3A 3WG5A 3HLN1 4JSBA 5E0SA 2F6QA 1ON9A 3SWXA 3ZWBA 4KD6A 5DU4A 3MYBA 4U1AA 4JOTA 3HP0A 3Q0GA 5IKLB 2J5II 1PIXA 4GM2A 3RSTA 1Q52A 3BF0A 3L3SA 3BPPA 4WCZA 4G2RA 1EF8A 3IAVA 3Q1TA 3IB9A 1WDKA 1UYSA 5JBXA 3KTGA 5G1RA 3M6MA 2D3TA 3LAOA 4EMLA 3R9TA 2Q2XA 3DJAA 4U0GA 1PJHA 2A81A 2FW2A 3U9SB 4B3JA 3QKAA 3H0JA 3RRVA 3QWDA 4RYFA 5E0NX 3R9QA 1ON3A 3T8AA 1OD4A 1N6DA 3H02A 4JYJA 4ELSA 1NZYA 3TDCA 4ZU2A 2F9YA 3GF7A 2WTBA 3T88A 1FC9A 1XX4A 5DUCA 4DI1A 1HNOA 3RSIA 3GLMA 4JJTA 4L6WA 1UIYA 1RJMA 4RCNA 3M6NA 3P85A 4HNKA 3ST9A 3QYRA 4HC8A 4WZ8B 3ZWCA 3MOYA 4OG1A 2EJ5A 5DKPA 3QREA 4B3HA 2VREA 1FC7A 1K32A 3U9RB 2ZQRA 1O8UA 4KPKA 1J7XA 3PGQA 3KQFA 4RYFH 1TYFA 3T89A 3FF6A 4FNDA 4FN8A 5DZKA 4JVTA 2VSSE 4ZDCA 2ZL2A 4U0HA 3H0SA 3V5EA 2J5GA 3Q0JA 4EMMA 2ZL0A 3QMJA 2F9IA 4Q0GA 4KNPA 2DEOA 4FJWD 5CTBA 3GKBA 1X0UA 2W3PA 1EF9A 5C90A 4JCSA 3VIVA 1K39A 1VRGA 4I42A 4WYOB 3HINA 4K29A 1JXZA 2NP9A 2VSUF 3I47A 4ELXA 3KTIA 3HRXA 5CTCA 4NEKA 1XNVA 2C8TA 4MI2A 4ASIA 4I4ZA 2J5SA 2VSUA 2F9IB 3TT6A 3NJDA 4JYLA 2X58A 1YG6A 4L8KA 5E0SH 3ZW9A 3TVWA 3KTJA 4QIJA 4LK5A 2ZL4A 1WDLA 4KWBA 5KDRA 3MFMA 1DUBA 3QK8A 4YLHA 3STAA 5KJPA 4ELWA 3OT6A 1SZOA 4K3WA 1RJNA 4B3IA 2PBPA 3R6HA 3PE8A 3QXZA 1Y7OA 4U19A 4U0GH 3DORA 3TVUA 1YG8A 5FUSA 2IEXA 1NZYB 4QFEA 2F9YB 2VSUC 2Q35A 1XO6A 2FZSA 4OMRA 2CE3A 3PEAA 3H81A 2A7SA 1UYTA 3OC7A 4EMPA 4JFCA 3T3WA 5KDRB 4FNBA 2FBMA 2VX2A 3R0OA 2PPYA 5DUFA 3KTHA 3BEZA 3TT7A 3LKEA 3R9SA 4ZDEA 5FIFA 3H0QA 2GTRA 3GMAA 2X24A 5INFA 1W2XA 2ZL3A 1FCFA 3HE2A 5DTWA 4ZDFA 4IZBA 2DUBA 1TG6A 4OLQA 2HW5A 3ZW8A 1WZ8A 1WDMA 3MT6A 3P5MA 5G1QA 3GF3A 3QXIA 3KTKA 3NJBA 4ZDDA 4FZWC 4IZDA 3IBBA 1XNWA 3SLLA 4JCRA 3JU1A 1Q51A 5INIA 4JCQA 1UYRA 4Q1IA 3ZWAA 5DU6A 5DU8A 4FB8A 2CBYA 2J5GD 2J5IA 3TV5A 3K8XA 5DZKH 2PG8A 3N6RB 1XNYA 3H0UA 3FDUA
chains in the Genus database with same CATH superfamily
