3KTIA

Structure of clpp in complex with adep1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktiA00
4OMRA 4ASIA 1ON9A 2ZL4A 1XNWA 2VSSA 2J5GA 3H0SA 1UIYA 3TT7A 1FC7A 4OLQA 4DI1A 3LKEA 4Q1IA 1Q52A 5DZKH 1XX4A 2C8TA 3KTHA 4FN8A 1PJHA 1XNYA 2FW2A 2ZQRA 3DJAA 3U9SB 4FN7A 3TRRA 3PZKA 3M6MA 3QREA 4ELSA 1X0UA 4RYFH 4JOTA 4L8KA 5INFA 3P5MA 3ZWCA 3GMAA 3Q7HA 1UYRA 5DU4A 3R6HA 1K32A 3V5IA 3KQFA 1RJNA 4U0GA 1DCIA 5DZKA 1Q51A 4JYJA 3BPPA 1FC6A 5DKPA 4FJWD 3H02A 2J5IB 4FB8A 2F9YA 3OT6A 4NNQA 2D3TA 3ST9A 4HC8A 5INGA 4B3HA 5C9GA 5JBXA 2ZL2A 3L3SA 2CE3A 4ZDFA 4YLHA 3M6NA 3NJDA 3QXZA 5DL1A 1UYTA 3JU1A 5DUFA 3MT6A 4WCZA 2X58A 2VSUF 4JCTA 2X24A 3QYRA 4JVTA 4KNPA 5DTWA 1WDLA 4RCNA 2J5SA 4JFCA 4U19A 1PIXA 2VSSF 3H0JA 3IB9A 1UYSA 2UZFA 4LK5A 2A81A 4OG1A 3GKBA 2VSUE 4K29A 3H81A 5FUSA 1J7XA 1YG6A 2Q35A 2VSSE 1DUBA 4WYOB 1FCFA 1XNVA 3FDUA 4G2RA 4ZU2A 4ELWA 3H0UA 1TG6A 1EF9A 2ZL0A 4HNKA 3ZW8A 2W3PA 1SG4A 3IAVA 1NZYB 3HP0A 4ELXA 3FF6A 3K50A 2A7SA 5KDRA 4L6WA 3ZWAA 4JCSA 3VIVA 2BZRA 3IBBA 1FC9A 4B3IA 2Q34A 4IZBA 2ZQQA 4JYLA 2EJ5A 2VREA 3Q0GA 3OMEA 5FIFA 4JSBA 1WDKA 3MOYA 1SZOA 1VRGA 3QXIA 1EY3A 5G1RA 1RJMA 5DU8A 3NJBA 3HLN1 2WTBA 2J5II 3WG5A 2F9YB 3R9TA 5E0NX 5KJPA 4MXIA 2ZL3A 1ON3A 3SWXA 1HNUA 4Q0GA 4JCRA 4GHNA 3KTKA 4EMMA 4ZDEA 3ZW9A 1MJ3A 3Q1TA 3HE2A 1JXZA 3LAOA 2DUBA 3QMJA 5DUCA 5CTBA 1EF8A 3QWDA 3BF0A 3T88A 1Y7OA 4I4ZA 1N6EA 1XO6A 3QKAA 3RSIA 3I47A 4MOUA 4ZDBA 4K3WA 2HW5A 4EMLA 4B3JA 3BEZA 3TVUA 3RSTA 3TZ3A 3H0QA 1N6FA 2Q2XA 3PGQA 1TYFA 3T89A 3R9QA 3G64A 3KTIA 3N6RB 4WZ8B 2IEXA 5INIA 3GLMA 3TV5A 2F9IB 2GTRA 4JJTA 3PEAA 4QFEA 1K39A 2F9IA 4NEKA 5G1SA 4IZCA 3GF3A 3MFMA 3U9RB 1YG8A 4FZWC 5CTCA 1UYVA 2VSUA 4U18A 3OC7A 5MGBA 4ZDDA 4I52A 3T3WA 4KD6A 3PE8A 3T8AA 3TLFA 4QIJA 2F6QA 4U0GH 3KTGA 3GF7A 3HRXA 5C90A 3TT6A 2F6IA 3ISAA 4F47A 4IZDA 4FNBA 3KTJA 1WDMA 3TDCA 4JWVA 5E0SH 1HZDA 5IKLB 2J5IA 4JCQA 1NZYA 2FBMA 4FNDA 1W2XA 1HNOA 4EMPA 3TVWA 3QK8A 3DORA 4QIIA 4KWBA 3ZWBA 3MYBA 2PPYA 4K2NA 5DTPA 1O8UA 4ZDCA 2DEOA 3U9TB 2FZSA 2VX2A 4MI2A 3V5EA 3P2LA 5KDRB 2CBYA 3K8XA 5E0SA 3Q0JA 2NP9A 4I42A 1OD2A 2PBPA 4GM2A 5JBWA 4KPKA 2PG8A 3SLLA 5DU6A 3R0OA 4RYFA 2VSUC 3STAA 3R9SA 4U0HA 3HINA 2A7KA 1N6DA 4FZWA 2QQ3A 3P85A 3RRVA 4Z0MA 4U1AA 1WZ8A 1OD4A 5G1QA 3T8BA 2J5GD
