3KTJA

Structure of clpp in complex with adep2 in monoclinic crystal form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
b'DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktjA00
2W3PA 4I42A 1N6EA 2A7SA 2PBPA 1Q51A 4ZDBA 5E0SH 2A7KA 1JXZA 3KTKA 5C9GA 2DEOA 2ZL2A 4QIJA 2Q35A 1XNWA 4QIIA 3RRVA 3MYBA 3H0SA 3KQFA 1ON9A 4QFEA 3MOYA 3P85A 2F9YB 4JYJA 3ZWAA 5G1QA 1DUBA 4FB8A 1EY3A 5MGBA 3TT6A 3DJAA 3LKEA 2C8TA 2VSUF 3DORA 2NP9A 1PJHA 3N6RB 4KD6A 3LAOA 1YG8A 3P5MA 3TRRA 1UIYA 1WDMA 3R9SA 5CTCA 1UYSA 3QXZA 2QQ3A 4L6WA 3TVUA 5JBWA 3NJDA 3KTHA 3K50A 1VRGA 2D3TA 2F6QA 4JJTA 4JOTA 5IKLB 2J5II 2BZRA 3R9QA 1TG6A 2VSSA 5G1SA 3P2LA 5INFA 4JCQA 2J5SA 3H0QA 1K32A 3V5EA 3HLN1 2Q2XA 4ZDFA 4I4ZA 1ON3A 4I52A 4ZDDA 1HNOA 3TV5A 4ZDEA 3RSIA 3Q1TA 3ZW8A 3OC7A 3OT6A 4JVTA 1X0UA 4FN7A 3QMJA 1HNUA 4FNDA 2F9IA 4RYFA 2VSUE 3HRXA 2J5IA 4IZCA 4JFCA 4EMMA 3G64A 1HZDA 3FDUA 3T89A 2X24A 3QXIA 3R0OA 4U19A 4HC8A 3QYRA 3QK8A 4JCSA 2ZL4A 4GHNA 2VREA 3T8AA 3IAVA 3SWXA 4OLQA 1UYTA 5DU8A 5E0SA 5INGA 4WZ8B 4KNPA 4RCNA 5DZKA 4ZDCA 5KDRB 3H0JA 3TDCA 1O8UA 3SLLA 3PGQA 4EMLA 2J5GD 3HINA 2CE3A 3Q0JA 4JWVA 4EMPA 4OG1A 3U9RB 1J7XA 3GKBA 3QREA 4Q1IA 1W2XA 4MXIA 5DTWA 5DKPA 3GLMA 1DCIA 3HE2A 4FZWC 5KJPA 4KWBA 3GF3A 3R6HA 2HW5A 2J5GA 3I47A 1NZYB 1UYRA 2EJ5A 3JU1A 1K39A 5FUSA 3HP0A 1SZOA 1XX4A 5DUFA 1FC7A 4F47A 4Z0MA 3GMAA 3BPPA 1YG6A 3PZKA 4MI2A 4HNKA 1WDKA 4MOUA 3QWDA 1SG4A 2F6IA 4WCZA 3TZ3A 2UZFA 2WTBA 4JCTA 3H81A 4U0GH 3MFMA 3M6NA 1N6DA 3K8XA 5DTPA 3TLFA 3TT7A 2FZSA 4ELWA 1XNVA 3RSTA 5C90A 4U18A 3KTIA 1TYFA 1OD2A 1XNYA 2GTRA 2VSUA 5FIFA 4ELSA 2CBYA 3ST9A 3T8BA 1RJNA 3GF7A 2ZQQA 5E0NX 2IEXA 3L3SA 3U9TB 2PG8A 2PPYA 4OMRA 4FJWD 1OD4A 2ZL3A 3OMEA 3H0UA 4K29A 1Q52A 1EF8A 5DU6A 2Q34A 4FN8A 4ASIA 4YLHA 5DU4A 4IZBA 3H02A 2DUBA 3FF6A 3IBBA 3TVWA 3U9SB 3MT6A 3KTJA 4L8KA 5DZKH 4G2RA 3BEZA 4FZWA 4GM2A 2A81A 1Y7OA 2VSSF 3QKAA 1FC9A 5JBXA 4K3WA 5INIA 2VX2A 1WZ8A 2ZQRA 1EF9A 3ZWCA 3M6MA 4IZDA 2X58A 5DUCA 1UYVA 1FC6A 3NJBA 4B3HA 1FCFA 4KPKA 2F9YA 5KDRA 4B3JA 5CTBA 2FW2A 4ELXA 3PEAA 3V5IA 1WDLA 4JSBA 4JYLA 3KTGA 4U1AA 2F9IB 1PIXA 3ZW9A 2J5IB 4B3IA 3T3WA 3VIVA 4U0GA 4FNBA 3ZWBA 5G1RA 1NZYA 4U0HA 4NNQA 3ISAA 1XO6A 2FBMA 4NEKA 1RJMA 2VSSE 3BF0A 4RYFH 3Q7HA 4DI1A 4LK5A 4JCRA 2ZL0A 1MJ3A 3WG5A 1N6FA 3T88A 3Q0GA 4ZU2A 4Q0GA 3PE8A 4K2NA 3R9TA 3STAA 5DL1A 3IB9A 4WYOB 2VSUC