5C9GA 4QIIA 4I52A 2BZRA 2ZQQA 5DTPA 1OD2A 3V5IA 2VSSF 3K50A 4IZCA 3G64A 1N6EA 3P2LA 4MXIA 5G1SA 4JCTA 3Q7HA 4GHNA 1UYVA 1MJ3A 5MGBA 2VSUE 5DL1A 2VSSA 2J5IB 3PZKA 3U9TB 4NNQA 3TZ3A 4MOUA 3TRRA 3OMEA 5INGA 2Q34A 4FZWA 1DCIA 2A7KA 2UZFA 4FN7A 4ZDBA 4JWVA 4K2NA 4U18A 4Z0MA 1N6FA 2F6IA 3T8BA 1FC6A 1HNUA 3TLFA 3ISAA 4F47A 1SG4A 1HZDA 5JBWA 1EY3A 2QQ3A 3WG5A 3HLN1 4JSBA 5E0SA 2F6QA 1ON9A 3SWXA 3ZWBA 4KD6A 5DU4A 3MYBA 4U1AA 4JOTA 3HP0A 3Q0GA 5IKLB 2J5II 1PIXA 4GM2A 3RSTA 4HDTA 1Q52A 3BF0A 3L3SA 3BPPA 4WCZA 4G2RA 1EF8A 3IAVA 3Q1TA 2YJGA 1WDKA 3IB9A 1UYSA 5JBXA 3KTGA 5G1RA 3BPTA 3M6MA 2D3TA 3LAOA 4EMLA 3R9TA 2Q2XA 3DJAA 4U0GA 1PJHA 2A81A 2FW2A 3U9SB 4B3JA 3QKAA 3H0JA 3RRVA 3QWDA 4RYFA 5E0NX 3R9QA 1ON3A 3T8AA 1OD4A 1N6DA 3H02A 4JYJA 4ELSA 1NZYA 3TDCA 4ZU2A 2F9YA 3GF7A 2WTBA 3T88A 1FC9A 1XX4A 5DUCA 4DI1A 1HNOA 3RSIA 3GLMA 4JJTA 4L6WA 1UIYA 1RJMA 4RCNA 3M6NA 3P85A 4HNKA 3ST9A 3QYRA 4HC8A 4WZ8B 3ZWCA 3MOYA 4OG1A 2EJ5A 5DKPA 3QREA 4B3HA 2VREA 1FC7A 1K32A 3U9RB 2ZQRA 1O8UA 4KPKA 1J7XA 3PGQA 3KQFA 4RYFH 1TYFA 3T89A 3FF6A 4FNDA 4FN8A 5DZKA 4JVTA 2VSSE 4ZDCA 2ZL2A 4U0HA 3H0SA 3V5EA 2J5GA 3Q0JA 4EMMA 2ZL0A 3QMJA 2F9IA 4Q0GA 4KNPA 2DEOA 4FJWD 5CTBA 3GKBA 1X0UA 2W3PA 1EF9A 5C90A 4JCSA 3VIVA 1K39A 1VRGA 4I42A 4WYOB 3HINA 4K29A 1JXZA 2NP9A 2VSUF 3I47A 4ELXA 3KTIA 3HRXA 5CTCA 4NEKA 1XNVA 2C8TA 4MI2A 4ASIA 4I4ZA 2J5SA 2VSUA 2F9IB 3TT6A 3NJDA 4JYLA 2X58A 1YG6A 4L8KA 5E0SH 3ZW9A 3TVWA 3KTJA 4NARA 4QIJA 4LK5A 2ZL4A 1WDLA 4KWBA 5KDRA 3MFMA 1DUBA 3QK8A 4YLHA 3STAA 5KJPA 4ELWA 3OT6A 1SZOA 4K3WA 1RJNA 4B3IA 2PBPA 3R6HA 3PE8A 3QXZA 1Y7OA 4U19A 4U0GH 3DORA 3TVUA 1YG8A 5FUSA 2IEXA 1NZYB 4QFEA 2F9YB 2VSUC 2Q35A 1XO6A 2FZSA 4OMRA 2CE3A 3PEAA 3H81A 2A7SA 1UYTA 3OC7A 4EMPA 4JFCA 3T3WA 5KDRB 4FNBA 2FBMA 2VX2A 3R0OA 2PPYA 5DUFA 3KTHA 3BEZA 3TT7A 3LKEA 3R9SA 4J2UA 4ZDEA 5FIFA 3H0QA 2GTRA 3GMAA 2X24A 5INFA 1W2XA 2ZL3A 1FCFA 3HE2A 5DTWA 4ZDFA 4IZBA 2DUBA 1TG6A 4OLQA 2HW5A 3ZW8A 1WZ8A 1WDMA 3MT6A 3P5MA 5G1QA 3GF3A 3QXIA 3KTKA 3NJBA 4ZDDA 4FZWC 4IZDA 3IBBA 1XNWA 3SLLA 4JCRA 3JU1A 1Q51A 5INIA 4JCQA 1UYRA 4Q1IA 3ZWAA 5DU6A 5DU8A 4FB8A 2CBYA 2J5GD 2J5IA 5HUQA 3TV5A 3K8XA 5DZKH 2PG8A 3N6RB 1XNYA 3H0UA 3FDUA
chains in the Genus database with same CATH topology