chains in the Genus database with same CATH superfamily
4OMRA 4ASIA 1ON9A 2ZL4A 1XNWA 2VSSA 2J5GA 3H0SA 1UIYA 3TT7A 1FC7A 4OLQA 4DI1A 3LKEA 4Q1IA 1Q52A 5DZKH 1XX4A 2C8TA 3KTHA 4FN8A 1PJHA 1XNYA 2FW2A 2ZQRA 3DJAA 3U9SB 4FN7A 3TRRA 3PZKA 3M6MA 3QREA 4ELSA 1X0UA 4RYFH 4JOTA 4L8KA 5INFA 3P5MA 3ZWCA 3GMAA 3Q7HA 1UYRA 5DU4A 3R6HA 1K32A 3V5IA 3KQFA 1RJNA 4U0GA 1DCIA 5DZKA 1Q51A 4JYJA 3BPPA 1FC6A 5DKPA 4FJWD 3H02A 2J5IB 4FB8A 2F9YA 3OT6A 4NNQA 2D3TA 3ST9A 4HC8A 5INGA 4B3HA 5C9GA 5JBXA 2ZL2A 3L3SA 2CE3A 4ZDFA 4YLHA 3M6NA 3NJDA 3QXZA 5DL1A 1UYTA 3JU1A 2YJGA 5DUFA 3MT6A 4WCZA 2X58A 2VSUF 4JCTA 2X24A 3QYRA 4JVTA 4KNPA 5DTWA 1WDLA 4RCNA 2J5SA 4JFCA 4U19A 1PIXA 2VSSF 3H0JA 3IB9A 1UYSA 2UZFA 4LK5A 2A81A 4OG1A 3GKBA 2VSUE 4K29A 3H81A 5FUSA 1J7XA 1YG6A 2Q35A 2VSSE 1DUBA 4WYOB 1FCFA 1XNVA 3FDUA 4G2RA 4J2UA 4ZU2A 4ELWA 3H0UA 1TG6A 1EF9A 2ZL0A 4HNKA 3ZW8A 2W3PA 1SG4A 3IAVA 1NZYB 3HP0A 4ELXA 3FF6A 3BPTA 3K50A 2A7SA 5KDRA 4L6WA 3ZWAA 4JCSA 3VIVA 2BZRA 3IBBA 1FC9A 4B3IA 2Q34A 4IZBA 2ZQQA 4JYLA 2EJ5A 2VREA 3Q0GA 3OMEA 5FIFA 4JSBA 1WDKA 3MOYA 1SZOA 1VRGA 3QXIA 1EY3A 5G1RA 1RJMA 5DU8A 3NJBA 3HLN1 2WTBA 2J5II 3WG5A 2F9YB 3R9TA 5E0NX 5KJPA 4MXIA 2ZL3A 1ON3A 3SWXA 1HNUA 4Q0GA 4JCRA 4GHNA 3KTKA 4EMMA 4ZDEA 3ZW9A 1MJ3A 3Q1TA 3HE2A 1JXZA 3LAOA 2DUBA 3QMJA 5DUCA 5CTBA 1EF8A 3QWDA 3BF0A 3T88A 1Y7OA 4I4ZA 1N6EA 1XO6A 3QKAA 3RSIA 3I47A 4MOUA 4ZDBA 4K3WA 2HW5A 4EMLA 4B3JA 3BEZA 3TVUA 3RSTA 3TZ3A 3H0QA 1N6FA 2Q2XA 3PGQA 1TYFA 3T89A 3R9QA 3G64A 3KTIA 3N6RB 4WZ8B 2IEXA 5INIA 3GLMA 3TV5A 2F9IB 2GTRA 4JJTA 3PEAA 4QFEA 1K39A 2F9IA 4NEKA 5G1SA 4HDTA 4IZCA 3GF3A 3MFMA 3U9RB 1YG8A 4FZWC 5CTCA 1UYVA 2VSUA 4U18A 3OC7A 5MGBA 4ZDDA 4I52A 3T3WA 4KD6A 3PE8A 3T8AA 3TLFA 4QIJA 2F6QA 4U0GH 3KTGA 3GF7A 3HRXA 5C90A 3TT6A 2F6IA 3ISAA 4F47A 4IZDA 4FNBA 3KTJA 1WDMA 3TDCA 4JWVA 5E0SH 1HZDA 5IKLB 2J5IA 4JCQA 1NZYA 2FBMA 4FNDA 1W2XA 1HNOA 4EMPA 3TVWA 3QK8A 3DORA 4QIIA 4KWBA 