chains in the Genus database with same CATH superfamily
2W3PA 4I42A 1N6EA 2A7SA 2PBPA 1Q51A 4ZDBA 5E0SH 2A7KA 1JXZA 3KTKA 5C9GA 2DEOA 2ZL2A 4QIJA 2Q35A 1XNWA 4QIIA 3RRVA 3MYBA 3H0SA 3KQFA 1ON9A 4QFEA 3MOYA 3P85A 2F9YB 4JYJA 3ZWAA 5G1QA 1DUBA 4FB8A 1EY3A 5MGBA 3TT6A 3DJAA 3LKEA 2C8TA 2VSUF 3DORA 2NP9A 1PJHA 3N6RB 4KD6A 3LAOA 4J2UA 1YG8A 3P5MA 3TRRA 1UIYA 1WDMA 3R9SA 5CTCA 1UYSA 3QXZA 2QQ3A 4L6WA 3TVUA 5JBWA 3NJDA 3KTHA 3K50A 1VRGA 2D3TA 2F6QA 4JJTA 4JOTA 5IKLB 2J5II 2BZRA 3R9QA 3BPTA 1TG6A 2VSSA 5G1SA 3P2LA 5INFA 4JCQA 2J5SA 3H0QA 1K32A 3V5EA 3HLN1 2Q2XA 4ZDFA 4I4ZA 1ON3A 4I52A 4ZDDA 1HNOA 3TV5A 4ZDEA 3RSIA 3Q1TA 3ZW8A 3OC7A 3OT6A 4JVTA 1X0UA 4FN7A 3QMJA 1HNUA 4FNDA 2F9IA 4RYFA 2VSUE 3HRXA 2J5IA 4IZCA 4JFCA 4EMMA 3G64A 1HZDA 3FDUA 3T89A 2X24A 3QXIA 3R0OA 4U19A 4HC8A 3QYRA 3QK8A 4JCSA 2ZL4A 4GHNA 2VREA 3T8AA 3IAVA 3SWXA 4OLQA 1UYTA 5DU8A 5E0SA 5INGA 4WZ8B 4KNPA 4RCNA 5DZKA 4ZDCA 5KDRB 3H0JA 3TDCA 1O8UA 3SLLA 3PGQA 4EMLA 2J5GD 3HINA 2CE3A 3Q0JA 4JWVA 4EMPA 2YJGA 4OG1A 3U9RB 1J7XA 3GKBA 3QREA 4Q1IA 1W2XA 4MXIA 5DTWA 5DKPA 3GLMA 1DCIA 3HE2A 4FZWC 5KJPA 4KWBA 3GF3A 3R6HA 2HW5A 2J5GA 3I47A 1NZYB 1UYRA 2EJ5A 3JU1A 1K39A 5FUSA 3HP0A 1SZOA 1XX4A 5DUFA 1FC7A 4F47A 4Z0MA 3GMAA 3BPPA 1YG6A 3PZKA 4MI2A 4HNKA 1WDKA 4MOUA 3QWDA 1SG4A 2F6IA 4WCZA 3TZ3A 2UZFA 2WTBA 4JCTA 3H81A 4U0GH 3MFMA 3M6NA 1N6DA 3K8XA 5DTPA 3TLFA 3TT7A 2FZSA 4ELWA 1XNVA 3RSTA 5C90A 4U18A 3KTIA 1TYFA 4NARA 1OD2A 1XNYA 2GTRA 2VSUA 5FIFA 4ELSA 2CBYA 3ST9A 3T8BA 1RJNA 3GF7A 2ZQQA 5E0NX 2IEXA 3L3SA 3U9TB 2PG8A 2PPYA 4OMRA 4FJWD 1OD4A 2ZL3A 3OMEA 3H0UA 4K29A 1Q52A 1EF8A 5DU6A 2Q34A 4FN8A 4ASIA 4YLHA 5DU4A 4IZBA 3H02A 4HDTA 2DUBA 3FF6A 3IBBA 3TVWA 3U9SB 3MT6A 3KTJA 4L8KA 5DZKH 4G2RA 3BEZA 4FZWA 4GM2A 2A81A 1Y7OA 2VSSF 3QKAA 1FC9A 5JBXA 4K3WA 5INIA 2VX2A 1WZ8A 2ZQRA 1EF9A 5HUQA 3ZWCA 3M6MA 4IZDA 2X58A 5DUCA 