5C9GA 4QIIA 4I52A 2BZRA 2ZQQA 5DTPA 1OD2A 3V5IA 2VSSF 3K50A 4IZCA 3G64A 1N6EA 3P2LA 4MXIA 5G1SA 4JCTA 3Q7HA 4GHNA 1UYVA 1MJ3A 5MGBA 2VSUE 5DL1A 2VSSA 2J5IB 3PZKA 3U9TB 4NNQA 3TZ3A 4MOUA 3TRRA 3OMEA 5INGA 2Q34A 4FZWA 1DCIA 2A7KA 2UZFA 4FN7A 4ZDBA 4JWVA 4K2NA 4U18A 4Z0MA 1N6FA 2F6IA 3T8BA 1FC6A 1HNUA 3TLFA 3ISAA 4F47A 1SG4A 1HZDA 5JBWA 1EY3A 2QQ3A 3WG5A 3HLN1 4JSBA 5E0SA 2F6QA 1ON9A 3SWXA 3ZWBA 4KD6A 5DU4A 3MYBA 4U1AA 4JOTA 3HP0A 3Q0GA 5IKLB 2J5II 1PIXA 4GM2A 3RSTA 4HDTA 1Q52A 3BF0A 3L3SA 3BPPA 4WCZA 4G2RA 1EF8A 3IAVA 3Q1TA 2YJGA 1WDKA 3IB9A 1UYSA 5JBXA 3KTGA 5G1RA 3BPTA 3M6MA 2D3TA 3LAOA 4EMLA 3R9TA 2Q2XA 3DJAA 4U0GA 1PJHA 2A81A 2FW2A 3U9SB 4B3JA 3QKAA 3H0JA 3RRVA 3QWDA 4RYFA 5E0NX 3R9QA 1ON3A 3T8AA 1OD4A 1N6DA 3H02A 4JYJA 4ELSA 1NZYA 3TDCA 4ZU2A 2F9YA 3GF7A 2WTBA 3T88A 1FC9A 1XX4A 5DUCA 4DI1A 1HNOA 3RSIA 3GLMA 4JJTA 4L6WA 1UIYA 1RJMA 4RCNA 3M6NA 3P85A 4HNKA 3ST9A 3QYRA 4HC8A 4WZ8B 3ZWCA 3MOYA 4OG1A 2EJ5A 5DKPA 3QREA 4B3HA 2VREA 1FC7A 1K32A 3U9RB 2ZQRA 1O8UA 4KPKA 1J7XA 3PGQA 3KQFA 4RYFH 1TYFA 3T89A 3FF6A 4FNDA 4FN8A 5DZKA 4JVTA 2VSSE 4ZDCA 2ZL2A 4U0HA 3H0SA 3V5EA 2J5GA 3Q0JA 4EMMA 2ZL0A 3QMJA 2F9IA 4Q0GA 4KNPA 2DEOA 4FJWD 5CTBA 3GKBA 1X0UA 2W3PA 1EF9A 5C90A 4JCSA 3VIVA 1K39A 1VRGA 4I42A 4WYOB 3HINA 4K29A 1JXZA 2NP9A 2VSUF 3I47A 4ELXA 3KTIA 3HRXA 5CTCA 4NEKA 1XNVA 2C8TA 4MI2A 4ASIA 4I4ZA 2J5SA 2VSUA 2F9IB 3TT6A 3NJDA 4JYLA 2X58A 1YG6A 4L8KA 5E0SH 3ZW9A 3TVWA 3KTJA 4NARA 4QIJA 4LK5A 2ZL4A 1WDLA 4KWBA 5KDRA 3MFMA 1DUBA 3QK8A 4YLHA 3STAA 5KJPA 4ELWA 3OT6A 1SZOA 4K3WA 1RJNA 4B3IA 2PBPA 3R6HA 3PE8A 3QXZA 1Y7OA 4U19A 4U0GH 3DORA 3TVUA 1YG8A 5FUSA 2IEXA 1NZYB 4QFEA 2F9YB 2VSUC 2Q35A 1XO6A 2FZSA 4OMRA 2CE3A 3PEAA 3H81A 2A7SA 1UYTA 3OC7A 4EMPA 4JFCA 3T3WA 5KDRB 4FNBA 2FBMA 2VX2A 3R0OA 2PPYA 5DUFA 3KTHA 3BEZA 3TT7A 3LKEA 3R9SA 4J2UA 4ZDEA 5FIFA 3H0QA 2GTRA 3GMAA 2X24A 5INFA 1W2XA 2ZL3A 1FCFA 3HE2A 5DTWA 4ZDFA 4IZBA 2DUBA 1TG6A 4OLQA 2HW5A 3ZW8A 1WZ8A 1WDMA 3MT6A 3P5MA 5G1QA 3GF3A 3QXIA 3KTKA 3NJBA 4ZDDA 4FZWC 