3ZWBA 3MYBA 2PPYA 4K2NA 5DTPA 1O8UA 4ZDCA 2DEOA 3U9TB 2FZSA 2VX2A 4MI2A 3V5EA 3P2LA 5KDRB 2CBYA 3K8XA 5E0SA 3Q0JA 2NP9A 4I42A 1OD2A 2PBPA 4GM2A 5JBWA 4KPKA 2PG8A 3SLLA 5DU6A 3R0OA 4NARA 4RYFA 2VSUC 3STAA 3R9SA 4U0HA 3HINA 2A7KA 1N6DA 4FZWA 2QQ3A 3P85A 3RRVA 4Z0MA 4U1AA 1WZ8A 1OD4A 5HUQA 5G1QA 3T8BA 2J5GD
chains in the Genus database with same CATH topology
4OMRA 4ASIA 1ON9A 2ZL4A 1XNWA 2VSSA 2J5GA 3H0SA 1UIYA 3TT7A 1FC7A 4OLQA 4DI1A 3LKEA 4Q1IA 1Q52A 5DZKH 1XX4A 2C8TA 3KTHA 4FN8A 1PJHA 1XNYA 2FW2A 2ZQRA 3DJAA 3U9SB 4FN7A 3TRRA 3PZKA 3M6MA 3QREA 4ELSA 1X0UA 4RYFH 4JOTA 4L8KA 5INFA 3P5MA 3ZWCA 3GMAA 3Q7HA 1UYRA 5DU4A 3R6HA 1K32A 3V5IA 3KQFA 1RJNA 4U0GA 1DCIA 5DZKA 1Q51A 4JYJA 3BPPA 1FC6A 5DKPA 4FJWD 3H02A 2J5IB 4FB8A 2F9YA 3OT6A 4NNQA 2D3TA 3ST9A 4HC8A 5INGA 4B3HA 5C9GA 5JBXA 2ZL2A 3L3SA 2CE3A 4ZDFA 4YLHA 3M6NA 3NJDA 3QXZA 5DL1A 1UYTA 3JU1A 2YJGA 5DUFA 3MT6A 4WCZA 2X58A 2VSUF 4JCTA 2X24A 3QYRA 4JVTA 4KNPA 5DTWA 1WDLA 4RCNA 2J5SA 4JFCA 4U19A 1PIXA 2VSSF 3H0JA 3IB9A 1UYSA 2UZFA 4LK5A 2A81A 4OG1A 3GKBA 2VSUE 4K29A 3H81A 5FUSA 1J7XA 1YG6A 2Q35A 2VSSE 1DUBA 4WYOB 1FCFA 1XNVA 3FDUA 4G2RA 4J2UA 4ZU2A 4ELWA 3H0UA 1TG6A 1EF9A 2ZL0A 4HNKA 3ZW8A 2W3PA 1SG4A 3IAVA 1NZYB 3HP0A 4ELXA 3FF6A 3BPTA 3K50A 2A7SA 5KDRA 4L6WA 3ZWAA 4JCSA 3VIVA 2BZRA 3IBBA 1FC9A 4B3IA 2Q34A 4IZBA 2ZQQA 4JYLA 2EJ5A 2VREA 3Q0GA 3OMEA 5FIFA 4JSBA 1WDKA 3MOYA 1SZOA 1VRGA 3QXIA 1EY3A 5G1RA 1RJMA 5DU8A 3NJBA 3HLN1 2WTBA 2J5II 3WG5A 2F9YB 3R9TA 5E0NX 5KJPA 4MXIA 2ZL3A 1ON3A 3SWXA 1HNUA 4Q0GA 4JCRA 4GHNA 3KTKA 4EMMA 4ZDEA 3ZW9A 1MJ3A 3Q1TA 3HE2A 1JXZA 3LAOA 2DUBA 3QMJA 5DUCA 5CTBA 1EF8A 3QWDA 3BF0A 3T88A 1Y7OA 4I4ZA 1N6EA 1XO6A 3QKAA 3RSIA 3I47A 4MOUA 4ZDBA 4K3WA 2HW5A 4EMLA 4B3JA 3BEZA 3TVUA 3RSTA 3TZ3A 3H0QA 1N6FA 2Q2XA 3PGQA 1TYFA 3T89A 3R9QA 3G64A 3KTIA 3N6RB 4WZ8B 2IEXA 5INIA 3GLMA 3TV5A 2F9IB 2GTRA 4JJTA 3PEAA 4QFEA 1K39A 2F9IA 4NEKA 5G1SA 4HDTA 4IZCA 3GF3A 3MFMA 3U9RB 1YG8A 4FZWC 5CTCA 1UYVA 2VSUA 4U18A 3OC7A 5MGBA 4ZDDA 4I52A 3T3WA 4KD6A 3PE8A 3T8AA 3TLFA 4QIJA 2F6QA 4U0GH 3KTGA 3GF7A 3HRXA 5C90A 3TT6A 2F6IA 3ISAA 