1UYVA 1FC6A 3NJBA 4B3HA 1FCFA 4KPKA 2F9YA 5KDRA 4B3JA 5CTBA 2FW2A 4ELXA 3PEAA 3V5IA 1WDLA 4JSBA 4JYLA 3KTGA 4U1AA 2F9IB 1PIXA 3ZW9A 2J5IB 4B3IA 3T3WA 3VIVA 4U0GA 4FNBA 3ZWBA 5G1RA 1NZYA 4U0HA 4NNQA 3ISAA 1XO6A 2FBMA 4NEKA 1RJMA 2VSSE 3BF0A 4RYFH 3Q7HA 4DI1A 4LK5A 4JCRA 2ZL0A 1MJ3A 3WG5A 1N6FA 3T88A 3Q0GA 4ZU2A 4Q0GA 3PE8A 4K2NA 3R9TA 3STAA 5DL1A 3IB9A 4WYOB 2VSUC
chains in the Genus database with same CATH topology
2W3PA 4I42A 1N6EA 2A7SA 2PBPA 1Q51A 4ZDBA 5E0SH 2A7KA 1JXZA 3KTKA 5C9GA 2DEOA 2ZL2A 4QIJA 2Q35A 1XNWA 4QIIA 3RRVA 3MYBA 3H0SA 3KQFA 1ON9A 4QFEA 3MOYA 3P85A 2F9YB 4JYJA 3ZWAA 5G1QA 1DUBA 4FB8A 1EY3A 5MGBA 3TT6A 3DJAA 3LKEA 2C8TA 2VSUF 3DORA 2NP9A 1PJHA 3N6RB 4KD6A 3LAOA 4J2UA 1YG8A 3P5MA 3TRRA 1UIYA 1WDMA 3R9SA 5CTCA 1UYSA 3QXZA 2QQ3A 4L6WA 3TVUA 5JBWA 3NJDA 3KTHA 3K50A 1VRGA 2D3TA 2F6QA 4JJTA 4JOTA 5IKLB 2J5II 2BZRA 3R9QA 3BPTA 1TG6A 2VSSA 5G1SA 3P2LA 5INFA 4JCQA 2J5SA 3H0QA 1K32A 3V5EA 3HLN1 2Q2XA 4ZDFA 4I4ZA 1ON3A 4I52A 4ZDDA 1HNOA 3TV5A 4ZDEA 3RSIA 3Q1TA 3ZW8A 3OC7A 3OT6A 4JVTA 1X0UA 4FN7A 3QMJA 1HNUA 4FNDA 2F9IA 4RYFA 2VSUE 3HRXA 2J5IA 4IZCA 4JFCA 4EMMA 3G64A 1HZDA 3FDUA 3T89A 2X24A 3QXIA 3R0OA 4U19A 4HC8A 3QYRA 3QK8A 4JCSA 2ZL4A 4GHNA 2VREA 3T8AA 3IAVA 3SWXA 4OLQA 1UYTA 5DU8A 5E0SA 5INGA 4WZ8B 4KNPA 4RCNA 5DZKA 4ZDCA 5KDRB 3H0JA 3TDCA 1O8UA 3SLLA 3PGQA 4EMLA 2J5GD 3HINA 2CE3A 3Q0JA 4JWVA 4EMPA 2YJGA 4OG1A 3U9RB 1J7XA 3GKBA 3QREA 4Q1IA 1W2XA 4MXIA 5DTWA 5DKPA 3GLMA 1DCIA 3HE2A 4FZWC 5KJPA 4KWBA 3GF3A 3R6HA 2HW5A 2J5GA 3I47A 1NZYB 1UYRA 2EJ5A 3JU1A 1K39A 5FUSA 3HP0A 1SZOA 1XX4A 5DUFA 1FC7A 4F47A 4Z0MA 3GMAA 3BPPA 1YG6A 3PZKA 4MI2A 4HNKA 1WDKA 4MOUA 3QWDA 1SG4A 2F6IA 4WCZA 3TZ3A 2UZFA 2WTBA 4JCTA 3H81A 4U0GH 3MFMA 3M6NA 1N6DA 3K8XA 5DTPA 3TLFA 3TT7A 2FZSA 4ELWA 1XNVA 3RSTA 5C90A 4U18A 3KTIA 1TYFA 4NARA 1OD2A 1XNYA 2GTRA 2VSUA 5FIFA 4ELSA 2CBYA 3ST9A 3T8BA 1RJNA 3GF7A 2ZQQA 5E0NX 2IEXA 3L3SA 3U9TB 2PG8A 2PPYA 4OMRA 4FJWD 1OD4A 2ZL3A 3OMEA 3H0UA 4K29A 1Q52A 1EF8A 5DU6A 2Q34A 4FN8A 4ASIA 4YLHA 5DU4A 4IZBA 3H02A 4HDTA 2DUBA 3FF6A 3IBBA 3TVWA 3U9SB 3MT6A 3KTJA 4L8KA 5DZKH 