4IZDA 3IBBA 1XNWA 3SLLA 4JCRA 3JU1A 1Q51A 5INIA 4JCQA 1UYRA 4Q1IA 3ZWAA 5DU6A 5DU8A 4FB8A 2CBYA 2J5GD 2J5IA 5HUQA 3TV5A 3K8XA 5DZKH 2PG8A 3N6RB 1XNYA 3H0UA 3FDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C9G A;  4QII A;  4I52 A;  2BZR A;  2ZQQ A;  5DTP A;  1OD2 A;  3V5I A;  2VSS F;  3K50 A;  4IZC A;  3G64 A;  1N6E A;  3P2L A;  4MXI A;  5G1S A;  4JCT A;  3Q7H A;  4GHN A;  1UYV A;  1MJ3 A;  5MGB A;  2VSU E;  5DL1 A;  2VSS A;  2J5I B;  3PZK A;  3U9T B;  4NNQ A;  3TZ3 A;  4MOU A;  3TRR A;  3OME A;  5ING A;  2Q34 A;  4FZW A;  1DCI A;  2A7K A;  2UZF A;  4FN7 A;  4ZDB A;  4JWV A;  4K2N A;  4U18 A;  4Z0M A;  1N6F A;  2F6I A;  3T8B A;  1FC6 A;  1HNU A;  3TLF A;  3ISA A;  4F47 A;  1SG4 A;  1HZD A;  5JBW A;  1EY3 A;  2QQ3 A;  3WG5 A;  3HLN 1;  4JSB A;  5E0S A;  2F6Q A;  1ON9 A;  3SWX A;  3ZWB A;  4KD6 A;  5DU4 A;  3MYB A;  4U1A A;  4JOT A;  3HP0 A;  3Q0G A;  5IKL B;  2J5I I;  1PIX A;  4GM2 A;  3RST A;  1Q52 A;  3BF0 A;  3L3S A;  3BPP A;  4WCZ A;  4G2R A;  1EF8 A;  3IAV A;  3Q1T A;  3IB9 A;  1WDK A;  1UYS A;  5JBX A;  3KTG A;  5G1R A;  3M6M A;  2D3T A;  3LAO A;  4EML A;  3R9T A;  2Q2X A;  3DJA A;  4U0G A;  1PJH A;  2A81 A;  2FW2 A;  3U9S B;  4B3J A;  3QKA A;  3H0J A;  3RRV A;  3QWD A;  4RYF A;  5E0N X;  3R9Q A;  1ON3 A;  3T8A A;  1OD4 A;  1N6D A;  3H02 A;  4JYJ A;  4ELS A;  1NZY A;  3TDC A;  4ZU2 A;  2F9Y A;  3GF7 A;  2WTB A;  3T88 A;  1FC9 A;  1XX4 A;  5DUC A;  4DI1 A;  1HNO A;  3RSI A;  3GLM A;  4JJT A;  4L6W A;  1UIY A;  1RJM A;  4RCN A;  3M6N A;  3P85 A;  4HNK A;  3ST9 A;  3QYR A;  4HC8 A;  4WZ8 B;  3ZWC A;  3MOY A;  4OG1 A;  2EJ5 A;  5DKP A;  3QRE A;  4B3H A;  2VRE A;  1FC7 A;  1K32 A;  3U9R B;  2ZQR A;  1O8U A;  4KPK A;  1J7X A;  3PGQ A;  3KQF A;  4RYF H;  1TYF A;  3T89 A;  3FF6 A;  4FND A;  4FN8 A;  5DZK A;  4JVT A;  2VSS E;  4ZDC A;  2ZL2 A;  4U0H A;  3H0S A;  3V5E A;  2J5G A;  3Q0J A;  4EMM A;  2ZL0 A;  3QMJ A;  2F9I A;  4Q0G A;  4KNP A;  2DEO A;  4FJW D;  5CTB A;  3GKB A;  1X0U A;  2W3P A;  1EF9 A;  5C90 