4F47A 4IZDA 4FNBA 3KTJA 1WDMA 3TDCA 4JWVA 5E0SH 1HZDA 5IKLB 2J5IA 4JCQA 1NZYA 2FBMA 4FNDA 1W2XA 1HNOA 4EMPA 3TVWA 3QK8A 3DORA 4QIIA 4KWBA 3ZWBA 3MYBA 2PPYA 4K2NA 5DTPA 1O8UA 4ZDCA 2DEOA 3U9TB 2FZSA 2VX2A 4MI2A 3V5EA 3P2LA 5KDRB 2CBYA 3K8XA 5E0SA 3Q0JA 2NP9A 4I42A 1OD2A 2PBPA 4GM2A 5JBWA 4KPKA 2PG8A 3SLLA 5DU6A 3R0OA 4NARA 4RYFA 2VSUC 3STAA 3R9SA 4U0HA 3HINA 2A7KA 1N6DA 4FZWA 2QQ3A 3P85A 3RRVA 4Z0MA 4U1AA 1WZ8A 1OD4A 5HUQA 5G1QA 3T8BA 2J5GD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMR A;  4ASI A;  1ON9 A;  2ZL4 A;  1XNW A;  2VSS A;  2J5G A;  3H0S A;  1UIY A;  3TT7 A;  1FC7 A;  4OLQ A;  4DI1 A;  3LKE A;  4Q1I A;  1Q52 A;  5DZK H;  1XX4 A;  2C8T A;  3KTH A;  4FN8 A;  1PJH A;  1XNY A;  2FW2 A;  2ZQR A;  3DJA A;  3U9S B;  4FN7 A;  3TRR A;  3PZK A;  3M6M A;  3QRE A;  4ELS A;  1X0U A;  4RYF H;  4JOT A;  4L8K A;  5INF A;  3P5M A;  3ZWC A;  3GMA A;  3Q7H A;  1UYR A;  5DU4 A;  3R6H A;  1K32 A;  3V5I A;  3KQF A;  1RJN A;  4U0G A;  1DCI A;  5DZK A;  1Q51 A;  4JYJ A;  3BPP A;  1FC6 A;  5DKP A;  4FJW D;  3H02 A;  2J5I B;  4FB8 A;  2F9Y A;  3OT6 A;  4NNQ A;  2D3T A;  3ST9 A;  4HC8 A;  5ING A;  4B3H A;  5C9G A;  5JBX A;  2ZL2 A;  3L3S A;  2CE3 A;  4ZDF A;  4YLH A;  3M6N A;  3NJD A;  3QXZ A;  5DL1 A;  1UYT A;  3JU1 A;  5DUF A;  3MT6 A;  4WCZ A;  2X58 A;  2VSU F;  4JCT A;  2X24 A;  3QYR A;  4JVT A;  4KNP A;  5DTW A;  1WDL A;  4RCN A;  2J5S A;  4JFC A;  4U19 A;  1PIX A;  2VSS F;  3H0J A;  3IB9 A;  1UYS A;  2UZF A;  4LK5 A;  2A81 A;  4OG1 A;  3GKB A;  2VSU E;  4K29 A;  3H81 A;  5FUS A;  1J7X A;  1YG6 A;  2Q35 A;  2VSS E;  1DUB A;  4WYO B;  1FCF A;  1XNV A;  3FDU A;  4G2R A;  4ZU2 A;  4ELW A;  3H0U A;  1TG6 A;  1EF9 A;  2ZL0 A;  4HNK A;  3ZW8 A;  2W3P A;  1SG4 A;  3IAV A;  1NZY B;  3HP0 A;  4ELX A;  3FF6 A;  3K50 A;  2A7S A;  5KDR A;  4L6W A;  3ZWA A;  4JCS A;  3VIV A;  2BZR A;  3IBB A;  1FC9 A;  4B3I A;  2Q34 A;  4IZB A;  2ZQQ A;  4JYL A;  2EJ5 A;  2VRE A;  3Q0G A;  3OME A;  5FIF A;  4JSB A;  1WDK A;  3MOY A;  1SZO A;  1VRG A;  3QXI A;  1EY3 A;  5G1R A;  1RJM A;  5DU8 A;  3NJB A;  