4G2RA 3BEZA 4FZWA 4GM2A 2A81A 1Y7OA 2VSSF 3QKAA 1FC9A 5JBXA 4K3WA 5INIA 2VX2A 1WZ8A 2ZQRA 1EF9A 5HUQA 3ZWCA 3M6MA 4IZDA 2X58A 5DUCA 1UYVA 1FC6A 3NJBA 4B3HA 1FCFA 4KPKA 2F9YA 5KDRA 4B3JA 5CTBA 2FW2A 4ELXA 3PEAA 3V5IA 1WDLA 4JSBA 4JYLA 3KTGA 4U1AA 2F9IB 1PIXA 3ZW9A 2J5IB 4B3IA 3T3WA 3VIVA 4U0GA 4FNBA 3ZWBA 5G1RA 1NZYA 4U0HA 4NNQA 3ISAA 1XO6A 2FBMA 4NEKA 1RJMA 2VSSE 3BF0A 4RYFH 3Q7HA 4DI1A 4LK5A 4JCRA 2ZL0A 1MJ3A 3WG5A 1N6FA 3T88A 3Q0GA 4ZU2A 4Q0GA 3PE8A 4K2NA 3R9TA 3STAA 5DL1A 3IB9A 4WYOB 2VSUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3P A;  4I42 A;  1N6E A;  2A7S A;  2PBP A;  1Q51 A;  4ZDB A;  5E0S H;  2A7K A;  1JXZ A;  3KTK A;  5C9G A;  2DEO A;  2ZL2 A;  4QIJ A;  2Q35 A;  1XNW A;  4QII A;  3RRV A;  3MYB A;  3H0S A;  3KQF A;  1ON9 A;  4QFE A;  3MOY A;  3P85 A;  2F9Y B;  4JYJ A;  3ZWA A;  5G1Q A;  1DUB A;  4FB8 A;  1EY3 A;  5MGB A;  3TT6 A;  3DJA A;  3LKE A;  2C8T A;  2VSU F;  3DOR A;  2NP9 A;  1PJH A;  3N6R B;  4KD6 A;  3LAO A;  1YG8 A;  3P5M A;  3TRR A;  1UIY A;  1WDM A;  3R9S A;  5CTC A;  1UYS A;  3QXZ A;  2QQ3 A;  4L6W A;  3TVU A;  5JBW A;  3NJD A;  3KTH A;  3K50 A;  1VRG A;  2D3T A;  2F6Q A;  4JJT A;  4JOT A;  5IKL B;  2J5I I;  2BZR A;  3R9Q A;  1TG6 A;  2VSS A;  5G1S A;  3P2L A;  5INF A;  4JCQ A;  2J5S A;  3H0Q A;  1K32 A;  3V5E A;  3HLN 1;  2Q2X A;  4ZDF A;  4I4Z A;  1ON3 A;  4I52 A;  4ZDD A;  1HNO A;  3TV5 A;  4ZDE A;  3RSI A;  3Q1T A;  3ZW8 A;  3OC7 A;  3OT6 A;  4JVT A;  1X0U A;  4FN7 A;  3QMJ A;  1HNU A;  4FND A;  2F9I A;  4RYF A;  2VSU E;  3HRX A;  2J5I A;  4IZC A;  4JFC A;  4EMM A;  3G64 A;  1HZD A;  3FDU A;  3T89 A;  2X24 A;  3QXI A;  3R0O A;  4U19 A;  4HC8 A;  3QYR A;  3QK8 A;  4JCS A;  2ZL4 A;  4GHN A;  2VRE A;  3T8A A;  3IAV A;  3SWX A;  4OLQ A;  1UYT A;  5DU8 A;  5E0S A;  5ING A;  4WZ8 B;  4KNP A;  4RCN A;  5DZK A;  4ZDC A;  5KDR B;  3H0J A;  3TDC A;  1O8U A;  3SLL A;  3PGQ A;  4EML A;  2J5G D;  3HIN A;  2CE3 A;  3Q0J A;  4JWV A;  4EMP A;  4OG1 A;  3U9R B;  1J7X A;  3GKB A;  3QRE A;  4Q1I A;  1W2X A;  4MXI A;  5DTW A;  5DKP A;  3GLM A;  1DCI A;  3HE2 A;  