A;  4JCS A;  3VIV A;  1K39 A;  1VRG A;  4I42 A;  4WYO B;  3HIN A;  4K29 A;  1JXZ A;  2NP9 A;  2VSU F;  3I47 A;  4ELX A;  3KTI A;  3HRX A;  5CTC A;  4NEK A;  1XNV A;  2C8T A;  4MI2 A;  4ASI A;  4I4Z A;  2J5S A;  2VSU A;  2F9I B;  3TT6 A;  3NJD A;  4JYL A;  2X58 A;  1YG6 A;  4L8K A;  5E0S H;  3ZW9 A;  3TVW A;  3KTJ A;  4QIJ A;  4LK5 A;  2ZL4 A;  1WDL A;  4KWB A;  5KDR A;  3MFM A;  1DUB A;  3QK8 A;  4YLH A;  3STA A;  5KJP A;  4ELW A;  3OT6 A;  1SZO A;  4K3W A;  1RJN A;  4B3I A;  2PBP A;  3R6H A;  3PE8 A;  3QXZ A;  1Y7O A;  4U19 A;  4U0G H;  3DOR A;  3TVU A;  1YG8 A;  5FUS A;  2IEX A;  1NZY B;  4QFE A;  2F9Y B;  2VSU C;  2Q35 A;  1XO6 A;  2FZS A;  4OMR A;  2CE3 A;  3PEA A;  3H81 A;  2A7S A;  1UYT A;  3OC7 A;  4EMP A;  4JFC A;  3T3W A;  5KDR B;  4FNB A;  2FBM A;  2VX2 A;  3R0O A;  2PPY A;  5DUF A;  3KTH A;  3BEZ A;  3TT7 A;  3LKE A;  3R9S A;  4ZDE A;  5FIF A;  3H0Q A;  2GTR A;  3GMA A;  2X24 A;  5INF A;  1W2X A;  2ZL3 A;  1FCF A;  3HE2 A;  5DTW A;  4ZDF A;  4IZB A;  2DUB A;  1TG6 A;  4OLQ A;  2HW5 A;  3ZW8 A;  1WZ8 A;  1WDM A;  3MT6 A;  3P5M A;  5G1Q A;  3GF3 A;  3QXI A;  3KTK A;  3NJB A;  4ZDD A;  4FZW C;  4IZD A;  3IBB A;  1XNW A;  3SLL A;  4JCR A;  3JU1 A;  1Q51 A;  5INI A;  4JCQ A;  1UYR A;  4Q1I A;  3ZWA A;  5DU6 A;  5DU8 A;  4FB8 A;  2CBY A;  2J5G D;  2J5I A;  3TV5 A;  3K8X A;  5DZK H;  2PG8 A;  3N6R B;  1XNY A;  3H0U A;  3FDU A; 
#chains in the Genus database with same CATH topology
 5C9G A;  4QII A;  4I52 A;  2BZR A;  2ZQQ A;  5DTP A;  1OD2 A;  3V5I A;  2VSS F;  3K50 A;  4IZC A;  3G64 A;  1N6E A;  3P2L A;  4MXI A;  5G1S A;  4JCT A;  3Q7H A;  4GHN A;  1UYV A;  1MJ3 A;  5MGB A;  2VSU E;  5DL1 A;  2VSS A;  2J5I B;  3PZK A;  3U9T B;  4NNQ A;  3TZ3 A;  4MOU A;  3TRR A;  3OME A;  5ING A;  2Q34 A;  4FZW A;  1DCI A;  2A7K A;  2UZF A;  4FN7 A;  4ZDB A;  4JWV A;  4K2N A;  4U18 A;  4Z0M A;  1N6F A;  2F6I A;  3T8B A;  1FC6 A;  1HNU A;  3TLF A;  3ISA A;  4F47 A;  1SG4 A;  1HZD A;  5JBW A;  1EY3 A;  2QQ3 A;  3WG5 A;  3HLN 1;  