3HLN 1;  2WTB A;  2J5I I;  3WG5 A;  2F9Y B;  3R9T A;  5E0N X;  5KJP A;  4MXI A;  2ZL3 A;  1ON3 A;  3SWX A;  1HNU A;  4Q0G A;  4JCR A;  4GHN A;  3KTK A;  4EMM A;  4ZDE A;  3ZW9 A;  1MJ3 A;  3Q1T A;  3HE2 A;  1JXZ A;  3LAO A;  2DUB A;  3QMJ A;  5DUC A;  5CTB A;  1EF8 A;  3QWD A;  3BF0 A;  3T88 A;  1Y7O A;  4I4Z A;  1N6E A;  1XO6 A;  3QKA A;  3RSI A;  3I47 A;  4MOU A;  4ZDB A;  4K3W A;  2HW5 A;  4EML A;  4B3J A;  3BEZ A;  3TVU A;  3RST A;  3TZ3 A;  3H0Q A;  1N6F A;  2Q2X A;  3PGQ A;  1TYF A;  3T89 A;  3R9Q A;  3G64 A;  3KTI A;  3N6R B;  4WZ8 B;  2IEX A;  5INI A;  3GLM A;  3TV5 A;  2F9I B;  2GTR A;  4JJT A;  3PEA A;  4QFE A;  1K39 A;  2F9I A;  4NEK A;  5G1S A;  4IZC A;  3GF3 A;  3MFM A;  3U9R B;  1YG8 A;  4FZW C;  5CTC A;  1UYV A;  2VSU A;  4U18 A;  3OC7 A;  5MGB A;  4ZDD A;  4I52 A;  3T3W A;  4KD6 A;  3PE8 A;  3T8A A;  3TLF A;  4QIJ A;  2F6Q A;  4U0G H;  3KTG A;  3GF7 A;  3HRX A;  5C90 A;  3TT6 A;  2F6I A;  3ISA A;  4F47 A;  4IZD A;  4FNB A;  3KTJ A;  1WDM A;  3TDC A;  4JWV A;  5E0S H;  1HZD A;  5IKL B;  2J5I A;  4JCQ A;  1NZY A;  2FBM A;  4FND A;  1W2X A;  1HNO A;  4EMP A;  3TVW A;  3QK8 A;  3DOR A;  4QII A;  4KWB A;  3ZWB A;  3MYB A;  2PPY A;  4K2N A;  5DTP A;  1O8U A;  4ZDC A;  2DEO A;  3U9T B;  2FZS A;  2VX2 A;  4MI2 A;  3V5E A;  3P2L A;  5KDR B;  2CBY A;  3K8X A;  5E0S A;  3Q0J A;  2NP9 A;  4I42 A;  1OD2 A;  2PBP A;  4GM2 A;  5JBW A;  4KPK A;  2PG8 A;  3SLL A;  5DU6 A;  3R0O A;  4RYF A;  2VSU C;  3STA A;  3R9S A;  4U0H A;  3HIN A;  2A7K A;  1N6D A;  4FZW A;  2QQ3 A;  3P85 A;  3RRV A;  4Z0M A;  4U1A A;  1WZ8 A;  1OD4 A;  5G1Q A;  3T8B A;  2J5G D; 
#chains in the Genus database with same CATH topology
 4OMR A;  4ASI A;  1ON9 A;  2ZL4 A;  1XNW A;  2VSS A;  2J5G A;  3H0S A;  1UIY A;  3TT7 A;  1FC7 A;  4OLQ A;  4DI1 A;  3LKE A;  4Q1I A;  1Q52 A;  5DZK H;  1XX4 A;  2C8T A;  3KTH A;  4FN8 A;  1PJH A;  1XNY A;  2FW2 A;  2ZQR A;  3DJA A;  3U9S B;  4FN7 A;  3TRR A;  3PZK A;  3M6M A;  3QRE A;  4ELS A;  1X0U A;  4RYF H;  4JOT A;  4L8K A;  5INF A;  3P5M A;  3ZWC A;  3GMA A;  3Q7H