4FZW C;  5KJP A;  4KWB A;  3GF3 A;  3R6H A;  2HW5 A;  2J5G A;  3I47 A;  1NZY B;  1UYR A;  2EJ5 A;  3JU1 A;  1K39 A;  5FUS A;  3HP0 A;  1SZO A;  1XX4 A;  5DUF A;  1FC7 A;  4F47 A;  4Z0M A;  3GMA A;  3BPP A;  1YG6 A;  3PZK A;  4MI2 A;  4HNK A;  1WDK A;  4MOU A;  3QWD A;  1SG4 A;  2F6I A;  4WCZ A;  3TZ3 A;  2UZF A;  2WTB A;  4JCT A;  3H81 A;  4U0G H;  3MFM A;  3M6N A;  1N6D A;  3K8X A;  5DTP A;  3TLF A;  3TT7 A;  2FZS A;  4ELW A;  1XNV A;  3RST A;  5C90 A;  4U18 A;  3KTI A;  1TYF A;  1OD2 A;  1XNY A;  2GTR A;  2VSU A;  5FIF A;  4ELS A;  2CBY A;  3ST9 A;  3T8B A;  1RJN A;  3GF7 A;  2ZQQ A;  5E0N X;  2IEX A;  3L3S A;  3U9T B;  2PG8 A;  2PPY A;  4OMR A;  4FJW D;  1OD4 A;  2ZL3 A;  3OME A;  3H0U A;  4K29 A;  1Q52 A;  1EF8 A;  5DU6 A;  2Q34 A;  4FN8 A;  4ASI A;  4YLH A;  5DU4 A;  4IZB A;  3H02 A;  2DUB A;  3FF6 A;  3IBB A;  3TVW A;  3U9S B;  3MT6 A;  3KTJ A;  4L8K A;  5DZK H;  4G2R A;  3BEZ A;  4FZW A;  4GM2 A;  2A81 A;  1Y7O A;  2VSS F;  3QKA A;  1FC9 A;  5JBX A;  4K3W A;  5INI A;  2VX2 A;  1WZ8 A;  2ZQR A;  1EF9 A;  3ZWC A;  3M6M A;  4IZD A;  2X58 A;  5DUC A;  1UYV A;  1FC6 A;  3NJB A;  4B3H A;  1FCF A;  4KPK A;  2F9Y A;  5KDR A;  4B3J A;  5CTB A;  2FW2 A;  4ELX A;  3PEA A;  3V5I A;  1WDL A;  4JSB A;  4JYL A;  3KTG A;  4U1A A;  2F9I B;  1PIX A;  3ZW9 A;  2J5I B;  4B3I A;  3T3W A;  3VIV A;  4U0G A;  4FNB A;  3ZWB A;  5G1R A;  1NZY A;  4U0H A;  4NNQ A;  3ISA A;  1XO6 A;  2FBM A;  4NEK A;  1RJM A;  2VSS E;  3BF0 A;  4RYF H;  3Q7H A;  4DI1 A;  4LK5 A;  4JCR A;  2ZL0 A;  1MJ3 A;  3WG5 A;  1N6F A;  3T88 A;  3Q0G A;  4ZU2 A;  4Q0G A;  3PE8 A;  4K2N A;  3R9T A;  3STA A;  5DL1 A;  3IB9 A;  4WYO B;  2VSU C; 
#chains in the Genus database with same CATH topology
 2W3P A;  4I42 A;  1N6E A;  2A7S A;  2PBP A;  1Q51 A;  4ZDB A;  5E0S H;  2A7K A;  1JXZ A;  3KTK A;  5C9G A;  2DEO A;  2ZL2 A;  4QIJ A;  2Q35 A;  1XNW A;  4QII A;  3RRV A;  3MYB A;  3H0S A;  3KQF A;  1ON9 A;  4QFE A;  3MOY A;  3P85 A;  2F9Y B;  4JYJ A;  3ZWA A;  5G1Q A;  1DUB A;  4FB8 A;  1EY3 A;  5MGB A;  3TT6 A;  3DJA A;  3LKE A;  2C8T A;  