4JSB A;  5E0S A;  2F6Q A;  1ON9 A;  3SWX A;  3ZWB A;  4KD6 A;  5DU4 A;  3MYB A;  4U1A A;  4JOT A;  3HP0 A;  3Q0G A;  5IKL B;  2J5I I;  1PIX A;  4GM2 A;  3RST A;  4HDT A;  1Q52 A;  3BF0 A;  3L3S A;  3BPP A;  4WCZ A;  4G2R A;  1EF8 A;  3IAV A;  3Q1T A;  2YJG A;  1WDK A;  3IB9 A;  1UYS A;  5JBX A;  3KTG A;  5G1R A;  3BPT A;  3M6M A;  2D3T A;  3LAO A;  4EML A;  3R9T A;  2Q2X A;  3DJA A;  4U0G A;  1PJH A;  2A81 A;  2FW2 A;  3U9S B;  4B3J A;  3QKA A;  3H0J A;  3RRV A;  3QWD A;  4RYF A;  5E0N X;  3R9Q A;  1ON3 A;  3T8A A;  1OD4 A;  1N6D A;  3H02 A;  4JYJ A;  4ELS A;  1NZY A;  3TDC A;  4ZU2 A;  2F9Y A;  3GF7 A;  2WTB A;  3T88 A;  1FC9 A;  1XX4 A;  5DUC A;  4DI1 A;  1HNO A;  3RSI A;  3GLM A;  4JJT A;  4L6W A;  1UIY A;  1RJM A;  4RCN A;  3M6N A;  3P85 A;  4HNK A;  3ST9 A;  3QYR A;  4HC8 A;  4WZ8 B;  3ZWC A;  3MOY A;  4OG1 A;  2EJ5 A;  5DKP A;  3QRE A;  4B3H A;  2VRE A;  1FC7 A;  1K32 A;  3U9R B;  2ZQR A;  1O8U A;  4KPK A;  1J7X A;  3PGQ A;  3KQF A;  4RYF H;  1TYF A;  3T89 A;  3FF6 A;  4FND A;  4FN8 A;  5DZK A;  4JVT A;  2VSS E;  4ZDC A;  2ZL2 A;  4U0H A;  3H0S A;  3V5E A;  2J5G A;  3Q0J A;  4EMM A;  2ZL0 A;  3QMJ A;  2F9I A;  4Q0G A;  4KNP A;  2DEO A;  4FJW D;  5CTB A;  3GKB A;  1X0U A;  2W3P A;  1EF9 A;  5C90 A;  4JCS A;  3VIV A;  1K39 A;  1VRG A;  4I42 A;  4WYO B;  3HIN A;  4K29 A;  1JXZ A;  2NP9 A;  2VSU F;  3I47 A;  4ELX A;  3KTI A;  3HRX A;  5CTC A;  4NEK A;  1XNV A;  2C8T A;  4MI2 A;  4ASI A;  4I4Z A;  2J5S A;  2VSU A;  2F9I B;  3TT6 A;  3NJD A;  4JYL A;  2X58 A;  1YG6 A;  4L8K A;  5E0S H;  3ZW9 A;  3TVW A;  3KTJ A;  4NAR A;  4QIJ A;  4LK5 A;  2ZL4 A;  1WDL A;  4KWB A;  5KDR A;  3MFM A;  1DUB A;  3QK8 A;  4YLH A;  3STA A;  5KJP A;  4ELW A;  3OT6 A;  1SZO A;  4K3W A;  1RJN A;  4B3I A;  2PBP A;  3R6H A;  3PE8 A;  3QXZ A;  1Y7O A;  4U19 A;  4U0G H;  3DOR A;  3TVU A;  1YG8 A;  5FUS A;  2IEX A;  1NZY B;  4QFE A;  2F9Y B;  2VSU C;  2Q35 A;  1XO6 A;  2FZS A;  4OMR A;  2CE3 A;  3PEA A;  3H81 A;  2A7S A;  1UYT A;  3OC7 A;  4EMP