A;  1UYR A;  5DU4 A;  3R6H A;  1K32 A;  3V5I A;  3KQF A;  1RJN A;  4U0G A;  1DCI A;  5DZK A;  1Q51 A;  4JYJ A;  3BPP A;  1FC6 A;  5DKP A;  4FJW D;  3H02 A;  2J5I B;  4FB8 A;  2F9Y A;  3OT6 A;  4NNQ A;  2D3T A;  3ST9 A;  4HC8 A;  5ING A;  4B3H A;  5C9G A;  5JBX A;  2ZL2 A;  3L3S A;  2CE3 A;  4ZDF A;  4YLH A;  3M6N A;  3NJD A;  3QXZ A;  5DL1 A;  1UYT A;  3JU1 A;  2YJG A;  5DUF A;  3MT6 A;  4WCZ A;  2X58 A;  2VSU F;  4JCT A;  2X24 A;  3QYR A;  4JVT A;  4KNP A;  5DTW A;  1WDL A;  4RCN A;  2J5S A;  4JFC A;  4U19 A;  1PIX A;  2VSS F;  3H0J A;  3IB9 A;  1UYS A;  2UZF A;  4LK5 A;  2A81 A;  4OG1 A;  3GKB A;  2VSU E;  4K29 A;  3H81 A;  5FUS A;  1J7X A;  1YG6 A;  2Q35 A;  2VSS E;  1DUB A;  4WYO B;  1FCF A;  1XNV A;  3FDU A;  4G2R A;  4J2U A;  4ZU2 A;  4ELW A;  3H0U A;  1TG6 A;  1EF9 A;  2ZL0 A;  4HNK A;  3ZW8 A;  2W3P A;  1SG4 A;  3IAV A;  1NZY B;  3HP0 A;  4ELX A;  3FF6 A;  3BPT A;  3K50 A;  2A7S A;  5KDR A;  4L6W A;  3ZWA A;  4JCS A;  3VIV A;  2BZR A;  3IBB A;  1FC9 A;  4B3I A;  2Q34 A;  4IZB A;  2ZQQ A;  4JYL A;  2EJ5 A;  2VRE A;  3Q0G A;  3OME A;  5FIF A;  4JSB A;  1WDK A;  3MOY A;  1SZO A;  1VRG A;  3QXI A;  1EY3 A;  5G1R A;  1RJM A;  5DU8 A;  3NJB A;  3HLN 1;  2WTB A;  2J5I I;  3WG5 A;  2F9Y B;  3R9T A;  5E0N X;  5KJP A;  4MXI A;  2ZL3 A;  1ON3 A;  3SWX A;  1HNU A;  4Q0G A;  4JCR A;  4GHN A;  3KTK A;  4EMM A;  4ZDE A;  3ZW9 A;  1MJ3 A;  3Q1T A;  3HE2 A;  1JXZ A;  3LAO A;  2DUB A;  3QMJ A;  5DUC A;  5CTB A;  1EF8 A;  3QWD A;  3BF0 A;  3T88 A;  1Y7O A;  4I4Z A;  1N6E A;  1XO6 A;  3QKA A;  3RSI A;  3I47 A;  4MOU A;  4ZDB A;  4K3W A;  2HW5 A;  4EML A;  4B3J A;  3BEZ A;  3TVU A;  3RST A;  3TZ3 A;  3H0Q A;  1N6F A;  2Q2X A;  3PGQ A;  1TYF A;  3T89 A;  3R9Q A;  3G64 A;  3KTI A;  3N6R B;  4WZ8 B;  2IEX A;  5INI A;  3GLM A;  3TV5 A;  2F9I B;  2GTR A;  4JJT A;  3PEA A;  4QFE A;  1K39 A;  2F9I A;  4NEK A;  5G1S A;  4HDT A;  4IZC A;  3GF3 A;  3MFM A;  3U9R B;  1YG8 A;  4FZW C;  5CTC A;  1UYV A;  2VSU A;  4U18 A;  3OC7 A;  5MGB A;  4ZDD A;  4I52 A;  3T3W A;  4KD6 A;  3PE8 A;  3T8A A;  3TLF