2VSU F;  3DOR A;  2NP9 A;  1PJH A;  3N6R B;  4KD6 A;  3LAO A;  4J2U A;  1YG8 A;  3P5M A;  3TRR A;  1UIY A;  1WDM A;  3R9S A;  5CTC A;  1UYS A;  3QXZ A;  2QQ3 A;  4L6W A;  3TVU A;  5JBW A;  3NJD A;  3KTH A;  3K50 A;  1VRG A;  2D3T A;  2F6Q A;  4JJT A;  4JOT A;  5IKL B;  2J5I I;  2BZR A;  3R9Q A;  3BPT A;  1TG6 A;  2VSS A;  5G1S A;  3P2L A;  5INF A;  4JCQ A;  2J5S A;  3H0Q A;  1K32 A;  3V5E A;  3HLN 1;  2Q2X A;  4ZDF A;  4I4Z A;  1ON3 A;  4I52 A;  4ZDD A;  1HNO A;  3TV5 A;  4ZDE A;  3RSI A;  3Q1T A;  3ZW8 A;  3OC7 A;  3OT6 A;  4JVT A;  1X0U A;  4FN7 A;  3QMJ A;  1HNU A;  4FND A;  2F9I A;  4RYF A;  2VSU E;  3HRX A;  2J5I A;  4IZC A;  4JFC A;  4EMM A;  3G64 A;  1HZD A;  3FDU A;  3T89 A;  2X24 A;  3QXI A;  3R0O A;  4U19 A;  4HC8 A;  3QYR A;  3QK8 A;  4JCS A;  2ZL4 A;  4GHN A;  2VRE A;  3T8A A;  3IAV A;  3SWX A;  4OLQ A;  1UYT A;  5DU8 A;  5E0S A;  5ING A;  4WZ8 B;  4KNP A;  4RCN A;  5DZK A;  4ZDC A;  5KDR B;  3H0J A;  3TDC A;  1O8U A;  3SLL A;  3PGQ A;  4EML A;  2J5G D;  3HIN A;  2CE3 A;  3Q0J A;  4JWV A;  4EMP A;  2YJG A;  4OG1 A;  3U9R B;  1J7X A;  3GKB A;  3QRE A;  4Q1I A;  1W2X A;  4MXI A;  5DTW A;  5DKP A;  3GLM A;  1DCI A;  3HE2 A;  4FZW C;  5KJP A;  4KWB A;  3GF3 A;  3R6H A;  2HW5 A;  2J5G A;  3I47 A;  1NZY B;  1UYR A;  2EJ5 A;  3JU1 A;  1K39 A;  5FUS A;  3HP0 A;  1SZO A;  1XX4 A;  5DUF A;  1FC7 A;  4F47 A;  4Z0M A;  3GMA A;  3BPP A;  1YG6 A;  3PZK A;  4MI2 A;  4HNK A;  1WDK A;  4MOU A;  3QWD A;  1SG4 A;  2F6I A;  4WCZ A;  3TZ3 A;  2UZF A;  2WTB A;  4JCT A;  3H81 A;  4U0G H;  3MFM A;  3M6N A;  1N6D A;  3K8X A;  5DTP A;  3TLF A;  3TT7 A;  2FZS A;  4ELW A;  1XNV A;  3RST A;  5C90 A;  4U18 A;  3KTI A;  1TYF A;  4NAR A;  1OD2 A;  1XNY A;  2GTR A;  2VSU A;  5FIF A;  4ELS A;  2CBY A;  3ST9 A;  3T8B A;  1RJN A;  3GF7 A;  2ZQQ A;  5E0N X;  2IEX A;  3L3S A;  3U9T B;  2PG8 A;  2PPY A;  4OMR A;  4FJW D;  1OD4 A;  2ZL3 A;  3OME A;  3H0U A;  4K29 A;  1Q52 A;  1EF8 A;  5DU6 A;  2Q34 A;  4FN8 A;  4ASI A;  4YLH A;  5DU4 A;  4IZB A;  3H02 A;  4HDT A;  2DUB A;  3FF6 A;  3IBB A;  3TVW A;  3U9S B;  