A;  4JFC A;  3T3W A;  5KDR B;  4FNB A;  2FBM A;  2VX2 A;  3R0O A;  2PPY A;  5DUF A;  3KTH A;  3BEZ A;  3TT7 A;  3LKE A;  3R9S A;  4J2U A;  4ZDE A;  5FIF A;  3H0Q A;  2GTR A;  3GMA A;  2X24 A;  5INF A;  1W2X A;  2ZL3 A;  1FCF A;  3HE2 A;  5DTW A;  4ZDF A;  4IZB A;  2DUB A;  1TG6 A;  4OLQ A;  2HW5 A;  3ZW8 A;  1WZ8 A;  1WDM A;  3MT6 A;  3P5M A;  5G1Q A;  3GF3 A;  3QXI A;  3KTK A;  3NJB A;  4ZDD A;  4FZW C;  4IZD A;  3IBB A;  1XNW A;  3SLL A;  4JCR A;  3JU1 A;  1Q51 A;  5INI A;  4JCQ A;  1UYR A;  4Q1I A;  3ZWA A;  5DU6 A;  5DU8 A;  4FB8 A;  2CBY A;  2J5G D;  2J5I A;  5HUQ A;  3TV5 A;  3K8X A;  5DZK H;  2PG8 A;  3N6R B;  1XNY A;  3H0U A;  3FDU A; 
#chains in the Genus database with same CATH homology
 5C9G A;  4QII A;  4I52 A;  2BZR A;  2ZQQ A;  5DTP A;  1OD2 A;  3V5I A;  2VSS F;  3K50 A;  4IZC A;  3G64 A;  1N6E A;  3P2L A;  4MXI A;  5G1S A;  4JCT A;  3Q7H A;  4GHN A;  1UYV A;  1MJ3 A;  5MGB A;  2VSU E;  5DL1 A;  2VSS A;  2J5I B;  3PZK A;  3U9T B;  4NNQ A;  3TZ3 A;  4MOU A;  3TRR A;  3OME A;  5ING A;  2Q34 A;  4FZW A;  1DCI A;  2A7K A;  2UZF A;  4FN7 A;  4ZDB A;  4JWV A;  4K2N A;  4U18 A;  4Z0M A;  1N6F A;  2F6I A;  3T8B A;  1FC6 A;  1HNU A;  3TLF A;  3ISA A;  4F47 A;  1SG4 A;  1HZD A;  5JBW A;  1EY3 A;  2QQ3 A;  3WG5 A;  3HLN 1;  4JSB A;  5E0S A;  2F6Q A;  1ON9 A;  3SWX A;  3ZWB A;  4KD6 A;  5DU4 A;  3MYB A;  4U1A A;  4JOT A;  3HP0 A;  3Q0G A;  5IKL B;  2J5I I;  1PIX A;  4GM2 A;  3RST A;  4HDT A;  1Q52 A;  3BF0 A;  3L3S A;  3BPP A;  4WCZ A;  4G2R A;  1EF8 A;  3IAV A;  3Q1T A;  2YJG A;  1WDK A;  3IB9 A;  1UYS A;  5JBX A;  3KTG A;  5G1R A;  3BPT A;  3M6M A;  2D3T A;  3LAO A;  4EML A;  3R9T A;  2Q2X A;  3DJA A;  4U0G A;  1PJH A;  2A81 A;  2FW2 A;  3U9S B;  4B3J A;  3QKA A;  3H0J A;  3RRV A;  3QWD A;  4RYF A;  5E0N X;  3R9Q A;  1ON3 A;  3T8A A;  1OD4 A;  1N6D A;  3H02 A;  4JYJ A;  4ELS A;  1NZY A;  3TDC A;  4ZU2 A;  2F9Y A;  3GF7 A;  2WTB A;  3T88 A;  1FC9 A;  1XX4 A;  5DUC A;  4DI1 A;  1HNO A;  3RSI A;  3GLM A;  4JJT A;  