A;  4QIJ A;  2F6Q A;  4U0G H;  3KTG A;  3GF7 A;  3HRX A;  5C90 A;  3TT6 A;  2F6I A;  3ISA A;  4F47 A;  4IZD A;  4FNB A;  3KTJ A;  1WDM A;  3TDC A;  4JWV A;  5E0S H;  1HZD A;  5IKL B;  2J5I A;  4JCQ A;  1NZY A;  2FBM A;  4FND A;  1W2X A;  1HNO A;  4EMP A;  3TVW A;  3QK8 A;  3DOR A;  4QII A;  4KWB A;  3ZWB A;  3MYB A;  2PPY A;  4K2N A;  5DTP A;  1O8U A;  4ZDC A;  2DEO A;  3U9T B;  2FZS A;  2VX2 A;  4MI2 A;  3V5E A;  3P2L A;  5KDR B;  2CBY A;  3K8X A;  5E0S A;  3Q0J A;  2NP9 A;  4I42 A;  1OD2 A;  2PBP A;  4GM2 A;  5JBW A;  4KPK A;  2PG8 A;  3SLL A;  5DU6 A;  3R0O A;  4NAR A;  4RYF A;  2VSU C;  3STA A;  3R9S A;  4U0H A;  3HIN A;  2A7K A;  1N6D A;  4FZW A;  2QQ3 A;  3P85 A;  3RRV A;  4Z0M A;  4U1A A;  1WZ8 A;  1OD4 A;  5HUQ A;  5G1Q A;  3T8B A;  2J5G D; 
#chains in the Genus database with same CATH homology
 4OMR A;  4ASI A;  1ON9 A;  2ZL4 A;  1XNW A;  2VSS A;  2J5G A;  3H0S A;  1UIY A;  3TT7 A;  1FC7 A;  4OLQ A;  4DI1 A;  3LKE A;  4Q1I A;  1Q52 A;  5DZK H;  1XX4 A;  2C8T A;  3KTH A;  4FN8 A;  1PJH A;  1XNY A;  2FW2 A;  2ZQR A;  3DJA A;  3U9S B;  4FN7 A;  3TRR A;  3PZK A;  3M6M A;  3QRE A;  4ELS A;  1X0U A;  4RYF H;  4JOT A;  4L8K A;  5INF A;  3P5M A;  3ZWC A;  3GMA A;  3Q7H A;  1UYR A;  5DU4 A;  3R6H A;  1K32 A;  3V5I A;  3KQF A;  1RJN A;  4U0G A;  1DCI A;  5DZK A;  1Q51 A;  4JYJ A;  3BPP A;  1FC6 A;  5DKP A;  4FJW D;  3H02 A;  2J5I B;  4FB8 A;  2F9Y A;  3OT6 A;  4NNQ A;  2D3T A;  3ST9 A;  4HC8 A;  5ING A;  4B3H A;  5C9G A;  5JBX A;  2ZL2 A;  3L3S A;  2CE3 A;  4ZDF A;  4YLH A;  3M6N A;  3NJD A;  3QXZ A;  5DL1 A;  1UYT A;  3JU1 A;  2YJG A;  5DUF A;  3MT6 A;  4WCZ A;  2X58 A;  2VSU F;  4JCT A;  2X24 A;  3QYR A;  4JVT A;  4KNP A;  5DTW A;  1WDL A;  4RCN A;  2J5S A;  4JFC A;  4U19 A;  1PIX A;  2VSS F;  3H0J A;  3IB9 A;  1UYS A;  2UZF A;  4LK5 A;  2A81 A;  4OG1 A;  3GKB A;  2VSU E;  4K29 A;  3H81 A;  5FUS A;  1J7X A;  1YG6 A;  2Q35 A;  2VSS E;  1DUB A;  4WYO B;  1FCF A;  1XNV A;  3FDU A;  4G2R A;  4J2U A;  4ZU2 A;  4ELW A;  3H0U A;  1TG6 A;  1EF9 A;  2ZL0 A;  4HNK A;  3ZW8 A;  