3MT6 A;  3KTJ A;  4L8K A;  5DZK H;  4G2R A;  3BEZ A;  4FZW A;  4GM2 A;  2A81 A;  1Y7O A;  2VSS F;  3QKA A;  1FC9 A;  5JBX A;  4K3W A;  5INI A;  2VX2 A;  1WZ8 A;  2ZQR A;  1EF9 A;  5HUQ A;  3ZWC A;  3M6M A;  4IZD A;  2X58 A;  5DUC A;  1UYV A;  1FC6 A;  3NJB A;  4B3H A;  1FCF A;  4KPK A;  2F9Y A;  5KDR A;  4B3J A;  5CTB A;  2FW2 A;  4ELX A;  3PEA A;  3V5I A;  1WDL A;  4JSB A;  4JYL A;  3KTG A;  4U1A A;  2F9I B;  1PIX A;  3ZW9 A;  2J5I B;  4B3I A;  3T3W A;  3VIV A;  4U0G A;  4FNB A;  3ZWB A;  5G1R A;  1NZY A;  4U0H A;  4NNQ A;  3ISA A;  1XO6 A;  2FBM A;  4NEK A;  1RJM A;  2VSS E;  3BF0 A;  4RYF H;  3Q7H A;  4DI1 A;  4LK5 A;  4JCR A;  2ZL0 A;  1MJ3 A;  3WG5 A;  1N6F A;  3T88 A;  3Q0G A;  4ZU2 A;  4Q0G A;  3PE8 A;  4K2N A;  3R9T A;  3STA A;  5DL1 A;  3IB9 A;  4WYO B;  2VSU C; 
#chains in the Genus database with same CATH homology
 2W3P A;  4I42 A;  1N6E A;  2A7S A;  2PBP A;  1Q51 A;  4ZDB A;  5E0S H;  2A7K A;  1JXZ A;  3KTK A;  5C9G A;  2DEO A;  2ZL2 A;  4QIJ A;  2Q35 A;  1XNW A;  4QII A;  3RRV A;  3MYB A;  3H0S A;  3KQF A;  1ON9 A;  4QFE A;  3MOY A;  3P85 A;  2F9Y B;  4JYJ A;  3ZWA A;  5G1Q A;  1DUB A;  4FB8 A;  1EY3 A;  5MGB A;  3TT6 A;  3DJA A;  3LKE A;  2C8T A;  2VSU F;  3DOR A;  2NP9 A;  1PJH A;  3N6R B;  4KD6 A;  3LAO A;  4J2U A;  1YG8 A;  3P5M A;  3TRR A;  1UIY A;  1WDM A;  3R9S A;  5CTC A;  1UYS A;  3QXZ A;  2QQ3 A;  4L6W A;  3TVU A;  5JBW A;  3NJD A;  3KTH A;  3K50 A;  1VRG A;  2D3T A;  2F6Q A;  4JJT A;  4JOT A;  5IKL B;  2J5I I;  2BZR A;  3R9Q A;  3BPT A;  1TG6 A;  2VSS A;  5G1S A;  3P2L A;  5INF A;  4JCQ A;  2J5S A;  3H0Q A;  1K32 A;  3V5E A;  3HLN 1;  2Q2X A;  4ZDF A;  4I4Z A;  1ON3 A;  4I52 A;  4ZDD A;  1HNO A;  3TV5 A;  4ZDE A;  3RSI A;  3Q1T A;  3ZW8 A;  3OC7 A;  3OT6 A;  4JVT A;  1X0U A;  4FN7 A;  3QMJ A;  1HNU A;  4FND A;  2F9I A;  4RYF A;  2VSU E;  3HRX A;  2J5I A;  4IZC A;  4JFC A;  4EMM A;  3G64 A;  1HZD A;  3FDU A;  3T89 A;  2X24 A;  3QXI A;  3R0O A;  4U19 A;  4HC8 A;  3QYR A;  3QK8 A;  4JCS A;  2ZL4 A;  4GHN A;  2VRE A;  3T8A A;  3IAV A;  3SWX A;  4OLQ A;  1UYT