4L6W A;  1UIY A;  1RJM A;  4RCN A;  3M6N A;  3P85 A;  4HNK A;  3ST9 A;  3QYR A;  4HC8 A;  4WZ8 B;  3ZWC A;  3MOY A;  4OG1 A;  2EJ5 A;  5DKP A;  3QRE A;  4B3H A;  2VRE A;  1FC7 A;  1K32 A;  3U9R B;  2ZQR A;  1O8U A;  4KPK A;  1J7X A;  3PGQ A;  3KQF A;  4RYF H;  1TYF A;  3T89 A;  3FF6 A;  4FND A;  4FN8 A;  5DZK A;  4JVT A;  2VSS E;  4ZDC A;  2ZL2 A;  4U0H A;  3H0S A;  3V5E A;  2J5G A;  3Q0J A;  4EMM A;  2ZL0 A;  3QMJ A;  2F9I A;  4Q0G A;  4KNP A;  2DEO A;  4FJW D;  5CTB A;  3GKB A;  1X0U A;  2W3P A;  1EF9 A;  5C90 A;  4JCS A;  3VIV A;  1K39 A;  1VRG A;  4I42 A;  4WYO B;  3HIN A;  4K29 A;  1JXZ A;  2NP9 A;  2VSU F;  3I47 A;  4ELX A;  3KTI A;  3HRX A;  5CTC A;  4NEK A;  1XNV A;  2C8T A;  4MI2 A;  4ASI A;  4I4Z A;  2J5S A;  2VSU A;  2F9I B;  3TT6 A;  3NJD A;  4JYL A;  2X58 A;  1YG6 A;  4L8K A;  5E0S H;  3ZW9 A;  3TVW A;  3KTJ A;  4NAR A;  4QIJ A;  4LK5 A;  2ZL4 A;  1WDL A;  4KWB A;  5KDR A;  3MFM A;  1DUB A;  3QK8 A;  4YLH A;  3STA A;  5KJP A;  4ELW A;  3OT6 A;  1SZO A;  4K3W A;  1RJN A;  4B3I A;  2PBP A;  3R6H A;  3PE8 A;  3QXZ A;  1Y7O A;  4U19 A;  4U0G H;  3DOR A;  3TVU A;  1YG8 A;  5FUS A;  2IEX A;  1NZY B;  4QFE A;  2F9Y B;  2VSU C;  2Q35 A;  1XO6 A;  2FZS A;  4OMR A;  2CE3 A;  3PEA A;  3H81 A;  2A7S A;  1UYT A;  3OC7 A;  4EMP A;  4JFC A;  3T3W A;  5KDR B;  4FNB A;  2FBM A;  2VX2 A;  3R0O A;  2PPY A;  5DUF A;  3KTH A;  3BEZ A;  3TT7 A;  3LKE A;  3R9S A;  4J2U A;  4ZDE A;  5FIF A;  3H0Q A;  2GTR A;  3GMA A;  2X24 A;  5INF A;  1W2X A;  2ZL3 A;  1FCF A;  3HE2 A;  5DTW A;  4ZDF A;  4IZB A;  2DUB A;  1TG6 A;  4OLQ A;  2HW5 A;  3ZW8 A;  1WZ8 A;  1WDM A;  3MT6 A;  3P5M A;  5G1Q A;  3GF3 A;  3QXI A;  3KTK A;  3NJB A;  4ZDD A;  4FZW C;  4IZD A;  3IBB A;  1XNW A;  3SLL A;  4JCR A;  3JU1 A;  1Q51 A;  5INI A;  4JCQ A;  1UYR A;  4Q1I A;  3ZWA A;  5DU6 A;  5DU8 A;  4FB8 A;  2CBY A;  2J5G D;  2J5I A;  5HUQ A;  3TV5 A;  3K8X A;  5DZK H;  2PG8 A;  3N6R B;  1XNY A;  3H0U A;  3FDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...