2W3P A;  1SG4 A;  3IAV A;  1NZY B;  3HP0 A;  4ELX A;  3FF6 A;  3BPT A;  3K50 A;  2A7S A;  5KDR A;  4L6W A;  3ZWA A;  4JCS A;  3VIV A;  2BZR A;  3IBB A;  1FC9 A;  4B3I A;  2Q34 A;  4IZB A;  2ZQQ A;  4JYL A;  2EJ5 A;  2VRE A;  3Q0G A;  3OME A;  5FIF A;  4JSB A;  1WDK A;  3MOY A;  1SZO A;  1VRG A;  3QXI A;  1EY3 A;  5G1R A;  1RJM A;  5DU8 A;  3NJB A;  3HLN 1;  2WTB A;  2J5I I;  3WG5 A;  2F9Y B;  3R9T A;  5E0N X;  5KJP A;  4MXI A;  2ZL3 A;  1ON3 A;  3SWX A;  1HNU A;  4Q0G A;  4JCR A;  4GHN A;  3KTK A;  4EMM A;  4ZDE A;  3ZW9 A;  1MJ3 A;  3Q1T A;  3HE2 A;  1JXZ A;  3LAO A;  2DUB A;  3QMJ A;  5DUC A;  5CTB A;  1EF8 A;  3QWD A;  3BF0 A;  3T88 A;  1Y7O A;  4I4Z A;  1N6E A;  1XO6 A;  3QKA A;  3RSI A;  3I47 A;  4MOU A;  4ZDB A;  4K3W A;  2HW5 A;  4EML A;  4B3J A;  3BEZ A;  3TVU A;  3RST A;  3TZ3 A;  3H0Q A;  1N6F A;  2Q2X A;  3PGQ A;  1TYF A;  3T89 A;  3R9Q A;  3G64 A;  3KTI A;  3N6R B;  4WZ8 B;  2IEX A;  5INI A;  3GLM A;  3TV5 A;  2F9I B;  2GTR A;  4JJT A;  3PEA A;  4QFE A;  1K39 A;  2F9I A;  4NEK A;  5G1S A;  4HDT A;  4IZC A;  3GF3 A;  3MFM A;  3U9R B;  1YG8 A;  4FZW C;  5CTC A;  1UYV A;  2VSU A;  4U18 A;  3OC7 A;  5MGB A;  4ZDD A;  4I52 A;  3T3W A;  4KD6 A;  3PE8 A;  3T8A A;  3TLF A;  4QIJ A;  2F6Q A;  4U0G H;  3KTG A;  3GF7 A;  3HRX A;  5C90 A;  3TT6 A;  2F6I A;  3ISA A;  4F47 A;  4IZD A;  4FNB A;  3KTJ A;  1WDM A;  3TDC A;  4JWV A;  5E0S H;  1HZD A;  5IKL B;  2J5I A;  4JCQ A;  1NZY A;  2FBM A;  4FND A;  1W2X A;  1HNO A;  4EMP A;  3TVW A;  3QK8 A;  3DOR A;  4QII A;  4KWB A;  3ZWB A;  3MYB A;  2PPY A;  4K2N A;  5DTP A;  1O8U A;  4ZDC A;  2DEO A;  3U9T B;  2FZS A;  2VX2 A;  4MI2 A;  3V5E A;  3P2L A;  5KDR B;  2CBY A;  3K8X A;  5E0S A;  3Q0J A;  2NP9 A;  4I42 A;  1OD2 A;  2PBP A;  4GM2 A;  5JBW A;  4KPK A;  2PG8 A;  3SLL A;  5DU6 A;  3R0O A;  4NAR A;  4RYF A;  2VSU C;  3STA A;  3R9S A;  4U0H A;  3HIN A;  2A7K A;  1N6D A;  4FZW A;  2QQ3 A;  3P85 A;  3RRV A;  4Z0M A;  4U1A A;  1WZ8 A;  1OD4 A;  5HUQ A;  5G1Q A;  3T8B A;  2J5G D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...