A;  5DU8 A;  5E0S A;  5ING A;  4WZ8 B;  4KNP A;  4RCN A;  5DZK A;  4ZDC A;  5KDR B;  3H0J A;  3TDC A;  1O8U A;  3SLL A;  3PGQ A;  4EML A;  2J5G D;  3HIN A;  2CE3 A;  3Q0J A;  4JWV A;  4EMP A;  2YJG A;  4OG1 A;  3U9R B;  1J7X A;  3GKB A;  3QRE A;  4Q1I A;  1W2X A;  4MXI A;  5DTW A;  5DKP A;  3GLM A;  1DCI A;  3HE2 A;  4FZW C;  5KJP A;  4KWB A;  3GF3 A;  3R6H A;  2HW5 A;  2J5G A;  3I47 A;  1NZY B;  1UYR A;  2EJ5 A;  3JU1 A;  1K39 A;  5FUS A;  3HP0 A;  1SZO A;  1XX4 A;  5DUF A;  1FC7 A;  4F47 A;  4Z0M A;  3GMA A;  3BPP A;  1YG6 A;  3PZK A;  4MI2 A;  4HNK A;  1WDK A;  4MOU A;  3QWD A;  1SG4 A;  2F6I A;  4WCZ A;  3TZ3 A;  2UZF A;  2WTB A;  4JCT A;  3H81 A;  4U0G H;  3MFM A;  3M6N A;  1N6D A;  3K8X A;  5DTP A;  3TLF A;  3TT7 A;  2FZS A;  4ELW A;  1XNV A;  3RST A;  5C90 A;  4U18 A;  3KTI A;  1TYF A;  4NAR A;  1OD2 A;  1XNY A;  2GTR A;  2VSU A;  5FIF A;  4ELS A;  2CBY A;  3ST9 A;  3T8B A;  1RJN A;  3GF7 A;  2ZQQ A;  5E0N X;  2IEX A;  3L3S A;  3U9T B;  2PG8 A;  2PPY A;  4OMR A;  4FJW D;  1OD4 A;  2ZL3 A;  3OME A;  3H0U A;  4K29 A;  1Q52 A;  1EF8 A;  5DU6 A;  2Q34 A;  4FN8 A;  4ASI A;  4YLH A;  5DU4 A;  4IZB A;  3H02 A;  4HDT A;  2DUB A;  3FF6 A;  3IBB A;  3TVW A;  3U9S B;  3MT6 A;  3KTJ A;  4L8K A;  5DZK H;  4G2R A;  3BEZ A;  4FZW A;  4GM2 A;  2A81 A;  1Y7O A;  2VSS F;  3QKA A;  1FC9 A;  5JBX A;  4K3W A;  5INI A;  2VX2 A;  1WZ8 A;  2ZQR A;  1EF9 A;  5HUQ A;  3ZWC A;  3M6M A;  4IZD A;  2X58 A;  5DUC A;  1UYV A;  1FC6 A;  3NJB A;  4B3H A;  1FCF A;  4KPK A;  2F9Y A;  5KDR A;  4B3J A;  5CTB A;  2FW2 A;  4ELX A;  3PEA A;  3V5I A;  1WDL A;  4JSB A;  4JYL A;  3KTG A;  4U1A A;  2F9I B;  1PIX A;  3ZW9 A;  2J5I B;  4B3I A;  3T3W A;  3VIV A;  4U0G A;  4FNB A;  3ZWB A;  5G1R A;  1NZY A;  4U0H A;  4NNQ A;  3ISA A;  1XO6 A;  2FBM A;  4NEK A;  1RJM A;  2VSS E;  3BF0 A;  4RYF H;  3Q7H A;  4DI1 A;  4LK5 A;  4JCR A;  2ZL0 A;  1MJ3 A;  3WG5 A;  1N6F A;  3T88 A;  3Q0G A;  4ZU2 A;  4Q0G A;  3PE8 A;  4K2N A;  3R9T A;  3STA A;  5DL1 A;  3IB9 A;  4WYO B;  2VSU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...